BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig10008

Length=1012
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006343677.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    380   6e-125   Solanum tuberosum [potatoes]
ref|XP_009617834.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        377   9e-124   Nicotiana tomentosiformis
ref|XP_004242567.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        376   2e-123   Solanum lycopersicum
ref|XP_009767201.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        372   6e-122   Nicotiana sylvestris
gb|KJB07579.1|  hypothetical protein B456_001G030800                    368   2e-120   Gossypium raimondii
ref|XP_007011977.1|  Alpha/beta-Hydrolases superfamily protein is...    368   2e-120   
ref|XP_010275727.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    367   6e-120   Nelumbo nucifera [Indian lotus]
emb|CBI18675.3|  unnamed protein product                                363   2e-118   Vitis vinifera
gb|KHG29529.1|  Lysosomal Pro-X carboxypeptidase                        363   3e-118   Gossypium arboreum [tree cotton]
ref|XP_003633162.2|  PREDICTED: lysosomal Pro-X carboxypeptidase        362   5e-118   
gb|KHG26338.1|  Lysosomal Pro-X carboxypeptidase                        358   2e-116   Gossypium arboreum [tree cotton]
ref|XP_002523506.1|  lysosomal pro-X carboxypeptidase, putative         357   4e-116   Ricinus communis
ref|XP_011017986.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    352   2e-115   Populus euphratica
ref|XP_012071462.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        355   2e-115   Jatropha curcas
ref|XP_002324555.2|  serine carboxypeptidase S28 family protein         355   3e-115   Populus trichocarpa [western balsam poplar]
gb|KJB54925.1|  hypothetical protein B456_009G054400                    355   3e-115   Gossypium raimondii
ref|XP_008457347.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        355   4e-115   Cucumis melo [Oriental melon]
emb|CDY20293.1|  BnaC04g36630D                                          353   8e-115   Brassica napus [oilseed rape]
ref|XP_004139280.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        353   9e-115   Cucumis sativus [cucumbers]
ref|XP_002878742.1|  serine carboxypeptidase S28 family protein         353   2e-114   Arabidopsis lyrata subsp. lyrata
gb|KFK32665.1|  serine carboxypeptidase s28 family protein              352   6e-114   Arabis alpina [alpine rockcress]
emb|CDY46135.1|  BnaA04g14230D                                          351   7e-114   Brassica napus [oilseed rape]
ref|XP_011017985.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    351   8e-114   Populus euphratica
ref|XP_010047139.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        351   1e-113   Eucalyptus grandis [rose gum]
ref|XP_010429398.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    351   1e-113   Camelina sativa [gold-of-pleasure]
ref|XP_009140531.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        351   2e-113   Brassica rapa
ref|XP_010932236.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    347   3e-113   Elaeis guineensis
ref|XP_010275726.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    350   6e-113   Nelumbo nucifera [Indian lotus]
ref|XP_006404933.1|  hypothetical protein EUTSA_v10000143mg             349   6e-113   Eutrema salsugineum [saltwater cress]
gb|KJB07578.1|  hypothetical protein B456_001G030800                    348   1e-112   Gossypium raimondii
ref|XP_010472431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    348   1e-112   Camelina sativa [gold-of-pleasure]
emb|CDP10200.1|  unnamed protein product                                347   3e-112   Coffea canephora [robusta coffee]
ref|NP_850050.1|  alpha/beta-Hydrolases superfamily protein             347   4e-112   Arabidopsis thaliana [mouse-ear cress]
gb|ABK95653.1|  unknown                                                 336   6e-112   Populus trichocarpa [western balsam poplar]
gb|EYU25337.1|  hypothetical protein MIMGU_mgv1a004964mg                347   7e-112   Erythranthe guttata [common monkey flower]
ref|XP_010932235.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    347   1e-111   Elaeis guineensis
gb|EEE66119.1|  hypothetical protein OsJ_22160                          339   1e-110   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006294084.1|  hypothetical protein CARUB_v10023078mg             341   9e-110   Capsella rubella
gb|EEC81080.1|  hypothetical protein OsI_23902                          342   1e-109   Oryza sativa Indica Group [Indian rice]
ref|XP_006657192.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    342   1e-109   Oryza brachyantha
ref|XP_010419297.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    348   3e-109   
ref|XP_002438750.1|  hypothetical protein SORBIDRAFT_10g025520          341   6e-109   Sorghum bicolor [broomcorn]
ref|XP_009390988.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        338   8e-109   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001058206.1|  Os06g0647400                                       339   1e-108   
ref|XP_003563318.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        337   7e-108   Brachypodium distachyon [annual false brome]
ref|XP_006841179.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    335   2e-107   Amborella trichopoda
dbj|BAJ92142.1|  predicted protein                                      334   1e-106   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87416.1|  predicted protein                                      334   1e-106   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACG41459.1|  lysosomal Pro-X carboxypeptidase precursor              333   2e-106   Zea mays [maize]
ref|NP_001142279.1|  uncharacterized protein LOC100274448 precursor     333   3e-106   Zea mays [maize]
ref|XP_006285773.1|  hypothetical protein CARUB_v10007247mg             331   5e-106   
ref|XP_004965729.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    332   1e-105   Setaria italica
ref|XP_010525816.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        330   1e-105   
gb|EMT03388.1|  Lysosomal Pro-X carboxypeptidase                        328   2e-105   
gb|KFK43799.1|  hypothetical protein AALP_AA1G174100                    329   3e-105   Arabis alpina [alpine rockcress]
dbj|BAJ86079.1|  predicted protein                                      330   4e-105   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010432914.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    328   5e-105   Camelina sativa [gold-of-pleasure]
gb|EMT22762.1|  Lysosomal Pro-X carboxypeptidase                        320   7e-105   
gb|EMS54705.1|  Lysosomal Pro-X carboxypeptidase                        330   2e-104   Triticum urartu
gb|EMT22761.1|  Lysosomal Pro-X carboxypeptidase                        328   3e-104   
gb|EMT13135.1|  Lysosomal Pro-X carboxypeptidase                        325   3e-103   
ref|XP_002869352.1|  serine carboxypeptidase S28 family protein         324   4e-103   Arabidopsis lyrata subsp. lyrata
gb|EMT03389.1|  Lysosomal Pro-X carboxypeptidase                        321   2e-101   
emb|CDX68714.1|  BnaC01g07390D                                          315   3e-101   
ref|XP_009127344.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    316   4e-100   Brassica rapa
ref|XP_008661011.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    306   1e-95    Zea mays [maize]
ref|XP_002438753.1|  hypothetical protein SORBIDRAFT_10g025550          303   3e-94    
gb|KDO59435.1|  hypothetical protein CISIN_1g044064mg                   291   1e-92    Citrus sinensis [apfelsine]
ref|XP_008659849.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    297   2e-92    Zea mays [maize]
gb|AFW87518.1|  putative serine peptidase S28 family protein            306   1e-91    
ref|XP_002438751.1|  hypothetical protein SORBIDRAFT_10g025530          272   4e-87    
ref|XP_010419296.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    280   1e-86    
gb|AAM15096.1|  putative prolylcarboxypeptidase                         280   2e-86    Arabidopsis thaliana [mouse-ear cress]
gb|AFW87519.1|  putative serine peptidase S28 family protein            281   4e-86    
gb|AIA26578.1|  serine protease                                         275   2e-85    Cicer arietinum [garbanzo]
ref|XP_006341228.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    275   2e-84    
ref|XP_003549991.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    275   4e-84    Glycine max [soybeans]
gb|ABR17702.1|  unknown                                                 275   5e-84    Picea sitchensis
ref|XP_004246480.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    274   8e-84    Solanum lycopersicum
ref|XP_010093782.1|  Lysosomal Pro-X carboxypeptidase                   271   1e-83    
ref|XP_004509045.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    274   1e-83    Cicer arietinum [garbanzo]
gb|EMS54706.1|  Lysosomal Pro-X carboxypeptidase                        275   7e-83    Triticum urartu
ref|XP_011046918.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    271   1e-82    Populus euphratica
gb|KJB54926.1|  hypothetical protein B456_009G054400                    268   2e-82    Gossypium raimondii
gb|KJB16584.1|  hypothetical protein B456_002G237800                    264   2e-82    Gossypium raimondii
ref|XP_009801420.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    270   5e-82    Nicotiana sylvestris
ref|XP_002308456.2|  hypothetical protein POPTR_0006s22440g             269   6e-82    Populus trichocarpa [western balsam poplar]
ref|XP_010910623.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    265   9e-82    Elaeis guineensis
ref|XP_009624783.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    268   1e-81    Nicotiana tomentosiformis
ref|XP_011467971.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    268   2e-81    Fragaria vesca subsp. vesca
ref|XP_007155790.1|  hypothetical protein PHAVU_003G232100g             267   3e-81    Phaseolus vulgaris [French bean]
ref|XP_002530520.1|  lysosomal pro-X carboxypeptidase, putative         267   3e-81    Ricinus communis
ref|XP_004305645.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    267   5e-81    Fragaria vesca subsp. vesca
ref|XP_006854747.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        267   6e-81    Amborella trichopoda
ref|XP_006604647.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    266   7e-81    Glycine max [soybeans]
gb|KJB16580.1|  hypothetical protein B456_002G237800                    265   3e-80    Gossypium raimondii
ref|XP_007027867.1|  Alpha/beta-Hydrolases superfamily protein is...    265   3e-80    
gb|KHN33177.1|  Lysosomal Pro-X carboxypeptidase                        265   4e-80    Glycine soja [wild soybean]
gb|KJB16585.1|  hypothetical protein B456_002G237800                    265   5e-80    Gossypium raimondii
ref|XP_006577088.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    264   7e-80    Glycine max [soybeans]
ref|XP_010943424.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        264   8e-80    Elaeis guineensis
ref|XP_010246130.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    263   9e-80    Nelumbo nucifera [Indian lotus]
ref|XP_008798888.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    263   1e-79    Phoenix dactylifera
ref|XP_009406760.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    263   1e-79    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406759.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    263   2e-79    
ref|NP_001044360.1|  Os01g0767100                                       263   3e-79    
emb|CDP02648.1|  unnamed protein product                                262   3e-79    Coffea canephora [robusta coffee]
emb|CDP10629.1|  unnamed protein product                                262   5e-79    Coffea canephora [robusta coffee]
gb|EAZ13666.1|  hypothetical protein OsJ_03583                          263   6e-79    Oryza sativa Japonica Group [Japonica rice]
gb|EAY75958.1|  hypothetical protein OsI_03875                          263   6e-79    Oryza sativa Indica Group [Indian rice]
emb|CBI30345.3|  unnamed protein product                                261   7e-79    Vitis vinifera
ref|XP_006430123.1|  hypothetical protein CICLE_v10011529mg             261   8e-79    Citrus clementina [clementine]
ref|XP_002281618.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    261   1e-78    Vitis vinifera
ref|XP_007047632.1|  Serine carboxypeptidase S28 family protein i...    261   1e-78    
ref|XP_006481710.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    260   1e-78    Citrus sinensis [apfelsine]
gb|KJB18075.1|  hypothetical protein B456_003G033300                    259   3e-78    Gossypium raimondii
ref|NP_001136852.1|  uncharacterized protein LOC100217003               253   4e-78    
gb|KHN02193.1|  Lysosomal Pro-X carboxypeptidase                        259   6e-78    Glycine soja [wild soybean]
ref|XP_008243494.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        258   1e-77    
emb|CDM83096.1|  unnamed protein product                                258   2e-77    Triticum aestivum [Canadian hard winter wheat]
ref|XP_012074389.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    258   2e-77    Jatropha curcas
ref|XP_010059402.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    258   2e-77    Eucalyptus grandis [rose gum]
gb|AFK45793.1|  unknown                                                 248   3e-77    Lotus japonicus
gb|KEH24167.1|  lysosomal pro-X carboxypeptidase-like protein           257   3e-77    Medicago truncatula
ref|XP_006426159.1|  hypothetical protein CICLE_v10025375mg             257   4e-77    Citrus clementina [clementine]
ref|XP_004494225.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    257   4e-77    Cicer arietinum [garbanzo]
ref|XP_008799734.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    256   5e-77    
ref|XP_006466409.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    257   5e-77    
ref|XP_004288288.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    256   1e-76    Fragaria vesca subsp. vesca
ref|XP_010683638.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    256   1e-76    Beta vulgaris subsp. vulgaris [field beet]
gb|KCW90503.1|  hypothetical protein EUGRSUZ_A02623                     254   1e-76    Eucalyptus grandis [rose gum]
ref|XP_006646360.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    255   2e-76    
gb|AGT17295.1|  hypothetical protein SHCRBa_168_J15_F_160               255   2e-76    Saccharum hybrid cultivar R570
ref|XP_010099406.1|  Lysosomal Pro-X carboxypeptidase                   255   2e-76    Morus notabilis
ref|XP_008350184.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    254   3e-76    
gb|KFK28424.1|  hypothetical protein AALP_AA8G512800                    254   3e-76    Arabis alpina [alpine rockcress]
ref|XP_004970093.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    256   4e-76    
ref|XP_010931151.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    253   6e-76    Elaeis guineensis
ref|XP_010024706.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    254   6e-76    
ref|XP_002310325.2|  hypothetical protein POPTR_0007s14600g             254   7e-76    
ref|XP_002263389.2|  PREDICTED: lysosomal Pro-X carboxypeptidase        253   7e-76    Vitis vinifera
ref|XP_001776094.1|  predicted protein                                  253   8e-76    
ref|XP_002458558.1|  hypothetical protein SORBIDRAFT_03g035680          253   9e-76    Sorghum bicolor [broomcorn]
ref|XP_008654499.1|  PREDICTED: uncharacterized protein LOC100217...    253   1e-75    
gb|AFW84965.1|  putative serine peptidase S28 family protein            253   1e-75    
gb|KEH24169.1|  lysosomal pro-X carboxypeptidase-like protein           253   1e-75    Medicago truncatula
ref|XP_010463531.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    253   1e-75    Camelina sativa [gold-of-pleasure]
ref|XP_011094280.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        252   2e-75    Sesamum indicum [beniseed]
dbj|BAK01568.1|  predicted protein                                      252   2e-75    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010518734.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        252   3e-75    Tarenaya hassleriana [spider flower]
gb|EYU18082.1|  hypothetical protein MIMGU_mgv1a005183mg                251   4e-75    Erythranthe guttata [common monkey flower]
ref|XP_010444594.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    251   4e-75    Camelina sativa [gold-of-pleasure]
ref|XP_006393989.1|  hypothetical protein EUTSA_v10003988mg             252   4e-75    Eutrema salsugineum [saltwater cress]
gb|KEH31545.1|  serine carboxypeptidase S28 family protein              252   4e-75    Medicago truncatula
ref|XP_009773191.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        251   5e-75    Nicotiana sylvestris
ref|XP_009342192.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    251   6e-75    Pyrus x bretschneideri [bai li]
ref|XP_011073662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        251   1e-74    Sesamum indicum [beniseed]
ref|XP_002864979.1|  serine carboxypeptidase S28 family protein         250   1e-74    
ref|XP_003521479.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    250   1e-74    
gb|ABR17682.1|  unknown                                                 250   2e-74    Picea sitchensis
ref|XP_009592890.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        250   2e-74    Nicotiana tomentosiformis
ref|XP_011031335.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        250   2e-74    Populus euphratica
emb|CDY45627.1|  BnaCnng13350D                                          249   4e-74    Brassica napus [oilseed rape]
ref|XP_011466418.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    249   4e-74    Fragaria vesca subsp. vesca
ref|XP_012079471.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        249   4e-74    Jatropha curcas
ref|XP_007162943.1|  hypothetical protein PHAVU_001G193200g             248   6e-74    Phaseolus vulgaris [French bean]
ref|XP_009372536.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    249   6e-74    Pyrus x bretschneideri [bai li]
ref|XP_010245640.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    248   7e-74    Nelumbo nucifera [Indian lotus]
ref|XP_006363792.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    248   1e-73    Solanum tuberosum [potatoes]
ref|XP_010316042.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    247   2e-73    Solanum lycopersicum
ref|NP_201377.2|  Serine carboxypeptidase S28 family protein            247   2e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004231954.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    247   2e-73    Solanum lycopersicum
dbj|BAB10683.1|  lysosomal Pro-X carboxypeptidase                       247   3e-73    Arabidopsis thaliana [mouse-ear cress]
gb|EPS74090.1|  hypothetical protein M569_00662                         246   5e-73    Genlisea aurea
ref|XP_006280309.1|  hypothetical protein CARUB_v10026232mg             246   5e-73    Capsella rubella
gb|AGV54352.1|  lysosomal Pro-X carboxypeptidase-like protein           245   9e-73    Phaseolus vulgaris [French bean]
ref|XP_010026544.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    245   1e-72    Eucalyptus grandis [rose gum]
ref|XP_010023346.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    246   1e-72    Eucalyptus grandis [rose gum]
ref|XP_009383556.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    244   2e-72    Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW59597.1|  hypothetical protein EUGRSUZ_H02342                     245   3e-72    Eucalyptus grandis [rose gum]
gb|EMT33353.1|  Lysosomal Pro-X carboxypeptidase                        239   3e-72    
ref|XP_009150668.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        244   4e-72    Brassica rapa
emb|CDY08753.1|  BnaA06g24710D                                          244   4e-72    Brassica napus [oilseed rape]
ref|XP_010680789.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    243   5e-72    
ref|XP_003569899.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        243   9e-72    Brachypodium distachyon [annual false brome]
ref|XP_008237071.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        242   2e-71    Prunus mume [ume]
gb|EPS59259.1|  hypothetical protein M569_15548                         239   7e-71    Genlisea aurea
ref|XP_004136495.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    240   7e-71    Cucumis sativus [cucumbers]
ref|XP_011622147.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    239   8e-71    Amborella trichopoda
ref|XP_008442879.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    239   2e-70    Cucumis melo [Oriental melon]
ref|XP_010023342.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    239   3e-70    Eucalyptus grandis [rose gum]
emb|CAN61013.1|  hypothetical protein VITISV_036738                     239   9e-70    Vitis vinifera
ref|XP_007011978.1|  Alpha/beta-Hydrolases superfamily protein is...    234   3e-69    
gb|KJB18076.1|  hypothetical protein B456_003G033300                    236   4e-69    Gossypium raimondii
ref|XP_002962483.1|  hypothetical protein SELMODRAFT_78660              234   5e-69    
gb|EMS49104.1|  Lysosomal Pro-X carboxypeptidase                        232   1e-66    Triticum urartu
dbj|BAK05623.1|  predicted protein                                      227   1e-65    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004980174.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    226   4e-65    
ref|XP_008779559.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    214   6e-65    Phoenix dactylifera
ref|XP_003576298.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    223   2e-64    Brachypodium distachyon [annual false brome]
ref|XP_006663226.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    220   7e-64    Oryza brachyantha
ref|XP_002962799.1|  hypothetical protein SELMODRAFT_78251              221   7e-64    
gb|EAZ17490.1|  hypothetical protein OsJ_33021                          214   2e-63    Oryza sativa Japonica Group [Japonica rice]
gb|EYU30781.1|  hypothetical protein MIMGU_mgv1a0254691mg               206   1e-61    Erythranthe guttata [common monkey flower]
ref|XP_008680725.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    216   1e-61    
ref|NP_001065793.1|  Os11g0156200                                       214   6e-61    
gb|EAY80009.1|  hypothetical protein OsI_35177                          214   7e-61    Oryza sativa Indica Group [Indian rice]
ref|XP_008458663.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    213   2e-60    Cucumis melo [Oriental melon]
ref|XP_008798889.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    208   9e-59    
emb|CBI17110.3|  unnamed protein product                                205   1e-58    Vitis vinifera
ref|XP_004145770.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        207   2e-58    Cucumis sativus [cucumbers]
gb|KDO78803.1|  hypothetical protein CISIN_1g0096312mg                  206   3e-58    Citrus sinensis [apfelsine]
ref|XP_009356964.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    205   1e-57    Pyrus x bretschneideri [bai li]
ref|XP_002450303.1|  hypothetical protein SORBIDRAFT_05g003460          206   2e-57    Sorghum bicolor [broomcorn]
gb|AAL77662.1|  AT5g65760/MPA24_11                                      204   2e-57    Arabidopsis thaliana [mouse-ear cress]
gb|AFW87517.1|  putative serine peptidase S28 family protein            205   3e-57    
ref|XP_002315345.1|  hypothetical protein POPTR_0010s23860g             202   2e-56    
gb|KJB55686.1|  hypothetical protein B456_009G088900                    201   6e-56    Gossypium raimondii
gb|KCW50737.1|  hypothetical protein EUGRSUZ_J00408                     201   8e-56    Eucalyptus grandis [rose gum]
ref|XP_008226847.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    201   8e-56    Prunus mume [ume]
ref|XP_010031434.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    201   8e-56    Eucalyptus grandis [rose gum]
ref|XP_011089978.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    200   1e-55    Sesamum indicum [beniseed]
ref|XP_002324914.2|  hypothetical protein POPTR_0018s02600g             200   2e-55    Populus trichocarpa [western balsam poplar]
ref|XP_002271961.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    199   3e-55    Vitis vinifera
ref|XP_010267352.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    198   6e-55    Nelumbo nucifera [Indian lotus]
ref|XP_010100140.1|  Lysosomal Pro-X carboxypeptidase                   197   8e-55    
ref|XP_006369363.1|  hypothetical protein POPTR_0001s22060g             199   1e-54    
ref|XP_006424415.1|  hypothetical protein CICLE_v10028929mg             192   2e-54    
gb|EMT30656.1|  Lysosomal Pro-X carboxypeptidase                        196   2e-54    
gb|KCW50735.1|  hypothetical protein EUGRSUZ_J00406                     192   2e-54    Eucalyptus grandis [rose gum]
ref|XP_007155791.1|  hypothetical protein PHAVU_003G232100g             195   3e-54    Phaseolus vulgaris [French bean]
gb|KCW50732.1|  hypothetical protein EUGRSUZ_J00405                     196   3e-54    Eucalyptus grandis [rose gum]
ref|XP_011657047.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    196   3e-54    Cucumis sativus [cucumbers]
gb|EYU41363.1|  hypothetical protein MIMGU_mgv1a0060841mg               186   3e-54    Erythranthe guttata [common monkey flower]
ref|XP_010034183.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    196   4e-54    Eucalyptus grandis [rose gum]
gb|KDP43933.1|  hypothetical protein JCGZ_05400                         194   4e-54    Jatropha curcas
emb|CBI17112.3|  unnamed protein product                                198   5e-54    Vitis vinifera
ref|XP_006485332.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    196   5e-54    Citrus sinensis [apfelsine]
ref|XP_009356983.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    196   6e-54    Pyrus x bretschneideri [bai li]
ref|XP_010031430.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    195   8e-54    
ref|XP_006485136.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    195   9e-54    Citrus sinensis [apfelsine]
ref|XP_002313555.2|  hypothetical protein POPTR_0009s00740g             194   1e-53    
ref|XP_011036743.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    195   1e-53    Populus euphratica
gb|KJB16582.1|  hypothetical protein B456_002G237800                    193   1e-53    Gossypium raimondii
ref|XP_012064654.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    194   2e-53    Jatropha curcas
ref|XP_006484928.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    186   2e-53    Citrus sinensis [apfelsine]
ref|XP_008458666.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    191   2e-53    Cucumis melo [Oriental melon]
emb|CAN64374.1|  hypothetical protein VITISV_018664                     193   3e-53    Vitis vinifera
ref|XP_006573176.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    192   4e-53    Glycine max [soybeans]
ref|XP_007016017.1|  Serine carboxypeptidase S28 family protein         193   4e-53    
gb|KHG27095.1|  Lysosomal Pro-X carboxypeptidase                        194   4e-53    Gossypium arboreum [tree cotton]
ref|XP_002271797.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        193   4e-53    Vitis vinifera
ref|XP_004487553.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    193   4e-53    Cicer arietinum [garbanzo]
gb|KDP43937.1|  hypothetical protein JCGZ_05404                         193   5e-53    Jatropha curcas
gb|KHN44803.1|  Lysosomal Pro-X carboxypeptidase                        192   5e-53    Glycine soja [wild soybean]
gb|EYU36116.1|  hypothetical protein MIMGU_mgv1a004675mg                193   5e-53    Erythranthe guttata [common monkey flower]
gb|KJB35194.1|  hypothetical protein B456_006G103600                    193   6e-53    Gossypium raimondii
ref|XP_007153468.1|  hypothetical protein PHAVU_003G038000g             193   6e-53    Phaseolus vulgaris [French bean]
ref|XP_006424406.1|  hypothetical protein CICLE_v10030241mg             192   7e-53    
ref|XP_010031431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    192   7e-53    Eucalyptus grandis [rose gum]
ref|XP_003517871.2|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    192   8e-53    Glycine max [soybeans]
ref|XP_007208680.1|  hypothetical protein PRUPE_ppa025450mg             193   9e-53    Prunus persica
ref|XP_010031432.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    192   1e-52    Eucalyptus grandis [rose gum]
gb|KCW50722.1|  hypothetical protein EUGRSUZ_J00400                     192   1e-52    Eucalyptus grandis [rose gum]
ref|XP_007016019.1|  Serine carboxypeptidase S28 family protein, ...    191   2e-52    
ref|XP_008458665.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    191   2e-52    
gb|KDO44733.1|  hypothetical protein CISIN_1g0127112mg                  185   2e-52    Citrus sinensis [apfelsine]
emb|CDP17394.1|  unnamed protein product                                191   3e-52    Coffea canephora [robusta coffee]
ref|XP_002523751.1|  lysosomal pro-X carboxypeptidase, putative         191   3e-52    
ref|XP_010031429.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    191   4e-52    Eucalyptus grandis [rose gum]
ref|XP_010100142.1|  Lysosomal Pro-X carboxypeptidase                   191   4e-52    
ref|XP_008458662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    190   6e-52    Cucumis melo [Oriental melon]
ref|XP_006495097.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    189   1e-51    Citrus sinensis [apfelsine]
ref|XP_010247711.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    189   2e-51    Nelumbo nucifera [Indian lotus]
ref|XP_007207893.1|  hypothetical protein PRUPE_ppa021011mg             189   2e-51    
ref|XP_006488629.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    188   2e-51    
ref|XP_012064658.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    188   3e-51    Jatropha curcas
ref|XP_004145825.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    188   3e-51    Cucumis sativus [cucumbers]
emb|CBI17109.3|  unnamed protein product                                193   3e-51    Vitis vinifera
ref|XP_010031433.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    187   6e-51    
ref|XP_008228032.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    187   6e-51    
gb|KJB35187.1|  hypothetical protein B456_006G103400                    187   1e-50    
ref|XP_001628070.1|  predicted protein                                  185   1e-50    
ref|XP_004250994.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    187   1e-50    
ref|XP_002523752.1|  Lysosomal Pro-X carboxypeptidase, putative         186   1e-50    
ref|XP_006424403.1|  hypothetical protein CICLE_v10028401mg             186   1e-50    
ref|XP_002523750.1|  Lysosomal Pro-X carboxypeptidase, putative         186   2e-50    
ref|XP_002313554.2|  hypothetical protein POPTR_0009s00750g             186   2e-50    
ref|XP_006424417.1|  hypothetical protein CICLE_v10028252mg             186   2e-50    
ref|XP_002272152.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        186   2e-50    
ref|XP_006132231.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        184   2e-50    
ref|XP_012064657.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    186   2e-50    
gb|KDP43936.1|  hypothetical protein JCGZ_05403                         186   2e-50    
ref|XP_006349128.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    186   2e-50    
ref|XP_008360161.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    179   3e-50    
ref|XP_002523754.1|  Lysosomal Pro-X carboxypeptidase, putative         186   3e-50    
gb|KFQ24633.1|  Lysosomal Pro-X carboxypeptidase                        179   3e-50    
ref|XP_002270231.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        186   3e-50    
gb|ABR16397.1|  unknown                                                 186   3e-50    
ref|XP_010187440.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        179   3e-50    
ref|XP_006484933.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    185   3e-50    
ref|XP_003129755.3|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    185   4e-50    
ref|XP_006436581.1|  hypothetical protein CICLE_v10033696mg             185   4e-50    
ref|XP_011004990.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    185   6e-50    
ref|XP_009785587.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    184   7e-50    
ref|XP_011005221.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    185   7e-50    
ref|XP_002530593.1|  lysosomal pro-X carboxypeptidase, putative         180   8e-50    
gb|KDP45057.1|  hypothetical protein JCGZ_01557                         182   9e-50    
ref|XP_010100139.1|  Lysosomal Pro-X carboxypeptidase                   186   1e-49    
emb|CAN65360.1|  hypothetical protein VITISV_036071                     185   1e-49    
gb|KFV63066.1|  Lysosomal Pro-X carboxypeptidase                        178   2e-49    
gb|KFV02463.1|  Lysosomal Pro-X carboxypeptidase                        182   2e-49    
ref|XP_003992730.2|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    184   2e-49    
ref|XP_006380821.1|  hypothetical protein POPTR_0007s14600g             182   2e-49    
ref|XP_006936943.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    183   2e-49    
ref|XP_009985955.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        182   2e-49    
ref|XP_009908966.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    178   2e-49    
gb|KFQ13604.1|  Lysosomal Pro-X carboxypeptidase                        181   3e-49    
ref|XP_004295650.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    183   3e-49    
gb|KHN27695.1|  Lysosomal Pro-X carboxypeptidase                        183   3e-49    
gb|KFW73852.1|  Lysosomal Pro-X carboxypeptidase                        181   3e-49    
gb|KFZ57497.1|  Lysosomal Pro-X carboxypeptidase                        181   3e-49    
ref|XP_007060650.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        180   3e-49    
ref|XP_006487982.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    182   4e-49    
ref|XP_010260171.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    182   4e-49    
ref|XP_009511986.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        181   5e-49    
gb|KFO13685.1|  Lysosomal Pro-X carboxypeptidase                        181   5e-49    
gb|KFV54794.1|  Lysosomal Pro-X carboxypeptidase                        181   6e-49    
ref|XP_009952778.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        181   6e-49    
emb|CDY28235.1|  BnaA01g06140D                                          172   6e-49    
ref|XP_010306431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        181   6e-49    
ref|XP_007079027.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        182   7e-49    
ref|XP_003596267.1|  Lysosomal Pro-X carboxypeptidase                   181   7e-49    
ref|XP_009967794.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        181   8e-49    
gb|KFV12075.1|  Lysosomal Pro-X carboxypeptidase                        179   8e-49    
ref|XP_010988491.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    182   8e-49    
ref|XP_006197540.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal Pr...    182   8e-49    
ref|XP_010988501.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    182   8e-49    
ref|XP_010077848.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        179   9e-49    
gb|KCW90505.1|  hypothetical protein EUGRSUZ_A02624                     181   1e-48    
gb|KFO79296.1|  Lysosomal Pro-X carboxypeptidase                        180   1e-48    
gb|KFR02889.1|  Lysosomal Pro-X carboxypeptidase                        180   1e-48    
gb|KFM08871.1|  Lysosomal Pro-X carboxypeptidase                        180   1e-48    
ref|XP_010971744.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    181   1e-48    
gb|KGL90198.1|  Lysosomal Pro-X carboxypeptidase                        180   1e-48    
ref|XP_010036093.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    181   1e-48    
ref|XP_010971745.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    181   1e-48    
gb|KFP28018.1|  Lysosomal Pro-X carboxypeptidase                        179   1e-48    
ref|XP_006186742.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        181   1e-48    
ref|XP_009279588.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        180   1e-48    
ref|XP_009879496.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        180   2e-48    
ref|XP_009468660.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        180   2e-48    
ref|XP_010575044.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        180   2e-48    
gb|EMP35010.1|  Lysosomal Pro-X carboxypeptidase                        180   2e-48    
ref|XP_009563433.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        180   2e-48    
ref|XP_007016018.1|  Serine carboxypeptidase S28 family protein         181   2e-48    
ref|XP_010203661.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        179   2e-48    
gb|KFV91939.1|  Lysosomal Pro-X carboxypeptidase                        179   2e-48    
ref|XP_011582829.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        180   3e-48    
ref|XP_010146580.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        179   3e-48    
gb|KFQ73298.1|  Lysosomal Pro-X carboxypeptidase                        178   4e-48    
gb|KFW66681.1|  Lysosomal Pro-X carboxypeptidase                        178   4e-48    
gb|KHN33176.1|  Lysosomal Pro-X carboxypeptidase                        178   4e-48    
gb|KFZ51659.1|  Lysosomal Pro-X carboxypeptidase                        178   5e-48    
ref|XP_010283636.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        178   5e-48    
ref|XP_007205162.1|  hypothetical protein PRUPE_ppa005445mg             179   5e-48    
gb|KFQ54980.1|  Lysosomal Pro-X carboxypeptidase                        178   5e-48    
gb|KFV84322.1|  Lysosomal Pro-X carboxypeptidase                        178   5e-48    
ref|XP_010175531.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        178   6e-48    
ref|XP_009321727.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        178   6e-48    
ref|XP_012091807.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    181   6e-48    
ref|XP_006035578.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        178   6e-48    
ref|XP_005434763.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        178   7e-48    
ref|XP_004708913.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        177   7e-48    
ref|XP_009679016.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        178   7e-48    
ref|XP_004251370.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    179   7e-48    
ref|XP_005287637.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        177   7e-48    
ref|XP_006273509.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    178   7e-48    
ref|XP_010018717.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        178   8e-48    
ref|XP_006424402.1|  hypothetical protein CICLE_v10030021mg             177   8e-48    
ref|XP_006991950.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        179   8e-48    
ref|XP_003219412.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        179   9e-48    
ref|XP_010683431.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        179   9e-48    
ref|XP_008590288.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        176   1e-47    
ref|XP_006388621.1|  hypothetical protein POPTR_0135s00200g             179   1e-47    
ref|XP_010247724.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    179   1e-47    
ref|XP_006865041.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    179   1e-47    
gb|KFP09734.1|  Lysosomal Pro-X carboxypeptidase                        177   1e-47    
gb|KFP73631.1|  Lysosomal Pro-X carboxypeptidase                        177   1e-47    
ref|XP_011371423.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        178   1e-47    
ref|XP_006926718.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    178   1e-47    
ref|XP_010651835.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    176   1e-47    
ref|XP_003468571.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        178   1e-47    
gb|KFP06048.1|  Lysosomal Pro-X carboxypeptidase                        177   1e-47    
ref|XP_005149846.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        178   1e-47    
ref|XP_005232277.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        178   1e-47    
ref|XP_006865042.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    179   1e-47    
gb|KFR08386.1|  Lysosomal Pro-X carboxypeptidase                        177   2e-47    
ref|XP_009640619.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        177   2e-47    
ref|XP_003764661.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        177   2e-47    
gb|KEH38910.1|  lysosomal pro-X carboxypeptidase-like protein           178   2e-47    
ref|XP_009930858.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        177   2e-47    
ref|XP_012065089.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    178   2e-47    
ref|XP_008498766.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal Pr...    177   3e-47    
gb|KFU94741.1|  Lysosomal Pro-X carboxypeptidase                        176   3e-47    
ref|XP_003418585.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        177   3e-47    
ref|XP_010002716.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        176   3e-47    
gb|EOA96670.1|  Lysosomal Pro-X carboxypeptidase                        176   3e-47    
ref|XP_006349129.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    177   3e-47    
ref|XP_009877154.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        177   3e-47    
ref|XP_425654.3|  PREDICTED: lysosomal Pro-X carboxypeptidase           177   3e-47    
ref|XP_005357661.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        177   3e-47    
ref|XP_005026125.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        176   3e-47    
ref|XP_006485140.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    176   4e-47    
ref|XP_004324072.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    175   4e-47    
ref|XP_010267351.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    176   4e-47    
ref|XP_009779688.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    177   4e-47    
ref|NP_001099751.2|  lysosomal Pro-X carboxypeptidase precursor         177   4e-47    
ref|XP_004385551.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        177   5e-47    
ref|XP_004473934.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    175   5e-47    
ref|XP_004434101.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    177   5e-47    
ref|XP_005417883.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        176   5e-47    
ref|XP_007537171.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        174   5e-47    
ref|XP_011005420.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    177   6e-47    
ref|XP_007203815.1|  hypothetical protein PRUPE_ppa005504m1g            167   6e-47    
ref|XP_002601798.1|  hypothetical protein BRAFLDRAFT_279167             176   6e-47    
gb|KDO44732.1|  hypothetical protein CISIN_1g010487mg                   177   7e-47    
gb|KFO92702.1|  Lysosomal Pro-X carboxypeptidase                        175   7e-47    
gb|AAH26424.1|  Prcp protein                                            175   8e-47    
gb|EDL06718.1|  prolylcarboxypeptidase (angiotensinase C)               175   8e-47    
ref|XP_010139237.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        175   8e-47    
ref|XP_002271733.2|  PREDICTED: lysosomal Pro-X carboxypeptidase        176   9e-47    
ref|XP_008973719.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    174   9e-47    
ref|XP_007016020.1|  Serine carboxypeptidase S28 family protein, ...    175   1e-46    
ref|XP_011717519.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    174   1e-46    
ref|XP_011240212.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    175   1e-46    
ref|XP_005579271.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    174   1e-46    
ref|XP_010343917.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    174   1e-46    
ref|XP_008261572.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        174   1e-46    
ref|XP_005323310.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        176   1e-46    
ref|XP_012078951.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    176   1e-46    
ref|XP_011005419.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    176   1e-46    
ref|XP_007120155.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    176   2e-46    
ref|XP_007440929.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    171   2e-46    
ref|XP_007150129.1|  hypothetical protein PHAVU_005G1292001g            169   2e-46    
ref|XP_005274150.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    173   2e-46    
ref|XP_009185280.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    173   2e-46    
ref|XP_003203584.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        175   2e-46    
ref|XP_009245156.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    173   2e-46    
gb|AAH55022.1|  Prcp protein                                            175   2e-46    
gb|ETN60051.1|  lysosomal Pro-X carboxypeptidase                        175   2e-46    
ref|NP_082519.1|  lysosomal Pro-X carboxypeptidase precursor            175   2e-46    
ref|XP_006763799.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    173   2e-46    
ref|XP_006747630.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        175   2e-46    
gb|KFO60084.1|  Lysosomal Pro-X carboxypeptidase                        174   2e-46    
ref|XP_004093164.1|  PREDICTED: LOW QUALITY PROTEIN: lysosomal Pr...    175   2e-46    
gb|KFW74038.1|  Lysosomal Pro-X carboxypeptidase                        174   2e-46    
ref|XP_008537200.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        175   3e-46    
ref|XP_007664991.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    175   3e-46    
ref|XP_008933120.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        174   3e-46    
ref|XP_007187662.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        175   3e-46    
ref|XP_006145040.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    174   3e-46    
ref|XP_004271881.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        174   3e-46    
ref|XP_007447423.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        174   3e-46    
ref|XP_005975526.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    174   3e-46    
ref|XP_008633192.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        174   3e-46    
ref|XP_005379866.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    174   4e-46    
ref|XP_004408704.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        174   4e-46    
ref|XP_004473933.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    174   4e-46    
ref|XP_010851518.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        174   4e-46    
ref|XP_005074170.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    174   4e-46    
ref|XP_005516789.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        173   4e-46    
emb|CBI17113.3|  unnamed protein product                                176   4e-46    
ref|XP_005038441.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        174   4e-46    
ref|XP_009070789.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        173   4e-46    
ref|NP_001033253.1|  lysosomal Pro-X carboxypeptidase precursor         174   5e-46    
ref|XP_004019471.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        174   5e-46    
ref|XP_004473932.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    174   5e-46    
ref|XP_005226767.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    174   5e-46    
ref|XP_004473931.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    174   5e-46    
ref|XP_005379867.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    174   5e-46    
ref|NP_001125428.1|  lysosomal Pro-X carboxypeptidase precursor         174   5e-46    
ref|XP_005975525.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    174   5e-46    
ref|XP_010399419.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        174   5e-46    
ref|XP_004051942.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    174   6e-46    
ref|XP_011717518.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    174   6e-46    
ref|XP_001175153.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    174   6e-46    
ref|NP_001248178.1|  lysosomal Pro-X carboxypeptidase precursor         174   6e-46    
ref|XP_004051943.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    174   6e-46    
ref|XP_005699540.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    174   6e-46    
ref|XP_003935096.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    174   6e-46    
ref|XP_006055696.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        174   6e-46    
ref|XP_005894702.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        174   7e-46    
pdb|3N2Z|B  Chain B, The Structure Of Human Prolylcarboxypeptidas...    172   7e-46    
ref|XP_009185279.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    172   8e-46    
ref|XP_008018495.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    172   8e-46    
ref|XP_007440930.1|  PREDICTED: lysosomal Pro-X carboxypeptidase-...    171   9e-46    
ref|XP_009631310.1|  PREDICTED: lysosomal Pro-X carboxypeptidase        174   9e-46    
ref|XP_005579269.1|  PREDICTED: lysosomal Pro-X carboxypeptidase ...    174   9e-46    
gb|EHH56621.1|  hypothetical protein EGM_06072                          174   9e-46    



>ref|XP_006343677.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=498

 Score =   380 bits (975),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 171/218 (78%), Positives = 192/218 (88%), Gaps = 0/218 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W AFVYTAMVNY TEANFM PLPAYPVE+MCKIIDG P GASK+S+AFAAASLYYNY+ T
Sbjct  281   WEAFVYTAMVNYPTEANFMMPLPAYPVEEMCKIIDGLPKGASKLSKAFAAASLYYNYTQT  340

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             EKCF++E  +D HGLHGWDWQACTEMVMPM  S ESMFPPSS+SY+E  + C++ YGVKP
Sbjct  341   EKCFNLEGGTDSHGLHGWDWQACTEMVMPMTCSNESMFPPSSFSYKEFSQDCKKQYGVKP  400

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT FGG RIEQVLKRFGSN+IFSNGMQDPWSRGGVLKNIS SIVALVT+KGAHH 
Sbjct  401   RPHWITTEFGGYRIEQVLKRFGSNMIFSNGMQDPWSRGGVLKNISSSIVALVTQKGAHHV  460

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDMDMN  357
             DFRS TKNDPDWLI QR++EV I++KW+ EYY+D+  N
Sbjct  461   DFRSETKNDPDWLIMQRKQEVAIIEKWLEEYYKDLKQN  498



>ref|XP_009617834.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana tomentosiformis]
Length=497

 Score =   377 bits (967),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 172/218 (79%), Positives = 192/218 (88%), Gaps = 0/218 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W AFVYTAMVNY TEANFM PLPAYPV++MC+IIDGFP GASKISRAFAAASLYYNY+ T
Sbjct  280   WEAFVYTAMVNYPTEANFMMPLPAYPVKEMCRIIDGFPKGASKISRAFAAASLYYNYTQT  339

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             EKCF++E  +D HGLHGWDWQACTEMVMPM  S ESMFPPSSYSY+E +  C++ YGV+P
Sbjct  340   EKCFNLEGGNDAHGLHGWDWQACTEMVMPMTCSNESMFPPSSYSYKEFKEDCKKKYGVEP  399

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT FGG RIEQVLKRFGSN+IFSNGMQDPWSRGGVLKNIS SIVALVT+KGAHH 
Sbjct  400   RPHWITTEFGGYRIEQVLKRFGSNMIFSNGMQDPWSRGGVLKNISASIVALVTQKGAHHV  459

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDMDMN  357
             DFRS TKNDPDWLI QR++E+ I+QKW+ EYY D+  N
Sbjct  460   DFRSETKNDPDWLIMQRKQEMAIIQKWLEEYYIDLKEN  497



>ref|XP_004242567.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Solanum lycopersicum]
Length=498

 Score =   376 bits (965),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 168/218 (77%), Positives = 191/218 (88%), Gaps = 0/218 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W AFVYTAMVNY TEANFM PLPAYPV++MCKIIDG P G SK+S+AFAAASLYYNY+ T
Sbjct  281   WEAFVYTAMVNYPTEANFMMPLPAYPVKEMCKIIDGLPKGGSKLSKAFAAASLYYNYTQT  340

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             EKCF++E  +D HGLHGWDWQACTEMVMPM  S ESMFPPSS+SY+E  + C++ +GVKP
Sbjct  341   EKCFNLEGGTDSHGLHGWDWQACTEMVMPMTCSNESMFPPSSFSYKEFSKDCKKQFGVKP  400

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT FGG RIEQVLKRFGSN+IFSNGMQDPWSRGGVLKNIS SIVALVT+KGAHH 
Sbjct  401   RPHWITTEFGGYRIEQVLKRFGSNMIFSNGMQDPWSRGGVLKNISSSIVALVTQKGAHHV  460

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDMDMN  357
             DFRS TKNDPDWLI QR++EV I++KW+ EYY+D+  N
Sbjct  461   DFRSETKNDPDWLIMQRKQEVAIIEKWLEEYYKDLKQN  498



>ref|XP_009767201.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana sylvestris]
Length=497

 Score =   372 bits (955),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 170/218 (78%), Positives = 188/218 (86%), Gaps = 0/218 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W AFVYTAMVNY T+ANFM PLPAYPV++MCKIIDG P GASKISRAFAAASLYYNY+  
Sbjct  280   WEAFVYTAMVNYPTKANFMMPLPAYPVQEMCKIIDGLPKGASKISRAFAAASLYYNYTKR  339

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             EKCF++E   D HGLHGWDWQACTEMVMPM  S ESMFPPSSYSY+E +  C++ YGV+P
Sbjct  340   EKCFNLEGGDDAHGLHGWDWQACTEMVMPMTCSNESMFPPSSYSYKEFKEDCKKKYGVEP  399

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT FGG RIEQVLKRFGSN+IFSNGMQDPWSRGGVLKNIS SIVALVT+KGAHH 
Sbjct  400   RPHWITTEFGGYRIEQVLKRFGSNMIFSNGMQDPWSRGGVLKNISASIVALVTQKGAHHV  459

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDMDMN  357
             DFRS TKNDP WLI QR++E  I+QKW+ EYYRD+  N
Sbjct  460   DFRSETKNDPGWLIMQRKQEAAIIQKWLEEYYRDLKQN  497



>gb|KJB07579.1| hypothetical protein B456_001G030800 [Gossypium raimondii]
Length=492

 Score =   368 bits (944),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 165/215 (77%), Positives = 185/215 (86%), Gaps = 0/215 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W+AFVYT+MVNY T+A+FMKPLPAYPV+KMCKIID  P+GA+K+SRAFAAASLYYNYS +
Sbjct  278   WTAFVYTSMVNYPTKADFMKPLPAYPVQKMCKIIDKIPSGATKLSRAFAAASLYYNYSRS  337

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             E CF IE E D HGLHGWDWQ CTEMVMPM  SKESMFPPS + YEE    CQ  YGV P
Sbjct  338   ENCFKIEHEVDGHGLHGWDWQTCTEMVMPMTCSKESMFPPSGFDYEEFAEQCQMKYGVSP  397

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT FGG RI++VLKRFGSNIIFSNGMQDPWSRGGVLKNIS SI++LVTEKGAHH 
Sbjct  398   RPHWITTEFGGERIQKVLKRFGSNIIFSNGMQDPWSRGGVLKNISSSIISLVTEKGAHHV  457

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             DFRSATK DP WLIQ R++EV+I+QKW+ EYY D+
Sbjct  458   DFRSATKKDPKWLIQLRKQEVEIIQKWLNEYYADL  492



>ref|XP_007011977.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY29596.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=498

 Score =   368 bits (944),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 164/215 (76%), Positives = 186/215 (87%), Gaps = 0/215 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W+AFVYTAMVNY TEANF+KPLPAYPV++MCKIID FP+GA+K+SR+FAAASLYYNYS  
Sbjct  281   WTAFVYTAMVNYPTEANFLKPLPAYPVQEMCKIIDKFPSGATKLSRSFAAASLYYNYSRA  340

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             E CF IE E D HGLHGWDWQ CTEMVMPM  SKESMFPPS + YEE    CQ  Y V P
Sbjct  341   ENCFEIEHEVDTHGLHGWDWQTCTEMVMPMTCSKESMFPPSGFDYEEFAEQCQMKYEVLP  400

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT FGG RI++VLK+FGSNIIFSNGMQDPWSRGGVLKNIS SI+ALVT+KGAHH 
Sbjct  401   RPHWITTEFGGERIQKVLKKFGSNIIFSNGMQDPWSRGGVLKNISASIIALVTKKGAHHV  460

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             DFRSATK+DPDWL++QR +EV+I+QKW+ EYY D+
Sbjct  461   DFRSATKDDPDWLVEQRRQEVEIIQKWLNEYYADL  495



>ref|XP_010275727.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Nelumbo 
nucifera]
Length=491

 Score =   367 bits (942),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 165/215 (77%), Positives = 183/215 (85%), Gaps = 0/215 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W+AFVYTAMVNY TEANFM PLPAYPV +MCKIIDGFP  A+K+SR  AAASLYYNYS T
Sbjct  276   WTAFVYTAMVNYPTEANFMMPLPAYPVREMCKIIDGFPPRATKLSRVVAAASLYYNYSRT  335

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             EKCF IE+ +D HGLHGWDWQACTEMVMPM  SK+SMFPPS++ Y+     C R YGV P
Sbjct  336   EKCFKIENATDAHGLHGWDWQACTEMVMPMTCSKDSMFPPSTFDYKAFSEQCMRKYGVLP  395

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT FGGNRIEQVLKRFGSNIIFSNGMQDPWSRG VLKNIS SI+AL TEKGAHH 
Sbjct  396   RPHWITTEFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGSVLKNISASIIALATEKGAHHV  455

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             DFRSATK DPDWL++QR +EV+I+Q+WI EY+ D 
Sbjct  456   DFRSATKEDPDWLVEQRRQEVEIIQRWINEYHSDF  490



>emb|CBI18675.3| unnamed protein product [Vitis vinifera]
Length=502

 Score =   363 bits (932),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 183/215 (85%), Gaps = 0/215 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             WSAFVYTAMVNY T+ANFM PLPAYPVE+MCKIID FP GA+ +SRAFAAASLYYNYSGT
Sbjct  286   WSAFVYTAMVNYPTKANFMMPLPAYPVEEMCKIIDRFPHGATNVSRAFAAASLYYNYSGT  345

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             EKCF +E+  D HGLHGWDWQACTEMVMP+  S ESMFPPSS+ Y+E    C R YGV P
Sbjct  346   EKCFDLENGKDAHGLHGWDWQACTEMVMPLTCSNESMFPPSSFEYKEFADECTRKYGVMP  405

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT FGG+RIEQVLKR  SNIIFSNGMQDPWSRG VLKNIS SIVALVT+KGAHH 
Sbjct  406   RPHWITTEFGGSRIEQVLKRSASNIIFSNGMQDPWSRGSVLKNISASIVALVTKKGAHHV  465

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             DFR ATK DPDWLI+QR +EV+ILQKWI +Y  D+
Sbjct  466   DFRFATKEDPDWLIEQRRQEVEILQKWIHDYNADL  500



>gb|KHG29529.1| Lysosomal Pro-X carboxypeptidase [Gossypium arboreum]
Length=492

 Score =   363 bits (931),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 164/215 (76%), Positives = 183/215 (85%), Gaps = 0/215 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W+AFVYTAMVNY T+A+FMKPLPAYPV+KMCKIID  P+ A+K+SRAFAAASLYYNYS +
Sbjct  278   WTAFVYTAMVNYPTKADFMKPLPAYPVQKMCKIIDKIPSRATKLSRAFAAASLYYNYSRS  337

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             E CF IE E D HGLHGWDWQ CTEMVMPM  SKESMFPPS + YEE    C+  Y V P
Sbjct  338   ENCFKIEHEVDGHGLHGWDWQTCTEMVMPMTCSKESMFPPSGFDYEEFAEQCRMKYCVSP  397

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT FGG RI++VLKRFGSNIIFSNGMQDPWSRGGVLKNIS SI+ALVTEKGAHH 
Sbjct  398   RPHWITTEFGGERIQKVLKRFGSNIIFSNGMQDPWSRGGVLKNISSSIIALVTEKGAHHV  457

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             DFRSATK DP WLIQ R++EV+I+QKW+ EYY D+
Sbjct  458   DFRSATKKDPKWLIQLRKQEVEIIQKWLNEYYADL  492



>ref|XP_003633162.2| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
Length=488

 Score =   362 bits (928),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 167/215 (78%), Positives = 183/215 (85%), Gaps = 0/215 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             WSAFVYTAMVNY T+ANFM PLPAYPVE+MCKIID FP GA+ +SRAFAAASLYYNYSGT
Sbjct  272   WSAFVYTAMVNYPTKANFMMPLPAYPVEEMCKIIDRFPHGATNVSRAFAAASLYYNYSGT  331

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             EKCF +E+  D HGLHGWDWQACTEMVMP+  S ESMFPPSS+ Y+E    C R YGV P
Sbjct  332   EKCFDLENGKDAHGLHGWDWQACTEMVMPLTCSNESMFPPSSFEYKEFADECTRKYGVMP  391

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT FGG+RIEQVLKR  SNIIFSNGMQDPWSRG VLKNIS SIVALVT+KGAHH 
Sbjct  392   RPHWITTEFGGSRIEQVLKRSASNIIFSNGMQDPWSRGSVLKNISASIVALVTKKGAHHV  451

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             DFR ATK DPDWLI+QR +EV+ILQKWI +Y  D+
Sbjct  452   DFRFATKEDPDWLIEQRRQEVEILQKWIHDYNADL  486



>gb|KHG26338.1| Lysosomal Pro-X carboxypeptidase [Gossypium arboreum]
Length=501

 Score =   358 bits (918),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 183/215 (85%), Gaps = 0/215 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W+AFVYTA+VNY TEANF+KPLPAYPV++MCKIID  P+G +K+SRAFAAASLYYNYS T
Sbjct  284   WTAFVYTAIVNYPTEANFLKPLPAYPVQQMCKIIDKSPSGETKLSRAFAAASLYYNYSQT  343

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             E CF +E E D HGLHGW WQ CTEMVMPM  S ESMFPPS + Y+     C+  YGV P
Sbjct  344   ENCFEVEYEVDPHGLHGWHWQTCTEMVMPMTCSNESMFPPSGFDYKRFAEQCRMKYGVLP  403

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT FGG RIE+VLKRFGSNIIFSNGMQDPWSRGGVL+NIS +I+ALVTEKGAHH 
Sbjct  404   RPHWITTEFGGERIEKVLKRFGSNIIFSNGMQDPWSRGGVLRNISATIIALVTEKGAHHV  463

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             DFR+ATK+DPDWLIQQR +EV+I+Q+W+ EYY D+
Sbjct  464   DFRAATKDDPDWLIQQRRQEVEIIQRWLDEYYVDL  498



>ref|XP_002523506.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF38845.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
Length=501

 Score =   357 bits (917),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 159/217 (73%), Positives = 187/217 (86%), Gaps = 0/217 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             WSA+VY+AMVNY TEANFMKPLPAYPV++MCKIIDGFPAGASK+SR FAAASLYYNYS  
Sbjct  280   WSAYVYSAMVNYPTEANFMKPLPAYPVKEMCKIIDGFPAGASKVSRVFAAASLYYNYSRG  339

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             EKCF +E+  D HGLHGW+WQACTEMVMPM  SKESMFPPS Y Y+E    C++ +GV P
Sbjct  340   EKCFQLENVPDAHGLHGWNWQACTEMVMPMTCSKESMFPPSGYDYKEFAEECKKKFGVMP  399

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             R HWITT FGG RI++VLKRFGSNIIFSNGM+DPWSRGGVLKNIS SI+A+VT+KGAHH 
Sbjct  400   RQHWITTEFGGKRIDKVLKRFGSNIIFSNGMEDPWSRGGVLKNISSSIIAIVTKKGAHHV  459

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDMDM  360
             DFRSATK+DP+WL + R++E+ I+ +WI EYY D+ +
Sbjct  460   DFRSATKDDPNWLKEMRKQEIQIIGRWIDEYYADLKL  496



>ref|XP_011017986.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Populus 
euphratica]
Length=410

 Score =   352 bits (904),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 181/215 (84%), Gaps = 0/215 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             WSAFVYTAMVNY TEANFM PLPAYPV+ MCKIIDGFP+GASKI+R FAAASLYYNYS  
Sbjct  190   WSAFVYTAMVNYPTEANFMMPLPAYPVQAMCKIIDGFPSGASKITRVFAAASLYYNYSRA  249

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             EKCF +E   D HGLHGW+WQACTEMVMPM  S+ESMFP SS+SY+E    C + +GVKP
Sbjct  250   EKCFKLEHGPDAHGLHGWNWQACTEMVMPMTCSEESMFPTSSFSYKEFAEDCMKTFGVKP  309

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             R HWITT FGG RI+ VLKR G NIIFSNGMQDPWSRGGVLKNIS S++ALVTEKGAHH 
Sbjct  310   RSHWITTEFGGKRIDLVLKRSGGNIIFSNGMQDPWSRGGVLKNISSSVIALVTEKGAHHV  369

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             DFRSATK+DP+WL + R +EV+I+Q WI +YY D+
Sbjct  370   DFRSATKDDPEWLKELRRQEVEIIQGWIDQYYPDL  404



>ref|XP_012071462.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Jatropha curcas]
 gb|KDP38645.1| hypothetical protein JCGZ_03998 [Jatropha curcas]
Length=501

 Score =   355 bits (912),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 161/217 (74%), Positives = 184/217 (85%), Gaps = 0/217 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             WSAFVYTAM+NY TEANFM PLPAYPV++MCKIIDGFP GASKISR FAAASLYYNYS  
Sbjct  280   WSAFVYTAMMNYPTEANFMMPLPAYPVKEMCKIIDGFPPGASKISRVFAAASLYYNYSHG  339

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             EKCF +E+E D HGLHGW+WQACTEMVMPM  SKESMFPPS + Y+E  + C++ YGV P
Sbjct  340   EKCFELENEHDAHGLHGWNWQACTEMVMPMTCSKESMFPPSGFDYKEFSKGCKKKYGVMP  399

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT +GG RI+QVLKR G NIIFSNGMQDPWSRGGVLKNIS SI+ALVT+KGAHH 
Sbjct  400   RPHWITTEYGGKRIDQVLKRSGGNIIFSNGMQDPWSRGGVLKNISSSIIALVTDKGAHHV  459

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDMDM  360
             DFRS+ K+DP WL + R +EV+I+ KWI EYY D+ +
Sbjct  460   DFRSSMKDDPYWLRELRSQEVEIISKWIDEYYADLKL  496



>ref|XP_002324555.2| serine carboxypeptidase S28 family protein [Populus trichocarpa]
 gb|ABK95724.1| unknown [Populus trichocarpa]
 gb|EEF03120.2| serine carboxypeptidase S28 family protein [Populus trichocarpa]
Length=500

 Score =   355 bits (911),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 182/215 (85%), Gaps = 0/215 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             WSAFVYTAMVNY TEANFM PLPAYPV+ MCKIIDGFP+GASKI+R FAAASLYYNYS  
Sbjct  280   WSAFVYTAMVNYPTEANFMMPLPAYPVQAMCKIIDGFPSGASKITRVFAAASLYYNYSRA  339

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             EKCF +E   D HGLHGW+WQACTEMVMPM  S+ESMFP SS+SY+E    C + +GVKP
Sbjct  340   EKCFKLEHGPDAHGLHGWNWQACTEMVMPMTCSEESMFPTSSFSYKEFAEDCMKTFGVKP  399

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT FGG RI+ VLKR G NIIFSNGMQDPWSRGGVLKNIS SI+ALVTEKGAHH 
Sbjct  400   RPHWITTEFGGKRIDLVLKRSGGNIIFSNGMQDPWSRGGVLKNISSSIIALVTEKGAHHV  459

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             DFRSATK+DP+WL + R +EV+I+Q WI +YY D+
Sbjct  460   DFRSATKDDPEWLKELRRQEVEIIQGWIDQYYPDL  494



>gb|KJB54925.1| hypothetical protein B456_009G054400 [Gossypium raimondii]
Length=501

 Score =   355 bits (911),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 157/215 (73%), Positives = 183/215 (85%), Gaps = 0/215 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W+AFVYTAMVNY TEANF+KPLPAYPV++MCKIID  P+GA++++RAFAAASLYYNYS T
Sbjct  284   WTAFVYTAMVNYPTEANFLKPLPAYPVQQMCKIIDKSPSGATRLTRAFAAASLYYNYSQT  343

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             E CF +E E D HGLHGW WQ CTEMVMPM  S ESMFPPS + Y++    C+  YGV P
Sbjct  344   ENCFEVEHEVDPHGLHGWHWQTCTEMVMPMTCSNESMFPPSGFDYKKFAEQCRMKYGVLP  403

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT FGG RIE+VLKRFGSNIIFSNGMQDPWSRGGVL+NIS +I+ALVTEKGAHH 
Sbjct  404   RPHWITTEFGGERIEKVLKRFGSNIIFSNGMQDPWSRGGVLRNISATIIALVTEKGAHHI  463

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             DFR+ TK+DPDWLIQQR +EV+ +Q+W+ EYY D+
Sbjct  464   DFRATTKDDPDWLIQQRRQEVENIQRWLDEYYVDL  498



>ref|XP_008457347.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Cucumis melo]
Length=499

 Score =   355 bits (910),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 157/219 (72%), Positives = 185/219 (84%), Gaps = 0/219 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             WSAFVYT+MVNY TEANFM+PLPAYPV++MCKIID F    SK+ + FAAASLYYNYS  
Sbjct  278   WSAFVYTSMVNYPTEANFMRPLPAYPVQEMCKIIDAFAPETSKLDKVFAAASLYYNYSHG  337

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             EKCF++E+  D HGL GWDWQACTEMVMPM  S +SMFPPS + YEE    C++ YGV P
Sbjct  338   EKCFNVENGPDLHGLSGWDWQACTEMVMPMTCSNQSMFPPSEFDYEEFATDCKKKYGVSP  397

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT FGG RIE+VLKRFGSN+IFSNGMQDPWSRGGVL+NIS SI+A+VTEKGAHH 
Sbjct  398   RPHWITTEFGGERIEEVLKRFGSNLIFSNGMQDPWSRGGVLRNISTSIIAIVTEKGAHHV  457

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDMDMNQ  354
             DFRSATK+DPDWL++QR++EV+I+ +WI EYY DM  ++
Sbjct  458   DFRSATKDDPDWLVEQRKQEVEIIHQWINEYYADMKQDK  496



>emb|CDY20293.1| BnaC04g36630D [Brassica napus]
Length=492

 Score =   353 bits (907),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 162/213 (76%), Positives = 178/213 (84%), Gaps = 0/213 (0%)
 Frame = -3

Query  1004  AFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEK  825
             AFVYTAMVNYAT ANFM PLP YPVE+MCKIIDGFP G+S + RAFAAASLYYNYSG+EK
Sbjct  278   AFVYTAMVNYATAANFMAPLPGYPVEQMCKIIDGFPRGSSNLDRAFAAASLYYNYSGSEK  337

Query  824   CFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRP  645
             CF +E  +DDHGL GW +QACTEMVMPM  S +SMFPP    YE  E  C   YGVKPRP
Sbjct  338   CFELEQPTDDHGLDGWGYQACTEMVMPMSCSNQSMFPPYENDYEAFEEQCMSKYGVKPRP  397

Query  644   HWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADF  465
             HWITT FGG RIE VLKRFGSNIIFSNGMQDPWSRGGVLKNIS SI+ALVT+KGAHHAD 
Sbjct  398   HWITTEFGGKRIESVLKRFGSNIIFSNGMQDPWSRGGVLKNISSSIIALVTKKGAHHADL  457

Query  464   RSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             R+ATK DP+WL +QR +EV I++KWI EYYRDM
Sbjct  458   RAATKGDPEWLKEQRRQEVAIIEKWISEYYRDM  490



>ref|XP_004139280.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Cucumis sativus]
 gb|KGN60732.1| hypothetical protein Csa_2G008720 [Cucumis sativus]
Length=499

 Score =   353 bits (907),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 158/219 (72%), Positives = 186/219 (85%), Gaps = 0/219 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             WSAFVYT+MVNY TEANFM+PLPAYPV++MCKIID F    SK+++AFAAASLYYNYS  
Sbjct  278   WSAFVYTSMVNYPTEANFMRPLPAYPVQEMCKIIDAFAPETSKLNKAFAAASLYYNYSHG  337

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             EKCF++E+  D HGL GW+WQACTEMVMPM  S +SMFPPS + YEE    C++ YGV P
Sbjct  338   EKCFNVENGPDLHGLSGWNWQACTEMVMPMTCSNQSMFPPSKFDYEEFATDCKKKYGVSP  397

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT +GG RIE+VLKRFGSNIIFSNGMQDPWSRGGVL+NIS SIVALVTEKGAHH 
Sbjct  398   RPHWITTEYGGERIEEVLKRFGSNIIFSNGMQDPWSRGGVLRNISTSIVALVTEKGAHHV  457

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDMDMNQ  354
             DFRSATK+DPDWL++QR +EV+I+ +WI E+Y DM  ++
Sbjct  458   DFRSATKDDPDWLVEQRRQEVEIIHQWINEHYADMKQDK  496



>ref|XP_002878742.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH55001.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=495

 Score =   353 bits (906),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/213 (75%), Positives = 179/213 (84%), Gaps = 0/213 (0%)
 Frame = -3

Query  1004  AFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEK  825
             AFVYTAMVNY T ANFM PLP YPVE+MCKIIDGFP G+S + RAFAAASLYYNYSG+EK
Sbjct  278   AFVYTAMVNYPTAANFMAPLPGYPVEQMCKIIDGFPRGSSNLDRAFAAASLYYNYSGSEK  337

Query  824   CFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRP  645
             CF +E ++DDHGL+GW +QACTEMVMPM  S +SM PP    YE  +  C   YGVKPRP
Sbjct  338   CFEMEQQTDDHGLNGWQYQACTEMVMPMSCSNQSMLPPYDNDYEAFQEQCMSTYGVKPRP  397

Query  644   HWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADF  465
             HWITT FGG RIE VLKRFGSNIIFSNGMQDPWSRGGVLKNIS SIVALVT+KGAHHAD 
Sbjct  398   HWITTEFGGKRIETVLKRFGSNIIFSNGMQDPWSRGGVLKNISSSIVALVTKKGAHHADL  457

Query  464   RSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             R+ATK+DP+WL +QR +EV I++KWI EYYRD+
Sbjct  458   RAATKDDPEWLKEQRRQEVSIIEKWISEYYRDL  490



>gb|KFK32665.1| serine carboxypeptidase s28 family protein [Arabis alpina]
Length=496

 Score =   352 bits (902),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 159/214 (74%), Positives = 182/214 (85%), Gaps = 0/214 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SAFVYTAMVNYAT ANFM PLPAYPVE+MCKI+DGFP G+S + RAFAAASLYYNYSG++
Sbjct  279   SAFVYTAMVNYATAANFMAPLPAYPVEQMCKIVDGFPRGSSNLDRAFAAASLYYNYSGSK  338

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPR  648
             KCF +E  +DDHGL GW WQACTEMVMPM +S +SMFPP    YE  +  C   YGVKPR
Sbjct  339   KCFEMEQPTDDHGLDGWGWQACTEMVMPMSISNQSMFPPYDNDYEAFQDQCMGRYGVKPR  398

Query  647   PHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHAD  468
             PHWITT FGG RIE VLKRFGSNIIFSNGMQDPWSRGGVLKNIS SIVALVT+KGAHHAD
Sbjct  399   PHWITTEFGGKRIETVLKRFGSNIIFSNGMQDPWSRGGVLKNISSSIVALVTKKGAHHAD  458

Query  467   FRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
              R+ATK+DP+WL +QR +EV I+++WI +YY+D+
Sbjct  459   LRAATKDDPEWLKEQRMQEVTIIEQWITQYYKDL  492



>emb|CDY46135.1| BnaA04g14230D [Brassica napus]
Length=494

 Score =   351 bits (901),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 160/213 (75%), Positives = 178/213 (84%), Gaps = 0/213 (0%)
 Frame = -3

Query  1004  AFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEK  825
             AFVYTAMVNYAT ANFM PLP YPVE+MCKIIDGFP G+S + RAFAAASLYYNYSG+EK
Sbjct  278   AFVYTAMVNYATAANFMAPLPGYPVEQMCKIIDGFPRGSSNLDRAFAAASLYYNYSGSEK  337

Query  824   CFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRP  645
             CF +E  +DDHGL GW +QACTEMVMPM  S +SMFPP    YE  E  C   YGVKPRP
Sbjct  338   CFELEQPTDDHGLDGWGYQACTEMVMPMSCSNQSMFPPYENDYEAFEEQCMSKYGVKPRP  397

Query  644   HWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADF  465
             HWITT FGG +IE VLKRFGSNIIFSNGMQDPWSRGGVLKNIS SI+ALVT+KGAHHAD 
Sbjct  398   HWITTEFGGKKIETVLKRFGSNIIFSNGMQDPWSRGGVLKNISSSIIALVTKKGAHHADL  457

Query  464   RSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             R+ATK DP+WL +QR +EV I++KWI EYYRD+
Sbjct  458   RAATKGDPEWLKEQRRQEVAIIEKWISEYYRDL  490



>ref|XP_011017985.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Populus 
euphratica]
Length=500

 Score =   351 bits (901),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 181/215 (84%), Gaps = 0/215 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             WSAFVYTAMVNY TEANFM PLPAYPV+ MCKIIDGFP+GASKI+R FAAASLYYNYS  
Sbjct  280   WSAFVYTAMVNYPTEANFMMPLPAYPVQAMCKIIDGFPSGASKITRVFAAASLYYNYSRA  339

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             EKCF +E   D HGLHGW+WQACTEMVMPM  S+ESMFP SS+SY+E    C + +GVKP
Sbjct  340   EKCFKLEHGPDAHGLHGWNWQACTEMVMPMTCSEESMFPTSSFSYKEFAEDCMKTFGVKP  399

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             R HWITT FGG RI+ VLKR G NIIFSNGMQDPWSRGGVLKNIS S++ALVTEKGAHH 
Sbjct  400   RSHWITTEFGGKRIDLVLKRSGGNIIFSNGMQDPWSRGGVLKNISSSVIALVTEKGAHHV  459

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             DFRSATK+DP+WL + R +EV+I+Q WI +YY D+
Sbjct  460   DFRSATKDDPEWLKELRRQEVEIIQGWIDQYYPDL  494



>ref|XP_010047139.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Eucalyptus grandis]
 gb|KCW78947.1| hypothetical protein EUGRSUZ_C00378 [Eucalyptus grandis]
Length=502

 Score =   351 bits (901),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 180/215 (84%), Gaps = 0/215 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W+AFVYTAMVNY TEANFM  LPAYPV++MCKIID  P G +K+S+AFAAASLYYNYS T
Sbjct  286   WAAFVYTAMVNYPTEANFMMHLPAYPVKEMCKIIDALPPGETKLSKAFAAASLYYNYSQT  345

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             EKCF IE  SD HGLHGWDWQACTEMVMPM  S ESMF P SY+Y      C + YGV P
Sbjct  346   EKCFDIEHGSDAHGLHGWDWQACTEMVMPMSCSSESMFTPYSYNYSAFAEQCMKNYGVTP  405

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWI T FGG +IE++LKRFGSNIIFSNGMQDPWSRGGVLKNIS SIVALVTE+GAHH 
Sbjct  406   RPHWIATEFGGKQIEKILKRFGSNIIFSNGMQDPWSRGGVLKNISASIVALVTEEGAHHV  465

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             DFR ATK+DP+WL++QR++EVDI+Q WI EYY D+
Sbjct  466   DFRFATKDDPNWLVEQRKQEVDIIQSWIDEYYADL  500



>ref|XP_010429398.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=495

 Score =   351 bits (900),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 159/213 (75%), Positives = 179/213 (84%), Gaps = 0/213 (0%)
 Frame = -3

Query  1004  AFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEK  825
             AFVYTAMVNY T ANFM PLP YPVE+MCKIIDGFP G+S + RAFAAASLYYNYSG+EK
Sbjct  279   AFVYTAMVNYPTAANFMAPLPGYPVEEMCKIIDGFPRGSSNLDRAFAAASLYYNYSGSEK  338

Query  824   CFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRP  645
             CF +E ++DDHGL+GW +QACTEMVMPM  S +SM PP    YE  E  C+  YGVKPRP
Sbjct  339   CFEMEQQTDDHGLNGWQYQACTEMVMPMSCSNQSMLPPYDNDYEAFEEQCKSRYGVKPRP  398

Query  644   HWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADF  465
             HWITT FGG RIE VLKRFGSNIIFSNG+QDPWSRGGVLKNIS SIVALVT+KGAHHAD 
Sbjct  399   HWITTEFGGMRIETVLKRFGSNIIFSNGLQDPWSRGGVLKNISSSIVALVTKKGAHHADL  458

Query  464   RSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             R+ATK DP+WL +QR +EV I++KWI EYYRD+
Sbjct  459   RAATKGDPEWLKEQRTQEVAIIEKWISEYYRDL  491



>ref|XP_009140531.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brassica rapa]
Length=526

 Score =   351 bits (901),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/213 (75%), Positives = 178/213 (84%), Gaps = 0/213 (0%)
 Frame = -3

Query  1004  AFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEK  825
             AFVYTAMVNYAT ANFM PLP YPVE+MCKIIDGFP G+S + RAFAAASLYYNYSG+EK
Sbjct  310   AFVYTAMVNYATTANFMAPLPGYPVEQMCKIIDGFPRGSSNLDRAFAAASLYYNYSGSEK  369

Query  824   CFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRP  645
             CF +E  +DDHGL GW +QACTEMVMPM  S +SMFPP    YE  E  C   YGVKPRP
Sbjct  370   CFELEQPTDDHGLDGWGYQACTEMVMPMSCSNQSMFPPYENDYEAFEEQCMSKYGVKPRP  429

Query  644   HWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADF  465
             HWITT FGG RIE VLKRFGSNIIFSNG+QDPWSRGGVLKNIS SI+ALVT+KGAHHAD 
Sbjct  430   HWITTEFGGKRIETVLKRFGSNIIFSNGLQDPWSRGGVLKNISSSIIALVTKKGAHHADL  489

Query  464   RSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             R+ATK DP+WL +QR +EV I++KWI EYYRD+
Sbjct  490   RAATKGDPEWLKEQRRQEVAIVEKWISEYYRDL  522



>ref|XP_010932236.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Elaeis 
guineensis]
Length=400

 Score =   347 bits (889),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 183/214 (86%), Gaps = 0/214 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W+AFVYTAMV+Y T +NF+ PLPAYP+++MC+IIDGFP GASK+++ F+AASLYYNYSG 
Sbjct  184   WTAFVYTAMVDYPTASNFLMPLPAYPIKEMCRIIDGFPQGASKLTKVFSAASLYYNYSGD  243

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             + CF IE+ +D HGLHGWDWQACTEMVMPM+ S ESMFP SSY Y+E    C   YGV+P
Sbjct  244   QSCFDIENGTDPHGLHGWDWQACTEMVMPMICSNESMFPSSSYDYDEFGDECMAKYGVRP  303

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT +GGNRI+ VLKRFGSNIIFSNGM+DPWSRGGVL+NIS SI+ALVTEKGAHH 
Sbjct  304   RPHWITTEYGGNRIDAVLKRFGSNIIFSNGMRDPWSRGGVLRNISSSIIALVTEKGAHHL  363

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             D R ATK+DP WL++QR++E+DI+Q WI +Y+ D
Sbjct  364   DLRYATKDDPKWLLEQRKQEIDIIQSWIDQYHID  397



>ref|XP_010275726.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Nelumbo 
nucifera]
Length=525

 Score =   350 bits (898),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 165/249 (66%), Positives = 183/249 (73%), Gaps = 34/249 (14%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W+AFVYTAMVNY TEANFM PLPAYPV +MCKIIDGFP  A+K+SR  AAASLYYNYS T
Sbjct  276   WTAFVYTAMVNYPTEANFMMPLPAYPVREMCKIIDGFPPRATKLSRVVAAASLYYNYSRT  335

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             EKCF IE+ +D HGLHGWDWQACTEMVMPM  SK+SMFPPS++ Y+     C R YGV P
Sbjct  336   EKCFKIENATDAHGLHGWDWQACTEMVMPMTCSKDSMFPPSTFDYKAFSEQCMRKYGVLP  395

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRG----------------------  537
             RPHWITT FGGNRIEQVLKRFGSNIIFSNGMQDPWSRG                      
Sbjct  396   RPHWITTEFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGRFQGKSFSEMKCEALSLFVFFF  455

Query  536   ------------GVLKNISDSIVALVTEKGAHHADFRSATKNDPDWLIQQREKEVDILQK  393
                          VLKNIS SI+AL TEKGAHH DFRSATK DPDWL++QR +EV+I+Q+
Sbjct  456   LEKNGTVMECPLSVLKNISASIIALATEKGAHHVDFRSATKEDPDWLVEQRRQEVEIIQR  515

Query  392   WIGEYYRDM  366
             WI EY+ D 
Sbjct  516   WINEYHSDF  524



>ref|XP_006404933.1| hypothetical protein EUTSA_v10000143mg [Eutrema salsugineum]
 dbj|BAJ33970.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46386.1| hypothetical protein EUTSA_v10000143mg [Eutrema salsugineum]
Length=494

 Score =   349 bits (895),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 158/214 (74%), Positives = 178/214 (83%), Gaps = 0/214 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SAF+YTAMVNYAT ANFM PLP YPVE+MCKIIDGFP G+S + RAFAAASLYYNYSG+E
Sbjct  277   SAFIYTAMVNYATAANFMAPLPGYPVEQMCKIIDGFPRGSSNLDRAFAAASLYYNYSGSE  336

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPR  648
             KCF +E  +DDHGL GW WQACTEMVMPM  S +SMFPP    YE  +  C   YGVKPR
Sbjct  337   KCFELEQPTDDHGLDGWGWQACTEMVMPMSCSNQSMFPPYDNDYEAFKEQCMSRYGVKPR  396

Query  647   PHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHAD  468
             PHWITT FGG RIE VLKRFGSNIIFSNGMQDPWSRGGVLKNIS SI+ALVT+KGAHHAD
Sbjct  397   PHWITTEFGGKRIETVLKRFGSNIIFSNGMQDPWSRGGVLKNISSSIIALVTKKGAHHAD  456

Query  467   FRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
              R+A+K DP+WL +QR +EV I++KWI EY+R +
Sbjct  457   LRAASKGDPEWLKEQRRQEVAIIEKWISEYHRAL  490



>gb|KJB07578.1| hypothetical protein B456_001G030800 [Gossypium raimondii]
Length=484

 Score =   348 bits (892),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 178/215 (83%), Gaps = 8/215 (4%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W+AFVYT+MVNY T+A+FMKPLPAYPV+KMCKIID  P+GA+K+SRAFAAASLYYNYS +
Sbjct  278   WTAFVYTSMVNYPTKADFMKPLPAYPVQKMCKIIDKIPSGATKLSRAFAAASLYYNYSRS  337

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             E CF IE E D HGLHGWDWQ CTEMVMPM  SKESMFPPS + YEE    CQ  YGV P
Sbjct  338   ENCFKIEHEVDGHGLHGWDWQTCTEMVMPMTCSKESMFPPSGFDYEEFAEQCQMKYGVSP  397

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT FGG RI++VLKRFGSNIIFSNGMQDPWSRGG        I++LVTEKGAHH 
Sbjct  398   RPHWITTEFGGERIQKVLKRFGSNIIFSNGMQDPWSRGG--------IISLVTEKGAHHV  449

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             DFRSATK DP WLIQ R++EV+I+QKW+ EYY D+
Sbjct  450   DFRSATKKDPKWLIQLRKQEVEIIQKWLNEYYADL  484



>ref|XP_010472431.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=495

 Score =   348 bits (893),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/213 (74%), Positives = 178/213 (84%), Gaps = 0/213 (0%)
 Frame = -3

Query  1004  AFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEK  825
             AFVYTAMVNY T ANFM PLP YPVE+MCKIIDGFP G+S + RAFAAASLYYNYSG+EK
Sbjct  279   AFVYTAMVNYPTPANFMAPLPGYPVEQMCKIIDGFPRGSSNLDRAFAAASLYYNYSGSEK  338

Query  824   CFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRP  645
             CF +E ++DDHGL+GW +QACTEMVMPM  S +SM PP    YE  +  C   YGVKPRP
Sbjct  339   CFEMEQQTDDHGLNGWQYQACTEMVMPMSCSNQSMLPPYDNDYEAFKEQCMSRYGVKPRP  398

Query  644   HWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADF  465
             HWITT FGG RIE VLKRFGSNIIFSNG+QDPWSRGGVLKNIS SIVALVT+KGAHHAD 
Sbjct  399   HWITTEFGGMRIETVLKRFGSNIIFSNGLQDPWSRGGVLKNISSSIVALVTKKGAHHADL  458

Query  464   RSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             R+ATK DP+WL +QR +EV I++KWI EYYRD+
Sbjct  459   RAATKGDPEWLKEQRTQEVAIIEKWISEYYRDL  491



>emb|CDP10200.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   347 bits (890),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 176/214 (82%), Gaps = 0/214 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             WSAF YTAMVNY  EANFMK LPAYPVE+MCKIIDG    A+K+SRA AAASLYYNYS T
Sbjct  279   WSAFTYTAMVNYPMEANFMKHLPAYPVEEMCKIIDGHSPRATKLSRAVAAASLYYNYSKT  338

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             EKCF +EDE +DHGL GW+WQACTEMVMPM  S  SMFPPS YSY+E    C R +GV P
Sbjct  339   EKCFKLEDEDNDHGLQGWNWQACTEMVMPMTCSNGSMFPPSPYSYKEFADDCNRQFGVWP  398

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             R HWITT FGG RI  VLKRFGSNIIFSNGMQDPWSRGGVLKNIS SIVALVTEKGAHH 
Sbjct  399   REHWITTEFGGMRINLVLKRFGSNIIFSNGMQDPWSRGGVLKNISSSIVALVTEKGAHHV  458

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             DFRSAT  DP+WLI QR +EV+I+QKW+ EYY D
Sbjct  459   DFRSATNKDPEWLIDQRRQEVEIIQKWLQEYYAD  492



>ref|NP_850050.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AAL25591.1| At2g24280/F27D4.19 [Arabidopsis thaliana]
 gb|AAM98275.1| At2g24280/F27D4.19 [Arabidopsis thaliana]
 gb|AEC07556.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=494

 Score =   347 bits (890),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 159/217 (73%), Positives = 178/217 (82%), Gaps = 0/217 (0%)
 Frame = -3

Query  1004  AFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEK  825
             AFVYTAMVNY T ANFM PLP YPVE+MCKIIDGFP G+S + RAFAAASLYYNYSG+EK
Sbjct  278   AFVYTAMVNYPTAANFMAPLPGYPVEQMCKIIDGFPRGSSNLDRAFAAASLYYNYSGSEK  337

Query  824   CFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRP  645
             CF +E ++DDHGL GW +QACTEMVMPM  S +SM PP     E  +  C   YGVKPRP
Sbjct  338   CFEMEQQTDDHGLDGWQYQACTEMVMPMSCSNQSMLPPYENDSEAFQEQCMTRYGVKPRP  397

Query  644   HWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADF  465
             HWITT FGG RIE VLKRFGSNIIFSNGMQDPWSRGGVLKNIS SIVALVT+KGAHHAD 
Sbjct  398   HWITTEFGGMRIETVLKRFGSNIIFSNGMQDPWSRGGVLKNISSSIVALVTKKGAHHADL  457

Query  464   RSATKNDPDWLIQQREKEVDILQKWIGEYYRDMDMNQ  354
             R+ATK+DP+WL +QR +EV I++KWI EYYRD+   Q
Sbjct  458   RAATKDDPEWLKEQRRQEVAIIEKWISEYYRDLREEQ  494



>gb|ABK95653.1| unknown [Populus trichocarpa]
Length=213

 Score =   336 bits (862),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 174/207 (84%), Gaps = 0/207 (0%)
 Frame = -3

Query  986  MVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIED  807
            MVNY TEANFM PLPAYPV+ MCKIIDGFP+GASKI+R FAAASLYYNYS  EKCF +E 
Sbjct  1    MVNYPTEANFMMPLPAYPVQAMCKIIDGFPSGASKITRVFAAASLYYNYSRAEKCFKLEH  60

Query  806  ESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTH  627
              D HGLHGW+WQACTEMVMPM  S+ESMFP SS+SY+E    C + +GVKPRPHWITT 
Sbjct  61   GPDAHGLHGWNWQACTEMVMPMTCSEESMFPTSSFSYKEFAEDCMKTFGVKPRPHWITTE  120

Query  626  FGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKN  447
            FGG RI+ VLKR G NIIFSNGMQDPWSRGGVLKNIS SI+ALVTEKGAHH DFRSATK+
Sbjct  121  FGGKRIDLVLKRSGGNIIFSNGMQDPWSRGGVLKNISSSIIALVTEKGAHHVDFRSATKD  180

Query  446  DPDWLIQQREKEVDILQKWIGEYYRDM  366
            DP+WL + R +EV+I+Q WI +YY D+
Sbjct  181  DPEWLKELRRQEVEIIQGWIDQYYPDL  207



>gb|EYU25337.1| hypothetical protein MIMGU_mgv1a004964mg [Erythranthe guttata]
Length=502

 Score =   347 bits (889),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 180/215 (84%), Gaps = 0/215 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W AFVY AM NY TE+NF+KPLPA+PV++MCKIIDG     +K+SR F AASLYYNYS T
Sbjct  284   WEAFVYVAMTNYPTESNFIKPLPAHPVKQMCKIIDGLSPETTKLSRVFEAASLYYNYSRT  343

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             EKCF +E+E+DDHGLHGW+WQACTEMVMPM +S ESMFPP  +SY++    C + YGV+P
Sbjct  344   EKCFELENENDDHGLHGWNWQACTEMVMPMSISNESMFPPYQFSYKDFSDDCLKNYGVRP  403

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT FGG  IEQVLKRFGSNIIFSNG+QDPWSRG VLKNIS SIVALV EKGAHH 
Sbjct  404   RPHWITTEFGGTNIEQVLKRFGSNIIFSNGLQDPWSRGSVLKNISTSIVALVAEKGAHHT  463

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D R AT+ DPDWLI+QR++E++I+QKWI +YY D+
Sbjct  464   DLRRATRKDPDWLIEQRKQEIEIIQKWISDYYIDI  498



>ref|XP_010932235.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Elaeis 
guineensis]
Length=525

 Score =   347 bits (889),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 183/215 (85%), Gaps = 0/215 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W+AFVYTAMV+Y T +NF+ PLPAYP+++MC+IIDGFP GASK+++ F+AASLYYNYSG 
Sbjct  309   WTAFVYTAMVDYPTASNFLMPLPAYPIKEMCRIIDGFPQGASKLTKVFSAASLYYNYSGD  368

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             + CF IE+ +D HGLHGWDWQACTEMVMPM+ S ESMFP SSY Y+E    C   YGV+P
Sbjct  369   QSCFDIENGTDPHGLHGWDWQACTEMVMPMICSNESMFPSSSYDYDEFGDECMAKYGVRP  428

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT +GGNRI+ VLKRFGSNIIFSNGM+DPWSRGGVL+NIS SI+ALVTEKGAHH 
Sbjct  429   RPHWITTEYGGNRIDAVLKRFGSNIIFSNGMRDPWSRGGVLRNISSSIIALVTEKGAHHL  488

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D R ATK+DP WL++QR++E+DI+Q WI +Y+ D 
Sbjct  489   DLRYATKDDPKWLLEQRKQEIDIIQSWIDQYHIDF  523



>gb|EEE66119.1| hypothetical protein OsJ_22160 [Oryza sativa Japonica Group]
Length=393

 Score =   339 bits (870),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 150/215 (70%), Positives = 179/215 (83%), Gaps = 0/215 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W+AFVYTAMV+Y T ANF+  LPAYP+++MCKII GFPAGA  + +AFAAASLYYNY+G 
Sbjct  174   WTAFVYTAMVDYPTPANFLMNLPAYPIKEMCKIIHGFPAGADIVDKAFAAASLYYNYTGD  233

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             + CF +ED  D HGL GW WQACTEMVMPM +S ESMFPP +++YE     C + YGV+P
Sbjct  234   QTCFQLEDGEDPHGLSGWGWQACTEMVMPMTISNESMFPPFTFTYEGKSDDCFQSYGVRP  293

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT +GGNRI+ VLKRFGSNIIFSNGM+DPWSRGGVLKNIS SI+ALVTEKGAHH 
Sbjct  294   RPHWITTEYGGNRIDLVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIIALVTEKGAHHL  353

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             DFRSATK+DPDW+++QR +EV I+Q WI +Y  D+
Sbjct  354   DFRSATKDDPDWVVEQRRQEVKIIQGWIDQYNEDL  388



>ref|XP_006294084.1| hypothetical protein CARUB_v10023078mg [Capsella rubella]
 gb|EOA26982.1| hypothetical protein CARUB_v10023078mg [Capsella rubella]
Length=495

 Score =   341 bits (874),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 175/213 (82%), Gaps = 0/213 (0%)
 Frame = -3

Query  1004  AFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEK  825
             AFVYTAMVNY T ANFM  LP YPVE+MCKIIDGFP G+S + RAFAAASLYYNYSG++K
Sbjct  279   AFVYTAMVNYPTAANFMASLPGYPVEQMCKIIDGFPRGSSNLDRAFAAASLYYNYSGSKK  338

Query  824   CFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRP  645
             CF +E +SDDHGL+GW +QACTEMVMPM  S +SM PP    YE  +  C   YGVKPRP
Sbjct  339   CFEMEQQSDDHGLNGWQYQACTEMVMPMSCSNQSMLPPYENDYEAFKEQCMSRYGVKPRP  398

Query  644   HWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADF  465
             HWITT FGG  IE VLKRFGSNIIFSNG+QDPWSRGGVLKNIS SI+ALVT+KGAHHAD 
Sbjct  399   HWITTEFGGKSIETVLKRFGSNIIFSNGLQDPWSRGGVLKNISSSIIALVTKKGAHHADL  458

Query  464   RSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             R+ATK DP+WL +QR +EV I++ WI EYYRD+
Sbjct  459   RAATKGDPEWLKEQRRQEVAIIENWISEYYRDL  491



>gb|EEC81080.1| hypothetical protein OsI_23902 [Oryza sativa Indica Group]
Length=539

 Score =   342 bits (877),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 180/215 (84%), Gaps = 0/215 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W+AFVYTAMV+Y T ANF+  LPAYP+++MCKIIDGFPAGA  + +AFAAASLYYNY+G 
Sbjct  320   WTAFVYTAMVDYPTPANFLMNLPAYPIKEMCKIIDGFPAGADIVDKAFAAASLYYNYTGD  379

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             + CF +ED  D HGL GW WQACTEMVMPM +S ESMFPP +++YE     C + YGV+P
Sbjct  380   QTCFQLEDGEDPHGLSGWGWQACTEMVMPMTISNESMFPPFTFTYEGKSDDCFQSYGVRP  439

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT +GGNRI+ VLKRFGSNIIFSNGM+DPWSRGGVLKNIS SI+ALVTEKGAHH 
Sbjct  440   RPHWITTEYGGNRIDLVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIIALVTEKGAHHL  499

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             DFRSATK+DPDW+++QR +EV I+Q WI +Y  D+
Sbjct  500   DFRSATKDDPDWVVEQRRQEVKIIQGWIDQYNEDL  534



>ref|XP_006657192.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Oryza brachyantha]
Length=532

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 181/215 (84%), Gaps = 0/215 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W+AFVYTAMV+Y T ANF+  LPAYPV++MCKIIDGFPAGA  + +AFAAASLYYNY+G 
Sbjct  313   WTAFVYTAMVDYPTPANFLMNLPAYPVKEMCKIIDGFPAGADIVDKAFAAASLYYNYTGD  372

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             + CF +ED  D HGL GW WQACTEMVMPM +S ESMFPP +++YE     C + YGV+P
Sbjct  373   QTCFELEDGGDPHGLSGWGWQACTEMVMPMTISNESMFPPFTFTYEGKSDDCFQSYGVRP  432

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT +GGN+I+ VLKRFGSNIIFSNGM+DPWSRGGVLKNIS SI ALVTEKGAHH 
Sbjct  433   RPHWITTEYGGNKIDLVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIFALVTEKGAHHL  492

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             DFRSATK+DPDW+++QR +EV+I+Q WI +Y +D+
Sbjct  493   DFRSATKDDPDWVVEQRRQEVEIIQGWIDQYNKDI  527



>ref|XP_010419297.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=810

 Score =   348 bits (894),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/213 (74%), Positives = 177/213 (83%), Gaps = 0/213 (0%)
 Frame = -3

Query  1004  AFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEK  825
             AFVYTAMVNY T ANFM PLP YPVE+MCKI+DGFP G+S + RAFAAASLYYNYSG+EK
Sbjct  279   AFVYTAMVNYPTAANFMAPLPGYPVEQMCKIVDGFPRGSSNLDRAFAAASLYYNYSGSEK  338

Query  824   CFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRP  645
             CF +E ++DDHGL GW +QACTEMVMPM  S +SM PP    YE  E  C   YGVKPRP
Sbjct  339   CFEMEQQTDDHGLDGWQYQACTEMVMPMSCSNQSMLPPYENDYEAFEEQCMSRYGVKPRP  398

Query  644   HWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADF  465
             HWITT FGG RIE VLKRFGSNIIFSNG+QDPWSRGGVLKNIS SIVALVT+KGAHHAD 
Sbjct  399   HWITTEFGGMRIETVLKRFGSNIIFSNGLQDPWSRGGVLKNISSSIVALVTKKGAHHADL  458

Query  464   RSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             R+ATK DP+WL +QR +EV I++KWI EYYRD+
Sbjct  459   RAATKGDPEWLKEQRTQEVAIIEKWISEYYRDL  491


 Score =   341 bits (875),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/221 (71%), Positives = 177/221 (80%), Gaps = 8/221 (4%)
 Frame = -3

Query  1004  AFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEK  825
             AFVYTAMVNY T ANFM PLP YPVE+MCKI+DGFP G+S + RAFAAASLYYNYSG+EK
Sbjct  586   AFVYTAMVNYPTAANFMAPLPGYPVEQMCKIVDGFPRGSSNLDRAFAAASLYYNYSGSEK  645

Query  824   CFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRP  645
             CF +E ++DDHGL GW +QACTEMVMPM  S +SM PP    YE  E  C   YGVKPRP
Sbjct  646   CFEMEQQTDDHGLDGWQYQACTEMVMPMSCSNQSMLPPYENDYEAFEEQCMSRYGVKPRP  705

Query  644   HWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGG--------VLKNISDSIVALVTE  489
             HWITT FGG RIE VLKRFGSNIIFSNG+QDPWSRGG        VLKNIS SIVALVT+
Sbjct  706   HWITTEFGGMRIETVLKRFGSNIIFSNGLQDPWSRGGSVLTSNFRVLKNISSSIVALVTK  765

Query  488   KGAHHADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             KGAHHAD R+ATK DP+WL +QR +EV I++KWI EYYRD+
Sbjct  766   KGAHHADLRAATKGDPEWLKEQRTQEVAIIEKWISEYYRDL  806



>ref|XP_002438750.1| hypothetical protein SORBIDRAFT_10g025520 [Sorghum bicolor]
 gb|EER90117.1| hypothetical protein SORBIDRAFT_10g025520 [Sorghum bicolor]
Length=558

 Score =   341 bits (874),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 152/215 (71%), Positives = 182/215 (85%), Gaps = 0/215 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W+AF YTAMV+Y T ANF++ LPAYPV++MCKIIDGFP GA  + +AFAAASLYYNY+G 
Sbjct  339   WTAFSYTAMVDYPTPANFLENLPAYPVKEMCKIIDGFPTGADILEKAFAAASLYYNYTGD  398

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             + C  IED  D HGL GW WQACTEM+MPM VS ESMFPPSS+SY+E    C + +GV+P
Sbjct  399   QTCNKIEDGDDPHGLDGWQWQACTEMIMPMTVSNESMFPPSSFSYDERSDECFQSWGVRP  458

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT +GG +I++VLKRFGSNIIFSNGM+DPWSRGGVLKNIS SI+ALVTEKGAHH 
Sbjct  459   RPHWITTEYGGYKIDKVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIIALVTEKGAHHL  518

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             DFRS+TK DPDW+I+QR +EVDI+Q WI +Y++DM
Sbjct  519   DFRSSTKGDPDWVIEQRRQEVDIIQGWIDQYHQDM  553



>ref|XP_009390988.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Musa acuminata subsp. 
malaccensis]
Length=506

 Score =   338 bits (868),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 152/215 (71%), Positives = 176/215 (82%), Gaps = 0/215 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W+AFVYTAM++Y T ANF+ PLPAYPV++MC+IIDGFPAG   + + F+AASLYYNYS T
Sbjct  290   WTAFVYTAMIDYPTPANFLMPLPAYPVKEMCRIIDGFPAGEDILIKVFSAASLYYNYSST  349

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
               CF IE+ SD HGLHGWDWQACTEMVMPM  S ESMFPPS+Y Y+E    C   Y V+P
Sbjct  350   NSCFDIENGSDPHGLHGWDWQACTEMVMPMTSSNESMFPPSTYDYKEFGDQCMTKYEVRP  409

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT +GGN+IE VLKRFGSNIIFSNGM+DPWSRGGVLKNIS SI+ALVT  GAHH 
Sbjct  410   RPHWITTEYGGNKIELVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIIALVTPLGAHHL  469

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             DFR+ATK+DP WL +QRE EV I+Q WI +YY D+
Sbjct  470   DFRAATKDDPKWLKEQRETEVKIIQAWIDQYYEDL  504



>ref|NP_001058206.1| Os06g0647400 [Oryza sativa Japonica Group]
 dbj|BAD37324.1| putative prolylcarboxypeptidase isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAF20120.1| Os06g0647400 [Oryza sativa Japonica Group]
 dbj|BAG95990.1| unnamed protein product [Oryza sativa Japonica Group]
Length=539

 Score =   339 bits (870),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 150/215 (70%), Positives = 179/215 (83%), Gaps = 0/215 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W+AFVYTAMV+Y T ANF+  LPAYP+++MCKII GFPAGA  + +AFAAASLYYNY+G 
Sbjct  320   WTAFVYTAMVDYPTPANFLMNLPAYPIKEMCKIIHGFPAGADIVDKAFAAASLYYNYTGD  379

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             + CF +ED  D HGL GW WQACTEMVMPM +S ESMFPP +++YE     C + YGV+P
Sbjct  380   QTCFQLEDGEDPHGLSGWGWQACTEMVMPMTISNESMFPPFTFTYEGKSDDCFQSYGVRP  439

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT +GGNRI+ VLKRFGSNIIFSNGM+DPWSRGGVLKNIS SI+ALVTEKGAHH 
Sbjct  440   RPHWITTEYGGNRIDLVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIIALVTEKGAHHL  499

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             DFRSATK+DPDW+++QR +EV I+Q WI +Y  D+
Sbjct  500   DFRSATKDDPDWVVEQRRQEVKIIQGWIDQYNEDL  534



>ref|XP_003563318.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brachypodium distachyon]
Length=536

 Score =   337 bits (865),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 150/215 (70%), Positives = 181/215 (84%), Gaps = 0/215 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W+AFVYTAMV+Y T ANF+  LPAYPV++MCKIID FP GA  + +AF+AASLYYNY+G 
Sbjct  317   WTAFVYTAMVDYPTPANFLMNLPAYPVKEMCKIIDAFPPGADIVDKAFSAASLYYNYTGD  376

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             +KCF +E   D HGL GW WQACTEMVMPM VS +SMFPPSS+SYEE    C   YGV+P
Sbjct  377   QKCFDVEGGDDPHGLSGWGWQACTEMVMPMTVSNKSMFPPSSFSYEEKSEGCLASYGVRP  436

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             R HWITT +GG++I++VLKRFGSNIIFSNGM+DPWSRGGVLKNIS SI+ALVTEKGAHH 
Sbjct  437   RMHWITTEYGGHKIDKVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIIALVTEKGAHHL  496

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             DFR+ATK+DPDW+I+QR +EV+I+Q WI +Y +D+
Sbjct  497   DFRTATKDDPDWVIEQRRQEVEIIQGWIDQYNKDI  531



>ref|XP_006841179.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Amborella 
trichopoda]
 gb|ERN02854.1| hypothetical protein AMTR_s00086p00173170 [Amborella trichopoda]
Length=511

 Score =   335 bits (860),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 177/215 (82%), Gaps = 0/215 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             WSAFVYTAMVNY T ANFM+PLPAYP+ +MC+ IDG P+    + + FAAAS+YYNYS T
Sbjct  277   WSAFVYTAMVNYPTPANFMRPLPAYPINEMCRNIDGLPSETDTLVKVFAAASVYYNYSST  336

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             +KCF +E+ SD HGLHGW+WQACTEMVMPM  S++ MFPPS++SY+E E  C + YGVK 
Sbjct  337   KKCFDMENASDAHGLHGWNWQACTEMVMPMSCSQQGMFPPSTFSYKEIEDDCMKKYGVKA  396

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT FGG+ IE+VLKRFGSNIIFSNGM DPWSRGGVLKNIS SIVALVTEKGAHH 
Sbjct  397   RPHWITTEFGGHNIEEVLKRFGSNIIFSNGMVDPWSRGGVLKNISSSIVALVTEKGAHHL  456

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             DFR AT+ DP WL++QR +E++++Q WI EY  D 
Sbjct  457   DFRFATRQDPRWLVEQRRQEIELIQGWIHEYNMDF  491



>dbj|BAJ92142.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=535

 Score =   334 bits (857),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 180/214 (84%), Gaps = 0/214 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +AF YTAMV+Y T ANFM  LPAYPV++MCKIID FP GA  I +AFAAASLYYNY+G +
Sbjct  319   TAFTYTAMVDYPTPANFMMNLPAYPVKEMCKIIDSFPTGADIIDKAFAAASLYYNYTGDQ  378

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPR  648
             KCF +E + D HGL GWDWQACTEMVMPM+VS ESMFPPSS+SYE    +C   YGV+PR
Sbjct  379   KCFQVEGDDDPHGLDGWDWQACTEMVMPMIVSNESMFPPSSFSYENNSDACLADYGVRPR  438

Query  647   PHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHAD  468
              +WITT +GG++I++VLKRFGSNIIFSNGM+DPWSRGGVLKNIS SI+ALVTEKGAHH D
Sbjct  439   MNWITTEYGGHKIDKVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIIALVTEKGAHHLD  498

Query  467   FRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             FRS TK+DPDW+++QR +EV+I+  WI +Y +D+
Sbjct  499   FRSETKDDPDWVVEQRRQEVEIIHGWIDQYNKDI  532



>dbj|BAJ87416.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score =   334 bits (856),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 180/214 (84%), Gaps = 0/214 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +AF YTAMV+Y T ANFM  LPAYPV++MCKIID FP GA  I +AFAAASLYYNY+G +
Sbjct  308   TAFTYTAMVDYPTPANFMMNLPAYPVKEMCKIIDSFPTGADIIDKAFAAASLYYNYTGDQ  367

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPR  648
             KCF +E + D HGL GWDWQACTEMVMPM+VS ESMFPPSS+SYE    +C   YGV+PR
Sbjct  368   KCFQVEGDDDPHGLDGWDWQACTEMVMPMIVSNESMFPPSSFSYENNSDACLADYGVRPR  427

Query  647   PHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHAD  468
              +WITT +GG++I++VLKRFGSNIIFSNGM+DPWSRGGVLKNIS SI+ALVTEKGAHH D
Sbjct  428   MNWITTEYGGHKIDKVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIIALVTEKGAHHLD  487

Query  467   FRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             FRS TK+DPDW+++QR +EV+I+  WI +Y +D+
Sbjct  488   FRSETKDDPDWVVEQRRQEVEIIHGWIDQYNKDI  521



>gb|ACG41459.1| lysosomal Pro-X carboxypeptidase precursor [Zea mays]
Length=542

 Score =   333 bits (855),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 180/215 (84%), Gaps = 0/215 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W+AF YTAMV+Y T ANF++ LPAYPV++MCK ID FPAGA  + +AFAAASLYYNY+G 
Sbjct  323   WTAFTYTAMVDYPTPANFLENLPAYPVKEMCKTIDAFPAGADVLEKAFAAASLYYNYTGD  382

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             + C  IED  D HGL GW WQACTEM+MPM +S ESMFPPS++SY++    C + +GV+P
Sbjct  383   QACNKIEDGDDPHGLDGWQWQACTEMIMPMTISNESMFPPSAFSYDDRSDECFQSWGVRP  442

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT +GG +I++VLKRFGSNIIFSNGM+DPWSRGGVLKNIS SI+ALVTEKGAHH 
Sbjct  443   RPHWITTEYGGYKIDKVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIIALVTEKGAHHL  502

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D RS+TK DPDWLI+QR +EV+I+Q WI +Y++DM
Sbjct  503   DLRSSTKGDPDWLIEQRRQEVEIIQGWIDQYHQDM  537



>ref|NP_001142279.1| uncharacterized protein LOC100274448 precursor [Zea mays]
 gb|ACF78774.1| unknown [Zea mays]
 gb|ACF88076.1| unknown [Zea mays]
 gb|AFW76174.1| putative serine peptidase S28 family protein [Zea mays]
Length=542

 Score =   333 bits (854),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 180/215 (84%), Gaps = 0/215 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W+AF YTAMV+Y T ANF++ LPAYPV++MCK ID FPAGA  + +AFAAASLYYNY+G 
Sbjct  323   WTAFTYTAMVDYPTPANFLENLPAYPVKEMCKTIDAFPAGADVLEKAFAAASLYYNYTGD  382

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             + C  IED  D HGL GW WQACTEM+MPM +S ESMFPPS++SY++    C + +GV+P
Sbjct  383   QACNKIEDGDDPHGLDGWQWQACTEMIMPMTISNESMFPPSAFSYDDRSDECFQSWGVRP  442

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT +GG +I++VLKRFGSNIIFSNGM+DPWSRGGVLKNIS SI+ALVTEKGAHH 
Sbjct  443   RPHWITTEYGGYKIDKVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIIALVTEKGAHHL  502

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D RS+TK DPDWLI+QR +EV+I+Q WI +Y++DM
Sbjct  503   DLRSSTKGDPDWLIEQRRQEVEIIQGWIDQYHQDM  537



>ref|XP_006285773.1| hypothetical protein CARUB_v10007247mg [Capsella rubella]
 gb|EOA18671.1| hypothetical protein CARUB_v10007247mg [Capsella rubella]
Length=483

 Score =   331 bits (848),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 175/214 (82%), Gaps = 0/214 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SAFV TAMVNY T ANFM PLPAYPVE+MCKIIDGFP  AS + RAFAAASLYYNYSG+E
Sbjct  262   SAFVNTAMVNYPTPANFMAPLPAYPVEEMCKIIDGFPPEASNLDRAFAAASLYYNYSGSE  321

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPR  648
             KCF IE+E+D HG++GW WQACTEMVMP+  S +SMF P     +  +  C R YGVKPR
Sbjct  322   KCFDIENETDPHGVNGWYWQACTEMVMPISCSNQSMFQPFENDDKGDQEYCLREYGVKPR  381

Query  647   PHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHAD  468
             PHWITT FGG RIE VLKRFGSNIIFSNGMQDPWSR G+LKNIS SI+ALVT+KGAHHAD
Sbjct  382   PHWITTEFGGQRIEMVLKRFGSNIIFSNGMQDPWSREGILKNISSSIIALVTKKGAHHAD  441

Query  467   FRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
              R+ATK DP+WL +QR +EV  ++KWI EYY D+
Sbjct  442   LRAATKEDPEWLKEQRRQEVAEMEKWISEYYSDL  475



>ref|XP_004965729.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Setaria italica]
Length=544

 Score =   332 bits (851),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 179/214 (84%), Gaps = 0/214 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +AF YTAMV+Y T ANF++ LPAYPV++MCKIIDGFP     + +AFAAASLYYNY+G  
Sbjct  326   TAFTYTAMVDYPTPANFLENLPAYPVKEMCKIIDGFPTNTDILEKAFAAASLYYNYTGDL  385

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPR  648
              C  IEDE D HGL GW WQACTEM+MPM VS ESMFPPSS+SY++    C + +GV+PR
Sbjct  386   TCNPIEDEDDPHGLDGWQWQACTEMIMPMTVSNESMFPPSSFSYKDRSDGCFQSWGVRPR  445

Query  647   PHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHAD  468
             PHWITT +GG +I++VLKRFGSNIIFSNGM+DPWSRGGVLKNIS SI+ALVTEKGAHH D
Sbjct  446   PHWITTEYGGYKIDKVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIIALVTEKGAHHLD  505

Query  467   FRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             FRSATK DPDW+I+QR +EV+I+Q WI +Y++DM
Sbjct  506   FRSATKGDPDWVIEQRRQEVEIIQGWIDQYHQDM  539



>ref|XP_010525816.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Tarenaya hassleriana]
Length=502

 Score =   330 bits (847),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/214 (73%), Positives = 172/214 (80%), Gaps = 1/214 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPA-GASKISRAFAAASLYYNYSGT  831
             +AFVYTAMVNY TEANFM PLPAYPV+KMCKIIDG  A GAS + R FAAASLYYNYSG+
Sbjct  286   TAFVYTAMVNYPTEANFMAPLPAYPVDKMCKIIDGSAARGASDLERVFAAASLYYNYSGS  345

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             EKCF I  E D HGL GW WQACTEMVMPM  S E MF P    Y+  E +C   +GVKP
Sbjct  346   EKCFDIGHEEDAHGLSGWGWQACTEMVMPMSCSDECMFQPFEEDYKGFEENCVFRFGVKP  405

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT FGG RIE+VLKRFGSNIIFSNGMQDPWSRGGVLKNIS SI+ALVT++GAHHA
Sbjct  406   RPHWITTEFGGQRIEKVLKRFGSNIIFSNGMQDPWSRGGVLKNISSSIIALVTKQGAHHA  465

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             D R  T+ DPDWL +QR +EV I+QKWI EYY D
Sbjct  466   DLRRETEEDPDWLKEQRRQEVAIIQKWIDEYYSD  499



>gb|EMT03388.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=459

 Score =   328 bits (841),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 176/214 (82%), Gaps = 0/214 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +AF  TAMV+Y T ANFM  LPAYPV++MCKIID FPA A  I +AFAAASLYYNY+G +
Sbjct  243   AAFTTTAMVDYPTPANFMMNLPAYPVKEMCKIIDSFPAEADVIGKAFAAASLYYNYTGDQ  302

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPR  648
             KCF +E   D HGLHGW WQACTEMVMPM VS ESMFPPSS+S E+    C  +YGV+PR
Sbjct  303   KCFEVEGGDDPHGLHGWGWQACTEMVMPMTVSNESMFPPSSFSDEKRSEGCHLVYGVRPR  362

Query  647   PHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHAD  468
              HWITT +GG++I++VLKRFGSNIIFSNGM+DPWSRGGVLKNIS SI+ALVTEKGAHH D
Sbjct  363   MHWITTEYGGHKIDKVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIIALVTEKGAHHLD  422

Query  467   FRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
              RSATK+DPDWL++QR +EV I+  WI +Y +D+
Sbjct  423   LRSATKDDPDWLVEQRRQEVGIIHGWIDQYNKDI  456



>gb|KFK43799.1| hypothetical protein AALP_AA1G174100 [Arabis alpina]
Length=497

 Score =   329 bits (844),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 174/215 (81%), Gaps = 1/215 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGAS-KISRAFAAASLYYNYSGT  831
             SAFV TAMVNY T ANFM PLPAYPVE+MCKIIDGFP GAS  + RAFAAASLYYNYSG+
Sbjct  277   SAFVDTAMVNYPTAANFMAPLPAYPVEQMCKIIDGFPLGASSNLERAFAAASLYYNYSGS  336

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             E CF +E+++D HGL  W WQACTEMVMPM  S +SMFPP     E  +  C   YGVK 
Sbjct  337   EICFDMENQTDPHGLAFWGWQACTEMVMPMSSSNQSMFPPFENDDEGEQELCMLAYGVKS  396

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT FGG RIE VLKRFGSNIIFSNGMQDPWSRGGVLKNIS+SI+ALVT+KGAHH 
Sbjct  397   RPHWITTEFGGQRIEMVLKRFGSNIIFSNGMQDPWSRGGVLKNISNSIIALVTKKGAHHT  456

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D R+ATK DP+WL +QR +EV I++KWI EYY D+
Sbjct  457   DLRAATKYDPEWLKEQRRQEVAIIEKWINEYYSDL  491



>dbj|BAJ86079.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=526

 Score =   330 bits (845),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 177/214 (83%), Gaps = 0/214 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +AF YTAMV+Y T ANFM+ LPAYPV++MCKIID FPAGA  + +AFAAASLYYNY+G +
Sbjct  310   TAFTYTAMVDYPTPANFMQNLPAYPVKEMCKIIDSFPAGADVVEKAFAAASLYYNYTGDQ  369

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPR  648
             KCF +E   D HGL GW WQACTEMVMPM VS ESMFPPS +SYEE    C   Y V+PR
Sbjct  370   KCFEVEGGDDPHGLSGWGWQACTEMVMPMTVSNESMFPPSGFSYEEKSEGCIAAYDVRPR  429

Query  647   PHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHAD  468
              HWITT +GG++I++VLKRFGSNIIFSN M+DPWSRGGVLKNIS SI+ALVTEKGAHH D
Sbjct  430   MHWITTEYGGHKIDKVLKRFGSNIIFSNEMRDPWSRGGVLKNISSSIIALVTEKGAHHLD  489

Query  467   FRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             FRSATK+DPDW+++QR +EV+I+  WI +Y +D+
Sbjct  490   FRSATKDDPDWVVEQRRQEVEIIHGWIDQYNKDI  523



>ref|XP_010432914.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=499

 Score =   328 bits (842),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 176/214 (82%), Gaps = 0/214 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SAFV TAMVNY T A+FM PLPAYPVE+MCKIIDGFP  AS + RAFAAA+LYYNYS +E
Sbjct  279   SAFVNTAMVNYPTPASFMAPLPAYPVEEMCKIIDGFPLEASNLDRAFAAANLYYNYSSSE  338

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPR  648
              CF IE+E+D HGL+GW WQACTEMVMP+  S +SMF P   + +  + +C R YGVKPR
Sbjct  339   NCFDIENETDPHGLNGWYWQACTEMVMPISCSNQSMFQPFESNDKRDQEACLREYGVKPR  398

Query  647   PHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHAD  468
             PHWITT FGG RIE VLKRFGSNIIFSNGMQDPWSR GVLKNIS SI+ALVT+KGAHHAD
Sbjct  399   PHWITTEFGGQRIEMVLKRFGSNIIFSNGMQDPWSREGVLKNISSSIIALVTKKGAHHAD  458

Query  467   FRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
              R+ATK+DP+WL +QR +EV  ++KWI EYY D+
Sbjct  459   LRAATKDDPEWLKEQRRQEVAEMEKWISEYYSDL  492



>gb|EMT22762.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=269

 Score =   320 bits (821),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 146/222 (66%), Positives = 181/222 (82%), Gaps = 2/222 (1%)
 Frame = -3

Query  986  MVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIED  807
            M +Y T ANF++ LPAYPV++MCKIID FPAGA  + +AFAAASLYYNY+G +KCF +E 
Sbjct  1    MTDYPTPANFLQNLPAYPVKEMCKIIDSFPAGADVVEKAFAAASLYYNYTGDQKCFQVEG  60

Query  806  ESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTH  627
              D HGL GWDWQACTEMVMP  VS ESMFPP ++SYEE    C   YGV+PR HWITT 
Sbjct  61   GDDPHGLSGWDWQACTEMVMPTTVSNESMFPPFNFSYEERSERCLASYGVRPRMHWITTE  120

Query  626  FGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKN  447
            +GG++I++VLKRFGSNIIFSNGM+DPWSRGGVLKNIS SI+ALVTEKGAHH DFRSATK+
Sbjct  121  YGGHKIDKVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIIALVTEKGAHHLDFRSATKD  180

Query  446  DPDWLIQQREKEVDILQKWIGEYYRDMD--MNQN*TNSILIL  327
            DPDW+++QR +EV+I+  WI +Y +D+   + +N ++SI+ L
Sbjct  181  DPDWVVEQRRQEVEIIHGWIDQYNKDIAQMVLKNISSSIIAL  222



>gb|EMS54705.1| Lysosomal Pro-X carboxypeptidase [Triticum urartu]
Length=568

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 179/216 (83%), Gaps = 0/216 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W+AF YTAMV+Y T ANFM  LPAYPV++MCKIID FPAGA  + +AFAAASLYYNY+G 
Sbjct  349   WNAFTYTAMVDYPTPANFMMNLPAYPVKEMCKIIDSFPAGADVVDKAFAAASLYYNYTGD  408

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             +KCF +E + D H L GW WQACTEMVMPM VS ESMFPP S++YE     C   YGV+P
Sbjct  409   QKCFQVEGDDDPHDLDGWGWQACTEMVMPMTVSNESMFPPDSFNYENMSEDCLLYYGVRP  468

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             R HWITT +GG++I++VLK+FGSNIIFSNGM+DPWSRGGVLKNIS SI+ALVTEKGAHH 
Sbjct  469   RMHWITTEYGGHKIDKVLKKFGSNIIFSNGMRDPWSRGGVLKNISSSIIALVTEKGAHHL  528

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDMD  363
             D RSATK+DPDW+++QR +EV+I++ WI +Y +D++
Sbjct  529   DLRSATKDDPDWVVEQRRQEVEIIRGWIDQYNKDIE  564



>gb|EMT22761.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=539

 Score =   328 bits (840),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 176/215 (82%), Gaps = 0/215 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W+AF YTAMV+Y T ANFM  LPAYPV++MCKIID FP GA  + +AF AASLYYNY+G 
Sbjct  322   WTAFTYTAMVDYPTPANFMMNLPAYPVKEMCKIIDSFPVGADVVEKAFTAASLYYNYTGD  381

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             +KCF +E   D HGL GW WQACTEMVMPM VS ESMFPPS +SYEE    C   Y V+P
Sbjct  382   QKCFEMEGGDDPHGLSGWGWQACTEMVMPMTVSNESMFPPSGFSYEEKSEGCFASYEVRP  441

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             R +WITT +GG++I++VLKRFGSNIIFSNGM+DPWSRGGVLKNIS SI+ALVTEKGAHH 
Sbjct  442   RMNWITTEYGGHKIDKVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIIALVTEKGAHHL  501

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             DFRSATK+DPDW+++QR +EV+I+  WI +Y +D+
Sbjct  502   DFRSATKDDPDWVVEQRRQEVEIIHGWIDQYNKDI  536



>gb|EMT13135.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=515

 Score =   325 bits (832),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 178/225 (79%), Gaps = 10/225 (4%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W+AF YTAMV+Y T ANFM  LPAYPV++MCKIID FP GA  I +AFAAASLYYNYSG 
Sbjct  288   WNAFTYTAMVDYPTPANFMMNLPAYPVKEMCKIIDSFPVGADVIDKAFAAASLYYNYSGD  347

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             +KCF +E   D HGL GW WQACTEMVMPM+VS ESMFPP S+SYE     C   YGV+P
Sbjct  348   QKCFEMEGGDDPHGLDGWGWQACTEMVMPMIVSNESMFPPFSFSYENNSEGCLAYYGVRP  407

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTE------  489
             R HWITT +GG++I++VLKRFGSNIIFSNGM+DPWSRGGVLKNIS SI+ALVTE      
Sbjct  408   RIHWITTEYGGHKIDKVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIIALVTENGKHEF  467

Query  488   ----KGAHHADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
                 +GAHH DFRSATK+DP+W+++QR +EV+I+  WI +Y +D+
Sbjct  468   KENMQGAHHLDFRSATKDDPEWVVEQRRQEVEIIHGWIDQYNKDI  512



>ref|XP_002869352.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH45611.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=497

 Score =   324 bits (830),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 173/214 (81%), Gaps = 0/214 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +AF  TAMVNY T ANFM PLPAYPVE+MCKIID FP  AS + RAFAAASLYYNYSG+E
Sbjct  277   TAFTDTAMVNYPTPANFMAPLPAYPVEEMCKIIDWFPLEASNLDRAFAAASLYYNYSGSE  336

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPR  648
              CF IE+++D HGL+GW WQACTEMVMP+  S +SMF P  Y  +  +  C + YGVKPR
Sbjct  337   NCFDIENQTDPHGLNGWYWQACTEMVMPISCSNQSMFQPFEYDEKVDQEDCLKEYGVKPR  396

Query  647   PHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHAD  468
             PHWITT FGG+RIE VLKRFGSNIIFSNGMQDPWSR GVLKNIS SI+A VT+KGAHH D
Sbjct  397   PHWITTEFGGHRIEMVLKRFGSNIIFSNGMQDPWSREGVLKNISSSIIAFVTKKGAHHTD  456

Query  467   FRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
              R+ATK+DP+WL +QR +EV  ++KWI EYY D+
Sbjct  457   LRAATKDDPEWLKEQRRQEVAEIEKWISEYYSDL  490



>gb|EMT03389.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=536

 Score =   321 bits (822),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/229 (64%), Positives = 184/229 (80%), Gaps = 2/229 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +AF++TAM++Y T ANF+  LPAYPV++MCKIID FPAGA  I +AFAAAS+YYNY+G +
Sbjct  261   TAFIHTAMMDYPTPANFLMNLPAYPVKEMCKIIDSFPAGADVIDKAFAAASVYYNYTGNQ  320

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPR  648
             KCF +E   D HG  GW WQACTEMVMPM VS ESMF PSS+SYE+   +C   YGV+PR
Sbjct  321   KCFQVEGGDDPHGFKGWGWQACTEMVMPMTVSNESMFRPSSFSYEKMSENCLAGYGVRPR  380

Query  647   PHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHAD  468
              HWIT+ +GG++I++VLKRFGSNIIFSNGM+DPWS GGVLKNIS SI+ALVTEKGAHH D
Sbjct  381   MHWITSEYGGHKIDKVLKRFGSNIIFSNGMRDPWSGGGVLKNISSSIIALVTEKGAHHLD  440

Query  467   FRSATKNDPDWLIQQREKEVDILQKWIGEYYRDMDMN--QN*TNSILIL  327
              RSATK+DPDW+++QR +EV+I+  WI +Y +D      +N ++SI+ L
Sbjct  441   LRSATKDDPDWVVEQRRQEVEIIHGWIDQYNKDTAQGVLKNISSSIIAL  489



>emb|CDX68714.1| BnaC01g07390D [Brassica napus]
Length=390

 Score =   315 bits (808),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 147/220 (67%), Positives = 172/220 (78%), Gaps = 2/220 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +AF+ TAMVNY T ANFM PLPAYPVE+MCKI+D  P  AS + RAFAAASLYY+YSG+E
Sbjct  168   TAFIETAMVNYPTPANFMAPLPAYPVEQMCKIMDELPLDASNLERAFAAASLYYSYSGSE  227

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERS-CQRMYGVKP  651
              CF +E+ +D HGL+GW WQACTEMVMPM  S  +MF P     E+  +  C R YGVKP
Sbjct  228   SCFDMENHTDSHGLNGWGWQACTEMVMPMSCSNHTMFRPFESDDEKANQEYCLREYGVKP  287

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEK-GAHH  474
             RPHWIT  FGG RIE VLKRFGSNIIFSNG+QDPWS GGVLKNIS SI+ALVT K GAHH
Sbjct  288   RPHWITAEFGGQRIEMVLKRFGSNIIFSNGLQDPWSGGGVLKNISSSIIALVTRKAGAHH  347

Query  473   ADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDMDMNQ  354
              D R+ATK+DP+WL QQR +EV I++KWI EYY D++  +
Sbjct  348   TDLRAATKDDPEWLKQQRRQEVAIIEKWISEYYNDLEQEE  387



>ref|XP_009127344.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Brassica rapa]
Length=504

 Score =   316 bits (810),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 172/219 (79%), Gaps = 1/219 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +AF+ TAMVNY T ANFM PLPAYPV +MCKI+D  P  AS + RAFAAASLYYNYSG+ 
Sbjct  283   TAFIETAMVNYPTPANFMAPLPAYPVGQMCKIMDELPLEASNLERAFAAASLYYNYSGSV  342

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERS-CQRMYGVKP  651
              CF +E+ +D HGL+GW WQACTEMVMPM  S ++MF P     E+  +  C R YGVKP
Sbjct  343   TCFDMENHTDSHGLNGWGWQACTEMVMPMSCSNQTMFRPFESDDEKANQEYCLREYGVKP  402

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP+WITT FGG RIE VLKRFGSNIIFSNG+QDPWS GGVLKNIS SI+ALVT KGAHH 
Sbjct  403   RPNWITTEFGGQRIEMVLKRFGSNIIFSNGLQDPWSGGGVLKNISSSIIALVTRKGAHHT  462

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDMDMNQ  354
             D R+ATK+DP+WL QQR +EV I++KWI EYY D++  +
Sbjct  463   DLRAATKDDPEWLKQQRRQEVAIIEKWISEYYNDLEQEE  501



>ref|XP_008661011.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Zea mays]
Length=532

 Score =   306 bits (783),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 174/216 (81%), Gaps = 2/216 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +AFV  AM++Y T A+F++ LPAYPV++MCKI+DGFPA A  + + FAAASLYYNY+G +
Sbjct  313   TAFVSIAMMDYPTPASFLENLPAYPVKEMCKIVDGFPADADILEKVFAAASLYYNYTGDQ  372

Query  827   KCFHIEDESDDH--GLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVK  654
              C  IEDE +     L+ W WQACTE++MPM  + +SMFPP ++SYE+    C + +GV+
Sbjct  373   TCNQIEDEGNPRCLNLNYWGWQACTELMMPMSSANDSMFPPHTFSYEDKANYCLQTFGVR  432

Query  653   PRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHH  474
             PRPHWITT +GG RI++VLKRFGSNIIFSNGM+DPWSRGGVLKNIS SIVALVTEKGAHH
Sbjct  433   PRPHWITTEYGGYRIDEVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIVALVTEKGAHH  492

Query  473   ADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
              D RSATK+DPDW+ +QR +EV+I+  WI +YYRDM
Sbjct  493   LDLRSATKDDPDWVTEQRRQEVEIIHGWIDQYYRDM  528



>ref|XP_002438753.1| hypothetical protein SORBIDRAFT_10g025550 [Sorghum bicolor]
 gb|EER90120.1| hypothetical protein SORBIDRAFT_10g025550 [Sorghum bicolor]
Length=569

 Score =   303 bits (776),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 180/217 (83%), Gaps = 3/217 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +AFVYTAMV+Y T ANF+K LPAYPV++MCKIIDGFPA A  + + FAAASLYYN++G +
Sbjct  349   TAFVYTAMVDYPTPANFLKNLPAYPVKEMCKIIDGFPANADILEKVFAAASLYYNFTGDQ  408

Query  827   KCFHIE---DESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGV  657
              C  IE   D S   GL GW WQACTEM+MPM  S ESMFPP ++SYE+T  +C ++YGV
Sbjct  409   TCNQIEYDDDSSSSLGLSGWGWQACTEMIMPMSDSNESMFPPDTFSYEDTSNTCFQLYGV  468

Query  656   KPRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAH  477
             +PRPHWITT +GG +I++VLKRFGSNIIFSNG++DPWSRGGVLK+IS SIVALVTEKGAH
Sbjct  469   RPRPHWITTEYGGYKIDKVLKRFGSNIIFSNGLRDPWSRGGVLKDISSSIVALVTEKGAH  528

Query  476   HADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             H D RSATK+DPDW+I+QR +EV+I+  WI +Y++DM
Sbjct  529   HLDLRSATKDDPDWVIEQRRQEVEIIHGWIDQYHQDM  565



>gb|KDO59435.1| hypothetical protein CISIN_1g044064mg [Citrus sinensis]
Length=338

 Score =   291 bits (746),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 148/186 (80%), Gaps = 0/186 (0%)
 Frame = -3

Query  941  AYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDESDDHGLHGWDWQAC  762
            +Y    MCKIIDG P G SK+S+ FA ASLYYNYS TEKCF IED +D HGL GW WQ C
Sbjct  153  SYGGRLMCKIIDGLPPGVSKLSQVFAGASLYYNYSQTEKCFMIEDAADPHGLDGWRWQTC  212

Query  761  TEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHFGGNRIEQVLKRFGS  582
            TEMVMPM  S  SMFPPS Y Y++    C   YGV+PR HWITT FGG RIE VLKRFGS
Sbjct  213  TEMVMPMTCSNNSMFPPSGYDYKDFAEQCMMTYGVRPRIHWITTEFGGKRIELVLKRFGS  272

Query  581  NIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKNDPDWLIQQREKEVDI  402
            NIIFSNGMQDPWSRGGVLKNIS SI+ALVT+KGAHH DFRS TK+DPDWL++ R +EV+I
Sbjct  273  NIIFSNGMQDPWSRGGVLKNISASIIALVTKKGAHHVDFRSKTKDDPDWLVELRRQEVEI  332

Query  401  LQKWIG  384
            +QKW+G
Sbjct  333  IQKWVG  338



>ref|XP_008659849.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Zea mays]
Length=533

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/218 (65%), Positives = 171/218 (78%), Gaps = 4/218 (2%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +AF YTAMV+Y T ANF+  LPAYPV++MCKIIDGFPAGA  + + FAAA+LYYNY+G +
Sbjct  312   TAFTYTAMVDYPTPANFLMDLPAYPVKEMCKIIDGFPAGADILEKVFAAANLYYNYTGDQ  371

Query  827   KCFHIEDESDDHGLHGWDW----QACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYG  660
              C  IE +SDD            QACTEM+MPM  S  SMFPPSS+SYE+T  +C +  G
Sbjct  372   ACNQIESDSDDSSSSLGLSGWGWQACTEMIMPMSTSNASMFPPSSFSYEDTSNACFQSTG  431

Query  659   VKPRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGA  480
             V+PRPHWITT +GG RI++VLKRFGSNIIFSNGM+DPWSRGGVLKNIS SIVALVTEKGA
Sbjct  432   VRPRPHWITTEYGGYRIDKVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIVALVTEKGA  491

Query  479   HHADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             HH D R AT  DPDW+ +QR +EV+I++ WI +Y+RDM
Sbjct  492   HHLDLRFATDEDPDWVTEQRRQEVEIIEGWIDQYHRDM  529



>gb|AFW87518.1| putative serine peptidase S28 family protein [Zea mays]
Length=1052

 Score =   306 bits (785),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 174/216 (81%), Gaps = 2/216 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +AFV  AM++Y T A+F++ LPAYPV++MCKI+DGFPA A  + + FAAASLYYNY+G +
Sbjct  340   TAFVSIAMMDYPTPASFLENLPAYPVKEMCKIVDGFPADADILEKVFAAASLYYNYTGDQ  399

Query  827   KCFHIEDESDDH--GLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVK  654
              C  IEDE +     L+ W WQACTE++MPM  + +SMFPP ++SYE+    C + +GV+
Sbjct  400   TCNQIEDEGNPRCLNLNYWGWQACTELMMPMSSANDSMFPPHTFSYEDKANYCLQTFGVR  459

Query  653   PRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHH  474
             PRPHWITT +GG RI++VLKRFGSNIIFSNGM+DPWSRGGVLKNIS SIVALVTEKGAHH
Sbjct  460   PRPHWITTEYGGYRIDEVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIVALVTEKGAHH  519

Query  473   ADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
              D RSATK+DPDW+ +QR +EV+I+  WI +YYRDM
Sbjct  520   LDLRSATKDDPDWVTEQRRQEVEIIHGWIDQYYRDM  555



>ref|XP_002438751.1| hypothetical protein SORBIDRAFT_10g025530 [Sorghum bicolor]
 gb|EER90118.1| hypothetical protein SORBIDRAFT_10g025530 [Sorghum bicolor]
Length=192

 Score =   272 bits (695),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 150/187 (80%), Gaps = 2/187 (1%)
 Frame = -3

Query  923  MCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDESDDHGLHG--WDWQACTEMV  750
            MCKIIDGFPA A  + + FAAASL+YNY+G + C HIED+     L    W WQACTEM+
Sbjct  1    MCKIIDGFPANADILEKVFAAASLFYNYTGDQTCNHIEDKDSPRSLDLSYWRWQACTEMI  60

Query  749  MPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHFGGNRIEQVLKRFGSNIIF  570
            MPM  S ESMFPPS++SYE+    C R +GV+PRPHWITT +GG +I++VLKRFGSNIIF
Sbjct  61   MPMSSSNESMFPPSTFSYEDRFNYCFRFFGVRPRPHWITTEYGGYKIDKVLKRFGSNIIF  120

Query  569  SNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKNDPDWLIQQREKEVDILQKW  390
            SNGM+DPWS GGVLKNIS SIVALVTEKGAHH D R ATK+DPDW+I+QR +EV+I+Q W
Sbjct  121  SNGMRDPWSGGGVLKNISSSIVALVTEKGAHHLDLRGATKDDPDWVIEQRRQEVEIIQGW  180

Query  389  IGEYYRD  369
            I +YY+D
Sbjct  181  IDQYYQD  187



>ref|XP_010419296.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=463

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 141/178 (79%), Gaps = 0/178 (0%)
 Frame = -3

Query  1004  AFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEK  825
             AFVYTAMVNY T ANFM PLP YPVE+MCKI+DGFP G+S + RAFAAASLYYNYSG+EK
Sbjct  286   AFVYTAMVNYPTAANFMAPLPGYPVEQMCKIVDGFPRGSSNLDRAFAAASLYYNYSGSEK  345

Query  824   CFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRP  645
             CF +E ++DDHGL GW +QACTEMVMPM  S +SM PP    YE  E  C   YGVKPRP
Sbjct  346   CFEMEQQTDDHGLDGWQYQACTEMVMPMSCSNQSMLPPYENDYEAFEEQCMSRYGVKPRP  405

Query  644   HWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             HWITT FGG RIE VLKRFGSNIIFSNG+QDPWSRGGVLKNIS SI +    +  HHA
Sbjct  406   HWITTEFGGMRIETVLKRFGSNIIFSNGLQDPWSRGGVLKNISSSIXSFCCVQLLHHA  463



>gb|AAM15096.1| putative prolylcarboxypeptidase [Arabidopsis thaliana]
Length=476

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 156/219 (71%), Gaps = 22/219 (10%)
 Frame = -3

Query  1004  AFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEK  825
             AFVYTAMVNY T ANFM PLP YPVE+MCKIIDGFP G+S + RAFAAASLYYNYSG+EK
Sbjct  278   AFVYTAMVNYPTAANFMAPLPGYPVEQMCKIIDGFPRGSSNLDRAFAAASLYYNYSGSEK  337

Query  824   CFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRP  645
             CF +E ++DDHGL GW +QACTEMVMPM  S +SM PP     E  +  C   YGVKPRP
Sbjct  338   CFEMEQQTDDHGLDGWQYQACTEMVMPMSCSNQSMLPPYENDSEAFQEQCMTRYGVKPRP  397

Query  644   HWITTHFGG--NRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             HWITT FGG  +   Q+ +                    VLKNIS SIVALVT+KGAHHA
Sbjct  398   HWITTEFGGMMDYFHQIFR--------------------VLKNISSSIVALVTKKGAHHA  437

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDMDMNQ  354
             D R+ATK+DP+WL +QR +EV I++KWI EYYRD+   Q
Sbjct  438   DLRAATKDDPEWLKEQRRQEVAIIEKWISEYYRDLREEQ  476



>gb|AFW87519.1| putative serine peptidase S28 family protein [Zea mays]
Length=552

 Score =   281 bits (720),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 142/237 (60%), Positives = 171/237 (72%), Gaps = 23/237 (10%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVE---KMCKIIDGFPAGASKISRAFAAASLYYNYS  837
             +AF YTAMV+Y T ANF+  LPAYPV+   +MCKIIDGFPAGA  + + FAAA+LYYNY+
Sbjct  312   TAFTYTAMVDYPTPANFLMDLPAYPVKEPIQMCKIIDGFPAGADILEKVFAAANLYYNYT  371

Query  836   GTEKCFHIEDESDDHGLHGWDW----QACTEMVMPMVVSKESMFPPSSYSYEETERSCQR  669
             G + C  IE +SDD            QACTEM+MPM  S  SMFPPSS+SYE+T  +C +
Sbjct  372   GDQACNQIESDSDDSSSSLGLSGWGWQACTEMIMPMSTSNASMFPPSSFSYEDTSNACFQ  431

Query  668   MYGVKPRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTE  489
               GV+PRPHWITT +GG RI++VLKRFGSNIIFSNGM+DPWSRGGVLKNIS SIVALVTE
Sbjct  432   STGVRPRPHWITTEYGGYRIDKVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIVALVTE  491

Query  488   KG----------------AHHADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             KG                AHH D R AT  DPDW+ +QR +EV+I++ WI +Y+RDM
Sbjct  492   KGEHGNLRRKKKKKKKKWAHHLDLRFATDEDPDWVTEQRRQEVEIIEGWIDQYHRDM  548



>gb|AIA26578.1| serine protease [Cicer arietinum]
Length=379

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 160/213 (75%), Gaps = 3/213 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMVNY   + FM PLP YP++++C+ IDG P G S + R +   ++YYNY+G  
Sbjct  161   SAYSYLAMVNYPYPSEFMMPLPGYPIKEVCRRIDGGPDGTSILERIYEGVNVYYNYTGEA  220

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKES-MFPPSSYSYEETERSCQRMYGVKP  651
             KCF ++D  D HGL GW+WQACTEMVMPM  S+ES MFPP  ++Y   E  C + +GVKP
Sbjct  221   KCFELDD--DPHGLDGWNWQACTEMVMPMSSSQESSMFPPYEFNYLSFEEECFKNFGVKP  278

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+ I   LK+FGSNIIFSNG+ DPWS G VL+NIS+SIV+LVT++GAHH 
Sbjct  279   RPKWITTEFGGHNIHAALKKFGSNIIFSNGLLDPWSGGSVLQNISESIVSLVTQEGAHHL  338

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYR  372
             D R++T+NDPDWLI+QR  E+ +++ WI EYY+
Sbjct  339   DLRASTENDPDWLIEQRATEIKLIEGWINEYYQ  371



>ref|XP_006341228.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=493

 Score =   275 bits (704),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 163/217 (75%), Gaps = 1/217 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             ++AFVYTAM +Y T +NF+ PLPAYPV++MCK ID   +G     + + AA++YYNY+G 
Sbjct  274   YTAFVYTAMTDYPTPSNFLNPLPAYPVKQMCKAIDDPKSGKDTFEKIYGAANIYYNYTGN  333

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPM-VVSKESMFPPSSYSYEETERSCQRMYGVK  654
               CF++ D SD HGL GW WQACTEMVMP    +KES+FPPS + Y E  + C+  +GV+
Sbjct  334   ATCFNLNDHSDPHGLAGWTWQACTEMVMPTDGNNKESIFPPSKWDYNERAQFCKSNFGVE  393

Query  653   PRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHH  474
             PRP+W+TT FGG  IE+VLKRFGSNIIF NG++DPWS  GVLK+IS SIVA+V ++GAHH
Sbjct  394   PRPNWVTTEFGGYNIERVLKRFGSNIIFFNGLRDPWSGAGVLKDISKSIVAIVAKEGAHH  453

Query  473   ADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDMD  363
              D R ++K DP WL Q RE+EV+I+  W+ +YY+ ++
Sbjct  454   VDLRWSSKEDPKWLKQVREREVNIISNWLSQYYQSLN  490



>ref|XP_003549991.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
 gb|KHN01721.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=513

 Score =   275 bits (703),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 161/213 (76%), Gaps = 3/213 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +A+ Y AMVNY   A FM  LP +P+ ++C+ IDG PAG S + R +   ++YYNY+G  
Sbjct  295   AAYSYLAMVNYPYPAEFMMTLPEHPIREVCRRIDGGPAGTSILERIYEGVNVYYNYTGEA  354

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKES-MFPPSSYSYEETERSCQRMYGVKP  651
             KCF ++D  D HG+ GW+WQACTEMVMPM  S+ES MFPP  Y+Y   +  C + +GVKP
Sbjct  355   KCFELDD--DPHGMSGWEWQACTEMVMPMSSSQESSMFPPYEYNYTSIQAECLKKFGVKP  412

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+ I   LK+FGSNIIFSNG+ DPWS GGVL+NIS+S+V+LVTE+GAHH 
Sbjct  413   RPRWITTEFGGHDIHATLKKFGSNIIFSNGLLDPWSGGGVLQNISESVVSLVTEEGAHHI  472

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYR  372
             D RS+TKNDPDWL++QRE E+ +++ WI +Y++
Sbjct  473   DLRSSTKNDPDWLVEQRETEIKLIEGWISDYHQ  505



>gb|ABR17702.1| unknown [Picea sitchensis]
Length=509

 Score =   275 bits (702),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 162/214 (76%), Gaps = 3/214 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+   AMV+Y   A+F+ PLPAYP++++CK+ID F  G   + R FA  S+YYNY+G E
Sbjct  290   SAYSNLAMVDYPYPASFLMPLPAYPIKEVCKVIDSFSNGTDVLDRIFAGVSVYYNYTGEE  349

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKES-MFPPSSYSYEETERSCQRMYGVKP  651
             KCF + D  D HG +GW+WQACTEMVMPM  + ES +FP  ++  E   ++C  M+GV+P
Sbjct  350   KCFDVND--DPHGENGWNWQACTEMVMPMSSNPESSIFPQFTFDIESYTKNCLNMFGVEP  407

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT FGG  I++VLK +GSNIIFSNG+ DPWS GGVL+NIS+SIVALVTE GAHH 
Sbjct  408   RPHWITTEFGGQDIKRVLKNYGSNIIFSNGLLDPWSGGGVLQNISNSIVALVTELGAHHL  467

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             D R+AT+NDP WL++QR  E+ I+ KW+ EYY+D
Sbjct  468   DLRAATENDPLWLVEQRNAEMKIINKWMNEYYQD  501



>ref|XP_004246480.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum lycopersicum]
Length=494

 Score =   274 bits (700),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 121/217 (56%), Positives = 162/217 (75%), Gaps = 1/217 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             ++AFVYTAM +Y T +NF+ PLPAYPV++MCK ID    G     + + AA++YYNY+G 
Sbjct  275   YTAFVYTAMTDYPTPSNFLNPLPAYPVKQMCKAIDDPKGGKDTFEKIYEAANIYYNYTGN  334

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPM-VVSKESMFPPSSYSYEETERSCQRMYGVK  654
               CF + D SD HGL GW WQ+CTEMVMP    +KES+FPPS + Y E  + C+ ++GV+
Sbjct  335   ATCFDLNDHSDPHGLAGWTWQSCTEMVMPTDGNNKESIFPPSKWDYNERAQFCKSIFGVE  394

Query  653   PRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHH  474
             PRP+W+TT FGG  IE+VLKRFGSNIIF NG++DPWS  GVLK+IS SIVA+V ++GAHH
Sbjct  395   PRPNWVTTEFGGYNIERVLKRFGSNIIFFNGLRDPWSGAGVLKDISKSIVAIVAKEGAHH  454

Query  473   ADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDMD  363
              D R ++K DP WL Q RE+EV+I+  W+ +YY+ ++
Sbjct  455   VDLRWSSKEDPKWLQQVREREVNIISNWLSQYYQSLN  491



>ref|XP_010093782.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
 gb|EXB54615.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
Length=400

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 163/215 (76%), Gaps = 1/215 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +A++YT+M +Y T +NF+ PLPAYP+++MCK ID    G    ++ + AA++YYNY+GT 
Sbjct  181   TAYIYTSMTDYPTPSNFLNPLPAYPIKQMCKAIDNPTTGNDTFAKLYGAANIYYNYTGTA  240

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMV-VSKESMFPPSSYSYEETERSCQRMYGVKP  651
             KCF ++D+SD HGL GW WQACTEM++P    +KES+FP S + Y      C+ +YGV+P
Sbjct  241   KCFDLDDDSDPHGLSGWGWQACTEMILPTSGNTKESIFPASEWHYSGRVSYCKNVYGVEP  300

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             R +WITT FGG  IE+VLKRFGSNIIF NG++DPWS GGVLKNIS SIVA+V ++GAHH 
Sbjct  301   RRNWITTEFGGFGIERVLKRFGSNIIFFNGLRDPWSGGGVLKNISRSIVAIVAKEGAHHV  360

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D R +TK DP+WL + R++E++I+  WI +YY D+
Sbjct  361   DLRFSTKEDPEWLKEVRKQEINIIAGWISQYYHDL  395



>ref|XP_004509045.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cicer arietinum]
Length=508

 Score =   274 bits (700),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 160/213 (75%), Gaps = 3/213 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMVNY   + FM PLP YP++++C+ IDG P G S + R +   ++YYNY+G  
Sbjct  290   SAYSYLAMVNYPYPSEFMMPLPGYPIKEVCRRIDGGPDGTSILERIYEGVNVYYNYTGEA  349

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKES-MFPPSSYSYEETERSCQRMYGVKP  651
             KCF ++D  D HGL GW+WQACTEMVMPM  S+ES MFPP  ++Y   E  C + +GVKP
Sbjct  350   KCFELDD--DPHGLDGWNWQACTEMVMPMSSSQESSMFPPYEFNYLSFEEECFKNFGVKP  407

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+ I   LK+FGSNIIFSNG+ DPWS G VL+NIS+SIV+LVT++GAHH 
Sbjct  408   RPKWITTEFGGHNIHAALKKFGSNIIFSNGLLDPWSGGSVLQNISESIVSLVTQEGAHHL  467

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYR  372
             D R++T+NDPDWLI+QR  E+ +++ WI EYY+
Sbjct  468   DLRASTENDPDWLIEQRATEIKLIEGWINEYYQ  500



>gb|EMS54706.1| Lysosomal Pro-X carboxypeptidase [Triticum urartu]
Length=632

 Score =   275 bits (703),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W+AF YTAMV+Y T ANFM  LPAYPV++MCKIID FPAGA  + +AFAAASLYYNY+G 
Sbjct  328   WTAFTYTAMVDYPTPANFMMNLPAYPVKEMCKIIDSFPAGADVVEKAFAAASLYYNYTGD  387

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             +KCF +E   D HGL GW WQACTEMVMPM VS ESMFPPS +SYEE    C   Y V+P
Sbjct  388   QKCFQVEGGDDPHGLSGWGWQACTEMVMPMTVSNESMFPPSGFSYEEKSEGCFASYEVRP  447

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             R +WITT +GG++I++VLKRFGSNIIFSNGM+DPWSRGGVLKNIS SI+ALVTEK  ++ 
Sbjct  448   RMNWITTEYGGHKIDKVLKRFGSNIIFSNGMRDPWSRGGVLKNISSSIIALVTEKAQYNK  507

Query  470   DF  465
             D 
Sbjct  508   DI  509


 Score =   182 bits (461),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -3

Query  725  SMFPPSSYSYEETERSCQRMYGVKPRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPW  546
            +MFPPS +SYEE    C   Y V+PR +WITT +GG++I++VLKRFGSNIIFSNGM+DPW
Sbjct  510  AMFPPSGFSYEEKSEGCFASYEVRPRMNWITTEYGGHKIDKVLKRFGSNIIFSNGMRDPW  569

Query  545  SRGGVLKNISDSIVALVTEKGAHHADFRSATKNDPDWLIQQREKEVDILQKWIGEYYR  372
            SRGGVLKNIS SI+ALVTEKGAHH DFRSATK+DPDW+++QR +EV+I+  WI +Y +
Sbjct  570  SRGGVLKNISSSIIALVTEKGAHHLDFRSATKDDPDWVVEQRRQEVEIIHGWIDQYNK  627



>ref|XP_011046918.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=504

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 165/217 (76%), Gaps = 1/217 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             ++A VYTAM +Y T +NF+ P+PAYPV++MCK ID    G +  ++ + AAS+YYNYSGT
Sbjct  285   YTALVYTAMTDYPTPSNFLSPMPAYPVKEMCKAIDDPKTGNNTFAKLYGAASVYYNYSGT  344

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMV-VSKESMFPPSSYSYEETERSCQRMYGVK  654
               CF+++D+SD HGL GW WQACTEM++P    +K+S+F  S ++Y++    C+  +GV+
Sbjct  345   ATCFNLDDDSDPHGLGGWSWQACTEMILPTSGNNKDSIFTASEWNYDDRATFCKAYFGVE  404

Query  653   PRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHH  474
             PRP+WITT FGG+ I++VLKRFGSNIIF NG++DPWS GGVL+NIS SIVA+V ++GAHH
Sbjct  405   PRPNWITTEFGGHDIKRVLKRFGSNIIFFNGLRDPWSGGGVLENISSSIVAIVAKQGAHH  464

Query  473   ADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDMD  363
              D R AT  DP WL   R++EV I+ KW+ +YY D+D
Sbjct  465   VDLRFATSEDPKWLQDVRKREVSIIAKWLSKYYDDLD  501



>gb|KJB54926.1| hypothetical protein B456_009G054400 [Gossypium raimondii]
Length=446

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W+AFVYTAMVNY TEANF+KPLPAYPV++MCKIID  P+GA++++RAFAAASLYYNYS T
Sbjct  284   WTAFVYTAMVNYPTEANFLKPLPAYPVQQMCKIIDKSPSGATRLTRAFAAASLYYNYSQT  343

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             E CF +E E D HGLHGW WQ CTEMVMPM  S ESMFPPS + Y++    C+  YGV P
Sbjct  344   ENCFEVEHEVDPHGLHGWHWQTCTEMVMPMTCSNESMFPPSGFDYKKFAEQCRMKYGVLP  403

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGG  534
             RPHWITT FGG RIE+VLKRFGSNIIFSNGMQDPWSRGG
Sbjct  404   RPHWITTEFGGERIEKVLKRFGSNIIFSNGMQDPWSRGG  442



>gb|KJB16584.1| hypothetical protein B456_002G237800 [Gossypium raimondii]
Length=315

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 157/215 (73%), Gaps = 1/215 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +AF YTAM +Y T +NF+ P+PAYPV++MCK ID   +G    ++ + AAS+YYNYSGT 
Sbjct  97    TAFAYTAMTDYPTPSNFLNPMPAYPVKQMCKAIDDPKSGNDTFAKLYGAASVYYNYSGTA  156

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVS-KESMFPPSSYSYEETERSCQRMYGVKP  651
              CF++    D HGL  W WQACTEM+MP   S KES+FP + ++Y     +C+  YGV P
Sbjct  157   TCFNLAYSPDPHGLDMWSWQACTEMIMPTSGSNKESIFPENQWNYSRRAAACKAFYGVHP  216

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP+WITT FGG+ I +VLKR+GSN+IF NG++DPWS GGVLKNIS +IVA+V E+GAHH 
Sbjct  217   RPNWITTEFGGHDIYRVLKRYGSNMIFFNGLRDPWSGGGVLKNISKTIVAIVAEQGAHHV  276

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D R ATK+DP WL   R+ E++I+  WI +YY D+
Sbjct  277   DLRFATKDDPKWLRDVRQMEINIISDWISQYYHDL  311



>ref|XP_009801420.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nicotiana sylvestris]
Length=508

 Score =   270 bits (689),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 158/213 (74%), Gaps = 1/213 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +AF YTAM +Y T +NF+ PLPAYPV++MCK ID    G     + + AA++YYNY+G  
Sbjct  289   TAFTYTAMTDYPTPSNFLNPLPAYPVKEMCKAIDDPKTGNDTFEKLYGAANIYYNYTGKA  348

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMV-VSKESMFPPSSYSYEETERSCQRMYGVKP  651
              C ++ D SD HGL GW WQACTEMVMP    +KES+FPPS + Y E  R C+ +  VKP
Sbjct  349   TCLNLNDNSDPHGLGGWTWQACTEMVMPTNGNNKESIFPPSEWDYNERVRFCKLILDVKP  408

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+ IE+VLKRFGSNIIF NG++DPWS GGVLK+IS SIVA++ ++GAHH 
Sbjct  409   RPDWITTEFGGHDIERVLKRFGSNIIFFNGLRDPWSGGGVLKDISKSIVAIIAKEGAHHV  468

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYR  372
             D R ++K DP+WL + R +E++I+ KWI +YY+
Sbjct  469   DLRWSSKEDPEWLREVRAREINIISKWISQYYQ  501



>ref|XP_002308456.2| hypothetical protein POPTR_0006s22440g [Populus trichocarpa]
 gb|EEE91979.2| hypothetical protein POPTR_0006s22440g [Populus trichocarpa]
Length=504

 Score =   269 bits (688),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 162/217 (75%), Gaps = 1/217 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             ++A VYTAM +Y T +NF+ P+PAYPV++MCK ID    G    ++ + AAS+YYNYSG 
Sbjct  285   YTALVYTAMTDYPTPSNFLNPMPAYPVKEMCKAIDDPKTGNKTFAKLYGAASVYYNYSGN  344

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMV-VSKESMFPPSSYSYEETERSCQRMYGVK  654
               CF+ +D+SD HGL GW WQACTEM++P    +K+S+FP S ++Y++    C+  +GV+
Sbjct  345   ATCFNHDDDSDPHGLGGWSWQACTEMILPTSGNNKDSIFPASEWNYDDRASFCKAYFGVE  404

Query  653   PRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHH  474
             PRP+WIT  FGG+ I++VLKRFGSNIIF NG++DPWS GGVL+NIS SIVA++ ++GAHH
Sbjct  405   PRPNWITAEFGGHDIKRVLKRFGSNIIFFNGLRDPWSGGGVLENISSSIVAIIAKQGAHH  464

Query  473   ADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDMD  363
              D R AT  DP WL   R++EV I+ KW+ EYY D+D
Sbjct  465   VDLRFATSEDPKWLQDVRKREVSIIAKWLSEYYDDLD  501



>ref|XP_010910623.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Elaeis guineensis]
Length=370

 Score =   265 bits (676),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 158/214 (74%), Gaps = 3/214 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   ++F+ PLPA P++++C  ID +P G   + R FA  S+YYNY+GT 
Sbjct  152   SAYSYLAMVDYPYPSDFLMPLPANPIKEVCTKIDSYPDGTDLLDRIFAGVSVYYNYTGTV  211

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF +ED  D HG+ GWDWQACTEMVMPM  S+E SMFP  ++SY   +  C + YGVKP
Sbjct  212   DCFDLED--DPHGMSGWDWQACTEMVMPMSSSQENSMFPAYNFSYAAYQDGCVQNYGVKP  269

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP W+TT FGG+ I+  L +FGSNIIFSNG+ DPWS G VL+NIS+SI+ALVTE GAHH 
Sbjct  270   RPRWVTTEFGGHDIKTALNKFGSNIIFSNGLLDPWSGGSVLQNISESIIALVTELGAHHI  329

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             D R +T  DPDWLI+QR+ E+ +++ WI ++Y++
Sbjct  330   DLRPSTDEDPDWLIEQRKSEISLIRGWIYDHYQE  363



>ref|XP_009624783.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nicotiana tomentosiformis]
Length=508

 Score =   268 bits (686),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/215 (57%), Positives = 156/215 (73%), Gaps = 1/215 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +AF YTAM +Y T +NF+ PLPAYPV++MCK ID    G     + + AA++YYNYSG  
Sbjct  289   TAFTYTAMTDYPTPSNFLNPLPAYPVKEMCKAIDDPKTGNDTFEKLYGAANMYYNYSGKA  348

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPM-VVSKESMFPPSSYSYEETERSCQRMYGVKP  651
              CF + D SD HGL GW WQACTEMVMP    +KES+FPPS + Y E  R CQ +  VKP
Sbjct  349   TCFDLNDNSDPHGLGGWTWQACTEMVMPTDGNNKESIFPPSEWDYNERVRFCQLILDVKP  408

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             R  WITT FGG  IE+VLKRFGSNIIF NG++DPWS GGVLK+IS SIVA++ ++GAHH 
Sbjct  409   RSDWITTEFGGYNIERVLKRFGSNIIFFNGLRDPWSGGGVLKDISKSIVAIIAKEGAHHV  468

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D R ++K DP+WL + R +EV+I+  WI +YY+ +
Sbjct  469   DLRWSSKEDPEWLREVRGREVNIISNWISQYYQTL  503



>ref|XP_011467971.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=509

 Score =   268 bits (685),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 160/218 (73%), Gaps = 1/218 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +A++YTAM +Y T +NF+ P+PAYPV++MCK ID    G    ++ F AA++YYNY+GT 
Sbjct  289   TAYIYTAMTDYPTPSNFLSPMPAYPVKQMCKAIDDPATGNDTFAKLFGAATVYYNYTGTA  348

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMV-VSKESMFPPSSYSYEETERSCQRMYGVKP  651
              CF   D SD H L GW WQACTEM+MP    ++ESMFPPS + Y+     C+  YGV+P
Sbjct  349   TCFDPNDNSDPHDLGGWQWQACTEMIMPTSGNNEESMFPPSEWRYQGRVSYCEGAYGVEP  408

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP+WITT FGG+ I++VL+R+GSNIIF NG++DPWS GGVL NIS+SIVA+V ++GAHH 
Sbjct  409   RPNWITTEFGGHDIKRVLRRYGSNIIFFNGLRDPWSGGGVLSNISESIVAIVAKEGAHHV  468

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDMDMN  357
             D R  T  DP+WL   R++E+ I+ KWI EYY D+ ++
Sbjct  469   DLRFKTSEDPEWLKDVRKQEIGIIAKWISEYYHDLALD  506



>ref|XP_007155790.1| hypothetical protein PHAVU_003G232100g [Phaseolus vulgaris]
 gb|ESW27784.1| hypothetical protein PHAVU_003G232100g [Phaseolus vulgaris]
Length=506

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/213 (55%), Positives = 159/213 (75%), Gaps = 3/213 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMVNY   ++F+  LP +P+ ++CK IDG PAG + + R +   ++YYNY+G E
Sbjct  288   SAYSYLAMVNYPYPSDFLMTLPGHPIREVCKKIDGVPAGTNILERIYEGVNVYYNYTGKE  347

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKES-MFPPSSYSYEETERSCQRMYGVKP  651
             KCF ++D  D HG+ GWDWQACTEMVMPM  +++S MFPP  Y+Y   +  C   YGVKP
Sbjct  348   KCFELDD--DPHGMSGWDWQACTEMVMPMSSNQDSSMFPPYEYNYTSFQEECLNDYGVKP  405

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+ I   LK+FGSNIIFSNG+ DPWS G VL+NIS+S+V+LVTE+GAHH 
Sbjct  406   RPKWITTEFGGHDIHATLKKFGSNIIFSNGLLDPWSGGSVLQNISESVVSLVTEEGAHHI  465

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYR  372
             D R +T+NDP WL++QRE E+ +++ WI +Y++
Sbjct  466   DLRPSTQNDPYWLVEQRETEIKLIEGWISDYHQ  498



>ref|XP_002530520.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
 gb|EEF31852.1| lysosomal pro-X carboxypeptidase, putative [Ricinus communis]
Length=508

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 159/215 (74%), Gaps = 1/215 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +A+VY+AM +Y T +NF+ PLPA+PV++MCK ID   AG    ++  AAAS+YYNYSGT 
Sbjct  289   TAWVYSAMTDYPTPSNFLNPLPAFPVKQMCKAIDDPTAGNDTFAKFHAAASVYYNYSGTA  348

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSK-ESMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D+SD HGL GWDWQACTEM++P   S  ES+FP S + Y +    C+  + + P
Sbjct  349   TCFDLDDDSDPHGLGGWDWQACTEMILPTGGSTAESIFPASEWDYNDRVTYCKLRFDIDP  408

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP+WITT FGG+ I+  LKRF SNIIF NG++DPWS GGVL++IS S+VALV EKGAHH 
Sbjct  409   RPNWITTEFGGHNIKMALKRFASNIIFFNGLRDPWSGGGVLEDISKSLVALVEEKGAHHV  468

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D R AT  DP WL + R+KEV I+ KW+ +YY+D+
Sbjct  469   DLRFATSEDPKWLQEVRQKEVKIIAKWLSDYYQDL  503



>ref|XP_004305645.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Fragaria vesca 
subsp. vesca]
Length=512

 Score =   267 bits (683),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 156/215 (73%), Gaps = 1/215 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SAF+YTAM +Y T +NFM P+PAYPV++MCK ID    G    ++ + A ++YYNYSGT 
Sbjct  294   SAFIYTAMTDYPTPSNFMTPVPAYPVKQMCKAIDNPATGNDTFAKLYGAVTVYYNYSGTT  353

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVS-KESMFPPSSYSYEETERSCQRMYGVKP  651
              CF  +D SD H L GWDWQACTEM+M    + KES+FPPS   Y++    C+  YGV+P
Sbjct  354   TCFDPDDNSDPHDLGGWDWQACTEMIMQTNGNDKESIFPPSESQYKDQVSYCKEAYGVEP  413

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP+WITT FGG+ I++VL+R+GSNIIF NG++DPWS GGVL NIS  IVA+V ++GAHH 
Sbjct  414   RPNWITTEFGGHDIKRVLRRYGSNIIFFNGLRDPWSGGGVLSNISKRIVAIVAKEGAHHV  473

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D R  T  DP+WL   R++EV I+ KWI EYY D+
Sbjct  474   DLRFKTNEDPEWLKDVRKQEVKIIAKWISEYYHDL  508



>ref|XP_006854747.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Amborella trichopoda]
 gb|ERN16214.1| hypothetical protein AMTR_s00030p00247420 [Amborella trichopoda]
Length=517

 Score =   267 bits (682),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 165/214 (77%), Gaps = 3/214 (1%)
 Frame = -3

Query  1004  AFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEK  825
             AF+YTAM +Y   ++F+ PLPA+P+E+MCK +D   AG  +    + AA+++YNY+G   
Sbjct  305   AFIYTAMTDYPVPSSFLAPLPAFPIEQMCKAVDD--AGDEQFKGIYEAANIFYNYTGDSM  362

Query  824   CFHIEDESDDHGLHGWDWQACTEMVMPMV-VSKESMFPPSSYSYEETERSCQRMYGVKPR  648
             CF++ D SD HGL+GW +QACTEM++     ++ES+FPP +Y+Y +T+  CQ+ YG+ PR
Sbjct  363   CFNLSDNSDRHGLNGWGFQACTEMLLATGGRTQESIFPPYTYNYTQTQEYCQQSYGINPR  422

Query  647   PHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHAD  468
             PHWITTHFGG+ I++VLKRFGSNIIF NG++DPWS GGVL+N+SDSIVALV ++GAHH D
Sbjct  423   PHWITTHFGGHDIKRVLKRFGSNIIFFNGLRDPWSGGGVLENLSDSIVALVAKEGAHHID  482

Query  467   FRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
              R +T+ DP WL + R++E+ IL  W+ +YY+D+
Sbjct  483   LRFSTEGDPMWLSEVRKREIHILSMWLEQYYKDI  516



>ref|XP_006604647.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
Length=508

 Score =   266 bits (681),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 161/218 (74%), Gaps = 1/218 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +A++YTAM +Y T +NF+ PLPAYPV+KMC+ ID    G +++++ +AAA++YYNY+G  
Sbjct  290   AAWIYTAMTDYPTPSNFLNPLPAYPVKKMCEAIDSSVTGNNRLAKLYAAANVYYNYTGKA  349

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVS-KESMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D SD H L GW WQACTEM+MP+  S KES+FP   +SYE     C   Y V+P
Sbjct  350   TCFDLDDNSDPHDLGGWQWQACTEMIMPVGGSNKESIFPEYEWSYEARASWCDFFYNVQP  409

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT FGG+ IE+VLKR  SNIIF NG++DPWS GGVLK IS +IVA+V +KGAHH 
Sbjct  410   RPHWITTEFGGHAIERVLKRSASNIIFFNGLRDPWSAGGVLKTISKTIVAIVAKKGAHHV  469

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDMDMN  357
             D R ++K DP WL   R++EV+I+  WI +Y++D+  N
Sbjct  470   DLRYSSKEDPQWLKDVRKQEVNIIASWISQYHQDLQSN  507



>gb|KJB16580.1| hypothetical protein B456_002G237800 [Gossypium raimondii]
Length=511

 Score =   265 bits (677),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 157/215 (73%), Gaps = 1/215 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +AF YTAM +Y T +NF+ P+PAYPV++MCK ID   +G    ++ + AAS+YYNYSGT 
Sbjct  293   TAFAYTAMTDYPTPSNFLNPMPAYPVKQMCKAIDDPKSGNDTFAKLYGAASVYYNYSGTA  352

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVS-KESMFPPSSYSYEETERSCQRMYGVKP  651
              CF++    D HGL  W WQACTEM+MP   S KES+FP + ++Y     +C+  YGV P
Sbjct  353   TCFNLAYSPDPHGLDMWSWQACTEMIMPTSGSNKESIFPENQWNYSRRAAACKAFYGVHP  412

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP+WITT FGG+ I +VLKR+GSN+IF NG++DPWS GGVLKNIS +IVA+V E+GAHH 
Sbjct  413   RPNWITTEFGGHDIYRVLKRYGSNMIFFNGLRDPWSGGGVLKNISKTIVAIVAEQGAHHV  472

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D R ATK+DP WL   R+ E++I+  WI +YY D+
Sbjct  473   DLRFATKDDPKWLRDVRQMEINIISDWISQYYHDL  507



>ref|XP_007027867.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY08369.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=508

 Score =   265 bits (677),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/215 (56%), Positives = 155/215 (72%), Gaps = 1/215 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +AFVYTAM +Y T +NF+ PLPAYPV++MCK ID    G    ++ + AA++YYN++GT 
Sbjct  290   TAFVYTAMTDYPTPSNFLNPLPAYPVKQMCKSIDDPTTGNDSFAKLYGAANVYYNHTGTT  349

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPM-VVSKESMFPPSSYSYEETERSCQRMYGVKP  651
              CF++    D HGL  W WQACTEM+MP    +++S+FP S +SY +    C+  YGV P
Sbjct  350   TCFNLAYSPDPHGLDMWSWQACTEMIMPTDGNNQDSIFPESQWSYSQRAAVCKGYYGVDP  409

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP+WITT FGG+ I + LKRFGSNIIF NG++DPWS GGVLKNIS +IVA+V E+GAHH 
Sbjct  410   RPNWITTEFGGHDISRALKRFGSNIIFYNGLRDPWSGGGVLKNISKTIVAIVAEQGAHHV  469

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D R AT  DP WL Q RE+EV I+  WI +YY D+
Sbjct  470   DLRFATSQDPKWLQQVREREVKIISNWISQYYHDL  504



>gb|KHN33177.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=509

 Score =   265 bits (676),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 160/218 (73%), Gaps = 1/218 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +A++YTAM +Y T +NF+ PLPAYPV+KMC+ ID    G +++++  AAAS+YYNY+G  
Sbjct  291   AAWIYTAMTDYPTPSNFLNPLPAYPVKKMCEAIDSSVTGNNRLAKLHAAASVYYNYTGKA  350

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVS-KESMFPPSSYSYEETERSCQRMYGVKP  651
             +CF ++D SD H L GW WQACTEM+MP+  S KES+FP   +SYE     C   Y V+P
Sbjct  351   RCFDLDDNSDPHDLGGWQWQACTEMIMPVGGSNKESIFPEYEWSYEARASWCDFFYNVQP  410

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT FGG+ IE+VLKR  SNIIF NG++DPWS GGVLK IS ++VA+V +KGAHH 
Sbjct  411   RPHWITTEFGGHAIERVLKRSASNIIFFNGLRDPWSGGGVLKTISKTLVAIVAKKGAHHV  470

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDMDMN  357
             D R ++K DP WL   R+ EV+I+  WI +Y++D+  N
Sbjct  471   DLRFSSKEDPQWLKDVRKLEVNIIASWISQYHQDLQSN  508



>gb|KJB16585.1| hypothetical protein B456_002G237800 [Gossypium raimondii]
Length=537

 Score =   265 bits (678),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 157/215 (73%), Gaps = 1/215 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +AF YTAM +Y T +NF+ P+PAYPV++MCK ID   +G    ++ + AAS+YYNYSGT 
Sbjct  319   TAFAYTAMTDYPTPSNFLNPMPAYPVKQMCKAIDDPKSGNDTFAKLYGAASVYYNYSGTA  378

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVS-KESMFPPSSYSYEETERSCQRMYGVKP  651
              CF++    D HGL  W WQACTEM+MP   S KES+FP + ++Y     +C+  YGV P
Sbjct  379   TCFNLAYSPDPHGLDMWSWQACTEMIMPTSGSNKESIFPENQWNYSRRAAACKAFYGVHP  438

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP+WITT FGG+ I +VLKR+GSN+IF NG++DPWS GGVLKNIS +IVA+V E+GAHH 
Sbjct  439   RPNWITTEFGGHDIYRVLKRYGSNMIFFNGLRDPWSGGGVLKNISKTIVAIVAEQGAHHV  498

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D R ATK+DP WL   R+ E++I+  WI +YY D+
Sbjct  499   DLRFATKDDPKWLRDVRQMEINIISDWISQYYHDL  533



>ref|XP_006577088.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Glycine 
max]
Length=509

 Score =   264 bits (674),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 160/218 (73%), Gaps = 1/218 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +A++YTAM +Y T +NF+ PLPAYPV+KMC+ ID    G +++++  AAAS+YYNY+G  
Sbjct  291   AAWIYTAMTDYPTPSNFLNPLPAYPVKKMCEAIDSSVTGNNRLAKLHAAASVYYNYTGKA  350

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVS-KESMFPPSSYSYEETERSCQRMYGVKP  651
             +CF ++D SD H L GW WQACTEM+MP+  S KES+FP   +SYE     C   Y V+P
Sbjct  351   RCFDLDDNSDPHDLGGWQWQACTEMIMPVGGSNKESIFPEYEWSYEARASWCDFFYNVQP  410

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT FGG+ +E+VLKR  SNIIF NG++DPWS GGVLK IS ++VA+V +KGAHH 
Sbjct  411   RPHWITTEFGGHAVERVLKRSASNIIFFNGLRDPWSGGGVLKTISKTLVAIVAKKGAHHV  470

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDMDMN  357
             D R ++K DP WL   R+ EV+I+  WI +Y++D+  N
Sbjct  471   DLRFSSKEDPQWLKDVRKLEVNIIASWISQYHQDLQSN  508



>ref|XP_010943424.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Elaeis guineensis]
Length=509

 Score =   264 bits (674),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 158/214 (74%), Gaps = 3/214 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   ++F+ PLPA P++++C  ID +P G   + R FA  S+YYNY+GT 
Sbjct  291   SAYSYLAMVDYPYPSDFLMPLPANPIKEVCTKIDSYPDGTDLLDRIFAGVSVYYNYTGTV  350

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF +ED  D HG+ GWDWQACTEMVMPM  S+E SMFP  ++SY   +  C + YGVKP
Sbjct  351   DCFDLED--DPHGMSGWDWQACTEMVMPMSSSQENSMFPAYNFSYAAYQDGCVQNYGVKP  408

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP W+TT FGG+ I+  L +FGSNIIFSNG+ DPWS G VL+NIS+SI+ALVTE GAHH 
Sbjct  409   RPRWVTTEFGGHDIKTALNKFGSNIIFSNGLLDPWSGGSVLQNISESIIALVTELGAHHI  468

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             D R +T  DPDWLI+QR+ E+ +++ WI ++Y++
Sbjct  469   DLRPSTDEDPDWLIEQRKSEISLIRGWIYDHYQE  502



>ref|XP_010246130.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=504

 Score =   263 bits (673),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 157/215 (73%), Gaps = 1/215 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +A +YTAM +Y T +NF++PLPAYPV++MCK ID    G    +R + A ++YYN +G  
Sbjct  289   TALIYTAMTDYPTPSNFLQPLPAYPVKQMCKAIDNPTVGNDTFARLYGAVNIYYNNTGNA  348

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSK-ESMFPPSSYSYEETERSCQRMYGVKP  651
              CF IED+SD HGL  W WQACTEM++P   +K +S+FP S + Y     +CQ  +G+ P
Sbjct  349   TCFDIEDDSDPHGLSEWTWQACTEMILPTDGNKNDSIFPASEWDYANRATNCQFAFGINP  408

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT +GG  I +VLKRFGSNIIF NG++DPWS GGVL++IS SI+A+V ++GAHH 
Sbjct  409   RPHWITTEYGGYDIRRVLKRFGSNIIFFNGLRDPWSGGGVLESISKSIIAIVAKEGAHHV  468

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D R +TK DP+WL   R++EV I++KW+ +YY D+
Sbjct  469   DLRFSTKEDPEWLRDVRKREVGIIRKWLSQYYNDL  503



>ref|XP_008798888.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Phoenix 
dactylifera]
Length=507

 Score =   263 bits (673),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 157/214 (73%), Gaps = 3/214 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   ++F+ PLPA P++++C+ ID +P G   + R FA  S+YYNY+GT 
Sbjct  289   SAYSYLAMVDYPYPSDFLMPLPANPIKEVCRKIDSYPDGTDLLDRIFAGVSIYYNYTGTV  348

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF +ED  D HG+ GW WQACTEMVMPM  S+E SMFP  ++SY   +  C   YGV+P
Sbjct  349   DCFDLED--DPHGMSGWGWQACTEMVMPMSSSQENSMFPTYNFSYAAYQDECVHNYGVRP  406

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP W+TT FGG+ I+  LK FGSNIIFSNG+ DPWS G VL+NIS+SI+ALVTE GAHH 
Sbjct  407   RPRWVTTEFGGHDIKTALKEFGSNIIFSNGLLDPWSGGSVLQNISESIIALVTELGAHHI  466

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             D R +T  DPDWLI+QR+ E+ +++ WI +YY++
Sbjct  467   DLRPSTNEDPDWLIEQRKSEISLIRGWIYDYYQE  500



>ref|XP_009406760.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=498

 Score =   263 bits (672),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 159/214 (74%), Gaps = 3/214 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   ++FM PLPA P++++C+ ID +  G + + R FA  S+YYNY+G  
Sbjct  280   SAYSYLAMVDYPYPSDFMMPLPANPIKEVCRKIDNYLDGTTVLERIFAGVSIYYNYTGNV  339

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF +ED  D HGL GW+WQACTEMVMPM  S+E SMFP   + Y   +  C + YGV+P
Sbjct  340   DCFDLED--DPHGLSGWNWQACTEMVMPMSSSQENSMFPAYDFDYAAYQDQCLQDYGVRP  397

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+ I+  LK+FGSNIIFSNG+ DPWS G VL+N+S+SI+ALVTE GAHH 
Sbjct  398   RPRWITTEFGGHDIKTALKKFGSNIIFSNGLLDPWSGGSVLQNVSESIIALVTELGAHHI  457

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             D R++TK DPDWL++QR  E+++++ W+ +YY++
Sbjct  458   DLRASTKEDPDWLVEQRNTEINLIKGWLYDYYQE  491



>ref|XP_009406759.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=500

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 159/214 (74%), Gaps = 3/214 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   ++FM PLPA P++++C+ ID +  G + + R FA  S+YYNY+G  
Sbjct  282   SAYSYLAMVDYPYPSDFMMPLPANPIKEVCRKIDNYLDGTTVLERIFAGVSIYYNYTGNV  341

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF +ED  D HGL GW+WQACTEMVMPM  S+E SMFP   + Y   +  C + YGV+P
Sbjct  342   DCFDLED--DPHGLSGWNWQACTEMVMPMSSSQENSMFPAYDFDYAAYQDQCLQDYGVRP  399

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+ I+  LK+FGSNIIFSNG+ DPWS G VL+N+S+SI+ALVTE GAHH 
Sbjct  400   RPRWITTEFGGHDIKTALKKFGSNIIFSNGLLDPWSGGSVLQNVSESIIALVTELGAHHI  459

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             D R++TK DPDWL++QR  E+++++ W+ +YY++
Sbjct  460   DLRASTKEDPDWLVEQRNTEINLIKGWLYDYYQE  493



>ref|NP_001044360.1| Os01g0767100 [Oryza sativa Japonica Group]
 dbj|BAD53352.1| putative prolylcarboxypeptidase, isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAD53324.1| putative prolylcarboxypeptidase, isoform 1 [Oryza sativa Japonica 
Group]
 dbj|BAF06274.1| Os01g0767100 [Oryza sativa Japonica Group]
Length=517

 Score =   263 bits (671),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 152/211 (72%), Gaps = 2/211 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   A+FM PLP  P++++C  ID  P G S + R +A  ++YYNY+GT 
Sbjct  287   SAYSYLAMVDYPMPADFMMPLPGNPIKELCTKIDNQPDGTSILERIYAGVNVYYNYTGTV  346

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPR  648
              CF + D  D HG+ GWDWQACTEMVMPM  S++SMFP   ++Y   E+ C   +GV+PR
Sbjct  347   DCFDLND--DPHGMDGWDWQACTEMVMPMSYSEDSMFPADKFNYTSYEKDCINSFGVEPR  404

Query  647   PHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHAD  468
             P WITT FGG+ I  VL+RFGSNIIF NG+ DPWS GGVLKNIS+S+VA++   GAHH D
Sbjct  405   PQWITTEFGGHNISLVLERFGSNIIFFNGLLDPWSGGGVLKNISESVVAIIAPLGAHHID  464

Query  467   FRSATKNDPDWLIQQREKEVDILQKWIGEYY  375
              R A+K+DPDWL++ RE E+ I+  W+ +YY
Sbjct  465   LRPASKDDPDWLVRLRESELGIISGWLSDYY  495



>emb|CDP02648.1| unnamed protein product [Coffea canephora]
Length=503

 Score =   262 bits (670),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/212 (55%), Positives = 156/212 (74%), Gaps = 3/212 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AM +Y   A+F+ PLP  P++++C+ ID  P G S + R +   ++YYNY+GT 
Sbjct  285   SAYGYLAMADYPYPADFLMPLPGNPIKELCRRIDSCPDGTSTLQRVYEGVNVYYNYTGTV  344

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKES-MFPPSSYSYEETERSCQRMYGVKP  651
              CF+++D  D HG+ GWDWQACTEMVMP   SK + MFP   Y+Y + E  C + Y VKP
Sbjct  345   DCFNLDD--DPHGMIGWDWQACTEMVMPFASSKNTGMFPEFEYNYADDEERCLKDYNVKP  402

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WI+T FGG+ ++ VLK+FGSNIIFSNG+ DPWS G VL+++S++IVALVTEKGAHH 
Sbjct  403   RPTWISTEFGGHDLKNVLKKFGSNIIFSNGLLDPWSGGSVLEDVSETIVALVTEKGAHHL  462

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYY  375
             D R+AT  DPDWL+ QRE EV +++KW+ EYY
Sbjct  463   DLRAATDEDPDWLVDQRESEVKLIKKWLQEYY  494



>emb|CDP10629.1| unnamed protein product [Coffea canephora]
Length=520

 Score =   262 bits (669),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 113/212 (53%), Positives = 160/212 (75%), Gaps = 1/212 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +AF+YTAM +Y T +NF+ PLPAYPV++MCK ID   AG + + + ++AA++YYN +G  
Sbjct  304   TAFIYTAMTDYPTPSNFLNPLPAYPVKQMCKAIDDRKAGNNTLEKLYSAANVYYNSTGRA  363

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSK-ESMFPPSSYSYEETERSCQRMYGVKP  651
              CF++ D+SD HGL  W WQACTEM++P+  +  + +FPPS + Y    +SC+  +GV+P
Sbjct  364   TCFNLNDDSDPHGLDEWSWQACTEMILPIGGNNADGIFPPSEWDYAGRAQSCEDAFGVQP  423

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP+WITT FGG+ I++VLKRFGSNIIF NG++DPWS GGVLK+IS S+VA+V ++GAHH 
Sbjct  424   RPNWITTEFGGHNIQRVLKRFGSNIIFFNGLRDPWSGGGVLKDISKSLVAIVAKEGAHHV  483

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYY  375
             D R +T  DP+WL   R +EV I++ W+ +YY
Sbjct  484   DLRFSTPEDPEWLKHARRREVKIIENWLSQYY  515



>gb|EAZ13666.1| hypothetical protein OsJ_03583 [Oryza sativa Japonica Group]
Length=549

 Score =   263 bits (671),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 152/211 (72%), Gaps = 2/211 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   A+FM PLP  P++++C  ID  P G S + R +A  ++YYNY+GT 
Sbjct  319   SAYSYLAMVDYPMPADFMMPLPGNPIKELCTKIDNQPDGTSILERIYAGVNVYYNYTGTV  378

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPR  648
              CF + D  D HG+ GWDWQACTEMVMPM  S++SMFP   ++Y   E+ C   +GV+PR
Sbjct  379   DCFDLND--DPHGMDGWDWQACTEMVMPMSYSEDSMFPADKFNYTSYEKDCINSFGVEPR  436

Query  647   PHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHAD  468
             P WITT FGG+ I  VL+RFGSNIIF NG+ DPWS GGVLKNIS+S+VA++   GAHH D
Sbjct  437   PQWITTEFGGHNISLVLERFGSNIIFFNGLLDPWSGGGVLKNISESVVAIIAPLGAHHID  496

Query  467   FRSATKNDPDWLIQQREKEVDILQKWIGEYY  375
              R A+K+DPDWL++ RE E+ I+  W+ +YY
Sbjct  497   LRPASKDDPDWLVRLRESELGIISGWLSDYY  527



>gb|EAY75958.1| hypothetical protein OsI_03875 [Oryza sativa Indica Group]
Length=549

 Score =   263 bits (671),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 152/211 (72%), Gaps = 2/211 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   A+FM PLP  P++++C  ID  P G S + R +A  ++YYNY+GT 
Sbjct  319   SAYSYLAMVDYPMPADFMMPLPGNPIKELCTKIDNQPDGTSILERIYAGVNVYYNYTGTV  378

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPR  648
              CF + D  D HG+ GWDWQACTEMVMPM  S++SMFP   ++Y   E+ C   +GV+PR
Sbjct  379   DCFDLND--DPHGMDGWDWQACTEMVMPMSYSEDSMFPADKFNYTSYEKDCINSFGVEPR  436

Query  647   PHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHAD  468
             P WITT FGG+ I  VL+RFGSNIIF NG+ DPWS GGVLKNIS+S+VA++   GAHH D
Sbjct  437   PQWITTEFGGHNISLVLERFGSNIIFFNGLLDPWSGGGVLKNISESVVAIIAPLGAHHID  496

Query  467   FRSATKNDPDWLIQQREKEVDILQKWIGEYY  375
              R A+K+DPDWL++ RE E+ I+  W+ +YY
Sbjct  497   LRPASKDDPDWLVRLRESELGIISGWLSDYY  527



>emb|CBI30345.3| unnamed protein product [Vitis vinifera]
Length=485

 Score =   261 bits (666),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 159/215 (74%), Gaps = 1/215 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +A+VYTAM +Y T +NF+ P+PAYPV++MCK ID    G    ++ + AA++YYNY+GT 
Sbjct  266   TAYVYTAMTDYPTPSNFLSPMPAYPVKQMCKAIDDPAQGNDTFAKLYGAANVYYNYTGTA  325

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVS-KESMFPPSSYSYEETERSCQRMYGVKP  651
              CF + D+SD HGL  W WQACTEM+MP+  + +ES+FP S+++Y      C+  + ++P
Sbjct  326   ACFDLADDSDPHGLGEWTWQACTEMIMPVNANNEESIFPVSTWNYSNRAAFCKFAFDIEP  385

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP+WITT FGG+ I++VLKRFGSNIIF NG++DPWS GGVL++IS SIVA+V + GAHH 
Sbjct  386   RPNWITTEFGGHDIKRVLKRFGSNIIFFNGLRDPWSGGGVLESISKSIVAIVAKDGAHHV  445

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D R AT  DP+WL   R++EV I+ KW  EYY D+
Sbjct  446   DLRFATSEDPEWLQDVRKREVKIITKWFSEYYHDL  480



>ref|XP_006430123.1| hypothetical protein CICLE_v10011529mg [Citrus clementina]
 gb|ESR43363.1| hypothetical protein CICLE_v10011529mg [Citrus clementina]
Length=505

 Score =   261 bits (667),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 157/217 (72%), Gaps = 1/217 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +AFVYTAM +Y T +NF+ PLPA+PV++MCK ID    G    ++ + AAS+YYNYSGT 
Sbjct  289   TAFVYTAMTDYPTPSNFLNPLPAFPVKEMCKAIDDPKTGNDVFAKLYGAASVYYNYSGTA  348

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVV-SKESMFPPSSYSYEETERSCQRMYGVKP  651
             KCF +  +SD HGL  W WQACTEM+M     +K+S+F  S   Y+   R C+  YGV P
Sbjct  349   KCFDLNGDSDPHGLSEWGWQACTEMIMLTGGDNKDSIFEESEEDYDARARYCKEAYGVDP  408

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP+WITT FGG++I  VLKRF SNIIF NG++DPWS GGVLKNIS +++ALV ++GAHH 
Sbjct  409   RPNWITTEFGGHKIGLVLKRFASNIIFFNGLRDPWSGGGVLKNISKTVLALVEKEGAHHV  468

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDMDM  360
             D R +TK DP WL   R +EV+I+ KWI +Y++D+ +
Sbjct  469   DLRFSTKEDPQWLKDVRRREVEIVGKWISQYFQDLAL  505



>ref|XP_002281618.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Vitis vinifera]
Length=507

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 159/215 (74%), Gaps = 1/215 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +A+VYTAM +Y T +NF+ P+PAYPV++MCK ID    G    ++ + AA++YYNY+GT 
Sbjct  288   TAYVYTAMTDYPTPSNFLSPMPAYPVKQMCKAIDDPAQGNDTFAKLYGAANVYYNYTGTA  347

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVS-KESMFPPSSYSYEETERSCQRMYGVKP  651
              CF + D+SD HGL  W WQACTEM+MP+  + +ES+FP S+++Y      C+  + ++P
Sbjct  348   ACFDLADDSDPHGLGEWTWQACTEMIMPVNANNEESIFPVSTWNYSNRAAFCKFAFDIEP  407

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP+WITT FGG+ I++VLKRFGSNIIF NG++DPWS GGVL++IS SIVA+V + GAHH 
Sbjct  408   RPNWITTEFGGHDIKRVLKRFGSNIIFFNGLRDPWSGGGVLESISKSIVAIVAKDGAHHV  467

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D R AT  DP+WL   R++EV I+ KW  EYY D+
Sbjct  468   DLRFATSEDPEWLQDVRKREVKIITKWFSEYYHDL  502



>ref|XP_007047632.1| Serine carboxypeptidase S28 family protein isoform 1 [Theobroma 
cacao]
 gb|EOX91789.1| Serine carboxypeptidase S28 family protein isoform 1 [Theobroma 
cacao]
Length=510

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 152/215 (71%), Gaps = 3/215 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y  MVNY   +NF+ PLP +P+ ++C+ ID  P G+S + R F   S+YYNY+G  
Sbjct  292   SAYSYLGMVNYPYPSNFLMPLPGHPIREVCRKIDSSPDGSSILERIFNGVSVYYNYTGEV  351

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HG+ GW+WQACTEMVMPM   +  SMFP   Y Y   +  C+R + V P
Sbjct  352   DCFQLDD--DPHGMDGWNWQACTEMVMPMSSDRNTSMFPAYDYDYSAFQEECRRDFQVTP  409

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+ IE VLK FGSNIIFSNG+ DPWS GGVLKNIS +IVALVTE+GAHH 
Sbjct  410   RPRWITTEFGGHDIEHVLKFFGSNIIFSNGLLDPWSGGGVLKNISQTIVALVTEEGAHHI  469

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D R++T  DPDWL++QRE E+++++ W+  Y   M
Sbjct  470   DLRASTTEDPDWLVEQRETEIELIEGWLDNYGEKM  504



>ref|XP_006481710.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=505

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 156/215 (73%), Gaps = 1/215 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +AFVYTAM +Y T +NF+ PLPA+PV++MCK ID    G    ++ + AAS+YYNYSGT 
Sbjct  289   TAFVYTAMTDYPTPSNFLNPLPAFPVKEMCKAIDDPKTGNDVFAKLYGAASVYYNYSGTA  348

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVV-SKESMFPPSSYSYEETERSCQRMYGVKP  651
             KCF +  +SD HGL  W WQACTEM+M     +K+S+F  S   Y+   R C+  YGV P
Sbjct  349   KCFDLNGDSDPHGLSEWGWQACTEMIMLTGGDNKDSIFEESEEDYDARARYCKEAYGVDP  408

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP+WITT FGG++I  VLKRF SNIIF NG++DPWS GGVLKNIS +++ALV ++GAHH 
Sbjct  409   RPNWITTEFGGHKIGLVLKRFASNIIFFNGLRDPWSGGGVLKNISKTVLALVEKEGAHHV  468

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D R +TK DP WL   R +EV+I+ KWI +Y++D+
Sbjct  469   DLRFSTKEDPQWLKDVRRREVEIIGKWISQYFQDL  503



>gb|KJB18075.1| hypothetical protein B456_003G033300 [Gossypium raimondii]
Length=508

 Score =   259 bits (663),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 152/215 (71%), Gaps = 3/215 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMVNY   +NF+ PLP +P+ ++CK IDG PAG+S + R F   S+YYNY+G  
Sbjct  290   SAYSYLAMVNYPYPSNFLMPLPGHPIREVCKRIDGSPAGSSILERIFNGVSVYYNYTGEV  349

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HG+ GW+WQACTEMVMPM   +  SMFP   + Y      CQR + V P
Sbjct  350   DCFQLDD--DPHGMDGWNWQACTEMVMPMSSDQNTSMFPAYDWDYSAFREGCQRDFQVTP  407

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+ IE VLK FGSNIIFSNG+ DPWS G VLKNIS++I+AL+T++GAHH 
Sbjct  408   RPRWITTEFGGHDIEHVLKSFGSNIIFSNGLLDPWSGGSVLKNISETIIALITKEGAHHI  467

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D R++   DPDWL++QR  E+ ++Q WI  Y + M
Sbjct  468   DLRASLTEDPDWLVEQRATEIKLIQGWIYNYSKKM  502



>ref|NP_001136852.1| uncharacterized protein LOC100217003 [Zea mays]
 gb|ACF82763.1| unknown [Zea mays]
Length=319

 Score =   253 bits (647),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 150/212 (71%), Gaps = 3/212 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   + F+ PLPA P++++C+ ID  P G   + R +A  ++YYNY+GT 
Sbjct  92    SAYSYLAMVDYPLPSEFLMPLPANPIKEVCRNIDSQPKGTGTLERIYAGVNVYYNYTGTV  151

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF + D  D HG+ GWDWQACTEMVMPM  S++ SM+PP  + Y      C + YGV+P
Sbjct  152   DCFDLND--DPHGMGGWDWQACTEMVMPMSYSEQRSMYPPYKFDYASYAEDCIKSYGVRP  209

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+ I +VL+ FGSNIIF NG+ DPWS GGVLKNIS+S+VA+V   GAHH 
Sbjct  210   RPKWITTEFGGHNITKVLENFGSNIIFFNGLLDPWSGGGVLKNISESVVAIVAPLGAHHI  269

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYY  375
             D R AT +DPDWL+  RE E++I+  W+ +YY
Sbjct  270   DLRPATPDDPDWLVALRESELEIISGWLWDYY  301



>gb|KHN02193.1| Lysosomal Pro-X carboxypeptidase [Glycine soja]
Length=506

 Score =   259 bits (661),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 160/218 (73%), Gaps = 3/218 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +A++YTAM +Y T +NF+  LPAYPV+KMC+ ID    G +++++ +AAA++YYNY+G  
Sbjct  290   AAWIYTAMTDYPTPSNFL--LPAYPVKKMCEAIDSSVTGNNRLAKLYAAANVYYNYTGKA  347

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVS-KESMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D SD H L GW WQACTEM+MP+  S KES+FP   +SYE     C   Y V+P
Sbjct  348   TCFDLDDNSDPHDLGGWQWQACTEMIMPVGGSNKESIFPEYEWSYEARASWCDFFYNVQP  407

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT FGG+ IE+VLKR  SNIIF NG++DPWS GGVLK IS +IVA+V +KGAHH 
Sbjct  408   RPHWITTEFGGHAIERVLKRSASNIIFFNGLRDPWSAGGVLKTISKTIVAIVAKKGAHHV  467

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDMDMN  357
             D R ++K DP WL   R++EV+I+  WI +Y++D+  N
Sbjct  468   DLRYSSKEDPQWLKDVRKQEVNIIASWISQYHQDLQSN  505



>ref|XP_008243494.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Prunus mume]
Length=504

 Score =   258 bits (658),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 156/215 (73%), Gaps = 1/215 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +A+ YTAM +Y T +NF+ PLPA+PV+KMC+ ID    G    ++ + AA++YYNYSGT 
Sbjct  286   TAYAYTAMTDYPTPSNFLCPLPAFPVKKMCEAIDDPTTGNDTFAKLYGAANVYYNYSGTV  345

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D SD H L GW WQACTEM+MP   + E S+FP S + Y++    C+  +G++P
Sbjct  346   TCFELDDNSDPHDLGGWYWQACTEMIMPTGGNNEDSIFPASDWDYKDQASVCKSRFGIEP  405

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+ IE+VLKR+GSNIIF NG++DPWS GGVLKNIS SIVA+V ++GAHH 
Sbjct  406   RPLWITTEFGGHAIERVLKRYGSNIIFFNGLRDPWSGGGVLKNISKSIVAIVAKEGAHHV  465

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D    +  DP+WL   R++E+ I+ KWI +YY D+
Sbjct  466   DLMFKSSEDPEWLQDVRKQEIKIIAKWISQYYHDL  500



>emb|CDM83096.1| unnamed protein product [Triticum aestivum]
Length=515

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 154/213 (72%), Gaps = 3/213 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   + F+ PLPA P++++C+ ID  P G+S + R +A  ++YYNY+GT 
Sbjct  287   SAYSYLAMVDYPMPSEFLMPLPASPIKEVCRNIDKQPEGSSILERIYAGVNIYYNYTGTV  346

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HG+ GWDWQACTEMVMPM  S+  SMFPP  + YE     C + +GV+P
Sbjct  347   DCFDLDD--DPHGMGGWDWQACTEMVMPMSSSEGLSMFPPDEFDYELYADDCVKNFGVRP  404

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WI+T FGG+ I  VL++FGSNIIF NG+ DPWS GGVLKNIS+S+VA+V   GAHH 
Sbjct  405   RPRWISTEFGGHNISSVLEKFGSNIIFFNGLLDPWSGGGVLKNISESVVAIVAPLGAHHI  464

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYR  372
             D R ATK DPDWL+  RE E++I+  W+ ++YR
Sbjct  465   DLRPATKEDPDWLVSLRESELEIISGWLSDHYR  497



>ref|XP_012074389.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Jatropha curcas]
 gb|KDP36180.1| hypothetical protein JCGZ_08824 [Jatropha curcas]
Length=499

 Score =   258 bits (658),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 157/216 (73%), Gaps = 1/216 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             ++A+ YTAM +Y T +NF+ PLP +PV++MCK ID    G    ++ + AAS+YYN+SGT
Sbjct  279   YTAWTYTAMTDYPTSSNFLNPLPPHPVKQMCKAIDDPTTGNDTFAKLYGAASVYYNHSGT  338

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMV-VSKESMFPPSSYSYEETERSCQRMYGVK  654
               CF +++ SD HGL GW WQACTEM++P    +KESMFP SS+S  +    CQ  + ++
Sbjct  339   ATCFDLDNNSDPHGLGGWSWQACTEMILPTGGNNKESMFPASSWSLNDRATYCQYAFHIQ  398

Query  653   PRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHH  474
             PRP+W+   FGG+ I++VLKRFGSNIIF NG++DPWS GGVL++IS SI+A+V +KGAHH
Sbjct  399   PRPNWVPIEFGGHNIKRVLKRFGSNIIFFNGLRDPWSGGGVLEDISKSIIAIVAKKGAHH  458

Query  473   ADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
              D R A+  DP WL   R++E+ I+ KW+ EYY D+
Sbjct  459   VDLRYASSEDPKWLQHVRKREIKIIAKWLSEYYLDL  494



>ref|XP_010059402.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW90504.1| hypothetical protein EUGRSUZ_A02624 [Eucalyptus grandis]
Length=516

 Score =   258 bits (659),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 153/215 (71%), Gaps = 1/215 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +A +YTAM +Y T +NF+ PLPAYPV++MCK ID    G    ++ + AA++YYNYSG  
Sbjct  297   TALIYTAMTDYPTPSNFLNPLPAYPVKQMCKAIDDPSKGDDDFAKLYGAANIYYNYSGGV  356

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF + D+SD HGL  W WQACTEM++P   ++E S+FP   Y+Y +   +C  ++GV P
Sbjct  357   SCFDLLDDSDPHGLGEWAWQACTEMILPTGGNRETSIFPAHEYNYNDRVATCTSLFGVVP  416

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WI   FGG+ I + L+RFGSNIIF NG++DPWS GGVLK+IS SIVA+V EKGAHH 
Sbjct  417   RPTWIPIEFGGHDIRRTLRRFGSNIIFFNGLRDPWSGGGVLKSISKSIVAIVAEKGAHHV  476

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D R +T  DP+WL   R+KE+ I+  WI +YYRD+
Sbjct  477   DLRYSTNEDPEWLQDVRKKEIKIISGWISQYYRDL  511



>gb|AFK45793.1| unknown [Lotus japonicus]
Length=212

 Score =   248 bits (632),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 149/206 (72%), Gaps = 3/206 (1%)
 Frame = -3

Query  986  MVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIED  807
            MVNY   + F+  LP +P++++C+ ID  PAG S + R +   ++YYNY+G  KCF ++D
Sbjct  1    MVNYPYPSEFLMTLPGHPIKEVCRRIDQGPAGTSILERIYEGVNVYYNYTGEAKCFELDD  60

Query  806  ESDDHGLHGWDWQACTEMVMPMVVSKES-MFPPSSYSYEETERSCQRMYGVKPRPHWITT  630
              D HGL GW+WQACTEMVMPM  S+ES MFPP  Y+Y      C + +GV+PRP WITT
Sbjct  61   --DPHGLSGWNWQACTEMVMPMSSSQESSMFPPYEYNYTSYLEDCIKSFGVEPRPKWITT  118

Query  629  HFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATK  450
             FGG+ I   LK+FGSNIIFSN + DPWS G VL+NI +SIV LVT++GAHH + R++T 
Sbjct  119  EFGGHNILAPLKKFGSNIIFSNSLLDPWSGGSVLQNIFESIVFLVTKEGAHHINLRASTG  178

Query  449  NDPDWLIQQREKEVDILQKWIGEYYR  372
            NDPDWL++QR  E+ ++Q WI +YYR
Sbjct  179  NDPDWLVEQRATEIKLIQGWISDYYR  204



>gb|KEH24167.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=501

 Score =   257 bits (656),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 154/214 (72%), Gaps = 1/214 (0%)
 Frame = -3

Query  1004  AFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEK  825
             A++YTAM +Y T  NF+ PLPAYPV KMC+ ID    G + + + + AAS+YYNYSGT K
Sbjct  285   AWIYTAMTDYPTPTNFLSPLPAYPVRKMCEAIDSSVTGKNTLEKLYDAASIYYNYSGTSK  344

Query  824   CFHIEDESDDHGLHGWDWQACTEMVMPM-VVSKESMFPPSSYSYEETERSCQRMYGVKPR  648
             CF + D SD H L GW WQAC+EM+MP    SKES+FP S +S ++    C+  Y V PR
Sbjct  345   CFDLNDHSDPHDLGGWQWQACSEMIMPEGASSKESIFPESKWSVKDRNAYCKFAYNVVPR  404

Query  647   PHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHAD  468
             P+WIT+ FGG+ IE VLKR   NIIF NG++DPWS GGVLKNIS +I+A+V ++GAHH D
Sbjct  405   PNWITSEFGGHNIEIVLKRSVGNIIFFNGLRDPWSGGGVLKNISKTIIAIVAKEGAHHVD  464

Query  467   FRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
              R +TK DP WL   R++EV I++ WI +Y++D+
Sbjct  465   LRYSTKEDPKWLKDVRKQEVKIIESWISQYHQDL  498



>ref|XP_006426159.1| hypothetical protein CICLE_v10025375mg [Citrus clementina]
 gb|ESR39399.1| hypothetical protein CICLE_v10025375mg [Citrus clementina]
Length=517

 Score =   257 bits (656),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/213 (55%), Positives = 150/213 (70%), Gaps = 3/213 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   ++FM PLP YP+ ++CK ID  P   S + R F   S+YYNY+G  
Sbjct  299   SAYSYLAMVDYPYPSDFMMPLPGYPIREVCKKIDNAPDATSILERIFEGVSVYYNYTGDV  358

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HGL GW+WQACTEMVMPM  S++ SMFP   Y+Y   +  C   + V P
Sbjct  359   DCFQLDD--DPHGLDGWNWQACTEMVMPMSSSRDKSMFPAYDYNYSSFKEECWNDFNVIP  416

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+ I+ VLK FGSNIIFSNG+ DPWS G VL+N+S++IVALVTE+GAHH 
Sbjct  417   RPRWITTEFGGHDIKSVLKLFGSNIIFSNGLLDPWSGGSVLQNLSETIVALVTEEGAHHL  476

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYR  372
             D R +T  DPDWL +QRE E+ +++ WI  YYR
Sbjct  477   DLRPSTNEDPDWLKKQRETEIKLIEDWIDNYYR  509



>ref|XP_004494225.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cicer arietinum]
Length=511

 Score =   257 bits (656),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/216 (55%), Positives = 158/216 (73%), Gaps = 2/216 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDG-FPAGASKISRAFAAASLYYNYSGT  831
             +A++YTAM +Y T +NF+ P+PAYPV+KMC+ ID         + + +AAA++YYNY+GT
Sbjct  292   TAWIYTAMTDYPTPSNFLSPMPAYPVKKMCEAIDNSVTENNHTLGKLYAAANIYYNYTGT  351

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPM-VVSKESMFPPSSYSYEETERSCQRMYGVK  654
              KCF + D SD H L GW WQACTEM+MP+   +KES+FP S +SY++    C+  Y V 
Sbjct  352   AKCFDLYDNSDPHDLGGWQWQACTEMIMPLDSNNKESIFPESEWSYKDRSSYCKFEYNVV  411

Query  653   PRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHH  474
             PRP+WIT+ FGG+ IE VLKR  SNIIF NG++DPWS GGVLKNIS SIVALV ++GAHH
Sbjct  412   PRPNWITSEFGGHDIEIVLKRSASNIIFFNGLRDPWSGGGVLKNISKSIVALVEKEGAHH  471

Query  473   ADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
              D R +TK DP WL   R +EV I++ WI +Y++D+
Sbjct  472   VDLRFSTKEDPKWLKDVRRQEVKIIESWISQYHQDL  507



>ref|XP_008799734.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Phoenix dactylifera]
Length=501

 Score =   256 bits (655),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 153/214 (71%), Gaps = 2/214 (1%)
 Frame = -3

Query  1004  AFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEK  825
             A VYTAM +Y T +NF+ PLPAYPV++MCK ID   AG    +R + A ++YYNYSGTE 
Sbjct  284   AIVYTAMTDYPTASNFLVPLPAYPVKQMCKAIDNPTAGNDTFARLYGAMNIYYNYSGTET  343

Query  824   CFHIEDESDDHGL-HGWDWQACTEM-VMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             C     +SD+HG+  GW WQ+CTEM ++    + ES+ PP++Y+Y E   +CQ  YGV P
Sbjct  344   CLAAGGDSDEHGMARGWSWQSCTEMTIVEGGSNNESILPPATYNYTEQAVACQNYYGVAP  403

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT FGG+ I +VLKRFGSNIIF NG++DPWS GGVLK++S+S++A+V  +GAHH 
Sbjct  404   RPHWITTEFGGHDIRRVLKRFGSNIIFFNGLRDPWSGGGVLKSLSNSLIAIVAPEGAHHV  463

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             D R +TK DP WL   R KE  I+  W+ +YY D
Sbjct  464   DLRFSTKEDPKWLKTVRTKENKIIAGWLEQYYSD  497



>ref|XP_006466409.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=520

 Score =   257 bits (656),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 118/213 (55%), Positives = 150/213 (70%), Gaps = 3/213 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   ++FM PLP YP+ ++CK ID  P   S + R F   S+YYNY+G  
Sbjct  302   SAYSYLAMVDYPYPSDFMMPLPGYPIREVCKKIDNAPDATSILERIFEGVSVYYNYTGNV  361

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HGL GW+WQACTEMVMPM  S++ SMFP   Y+Y   +  C   + V P
Sbjct  362   DCFQLDD--DPHGLDGWNWQACTEMVMPMSSSRDKSMFPAYDYNYSSFKEECWNDFNVIP  419

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+ I+ VLK FGSNIIFSNG+ DPWS G VL+N+S++IVALVTE+GAHH 
Sbjct  420   RPRWITTEFGGHDIKSVLKLFGSNIIFSNGLLDPWSGGSVLQNLSETIVALVTEEGAHHL  479

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYR  372
             D R +T  DPDWL +QRE E+ +++ WI  YYR
Sbjct  480   DLRPSTNEDPDWLKKQRETEIKLIEGWIDNYYR  512



>ref|XP_004288288.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Fragaria 
vesca subsp. vesca]
Length=509

 Score =   256 bits (653),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/214 (56%), Positives = 151/214 (71%), Gaps = 2/214 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMVNY   + FM PLP +P+ ++C+ IDG P G S + R F   S+YYNYSG  
Sbjct  290   SAYSYLAMVNYPYGSEFMMPLPGHPIREVCRRIDGCPDGTSTLERVFEGISVYYNYSGNA  349

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF +ED SD  G  GW+WQACTEMVMPM  S++ SMF    Y++   +  C +    KP
Sbjct  350   DCFELEDTSD-VGTDGWNWQACTEMVMPMSSSRDRSMFKTYDYNFSSFQDWCWKELNAKP  408

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+ I+  LK FGSNIIFSNG+ DPWS G VL+NIS SIVALVTE+GAHH 
Sbjct  409   RPTWITTEFGGHDIKATLKNFGSNIIFSNGLLDPWSGGSVLQNISQSIVALVTEEGAHHI  468

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             D R +TK DPDWL++QRE E+ ++Q W+ E+Y++
Sbjct  469   DLRFSTKGDPDWLVEQRESEIKLIQGWLDEFYQE  502



>ref|XP_010683638.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Beta vulgaris 
subsp. vulgaris]
Length=509

 Score =   256 bits (653),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 155/215 (72%), Gaps = 1/215 (0%)
 Frame = -3

Query  1004  AFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEK  825
             A++YTAM +Y T +NF+ PLPA+PV +MCK ID    G    ++ + AA++YYNY+G   
Sbjct  291   AYIYTAMTDYPTPSNFLNPLPAFPVRQMCKAIDNPELGNDTFAKLYGAANIYYNYTGNVD  350

Query  824   CFHIEDESDDHGLHGWDWQACTEMVMPM-VVSKESMFPPSSYSYEETERSCQRMYGVKPR  648
             CF I ++SD HGL  W WQACTEM++P    +KES+FP S+  Y + +  C  +YGV+PR
Sbjct  351   CFDITNDSDKHGLDEWTWQACTEMILPTDGNNKESIFPTSNDDYNDRDLYCTSIYGVQPR  410

Query  647   PHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHAD  468
             PHWITT FGG  I +VL+R+ SNI+F NG +DPWS GGVLKNIS S+VA+V ++GAHH D
Sbjct  411   PHWITTEFGGFDIHRVLRRYASNILFFNGRRDPWSGGGVLKNISSSLVAIVAKEGAHHVD  470

Query  467   FRSATKNDPDWLIQQREKEVDILQKWIGEYYRDMD  363
              R +T+ DP+WL + R+ E+  ++KW+  YY D+D
Sbjct  471   LRYSTEEDPNWLKEIRKTEIHHIKKWLSRYYHDLD  505



>gb|KCW90503.1| hypothetical protein EUGRSUZ_A02623 [Eucalyptus grandis]
Length=465

 Score =   254 bits (649),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 151/215 (70%), Gaps = 1/215 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +A VY AM +Y T +NF+ PLPAYP+++MCK ID    G    ++ + AA++YYNYSG  
Sbjct  249   TALVYAAMTDYPTPSNFLTPLPAYPIKQMCKAIDDPSKGDDDFAKLYGAANIYYNYSGGI  308

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF + D+SD HGL GW WQACTEMVMP+  ++E S+FP   Y+Y +T  SC     V  
Sbjct  309   SCFDLMDDSDPHGLSGWGWQACTEMVMPIDGNRETSIFPAYKYNYTDTISSCAADSSVVS  368

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WI   FGG+ I + L+RFGSNIIF NG++DPWS GGVLK+IS SIVA+V EKGAHH 
Sbjct  369   RPTWIPIEFGGHDIRRTLRRFGSNIIFFNGLRDPWSGGGVLKSISKSIVAIVAEKGAHHV  428

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D R +T  DP+WL   R+KE+ I+  WI +YYRD+
Sbjct  429   DLRYSTSEDPEWLQDVRKKEIKIISGWISQYYRDL  463



>ref|XP_006646360.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Oryza brachyantha]
Length=500

 Score =   255 bits (651),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/224 (54%), Positives = 155/224 (69%), Gaps = 5/224 (2%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   ++F+ PLP  P++++C+ ID  P G S + R +A  ++YYNY+GT 
Sbjct  272   SAYSYLAMVDYPMPSDFLMPLPGNPIKEVCRKIDSQPDGTSILERIYAGVNIYYNYTGTF  331

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF + D  D HG+ GWDWQACTEMVMPM  S++ SMFP   + Y   E  C   +GV+P
Sbjct  332   DCFDLND--DPHGMGGWDWQACTEMVMPMSYSEDGSMFPAYKFDYASYENDCISSFGVRP  389

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+ I  VL+RFGSNIIF NG+ DPWS GGVLKNIS+S+VA+V   GAHH 
Sbjct  390   RPQWITTEFGGHNISLVLERFGSNIIFFNGLLDPWSGGGVLKNISESVVAIVAPLGAHHI  449

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYY--RDMDMNQN*T  345
             D R ATK DPDWL+  R+ E+DI+  W+ +YY  R  D+ Q  T
Sbjct  450   DLRPATKADPDWLVSIRKSELDIISGWLLDYYGARRGDLLQRAT  493



>gb|AGT17295.1| hypothetical protein SHCRBa_168_J15_F_160 [Saccharum hybrid cultivar 
R570]
Length=523

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 150/212 (71%), Gaps = 3/212 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   + F+ PLPA P++++C+ ID  P G S + R +A  ++YYNY+GT 
Sbjct  296   SAYSYLAMVDYPLPSEFLMPLPANPIKEVCRNIDSQPEGTSTLERIYAGVNVYYNYTGTV  355

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSK-ESMFPPSSYSYEETERSCQRMYGVKP  651
              CF + D  D HG+ GWDWQACTEMVMPM  S+  SM+PP  + Y      C + YGV+P
Sbjct  356   GCFDLND--DPHGMGGWDWQACTEMVMPMSYSEVRSMYPPYKFDYPSYAEDCIKSYGVRP  413

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+ I +VL++FGSNIIF NG+ DPWS GGVLKNIS+S++A+V   GAHH 
Sbjct  414   RPRWITTEFGGHNITKVLEKFGSNIIFFNGLLDPWSGGGVLKNISESVIAIVAPLGAHHI  473

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYY  375
             D R AT +DPDWL+  RE E+ I+  W+ +YY
Sbjct  474   DLRPATPDDPDWLVALRESELKIISGWLSDYY  505



>ref|XP_010099406.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
 gb|EXB78251.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
Length=514

 Score =   255 bits (651),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 152/212 (72%), Gaps = 2/212 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMVNY   +NF+ PLP +P+ ++CK IDG P G S + + F   S++YNY+G  
Sbjct  297   SAYSYLAMVNYPYPSNFIMPLPGHPIREVCKKIDGSPVGTSTLEQIFEGISVFYNYTGDV  356

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPR  648
             +CF ++D  D HG+ GW+WQACTEMVMP   S  SMFP   ++    E  C   +GVKPR
Sbjct  357   ECFQLDD--DPHGMDGWNWQACTEMVMPTSSSWGSMFPRYDFNLSAYEEQCWNDFGVKPR  414

Query  647   PHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHAD  468
             P WITT FGG+ I+  L+RFGSNIIF NG+ DPWS GGVL+NIS+SIVALVT +GAHH D
Sbjct  415   PRWITTEFGGHDIKADLERFGSNIIFFNGLLDPWSGGGVLQNISESIVALVTIEGAHHID  474

Query  467   FRSATKNDPDWLIQQREKEVDILQKWIGEYYR  372
              R++TK DPDWL++ RE E+ +++ WI  YY+
Sbjct  475   LRASTKEDPDWLVELRETEIKLIKGWIDNYYQ  506



>ref|XP_008350184.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Malus domestica]
Length=514

 Score =   254 bits (650),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 157/215 (73%), Gaps = 1/215 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +AF YTAM +Y T +NF+ PLPA+PV++MC  ID    G     + + AAS+YYNYSGT 
Sbjct  296   TAFTYTAMTDYPTPSNFLSPLPAFPVKQMCAAIDDPTTGNDTFKKLYGAASVYYNYSGTA  355

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMV-VSKESMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D+SD H L GW WQACTEM+MP    ++ES+FP S + Y     SC+R +G++P
Sbjct  356   TCFDLDDDSDPHDLGGWSWQACTEMIMPTSGNTEESIFPASEWKYXYRAASCKRSFGIEP  415

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+ IE+VLKR+GSNIIF NG++DPWS GGVLKNIS SIVA+V ++GAHH 
Sbjct  416   RPLWITTEFGGHDIERVLKRYGSNIIFFNGLRDPWSGGGVLKNISKSIVAIVAKEGAHHV  475

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D R     DPDWL + R++E++I+  WI +YY D+
Sbjct  476   DLRFKNSEDPDWLKEVRKQEINIIGNWISQYYHDL  510



>gb|KFK28424.1| hypothetical protein AALP_AA8G512800 [Arabis alpina]
Length=513

 Score =   254 bits (650),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 150/211 (71%), Gaps = 3/211 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   A+FM PLP +P++++C+ ID  P+ AS + R +A  S+YYNY+G  
Sbjct  290   SAYSYLAMVDYPYSADFMMPLPGHPIKEVCRKIDSAPSDASILDRIYAGISVYYNYTGDV  349

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HGL GWDWQACTEMVMPM  S+E SMFP   ++Y   +  C   + V P
Sbjct  350   DCFKLDD--DPHGLDGWDWQACTEMVMPMSSSQENSMFPADDFNYSSYKEECWNTFRVNP  407

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP W+TT  GG+ IE  LK FGSNIIFSNG+ DPWS G VLKN+SD+IVALVT++GAHH 
Sbjct  408   RPRWVTTELGGHDIETTLKSFGSNIIFSNGLLDPWSGGSVLKNLSDTIVALVTKEGAHHL  467

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEY  378
             D R +T  DP WL++QRE E+ ++Q WI  Y
Sbjct  468   DLRPSTPEDPKWLVEQREAEIRLIQGWIETY  498



>ref|XP_004970093.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Setaria italica]
Length=565

 Score =   256 bits (653),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 152/212 (72%), Gaps = 3/212 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   + F+ PLPA P++++C+ ID  P G S + R +A  ++YYNY+GT 
Sbjct  338   SAYSYLAMVDYPIPSEFLMPLPANPIKEVCRNIDSQPEGTSILERIYAGVNVYYNYTGTV  397

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF + D  D HG+ GWDWQACTEMVMPM  S++ SM+PP  + Y     +C + YGV+P
Sbjct  398   GCFDLND--DPHGMGGWDWQACTEMVMPMSYSEDRSMYPPYKFDYASYAENCIKSYGVRP  455

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT+FGG+ I  VL++FGSNIIF NG+ DPWS GGVLKNIS+S++A+V   GAHH 
Sbjct  456   RPRWITTNFGGHNITTVLEKFGSNIIFFNGLLDPWSGGGVLKNISESVIAIVAPLGAHHI  515

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYY  375
             D R AT +DPDWL+  RE E+ I+  W+ +YY
Sbjct  516   DLRPATSDDPDWLVSLRESELKIISGWLSDYY  547



>ref|XP_010931151.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Elaeis guineensis]
Length=500

 Score =   253 bits (647),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 154/215 (72%), Gaps = 3/215 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA VY AM +Y T +NF+ PLPAYPV++MCK I+   AG    +R + A ++YYNYSGTE
Sbjct  284   SAIVYAAMTDYPTASNFLAPLPAYPVKQMCKAINNPTAGNDTFTRLYGAMNIYYNYSGTE  343

Query  827   KCFHIEDESDDHGLH-GWDWQACTEMVMPMVVSK-ESMFPPSSYSYEETERSCQRMYGVK  654
              CF +   SD+HG+  GW+WQ+C EM++P   S  ES+FPPS+Y+Y +    CQ  Y V 
Sbjct  344   TCF-VTVGSDEHGMDDGWEWQSCMEMILPTGASNNESIFPPSTYNYTDQAVGCQEYYYVA  402

Query  653   PRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHH  474
             PRPHWITT FGG+ I +VLKR GSNIIF NG++DPWS GGVLK++S S++A+V  +GAHH
Sbjct  403   PRPHWITTEFGGHDIRRVLKRSGSNIIFFNGLRDPWSGGGVLKSLSKSLIAIVEPEGAHH  462

Query  473   ADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
              D R +TK DP WL   R KEV I+ +W+ +YY D
Sbjct  463   VDLRFSTKEDPKWLKAVRMKEVKIISRWLEQYYSD  497



>ref|XP_010024706.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=515

 Score =   254 bits (648),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 151/215 (70%), Gaps = 1/215 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +A VY AM +Y T +NF+ PLPAYP+++MCK ID    G    ++ + AA++YYNYSG  
Sbjct  299   TALVYAAMTDYPTPSNFLTPLPAYPIKQMCKAIDDPSKGDDDFAKLYGAANIYYNYSGGI  358

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF + D+SD HGL GW WQACTEMVMP+  ++E S+FP   Y+Y +T  SC     V  
Sbjct  359   SCFDLMDDSDPHGLSGWGWQACTEMVMPIDGNRETSIFPAYKYNYTDTISSCAADSSVVS  418

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WI   FGG+ I + L+RFGSNIIF NG++DPWS GGVLK+IS SIVA+V EKGAHH 
Sbjct  419   RPTWIPIEFGGHDIRRTLRRFGSNIIFFNGLRDPWSGGGVLKSISKSIVAIVAEKGAHHV  478

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D R +T  DP+WL   R+KE+ I+  WI +YYRD+
Sbjct  479   DLRYSTSEDPEWLQDVRKKEIKIISGWISQYYRDL  513



>ref|XP_002310325.2| hypothetical protein POPTR_0007s14600g [Populus trichocarpa]
 gb|EEE90775.2| hypothetical protein POPTR_0007s14600g [Populus trichocarpa]
Length=515

 Score =   254 bits (648),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 150/214 (70%), Gaps = 3/214 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   ++FM PLP YP+ ++CK IDG P G S + R F   S+YYNY+G  
Sbjct  297   SAYSYLAMVDYPYPSSFMMPLPGYPIGEVCKRIDGCPDGTSILERIFEGISIYYNYTGEL  356

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVS-KESMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HGL GW+WQACTEMVMPM  S   SMFP   ++Y   +  C   +GV P
Sbjct  357   HCFELDD--DPHGLDGWNWQACTEMVMPMSSSHNASMFPTYDFNYSSYQEGCWEEFGVIP  414

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG  I+  L+ FGSNIIFSNG+ DPWS G VL+NIS+++VALVTE+GAHH 
Sbjct  415   RPRWITTEFGGQDIKTALETFGSNIIFSNGLLDPWSGGSVLQNISETVVALVTEEGAHHI  474

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             D R +T  DPDWL++QRE EV +++ WI  Y ++
Sbjct  475   DLRPSTPEDPDWLVEQRETEVKLIKGWIDGYLKE  508



>ref|XP_002263389.2| PREDICTED: lysosomal Pro-X carboxypeptidase [Vitis vinifera]
 emb|CBI29519.3| unnamed protein product [Vitis vinifera]
Length=510

 Score =   253 bits (647),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 155/213 (73%), Gaps = 3/213 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ + AMVNY   ++F+ PLP +P++++C+ +D  P G S + R F   S+YYNY+G  
Sbjct  292   SAYSFLAMVNYPYPSDFLMPLPGHPIKEVCRKMDSCPEGTSVLERIFEGVSVYYNYTGKV  351

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKES-MFPPSSYSYEETERSCQRMYGVKP  651
             +CF ++D  D HG+ GW+WQACTEMVMPM  S+ES MFP   Y+Y   +  C + + VKP
Sbjct  352   ECFQLDD--DPHGMDGWNWQACTEMVMPMASSRESSMFPTYDYNYSSFQEECWKDFSVKP  409

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+  +  LK FGSNIIFSNG+ DPWS G VL+NIS+++VALVTE+GAHH 
Sbjct  410   RPTWITTEFGGHEFKTTLKVFGSNIIFSNGLLDPWSGGSVLQNISETVVALVTEEGAHHI  469

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYR  372
             D RS+T  DPDWL++QR  EV +++ WI +Y++
Sbjct  470   DLRSSTAEDPDWLVEQRAFEVKLIKGWIEDYHQ  502



>ref|XP_001776094.1| predicted protein [Physcomitrella patens]
 gb|EDQ59139.1| predicted protein [Physcomitrella patens]
Length=505

 Score =   253 bits (646),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 155/219 (71%), Gaps = 3/219 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y    NF+ PLPAYPV ++C++ID  P G+  +SR FA AS+YYNYSG  
Sbjct  273   SAYSYVAMVDYPIPTNFITPLPAYPVREICRVIDSLPEGSDILSRIFAGASVYYNYSGQA  332

Query  827   KCFHIEDE-SDDHGLHGWDWQ-ACTEMVMPMVVSKESM-FPPSSYSYEETERSCQRMYGV  657
             +CF   D  +DD G+ GWDWQ ACTEM+MPM  +  +  F P  +  E   + C + YGV
Sbjct  333   ECFQPSDPGNDDLGVTGWDWQQACTEMIMPMSSNSSNSMFQPYDWDLEGNIQYCMKTYGV  392

Query  656   KPRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAH  477
             +PRP+WITT++GG  I+ VLK FGSNI+FSNG+ DPWS GGVL+NIS SI+ALV  +GAH
Sbjct  393   RPRPNWITTNYGGKDIKAVLKDFGSNIVFSNGLLDPWSGGGVLENISSSIIALVAPEGAH  452

Query  476   HADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDMDM  360
             H D R++TK DPDWL++QR  EV  + KWI  Y  D ++
Sbjct  453   HLDLRASTKIDPDWLVEQRATEVAYITKWIAAYNSDKNL  491



>ref|XP_002458558.1| hypothetical protein SORBIDRAFT_03g035680 [Sorghum bicolor]
 gb|EES03678.1| hypothetical protein SORBIDRAFT_03g035680 [Sorghum bicolor]
Length=518

 Score =   253 bits (647),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 149/212 (70%), Gaps = 3/212 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   + F+ PLPA P++++C+ ID  P G S + R +A  ++YYNY+GT 
Sbjct  291   SAYSYLAMVDYPLPSEFLMPLPANPIKEVCRNIDSQPEGTSTLERIYAGVNVYYNYTGTV  350

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSK-ESMFPPSSYSYEETERSCQRMYGVKP  651
              CF + D  D HG+ GWDWQACTEMVMPM  S+  SM+PP  + Y      C + YGV+P
Sbjct  351   GCFDLND--DPHGMGGWDWQACTEMVMPMSYSEGRSMYPPYKFDYPSYADGCIKSYGVRP  408

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+ I  VL++FGSNIIF NG+ DPWS GGVLKNIS+S++A+V   GAHH 
Sbjct  409   RPRWITTEFGGHNITTVLEKFGSNIIFFNGLLDPWSGGGVLKNISESVIAIVAPLGAHHI  468

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYY  375
             D R AT +DPDWL+  RE E+ I+  W+ +YY
Sbjct  469   DLRPATPDDPDWLVALRESELKIISGWLSDYY  500



>ref|XP_008654499.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654500.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654501.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654502.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654503.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654504.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 ref|XP_008654505.1| PREDICTED: uncharacterized protein LOC100217003 isoform X1 [Zea 
mays]
 gb|AFW84964.1| putative serine peptidase S28 family protein [Zea mays]
Length=517

 Score =   253 bits (647),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 150/212 (71%), Gaps = 3/212 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   + F+ PLPA P++++C+ ID  P G   + R +A  ++YYNY+GT 
Sbjct  290   SAYSYLAMVDYPLPSEFLMPLPANPIKEVCRNIDSQPKGTGTLERIYAGVNVYYNYTGTV  349

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF + D  D HG+ GWDWQACTEMVMPM  S++ SM+PP  + Y      C + YGV+P
Sbjct  350   DCFDLND--DPHGMGGWDWQACTEMVMPMSYSEQRSMYPPYKFDYASYAEDCIKSYGVRP  407

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+ I +VL+ FGSNIIF NG+ DPWS GGVLKNIS+S+VA+V   GAHH 
Sbjct  408   RPKWITTEFGGHNITKVLENFGSNIIFFNGLLDPWSGGGVLKNISESVVAIVAPLGAHHI  467

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYY  375
             D R AT +DPDWL+  RE E++I+  W+ +YY
Sbjct  468   DLRPATPDDPDWLVALRESELEIISGWLWDYY  499



>gb|AFW84965.1| putative serine peptidase S28 family protein [Zea mays]
Length=515

 Score =   253 bits (646),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 150/212 (71%), Gaps = 3/212 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   + F+ PLPA P++++C+ ID  P G   + R +A  ++YYNY+GT 
Sbjct  288   SAYSYLAMVDYPLPSEFLMPLPANPIKEVCRNIDSQPKGTGTLERIYAGVNVYYNYTGTV  347

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF + D  D HG+ GWDWQACTEMVMPM  S++ SM+PP  + Y      C + YGV+P
Sbjct  348   DCFDLND--DPHGMGGWDWQACTEMVMPMSYSEQRSMYPPYKFDYASYAEDCIKSYGVRP  405

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+ I +VL+ FGSNIIF NG+ DPWS GGVLKNIS+S+VA+V   GAHH 
Sbjct  406   RPKWITTEFGGHNITKVLENFGSNIIFFNGLLDPWSGGGVLKNISESVVAIVAPLGAHHI  465

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYY  375
             D R AT +DPDWL+  RE E++I+  W+ +YY
Sbjct  466   DLRPATPDDPDWLVALRESELEIISGWLWDYY  497



>gb|KEH24169.1| lysosomal pro-X carboxypeptidase-like protein [Medicago truncatula]
Length=501

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 159/215 (74%), Gaps = 6/215 (3%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +A +YTAM +Y T +NF+ PLPAYPV+KMC+ ID   +G    ++ +AAA+++YNYSG+ 
Sbjct  289   TALMYTAMTDYPTPSNFVTPLPAYPVKKMCEAIDSKSSGNETFTKLYAAANIFYNYSGSV  348

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMV-VSKESMFPPSSYSYEETERSCQRMYGVKP  651
              CF I ++S      GWDWQ+CTEM+MP+   ++ES+FP   +  EET   C++ Y + P
Sbjct  349   ICFDISNDSG-----GWDWQSCTEMIMPLGGNNEESIFPAHKWELEETLSYCKQTYHIDP  403

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT FGG+ I +VLKR+GSNIIF NG++DPWS GGVLKNIS +++A+V ++GAHH 
Sbjct  404   RPHWITTEFGGHDIGRVLKRYGSNIIFFNGLRDPWSGGGVLKNISKTLIAIVAKEGAHHV  463

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D R +TK DP+WL   R++EV I+  WI +YY+D+
Sbjct  464   DLRFSTKEDPEWLKDVRKQEVKIITSWISQYYQDL  498



>ref|XP_010463531.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=505

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 150/211 (71%), Gaps = 3/211 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   A+FM PLP +P+ ++C+ IDG  + AS + R +A  S+YYNY+G  
Sbjct  282   SAYSYLAMVDYPYPADFMMPLPGHPIREVCRKIDGANSDASILDRIYAGVSVYYNYTGNV  341

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HGL GW+WQACTEMVMPM  S+E SMFP   ++Y   +  C + + V P
Sbjct  342   DCFELDD--DPHGLDGWNWQACTEMVMPMSSSQENSMFPADGFNYSSYKEECWKTFRVNP  399

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP W TT FGG+ IE  LK FGSNIIFSNG+ DPWS G VLKN+SD+IVALVT++GAHH 
Sbjct  400   RPKWATTEFGGHDIETTLKSFGSNIIFSNGLLDPWSGGSVLKNLSDTIVALVTKEGAHHL  459

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEY  378
             D R +T +DP WL+ QRE E+ ++Q WI  Y
Sbjct  460   DLRPSTPDDPKWLVDQREAEIRLIQGWIETY  490



>ref|XP_011094280.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Sesamum indicum]
Length=510

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 152/215 (71%), Gaps = 1/215 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +A+ YTAM +Y T  NF+ PLPAYPV++MCK ID    G +   + + AA++YYNY+G  
Sbjct  287   TAYTYTAMTDYPTPTNFLAPLPAYPVKQMCKAIDDPKTGNNTFEKLYGAANVYYNYTGDA  346

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF + D+SD HGL GW WQACTEM++    + E S+FPP++YSY +    C+  Y ++P
Sbjct  347   TCFDLADDSDPHGLGGWTWQACTEMILLTDGNTEDSIFPPNNYSYNDRFVFCKDNYNIEP  406

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WI T FG + I +VLKRFGSNIIF NG++DPWS GGVLK+IS S+VA+V ++GAHH 
Sbjct  407   RPTWIPTQFGAHNIYRVLKRFGSNIIFFNGLRDPWSGGGVLKDISKSLVAIVAKEGAHHV  466

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D R +T  DP WL   R +EV I+ KW+ +YYR +
Sbjct  467   DLRFSTSEDPKWLEDVRNREVRIISKWLSQYYRTL  501



>dbj|BAK01568.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=514

 Score =   252 bits (644),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/213 (54%), Positives = 151/213 (71%), Gaps = 3/213 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   + F+ PLPA P++++C+ ID  P  +S + R +A  ++YYNY+GT 
Sbjct  286   SAYSYLAMVDYPMPSEFLMPLPANPIKEVCRNIDKQPERSSILERIYAGVNIYYNYTGTV  345

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HG+ GWDWQACTEMVMPM  S+  SMFPP  + Y      C + +GV+P
Sbjct  346   HCFDLDD--DPHGMGGWDWQACTEMVMPMSSSEGLSMFPPDEFDYALYADDCVKNFGVRP  403

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WI+T FGG+ I  VL++F SNIIF NG+ DPWS GGVLKNISDS+VA+V   GAHH 
Sbjct  404   RPRWISTEFGGHNISSVLEKFSSNIIFFNGLLDPWSGGGVLKNISDSVVAIVAPLGAHHI  463

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYR  372
             D R ATK DPDWL+  RE E++I+  W+ ++YR
Sbjct  464   DLRPATKEDPDWLVSLRESELEIISGWLSDHYR  496



>ref|XP_010518734.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Tarenaya hassleriana]
Length=515

 Score =   252 bits (644),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/214 (55%), Positives = 152/214 (71%), Gaps = 3/214 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   ANFM P+P +P+ ++C+ +D    G S + R FA  S+YYNY+G  
Sbjct  297   SAYSYLAMVDYPYPANFMMPMPGHPIREVCRRVDESHDGTSILDRIFAGVSVYYNYTGNV  356

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HGL GWD+QACTEMVMPM  SKE SMFP   ++Y   +  C  M+ V P
Sbjct  357   GCFKLDD--DPHGLDGWDFQACTEMVMPMSSSKENSMFPTYDFNYSSYKEECWDMFRVIP  414

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+ IE +LK FGSNIIFSNG+ DPWS G +LKNIS++IVALVT++GAHH 
Sbjct  415   RPRWITTEFGGHGIETILKMFGSNIIFSNGLLDPWSGGSILKNISETIVALVTKEGAHHL  474

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             D R +T  DP WL++QRE E+ ++Q WI  Y ++
Sbjct  475   DLRPSTPEDPQWLVEQREAEIRVIQGWINSYRKE  508



>gb|EYU18082.1| hypothetical protein MIMGU_mgv1a005183mg [Erythranthe guttata]
Length=494

 Score =   251 bits (641),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 156/216 (72%), Gaps = 2/216 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +A+ YTAM +Y T  NF+ P+PAYPV++MCK ID   +G +   + +AAAS+YYNY+G  
Sbjct  275   TAYTYTAMTDYPTPTNFLNPMPAYPVKQMCKAIDDPKSGNNTFEKLYAAASIYYNYTGNA  334

Query  827   KCFHIEDESDDHGLH-GWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVK  654
             KCF++ D SD HG+  GW+WQACTEM++    + E S+FP S+YSY +  + C+  Y + 
Sbjct  335   KCFNLIDRSDPHGIRPGWNWQACTEMILLTDGNTEDSIFPASNYSYNDRLQYCKSNYDID  394

Query  653   PRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHH  474
             PRP WI T FG   I +VLKRFGSNIIF NG++DPWS GGVLK+IS S+VA+V ++GAHH
Sbjct  395   PRPTWIPTEFGARHIHRVLKRFGSNIIFFNGLRDPWSGGGVLKDISKSVVAIVAKEGAHH  454

Query  473   ADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
              D R +T+ DP+WL + R++EV I+  W+ +YY  +
Sbjct  455   VDLRFSTREDPEWLREVRKREVHIISNWLSQYYHTL  490



>ref|XP_010444594.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Camelina sativa]
Length=509

 Score =   251 bits (642),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 149/211 (71%), Gaps = 3/211 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   A+FM PLP +P+ ++C+ IDG  + AS + R +A  S+YYNY+G  
Sbjct  286   SAYSYLAMVDYPYPADFMMPLPGHPIREVCRKIDGANSDASILDRIYAGVSVYYNYTGNV  345

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HGL GW+WQACTEMVMPM  S+E SMFP   ++Y   +  C   + V P
Sbjct  346   DCFELDD--DPHGLDGWNWQACTEMVMPMSSSQENSMFPADDFNYSSYKEECWDTFRVNP  403

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP W TT FGG+ IE  LK FGSNIIFSNG+ DPWS G VLKN+SD+IVALVT++GAHH 
Sbjct  404   RPKWATTEFGGHDIETTLKSFGSNIIFSNGLLDPWSGGSVLKNLSDTIVALVTKEGAHHL  463

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEY  378
             D R +T NDP WL+ QRE E+ +++ WI  Y
Sbjct  464   DLRPSTPNDPKWLVDQREAEIGLIEGWIETY  494



>ref|XP_006393989.1| hypothetical protein EUTSA_v10003988mg [Eutrema salsugineum]
 gb|ESQ31275.1| hypothetical protein EUTSA_v10003988mg [Eutrema salsugineum]
Length=526

 Score =   252 bits (644),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 150/211 (71%), Gaps = 3/211 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMVNY   ANFM PLP +P++++C+ IDG  + AS + R FA  S+YYNY+G  
Sbjct  303   SAYSYLAMVNYPYPANFMMPLPGHPIKEVCRKIDGASSDASILDRIFAGISVYYNYTGDV  362

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HGL GW+WQACTEMVMPM  S+E SMFP  +++Y   +  C   + V P
Sbjct  363   DCFELDD--DPHGLDGWNWQACTEMVMPMSSSEENSMFPAYAFNYSSYKDECWNTFRVNP  420

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP W+TT  GG+ IE  LK FGSNIIFSNG+ DPWS G VLKN+S++IVALVT++G HH 
Sbjct  421   RPRWVTTELGGHDIETTLKSFGSNIIFSNGLLDPWSGGSVLKNLSNTIVALVTQEGGHHL  480

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEY  378
             D R +T  DP WL++QRE E+ ++Q WI  Y
Sbjct  481   DLRPSTPEDPKWLVEQREAEIRLIQGWIRTY  511



>gb|KEH31545.1| serine carboxypeptidase S28 family protein [Medicago truncatula]
Length=527

 Score =   252 bits (643),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 120/236 (51%), Positives = 159/236 (67%), Gaps = 25/236 (11%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASL--------  852
             SA+ Y AMVNY   + F+ PLP +P++++C+ ID  PAG S + R F   ++        
Sbjct  287   SAYSYLAMVNYPYPSEFLMPLPGHPIKEVCRRIDKGPAGTSILERIFEGVNVNYNYKGPA  346

Query  851   --------------YYNYSGTEKCFHIEDESDDHGLHGWDWQACTEMVMPMVVS-KESMF  717
                           YYNY+G  KCF ++D  D HGL GW++QACTEMVMPM  S K SMF
Sbjct  347   GTSILERIYEGVNVYYNYTGEAKCFELDD--DPHGLSGWNFQACTEMVMPMSSSRKSSMF  404

Query  716   PPSSYSYEETERSCQRMYGVKPRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRG  537
             PP  Y+Y   +  C + +GVKPRP  ITT FGG+ I   L++FGSNIIFSNG+ DPWS G
Sbjct  405   PPYEYNYSSFQEDCLKNFGVKPRPKQITTVFGGHNIHLALRKFGSNIIFSNGLLDPWSGG  464

Query  536   GVLKNISDSIVALVTEKGAHHADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
              VL+NIS+SIV+LVTE+GAHH D R++T+NDPDWL++QR  EV ++Q WI +YY++
Sbjct  465   SVLQNISESIVSLVTEEGAHHIDLRASTENDPDWLVEQRATEVKLIQGWISDYYQN  520



>ref|XP_009773191.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana sylvestris]
Length=511

 Score =   251 bits (641),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 151/214 (71%), Gaps = 3/214 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AM NY     F+ PLP  P++++C+ IDG P GAS + R F   ++YYNY+G  
Sbjct  293   SAYSYLAMANYPYPTGFLMPLPGSPIKEVCRKIDGLPDGASVLQRIFEGINVYYNYTGKV  352

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF+++D  D HG+ GWDWQACTEMVMPM  +K  SMFP   Y  +  E  C + + VKP
Sbjct  353   DCFNLDD--DPHGMSGWDWQACTEMVMPMASNKTTSMFPEFYYDPKLNEEQCLKDFHVKP  410

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+  +  LK FGSNIIFSNG+ DPWS G VL+++S++IVAL+TEKGAHH 
Sbjct  411   RPTWITTAFGGHAFKSALKAFGSNIIFSNGLLDPWSGGSVLEDVSETIVALITEKGAHHL  470

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             D R+AT  DPDWL++QR  E+ +++ W+ +YY +
Sbjct  471   DLRAATAEDPDWLLEQRSSEIKLIRGWLDKYYDE  504



>ref|XP_009342192.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Pyrus x bretschneideri]
Length=521

 Score =   251 bits (642),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/213 (53%), Positives = 150/213 (70%), Gaps = 1/213 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMVNY   A F+ PLP +P++++C+ ID  P G S + R F   S++YNY+G  
Sbjct  303   SAYSYLAMVNYPYPAEFVMPLPGHPIKEVCRKIDDCPDGTSTLERVFEGVSIFYNYTGQA  362

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPR  648
             +CF +ED S   G  GW+WQACTEMVMPM     SMFP   ++    E  C + Y VKPR
Sbjct  363   ECFELEDTSA-VGTDGWNWQACTEMVMPMSSRDASMFPTYDFNLSSFEEECLKNYNVKPR  421

Query  647   PHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHAD  468
             P WITT +GG+ I+  LK FGSNIIFSNG+ DPWS G VL+N+S++IVALV E+GAHH D
Sbjct  422   PTWITTEYGGHDIKATLKAFGSNIIFSNGLLDPWSGGSVLQNVSETIVALVAEEGAHHLD  481

Query  467   FRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
              R +TK+DP WLI+QRE E+ +++ WI ++Y+D
Sbjct  482   LRFSTKDDPKWLIEQRETEIKLIEGWIEKFYQD  514



>ref|XP_011073662.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Sesamum indicum]
Length=518

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/213 (55%), Positives = 150/213 (70%), Gaps = 3/213 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AM +Y   A+F+ P+PA P++++CK ID  P G S I R     S+YYNY+G  
Sbjct  300   SAYSYLAMADYPYPADFLMPMPANPIKEVCKKIDNCPDGTSIIQRIVEGVSVYYNYTGKV  359

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HG++GW+WQACTEMVMP   SK+ SMFP   Y+Y   E  C   Y VKP
Sbjct  360   DCFDLDD--DPHGMNGWNWQACTEMVMPTSSSKDASMFPAYDYNYTSDEEWCWENYRVKP  417

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WI+T FGG+  +  LK FGSNIIFSNG+ DPWS G VL++IS++IVALVTEKGAHH 
Sbjct  418   RPTWISTEFGGHGFKHTLKNFGSNIIFSNGLLDPWSGGSVLEDISETIVALVTEKGAHHL  477

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYR  372
             D R AT  DPDWL++QR  EV ++Q W+ EY++
Sbjct  478   DLRPATAEDPDWLVEQRAAEVKLIQGWLDEYFK  510



>ref|XP_002864979.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH41238.1| serine carboxypeptidase S28 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=514

 Score =   250 bits (639),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 149/211 (71%), Gaps = 3/211 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   A+FM PLP +P+ ++C+ IDG  + AS + R FA  S+YYNY+G  
Sbjct  291   SAYSYLAMVDYPYPADFMMPLPGHPIREVCRKIDGAHSDASILDRIFAGISVYYNYTGNV  350

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HGL GW+WQACTEMVMPM  ++E SMFP   ++Y   +  C   + V P
Sbjct  351   DCFKLDD--DPHGLDGWNWQACTEMVMPMSSNQEKSMFPAYDFNYSSYKEECWNTFRVNP  408

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP W+TT FGG+ IE  LK FGSNIIFSNGM DPWS G VLKN+S++IVALVT++GAHH 
Sbjct  409   RPKWVTTEFGGHDIETTLKLFGSNIIFSNGMLDPWSGGSVLKNLSNTIVALVTKEGAHHL  468

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEY  378
             D R +T  DP WL+ QRE E+ ++Q WI  Y
Sbjct  469   DLRPSTPEDPKWLVDQREAEIQLIQGWIETY  499



>ref|XP_003521479.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Glycine max]
Length=504

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 156/213 (73%), Gaps = 4/213 (2%)
 Frame = -3

Query  989  AMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIE  810
            AM +Y T + F+ PLPAYPV KMC+ ID   A     ++ +AAA+++YNY+GT  CF ++
Sbjct  295  AMTDYPTPSVFLAPLPAYPVRKMCEAIDNLSAVNETFTKLYAAANIFYNYTGTATCFFLD  354

Query  809  DESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKPRPHWIT  633
            + +   G  GWDWQACTE++MP+  + E SMFPP  +   + E  C+R+Y ++PRPHWIT
Sbjct  355  NTTAPLG--GWDWQACTELIMPLGANNEGSMFPPYKWKLRDVEFYCKRVYHIQPRPHWIT  412

Query  632  THFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSAT  453
            T FGG+ I++VLKR GSNIIF NG++DPWS GGVLKNIS++IVA+V ++GAHH D R +T
Sbjct  413  TEFGGHDIKRVLKRSGSNIIFFNGLRDPWSGGGVLKNISETIVAIVAKEGAHHVDLRFST  472

Query  452  KNDPDWLIQQREKEVDILQKWIGEYYRDMDMNQ  354
              DP+WL   R++E+ I+  WI +YY+D+ +NQ
Sbjct  473  TEDPEWLKDIRKREIKIIANWISQYYQDL-LNQ  504



>gb|ABR17682.1| unknown [Picea sitchensis]
Length=501

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 155/216 (72%), Gaps = 2/216 (1%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             + A+   AM +Y   ANF++PLPAYPV++MCK ID        +S+ +  A++YYNY+G 
Sbjct  281   YDAYYTAAMTDYPVAANFVQPLPAYPVKQMCKAIDNPSGSTDLLSQLYGVANVYYNYTGR  340

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVS-KESMFPPSSYSYEETERSCQRMYGVK  654
               CF I   SD HG  GW +QACTEMVMPM    K+SMFP S++ Y+E   SC+  YGV+
Sbjct  341   SSCFDIR-PSDPHGEDGWQFQACTEMVMPMADDPKKSMFPNSTFDYQERVDSCESAYGVQ  399

Query  653   PRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHH  474
             PR HWITT +GG+ I++VLK F SNIIF NG++DPWS GGVL++I++S+VA+V ++GAHH
Sbjct  400   PRRHWITTQYGGHHIKRVLKNFASNIIFFNGLRDPWSGGGVLEDINESVVAIVAKEGAHH  459

Query  473   ADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
              DFR ATK+DP WL   R KE+ I++ W+ +YY ++
Sbjct  460   VDFRFATKDDPQWLKDARTKEISIIKSWLQQYYMEL  495



>ref|XP_009592890.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Nicotiana tomentosiformis]
Length=511

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 149/214 (70%), Gaps = 3/214 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AM NY    +F+ PLP  P++++C+ ID  P GAS + R F   ++YYNY+GT 
Sbjct  293   SAYSYLAMANYPYPTDFLMPLPGSPIKEVCRKIDSLPDGASVLQRIFEGINVYYNYTGTV  352

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF+++D  D HG+ GWDWQACTEMVMPM  ++  SMFP   Y     E  C + + VKP
Sbjct  353   DCFNLDD--DPHGMGGWDWQACTEMVMPMASNRTTSMFPEFYYDPTSNEEQCLKDFHVKP  410

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+  +  LK FGSNIIFSNG+ DPWS G VL+N+S +IVAL TEKGAHH 
Sbjct  411   RPTWITTEFGGHAFKSALKAFGSNIIFSNGLLDPWSGGSVLENVSKTIVALTTEKGAHHL  470

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             D R+ T +DPDWL++QR  E+ +++ W+ +YY +
Sbjct  471   DLRAGTASDPDWLLEQRSSEIKLIRGWLDKYYDE  504



>ref|XP_011031335.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Populus euphratica]
Length=515

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 149/214 (70%), Gaps = 3/214 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   ++FM PLP YP+ ++CK IDG P G S + R F   S+YYNY+G  
Sbjct  297   SAYSYLAMVDYPYPSSFMMPLPGYPIREVCKRIDGCPDGTSILERIFEGISIYYNYTGEL  356

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HGL GW+WQACTEMVMPM  S + SMF    ++Y   +  C   +GV P
Sbjct  357   HCFELDD--DPHGLDGWNWQACTEMVMPMSSSHDASMFSTYDFNYSSYQEGCWEEFGVIP  414

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WIT  FGG  I+  L+ FGSNIIFSNG+ DPWS G VL+NIS+++VALVTE+GAHH 
Sbjct  415   RPRWITMEFGGQDIKTALETFGSNIIFSNGLLDPWSGGSVLQNISETVVALVTEEGAHHI  474

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             D R +T  DPDWL++QRE EV +++ WI  Y ++
Sbjct  475   DLRPSTPEDPDWLVEQRETEVKLIKGWIDGYLKE  508



>emb|CDY45627.1| BnaCnng13350D [Brassica napus]
Length=506

 Score =   249 bits (635),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 148/211 (70%), Gaps = 3/211 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   A+FM PLP +P++++C+ IDG  + AS + R +A  S+YYNY+G  
Sbjct  283   SAYSYLAMVDYPYPADFMMPLPGHPIKEVCRKIDGASSDASILERIYAGVSVYYNYTGKV  342

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HGL GW+WQACTEMVMPM  S+E SMF    ++Y   +  C   +GV P
Sbjct  343   GCFELDD--DPHGLDGWNWQACTEMVMPMSSSQENSMFTAYDFNYSSYKEDCWNTFGVNP  400

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP W+TT  GG+ IE  LK FGSNIIFSNG+ DPWS G VLKN+S +IVALVTE+G HH 
Sbjct  401   RPRWVTTELGGHDIETALKSFGSNIIFSNGLLDPWSGGSVLKNLSSTIVALVTEEGGHHL  460

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEY  378
             D R +T  DP WL++QRE E+ ++Q WI  Y
Sbjct  461   DLRPSTPEDPKWLVEQREAEIGLIQGWIRTY  491



>ref|XP_011466418.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Fragaria 
vesca subsp. vesca]
Length=506

 Score =   249 bits (635),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 149/214 (70%), Gaps = 5/214 (2%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMVNY   + FM PLP +P+ ++C+ IDG P G S + R F   S+YYNYSG  
Sbjct  290   SAYSYLAMVNYPYGSEFMMPLPGHPIREVCRRIDGCPDGTSTLERVFEGISVYYNYSGNA  349

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF +ED SD  G  GW+WQACTEMVMPM  S++ SMF    Y++   +  C +    KP
Sbjct  350   DCFELEDTSD-VGTDGWNWQACTEMVMPMSSSRDRSMFKTYDYNFSSFQDWCWKELNAKP  408

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+     LK FGSNIIFSNG+ DPWS G VL+NIS SIVALVTE+GAHH 
Sbjct  409   RPTWITTEFGGH---ATLKNFGSNIIFSNGLLDPWSGGSVLQNISQSIVALVTEEGAHHI  465

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             D R +TK DPDWL++QRE E+ ++Q W+ E+Y++
Sbjct  466   DLRFSTKGDPDWLVEQRESEIKLIQGWLDEFYQE  499



>ref|XP_012079471.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Jatropha curcas]
 gb|KDP32128.1| hypothetical protein JCGZ_12589 [Jatropha curcas]
Length=514

 Score =   249 bits (636),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 151/211 (72%), Gaps = 3/211 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   + FM PLP +P+ ++CK IDG P G + + R F   S+YYNY+G  
Sbjct  296   SAYSYLAMVDYPYPSAFMMPLPGHPIREVCKKIDGSPDGTNILERIFEGVSIYYNYTGDV  355

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HGL GW+WQACTEMVMPM  SK+ SMF    ++Y   +  C + +GV+P
Sbjct  356   DCFELDD--DPHGLDGWNWQACTEMVMPMASSKDASMFLTYDFNYTSFKEECLKNFGVEP  413

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+ I+  L+ FGSNIIFSNG+ DPWS G VL+N+S+++VALVT++GAHH 
Sbjct  414   RPRWITTEFGGHDIKTALESFGSNIIFSNGLLDPWSGGSVLQNLSETVVALVTKEGAHHI  473

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEY  378
             D RS+T  DPDWL++QR  E+ +++ WI  Y
Sbjct  474   DLRSSTPEDPDWLVEQRATEIKLIEGWINGY  504



>ref|XP_007162943.1| hypothetical protein PHAVU_001G193200g [Phaseolus vulgaris]
 gb|ESW34937.1| hypothetical protein PHAVU_001G193200g [Phaseolus vulgaris]
Length=506

 Score =   248 bits (634),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 158/219 (72%), Gaps = 3/219 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +A+VYTAM +Y T +NF+ PLPAYP++KMC+ ID        + + +AAAS+YYNY+GT 
Sbjct  290   TAWVYTAMTDYPTPSNFLSPLPAYPIKKMCEAIDR--EKNDGLGKLYAAASVYYNYTGTA  347

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVS-KESMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D+SD H L GW WQACTEM+MP+  S K S+FP   +SY++   +CQ  Y V P
Sbjct  348   TCFDLDDDSDPHDLGGWQWQACTEMIMPVGGSNKHSIFPEYVWSYQDRASACQFFYNVTP  407

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT FGG+ I+ VLKR  SNIIF NG++DPWS GGVLKNIS +IVA+V ++GAHH 
Sbjct  408   RPHWITTEFGGHAIQTVLKRSASNIIFFNGLRDPWSGGGVLKNISKTIVAIVEKRGAHHV  467

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDMDMNQ  354
             D R + K DP WL   R +EV+I+  WI +YY+D+  N 
Sbjct  468   DLRYSAKEDPKWLKDVRRQEVNIIASWISQYYQDLHSNN  506



>ref|XP_009372536.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Pyrus x bretschneideri]
Length=514

 Score =   249 bits (635),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 156/215 (73%), Gaps = 1/215 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +AF YTAM +Y T +NF+ P+PA+PV++MC  ID    G     + + AAS+YYNYSG  
Sbjct  296   TAFTYTAMTDYPTPSNFLSPMPAFPVKQMCAAIDDPTTGNDTFKKLYGAASVYYNYSGKA  355

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D+SD H L GW WQACTEM+MPM  + E S+FP S + Y+    SC R +G++P
Sbjct  356   TCFDLDDDSDPHDLGGWSWQACTEMIMPMGGNTEVSIFPASEWKYKYRAASCMRNFGIEP  415

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+ I++VLKR+GSNIIF NG++DPWS GGVLKNIS SIVA+V ++GAHH 
Sbjct  416   RPLWITTEFGGHDIKRVLKRYGSNIIFFNGLRDPWSGGGVLKNISKSIVAIVAKEGAHHV  475

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D R     DP+WL + R++E++I+  WI +YY D+
Sbjct  476   DLRFKNSEDPEWLKEVRKQEINIIGNWISQYYHDL  510



>ref|XP_010245640.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Nelumbo 
nucifera]
Length=519

 Score =   248 bits (634),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 149/214 (70%), Gaps = 1/214 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   ++FM PLP  P++++C+ ID FP G S + R FA  S+YYNY+G  
Sbjct  298   SAYSYLAMVDYPYPSDFMMPLPGNPIKEVCRKIDSFPDGTSTLERIFAGVSVYYNYTGVV  357

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF + + + D G  GWDWQACTEMVMPM  S+  SMF    ++Y   +  C + +G+KP
Sbjct  358   DCFDLGESNQDLGADGWDWQACTEMVMPMSSSQSTSMFTAYDFNYSSYQDECFKHFGIKP  417

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             R  WITT FGG+ +   LK FGSNIIFSNG+ DPWS GGVL+N+S++I ALVT++GAHH 
Sbjct  418   RSRWITTEFGGHNLLTDLKTFGSNIIFSNGLLDPWSGGGVLQNVSETITALVTKEGAHHI  477

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             D R +   DPDWL++QR  EV ++  WI +YY++
Sbjct  478   DLRPSIDEDPDWLVEQRASEVKLITGWINKYYQE  511



>ref|XP_006363792.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Solanum tuberosum]
Length=521

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 147/212 (69%), Gaps = 3/212 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMVNY    +F+ PLP  P++++C+ ID  P GAS + R F   S+YYNY+G  
Sbjct  302   SAYSYLAMVNYPYSTDFLMPLPGSPIKEVCRKIDSLPDGASVLQRIFEGISIYYNYTGKV  361

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF + D  D HG+ GWDWQACTEM+MPM  ++  SMFP   Y  +  E  C + + VKP
Sbjct  362   DCFDLND--DPHGMSGWDWQACTEMIMPMASNRTTSMFPEFYYDPKSNEEQCLKDFHVKP  419

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+  +  LK FGSNIIFSNG+ DPWS G VL+++S++IVAL T+KGAHH 
Sbjct  420   RPTWITTEFGGHAFKSALKAFGSNIIFSNGLLDPWSGGSVLEDVSETIVALTTKKGAHHL  479

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYY  375
             D R+AT  DPDWL+ QR  E+ +++ W+ E+Y
Sbjct  480   DLRAATAEDPDWLLDQRSSEIKLIRGWLDEHY  511



>ref|XP_010316042.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Solanum 
lycopersicum]
Length=489

 Score =   247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 147/212 (69%), Gaps = 3/212 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMVNY    +F+ PLP  P++++C+ ID  P GAS + R F   S+YYNY+G  
Sbjct  270   SAYSYLAMVNYPYPTDFLMPLPGSPIKEVCRKIDSLPDGASVLQRIFEGISIYYNYTGKV  329

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVS-KESMFPPSSYSYEETERSCQRMYGVKP  651
              CF++ D  D HG+ GWDWQACTEM+MPM  +   SMFP   Y  +  E  C + + VKP
Sbjct  330   DCFNLND--DPHGMSGWDWQACTEMIMPMASNMTTSMFPEFYYDPKSNEEQCLKDFRVKP  387

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+  +  LK FGSNIIFSNG+ DPWS G VL+++S++IVAL T+KGAHH 
Sbjct  388   RPTWITTEFGGHAFKSALKAFGSNIIFSNGLLDPWSGGSVLEDVSETIVALTTKKGAHHL  447

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYY  375
             D R+AT  DPDWL+ QR  E+ +++ W+ E+Y
Sbjct  448   DLRAATAEDPDWLLDQRSSEIKLIRGWLDEHY  479



>ref|NP_201377.2| Serine carboxypeptidase S28 family protein [Arabidopsis thaliana]
 gb|ABF57288.1| At5g65760 [Arabidopsis thaliana]
 dbj|BAF00060.1| lysosomal Pro-X carboxypeptidase [Arabidopsis thaliana]
 gb|AED98102.1| Serine carboxypeptidase S28 family protein [Arabidopsis thaliana]
Length=515

 Score =   247 bits (631),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 148/211 (70%), Gaps = 3/211 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   A+FM PLP +P+ ++C+ IDG  + AS + R +A  S+YYNY+G  
Sbjct  292   SAYSYLAMVDYPYPADFMMPLPGHPIREVCRKIDGAGSNASILDRIYAGISVYYNYTGNV  351

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HGL GW+WQACTEMVMPM  ++E SMFP   ++Y   +  C   + V P
Sbjct  352   DCFKLDD--DPHGLDGWNWQACTEMVMPMSSNQENSMFPGYGFNYSSYKEECWNTFRVNP  409

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP W+TT FGG+ I   LK FGSNIIFSNG+ DPWS G VLKN+SD+IVALVT++GAHH 
Sbjct  410   RPKWVTTEFGGHDIATTLKSFGSNIIFSNGLLDPWSGGSVLKNLSDTIVALVTKEGAHHL  469

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEY  378
             D R +T  DP WL+ QRE E+ ++Q WI  Y
Sbjct  470   DLRPSTPEDPKWLVDQREAEIRLIQGWIETY  500



>ref|XP_004231954.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Solanum 
lycopersicum]
Length=505

 Score =   247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/214 (52%), Positives = 148/214 (69%), Gaps = 3/214 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMVNY    +F+ PLP  P++++C+ ID  P GAS + R F   S+YYNY+G  
Sbjct  286   SAYSYLAMVNYPYPTDFLMPLPGSPIKEVCRKIDSLPDGASVLQRIFEGISIYYNYTGKV  345

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVS-KESMFPPSSYSYEETERSCQRMYGVKP  651
              CF++ D  D HG+ GWDWQACTEM+MPM  +   SMFP   Y  +  E  C + + VKP
Sbjct  346   DCFNLND--DPHGMSGWDWQACTEMIMPMASNMTTSMFPEFYYDPKSNEEQCLKDFRVKP  403

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+  +  LK FGSNIIFSNG+ DPWS G VL+++S++IVAL T+KGAHH 
Sbjct  404   RPTWITTEFGGHAFKSALKAFGSNIIFSNGLLDPWSGGSVLEDVSETIVALTTKKGAHHL  463

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             D R+AT  DPDWL+ QR  E+ +++ W+ E+Y +
Sbjct  464   DLRAATAEDPDWLLDQRSSEIKLIRGWLDEHYDE  497



>dbj|BAB10683.1| lysosomal Pro-X carboxypeptidase [Arabidopsis thaliana]
Length=529

 Score =   247 bits (631),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/211 (54%), Positives = 148/211 (70%), Gaps = 3/211 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   A+FM PLP +P+ ++C+ IDG  + AS + R +A  S+YYNY+G  
Sbjct  306   SAYSYLAMVDYPYPADFMMPLPGHPIREVCRKIDGAGSNASILDRIYAGISVYYNYTGNV  365

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HGL GW+WQACTEMVMPM  ++E SMFP   ++Y   +  C   + V P
Sbjct  366   DCFKLDD--DPHGLDGWNWQACTEMVMPMSSNQENSMFPGYGFNYSSYKEECWNTFRVNP  423

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP W+TT FGG+ I   LK FGSNIIFSNG+ DPWS G VLKN+SD+IVALVT++GAHH 
Sbjct  424   RPKWVTTEFGGHDIATTLKSFGSNIIFSNGLLDPWSGGSVLKNLSDTIVALVTKEGAHHL  483

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEY  378
             D R +T  DP WL+ QRE E+ ++Q WI  Y
Sbjct  484   DLRPSTPEDPKWLVDQREAEIRLIQGWIETY  514



>gb|EPS74090.1| hypothetical protein M569_00662, partial [Genlisea aurea]
Length=490

 Score =   246 bits (627),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 156/215 (73%), Gaps = 1/215 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +A +YTAM +Y T ++F+ PLPA+PV++MC+ ID    G S  ++ + AA++YYNYSG  
Sbjct  276   TALIYTAMTDYPTPSDFLAPLPAHPVKQMCEAIDDPTTGNSTFAKMYGAANVYYNYSGNA  335

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF + D+SD HG++GW WQACTEM++    ++E S+F  S+YSY +    C+  YGV+P
Sbjct  336   TCFDLADDSDPHGVNGWYWQACTEMILITDGNREESIFTASNYSYNDRREYCKDKYGVEP  395

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP+W  T FG + I++ LK FGS+IIF NG++DPWS GGVLKN+S+S+VA+V ++GAHH 
Sbjct  396   RPNWAPTEFGAHNIKRALKNFGSSIIFFNGLRDPWSGGGVLKNLSESLVAIVAKEGAHHV  455

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D R +TK DP WL+  R++E +I+  W+  Y+ D+
Sbjct  456   DLRFSTKEDPKWLVDVRKRETEIISTWLSHYHSDI  490



>ref|XP_006280309.1| hypothetical protein CARUB_v10026232mg [Capsella rubella]
 gb|EOA13207.1| hypothetical protein CARUB_v10026232mg [Capsella rubella]
Length=518

 Score =   246 bits (628),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 147/211 (70%), Gaps = 3/211 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   A+FM PLP  P+ ++C+ IDG  + A+ + R +A  S+YYNY+G  
Sbjct  295   SAYSYLAMVDYPYPADFMMPLPGDPIREVCRKIDGANSDATVLDRIYAGVSVYYNYTGNI  354

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSK-ESMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HGL GW+WQACTEMVMPM  S+  SMFP   ++Y   +  C   + V P
Sbjct  355   DCFELDD--DPHGLDGWNWQACTEMVMPMSSSQGNSMFPADDFNYSSYKEECWNTFRVNP  412

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP W+TT FGG+ IE  LK FGSNIIFSNG+ DPWS G VLKN+S+SI+ALVT++GAHH 
Sbjct  413   RPKWVTTEFGGHDIETTLKLFGSNIIFSNGLLDPWSGGSVLKNLSNSIIALVTKEGAHHL  472

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEY  378
             D R +T  DP WL+ QRE E+ ++Q WI  Y
Sbjct  473   DLRPSTPEDPKWLVDQREAEIRLIQGWIETY  503



>gb|AGV54352.1| lysosomal Pro-X carboxypeptidase-like protein [Phaseolus vulgaris]
Length=506

 Score =   245 bits (626),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 151/213 (71%), Gaps = 3/213 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA  Y  M+NY   + F+  LP + + ++CK IDG PAG S +   +   ++Y NY+G  
Sbjct  288   SADRYMTMMNYPYPSEFLMTLPGHRIREVCKKIDGVPAGTSILEGIYEGVNVYCNYTGKR  347

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKES-MFPPSSYSYEETERSCQRMYGVKP  651
             KCF ++D  D HG+ GWDWQACTEMVMPM  +++S MFPP   +Y   +  C   YGVKP
Sbjct  348   KCFEVDD--DRHGMSGWDWQACTEMVMPMSSNQDSSMFPPYECNYTSFQEECLNDYGVKP  405

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+ I   LK+FGS+IIFSNG+ DPWS G VL+NIS+S+V+LVTE+GAHH 
Sbjct  406   RPKWITTEFGGHDIHATLKKFGSDIIFSNGLLDPWSGGSVLQNISESVVSLVTEEGAHHI  465

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYR  372
             D R +T+NDP WL++QRE E+ +++ WI +Y++
Sbjct  466   DLRPSTQNDPYWLVEQRETEIKLIEGWISDYHQ  498



>ref|XP_010026544.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=515

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 143/207 (69%), Gaps = 3/207 (1%)
 Frame = -3

Query  989  AMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIE  810
            AMVNY   ++F+ PLP YP+ ++C+ IDG P G S + R F   S+YYNY+G   CF + 
Sbjct  305  AMVNYPYPSDFLMPLPGYPIREVCRKIDGCPDGTSILERVFEGVSVYYNYTGKVDCFDLY  364

Query  809  DESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKPRPHWIT  633
            D  D HG+ GWDWQ+CTEMVMPM  +   SMFP   +     +  C+  Y V PRP WIT
Sbjct  365  D--DPHGMAGWDWQSCTEMVMPMSSNPHTSMFPRYDFDLSADKEYCRTEYKVNPRPEWIT  422

Query  632  THFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSAT  453
            T FGG  I   LK FGSNIIFSNG+ DPWS G V KN+SDSIVAL T++GAHH D R+AT
Sbjct  423  TEFGGKDIMTTLKTFGSNIIFSNGLLDPWSGGSVTKNVSDSIVALNTQEGAHHLDLRAAT  482

Query  452  KNDPDWLIQQREKEVDILQKWIGEYYR  372
             +DPDWL++QR  E+ +++KW+ +YY+
Sbjct  483  AHDPDWLVEQRATEIKLIRKWLRDYYQ  509



>ref|XP_010023346.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=528

 Score =   246 bits (627),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/213 (52%), Positives = 147/213 (69%), Gaps = 3/213 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ + AMV+Y   + F+ PLP YP+ ++C+ IDG P G S + R F   S+YYNY+G  
Sbjct  299   SAYSFLAMVDYPYPSEFLMPLPGYPIREVCRKIDGCPDGTSILERVFEGVSVYYNYTGEV  358

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HG+ GW+WQACTEMVMPM  S + SMFP   +++   +  C   + V P
Sbjct  359   DCFELDD--DPHGMDGWNWQACTEMVMPMSSSPDASMFPTYDFNFSAFQEECWTDFKVIP  416

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITTHFGG  I   LK FGSNIIFSNG  DPWS   V +N+SDS+VAL T++GAHH 
Sbjct  417   RPTWITTHFGGKDIMTTLKTFGSNIIFSNGFLDPWSGYSVTQNVSDSLVALNTQEGAHHI  476

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYR  372
             D R+AT  DPDWL++QR  E+ +++KW+ +YY+
Sbjct  477   DLRAATAEDPDWLVEQRAAEIKLMKKWLSDYYQ  509



>ref|XP_009383556.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Musa acuminata 
subsp. malaccensis]
Length=496

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/218 (51%), Positives = 151/218 (69%), Gaps = 3/218 (1%)
 Frame = -3

Query  1004  AFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEK  825
             A VY AM +Y T ++F+ PLPAYPV++MCK ID   +G    +R + A ++YYNY+G   
Sbjct  279   ALVYGAMTDYPTVSDFLTPLPAYPVKQMCKAIDDPISGNDTFARLYGAMNIYYNYTGKAT  338

Query  824   CFHIEDES--DDHGLHGWDWQACTEMVMPMV-VSKESMFPPSSYSYEETERSCQRMYGVK  654
             CF +  +S  D  G  GW+WQ+CTEM++P    S+ESMFP + YSY++    C+  YGV 
Sbjct  339   CFDVNTDSLDDTVGTDGWNWQSCTEMILPTGGRSEESMFPANKYSYDDNAGFCESYYGVA  398

Query  653   PRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHH  474
             PRPHWITT FGG+ I +VLKRFGSNIIF NG++DPWS GGVLK+++ S+ A+V  +GAHH
Sbjct  399   PRPHWITTEFGGHDITRVLKRFGSNIIFFNGLRDPWSGGGVLKSLNPSLKAMVVPQGAHH  458

Query  473   ADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDMDM  360
              D R +TK DP WL   R KE++I+  W  ++Y D  +
Sbjct  459   VDLRYSTKEDPMWLQNVRRKEINIIAGWTNQFYADSKL  496



>gb|KCW59597.1| hypothetical protein EUGRSUZ_H02342 [Eucalyptus grandis]
Length=550

 Score =   245 bits (626),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 143/207 (69%), Gaps = 3/207 (1%)
 Frame = -3

Query  989  AMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIE  810
            AMVNY   ++F+ PLP YP+ ++C+ IDG P G S + R F   S+YYNY+G   CF + 
Sbjct  340  AMVNYPYPSDFLMPLPGYPIREVCRKIDGCPDGTSILERVFEGVSVYYNYTGKVDCFDLY  399

Query  809  DESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKPRPHWIT  633
            D  D HG+ GWDWQ+CTEMVMPM  +   SMFP   +     +  C+  Y V PRP WIT
Sbjct  400  D--DPHGMAGWDWQSCTEMVMPMSSNPHTSMFPRYDFDLSADKEYCRTEYKVNPRPEWIT  457

Query  632  THFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSAT  453
            T FGG  I   LK FGSNIIFSNG+ DPWS G V KN+SDSIVAL T++GAHH D R+AT
Sbjct  458  TEFGGKDIMTTLKTFGSNIIFSNGLLDPWSGGSVTKNVSDSIVALNTQEGAHHLDLRAAT  517

Query  452  KNDPDWLIQQREKEVDILQKWIGEYYR  372
             +DPDWL++QR  E+ +++KW+ +YY+
Sbjct  518  AHDPDWLVEQRATEIKLIRKWLRDYYQ  544



>gb|EMT33353.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=347

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 142/200 (71%), Gaps = 3/200 (2%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   + F+ PLPA P++++C+ ID  P G+S + R +A  ++YYNY+GT 
Sbjct  137   SAYSYLAMVDYPMPSEFLMPLPANPIKEVCRNIDKQPEGSSILERIYAGVNIYYNYTGTV  196

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HG+ GWDWQACTEMVMPM  S+  SMFPP  + Y      C + +GV+P
Sbjct  197   DCFDLDD--DPHGMGGWDWQACTEMVMPMSSSEGLSMFPPDEFDYALYADDCVKNFGVRP  254

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WI+T FGG+ I  VL++FGSNIIF NG+ DPWS GGVLKNIS+S+VA+V   GAHH 
Sbjct  255   RPRWISTEFGGHNISSVLEKFGSNIIFFNGLLDPWSGGGVLKNISESVVAIVAPLGAHHI  314

Query  470   DFRSATKNDPDWLIQQREKE  411
             D R ATK DPDWLI   E +
Sbjct  315   DLRPATKEDPDWLISCGESK  334



>ref|XP_009150668.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brassica rapa]
Length=506

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 146/211 (69%), Gaps = 3/211 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   A+FM PLP +P++++C+ IDG  + AS + R +A  S+YYNY+G  
Sbjct  283   SAYSYLAMVDYPYPADFMMPLPGHPIKEVCRKIDGASSDASILERIYAGVSVYYNYTGKV  342

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVS-KESMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HGL GW+WQACTEMVMPM  S K SMF    ++Y   +  C   + V P
Sbjct  343   GCFELDD--DPHGLDGWNWQACTEMVMPMSSSQKNSMFTAYDFNYSSYKEDCWNTFRVNP  400

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP W+TT  GG+ IE  LK FGSNIIFSNG+ DPWS G VLKN+S +IVALVT++G HH 
Sbjct  401   RPRWVTTELGGHDIETTLKSFGSNIIFSNGLLDPWSGGSVLKNLSSTIVALVTKEGGHHL  460

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEY  378
             D R +T  DP WL++QRE E+ ++Q WI  Y
Sbjct  461   DLRPSTPEDPKWLVEQREAEIGLIQGWIRTY  491



>emb|CDY08753.1| BnaA06g24710D [Brassica napus]
Length=506

 Score =   244 bits (622),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 146/211 (69%), Gaps = 3/211 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   A+FM PLP +P++++C+ IDG  + AS + R +A  S+YYNY+G  
Sbjct  283   SAYSYLAMVDYPYPADFMMPLPGHPIKEVCRKIDGASSDASILERIYAGVSVYYNYTGKV  342

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVS-KESMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HGL GW+WQACTEMVMPM  S K SMF    ++Y   +  C   + V P
Sbjct  343   GCFELDD--DPHGLDGWNWQACTEMVMPMSSSQKNSMFTAYDFNYSSYKEDCWNTFRVNP  400

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP W+TT  GG+ IE  LK FGSNIIFSNG+ DPWS G VLKN+S +IVALVT++G HH 
Sbjct  401   RPRWVTTELGGHDIETTLKSFGSNIIFSNGLLDPWSGGSVLKNLSSTIVALVTKEGGHHL  460

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEY  378
             D R +T  DP WL++QRE E+ ++Q WI  Y
Sbjct  461   DLRPSTPEDPKWLVEQREAEIGLIQGWIRTY  491



>ref|XP_010680789.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010680790.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Beta vulgaris 
subsp. vulgaris]
Length=498

 Score =   243 bits (620),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/214 (51%), Positives = 149/214 (70%), Gaps = 3/214 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMVNY   ++F+  LP +P+ ++C+ ID    G S + R F   ++YYNYSGT 
Sbjct  276   SAYSYLAMVNYPYPSDFLMSLPGHPIREVCRRIDSAADGTSVLDRIFNGVTVYYNYSGTV  335

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVS-KESMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HG+ GW WQACTEMVMPM    K SMFP  +++Y   +  C + YGVKP
Sbjct  336   DCFKLDD--DPHGMSGWQWQACTEMVMPMSSDPKTSMFPTFTFNYTYEQERCMKSYGVKP  393

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             R  WITT FGG+  +   K  GSNIIF++G+ DPWS G VL+N+S+++VALVTE+GAHH 
Sbjct  394   RGRWITTEFGGHDFKTTWKESGSNIIFASGLLDPWSGGSVLQNVSETLVALVTEEGAHHL  453

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             D R++T NDPDWL+QQR  E+ ++Q WI +Y R+
Sbjct  454   DLRASTPNDPDWLVQQRASEIRLIQGWIDDYNRN  487



>ref|XP_003569899.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Brachypodium distachyon]
Length=512

 Score =   243 bits (620),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 147/212 (69%), Gaps = 3/212 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ + AMV+Y   ++F+ PLP+ P++++C+ ID    G S + R +A  ++YYNY+GT 
Sbjct  283   SAYGFLAMVDYPMSSDFLMPLPSNPIKEVCRNIDKQLDGTSTLERIYAGVNIYYNYTGTV  342

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HG+ GW WQACTEMVMPM  S+  SMFPP  + Y      C + +GV+P
Sbjct  343   DCFDLDD--DPHGMGGWQWQACTEMVMPMSSSESLSMFPPYEFDYASYADDCVKSFGVRP  400

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
              P WITT FGG+ I  VL++FGSNIIF NG+ DPWS GGVLKNIS S+VA+V   GAHH 
Sbjct  401   SPRWITTEFGGHNISAVLEKFGSNIIFFNGLLDPWSGGGVLKNISGSVVAIVAPLGAHHI  460

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYY  375
             D R ATK DPDWL+  RE E+ I+  W+ ++Y
Sbjct  461   DLRPATKEDPDWLVSLRESELGIISGWLSDHY  492



>ref|XP_008237071.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Prunus mume]
Length=517

 Score =   242 bits (617),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/214 (52%), Positives = 151/214 (71%), Gaps = 2/214 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMVNY   A F+ PLP +P++++C+ IDG P G S + R F   S++YNY+G  
Sbjct  298   SAYSYLAMVNYPYAAEFVMPLPGHPIKEVCRKIDGCPDGTSTLERIFEGVSIFYNYTGQA  357

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
             KCF + D+SD  G  GW+WQACTEMVMPM  S++ SMF    Y+    +  C + Y VKP
Sbjct  358   KCFELIDDSD-VGTDGWNWQACTEMVMPMSCSQDASMFQTYDYNLSSFQEECWKDYNVKP  416

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP  ITT FGG+ I+  LK FGSNIIFSNG+ DPWS G VL+N+S++IVALVTE+GAHH 
Sbjct  417   RPTRITTEFGGHDIKATLKSFGSNIIFSNGLLDPWSGGSVLQNVSETIVALVTEEGAHHI  476

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             D R + K DP+WL+ QR  E+ +++ W+ ++Y++
Sbjct  477   DLRFSKKEDPEWLVDQRATEIKLIEGWLEKFYQE  510



>gb|EPS59259.1| hypothetical protein M569_15548, partial [Genlisea aurea]
Length=465

 Score =   239 bits (610),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 144/211 (68%), Gaps = 2/211 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             S + Y AM +Y    +F+ P+P  P++++C+ ID +P G   + R F   S+YYN++G  
Sbjct  257   SGYSYLAMADYPYATDFLMPMPKNPIKEVCRRIDSYPNGTDILRRIFEGVSVYYNFTGNV  316

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPR  648
              CF ++D  D HG++GW+WQACTEMVMP+    +SMFP   +  +     C + + V PR
Sbjct  317   DCFKLDD--DPHGMNGWNWQACTEMVMPLSSGTKSMFPGYDFDLDSDAYWCFQSFRVTPR  374

Query  647   PHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHAD  468
             P WITT FGG+  +  L+ FGSNI+FSNG+ DPWS G VL+N+SD+IVALVTEKGAHH D
Sbjct  375   PTWITTEFGGHGFKNALRWFGSNIVFSNGLLDPWSGGSVLENVSDTIVALVTEKGAHHLD  434

Query  467   FRSATKNDPDWLIQQREKEVDILQKWIGEYY  375
              R AT  DPDWL+ QRE E+ ++Q W+ EYY
Sbjct  435   LRPATVEDPDWLLDQREIEMKLIQGWLDEYY  465



>ref|XP_004136495.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 gb|KGN59164.1| hypothetical protein Csa_3G778210 [Cucumis sativus]
Length=502

 Score =   240 bits (613),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 159/215 (74%), Gaps = 1/215 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +A +YTAM +Y T +NF+ PLPAYPV++MCK ID   +G    ++ + AA++YYN++GT 
Sbjct  285   TAIIYTAMTDYPTPSNFLNPLPAYPVKQMCKAIDDPRSGNDSFTKLYGAANIYYNFTGTV  344

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMV-VSKESMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D+SD H L  W WQACTEM++P    +KES+FP S++ + +  + C+  + V+P
Sbjct  345   TCFDLDDDSDPHDLGDWSWQACTEMILPTGGNTKESIFPASTWHFADRFQFCKTFFDVEP  404

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             R  WI THFGG+ IE+VLKRFGSNIIF NG++DPWS GGVLKNIS +I+A+V ++GAHH 
Sbjct  405   RRIWIPTHFGGHNIERVLKRFGSNIIFFNGLRDPWSGGGVLKNISSTIIAIVAKEGAHHV  464

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D R +  +DP WL   R++EV+I++ W+ +YY D+
Sbjct  465   DLRFSNPDDPKWLKDVRKQEVNIIEDWLSQYYLDL  499



>ref|XP_011622147.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X2 [Amborella 
trichopoda]
Length=459

 Score =   239 bits (609),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 137/215 (64%), Gaps = 52/215 (24%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             WSAFVYTAMVNY T ANFM+PLPAYP+                                 
Sbjct  277   WSAFVYTAMVNYPTPANFMRPLPAYPIN--------------------------------  304

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
                                 +ACTEMVMPM  S++ MFPPS++SY+E E  C + YGVK 
Sbjct  305   --------------------EACTEMVMPMSCSQQGMFPPSTFSYKEIEDDCMKKYGVKA  344

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RPHWITT FGG+ IE+VLKRFGSNIIFSNGM DPWSRGGVLKNIS SIVALVTEKGAHH 
Sbjct  345   RPHWITTEFGGHNIEEVLKRFGSNIIFSNGMVDPWSRGGVLKNISSSIVALVTEKGAHHL  404

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             DFR AT+ DP WL++QR +E++++Q WI EY  D 
Sbjct  405   DFRFATRQDPRWLVEQRRQEIELIQGWIHEYNMDF  439



>ref|XP_008442879.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis melo]
Length=502

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 156/215 (73%), Gaps = 1/215 (0%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +A +YTAM +Y T +NF+ PLPAYPV++MCK ID    G    ++ + AA++YYNY+GT 
Sbjct  285   TAILYTAMTDYPTPSNFLNPLPAYPVKQMCKAIDDSRTGNDTFAKLYGAANVYYNYTGTA  344

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMV-VSKESMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D+SD H L  W WQACTEM++P    +KES+FP S++ + +    C+  + V+P
Sbjct  345   TCFDLDDDSDPHDLGDWTWQACTEMILPTGGNTKESIFPASTWHFADRLHFCKTFFDVEP  404

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             R  WI THFGG+ IE+VLKRFGSNIIF NG++DPWS GGVLKNIS +I+A+V ++GAHH 
Sbjct  405   RRIWIPTHFGGHNIERVLKRFGSNIIFFNGLRDPWSGGGVLKNISSTIIAIVAKEGAHHV  464

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D R ++  DP WL   R++E+ I++ W+ +YY D+
Sbjct  465   DLRFSSAEDPKWLKDVRQQELSIIEDWLSQYYLDL  499



>ref|XP_010023342.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 ref|XP_010023343.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW59598.1| hypothetical protein EUGRSUZ_H02343 [Eucalyptus grandis]
Length=532

 Score =   239 bits (610),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 147/213 (69%), Gaps = 3/213 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMVNY   ++F+ PLP +P+ ++C+ IDG P G S + R      +YYN++G  
Sbjct  303   SAYSYLAMVNYPYPSDFIMPLPGHPIREVCRKIDGCPDGTSILERVSEGVGVYYNHTGEV  362

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HG++GW+WQACTEMVMP+  S + SMFP   +++   +  C   + V P
Sbjct  363   NCFELDD--DPHGMNGWNWQACTEMVMPLSSSPDTSMFPTYDFNFSAFQEECWTDFKVNP  420

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG  I   LK FGSNIIFSNG  DPWS G V +N+SDSIVAL T++GAHH 
Sbjct  421   RPRWITTEFGGKDIMTDLKTFGSNIIFSNGFLDPWSGGSVTQNVSDSIVALNTQEGAHHL  480

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYR  372
             D R+AT  DP+WL++QR  E+ +++KW+ +YY+
Sbjct  481   DLRAATAEDPNWLVEQRATEIRVIKKWLSDYYQ  513



>emb|CAN61013.1| hypothetical protein VITISV_036738 [Vitis vinifera]
Length=554

 Score =   239 bits (609),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 106/193 (55%), Positives = 145/193 (75%), Gaps = 1/193 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +A+VYTAM +Y T +NF+ P+PAYPV++MCK ID    G    ++ + AA++YYNY+GT 
Sbjct  277   TAYVYTAMTDYPTPSNFLSPMPAYPVKQMCKAIDDPAXGNDTFAKLYGAANVYYNYTGTA  336

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVS-KESMFPPSSYSYEETERSCQRMYGVKP  651
              CF + D+SD HGL  W WQACTEM+MP+  + +ES+FP S+++Y      C+  + ++P
Sbjct  337   ACFDLADDSDPHGLGEWTWQACTEMIMPVNANNEESIFPVSTWNYSNRAAFCKFAFDIEP  396

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP+WITT FGG+ I++VLKRFGSNIIF NG++DPWS GGVL++IS SIVA+V + GAHH 
Sbjct  397   RPNWITTEFGGHDIKRVLKRFGSNIIFFNGLRDPWSGGGVLESISKSIVAIVAKDGAHHV  456

Query  470   DFRSATKNDPDWL  432
             D R AT  DP+WL
Sbjct  457   DLRFATSEDPEWL  469



>ref|XP_007011978.1| Alpha/beta-Hydrolases superfamily protein isoform 2, partial 
[Theobroma cacao]
 gb|EOY29597.1| Alpha/beta-Hydrolases superfamily protein isoform 2, partial 
[Theobroma cacao]
Length=420

 Score =   234 bits (596),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W+AFVYTAMVNY TEANF+KPLPAYPV++MCKIID FP+GA+K+SR+FAAASLYYNYS  
Sbjct  281   WTAFVYTAMVNYPTEANFLKPLPAYPVQEMCKIIDKFPSGATKLSRSFAAASLYYNYSRA  340

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKP  651
             E CF IE E D HGLHGWDWQ CTEMVMPM  SKESMFPPS + YEE    CQ  Y V P
Sbjct  341   ENCFEIEHEVDTHGLHGWDWQTCTEMVMPMTCSKESMFPPSGFDYEEFAEQCQMKYEVLP  400

Query  650   RPHWITTHFGGNRIEQVLKR  591
             RPHWITT FGG RI++VLK+
Sbjct  401   RPHWITTEFGGERIQKVLKK  420



>gb|KJB18076.1| hypothetical protein B456_003G033300, partial [Gossypium raimondii]
Length=539

 Score =   236 bits (603),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 144/215 (67%), Gaps = 15/215 (7%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMVNY   +NF+ PLP +P+ ++CK IDG PAG+S + R F   S+YYNY+G  
Sbjct  333   SAYSYLAMVNYPYPSNFLMPLPGHPIREVCKRIDGSPAGSSILERIFNGVSVYYNYTGEV  392

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HG+ GW+WQACTEMVMPM   +  SMFP   + Y      CQR + V P
Sbjct  393   DCFQLDD--DPHGMDGWNWQACTEMVMPMSSDQNTSMFPAYDWDYSAFREGCQRDFQVTP  450

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WITT FGG+ IE VLK FGSNIIFSNG+ DPWS G VLKNIS++I+AL+T+      
Sbjct  451   RPRWITTEFGGHDIEHVLKSFGSNIIFSNGLLDPWSGGSVLKNISETIIALITK------  504

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
                   + DPDWL++QR  E+ ++Q WI  Y + M
Sbjct  505   ------EEDPDWLVEQRATEIKLIQGWIYNYSKKM  533



>ref|XP_002962483.1| hypothetical protein SELMODRAFT_78660 [Selaginella moellendorffii]
 gb|EFJ35946.1| hypothetical protein SELMODRAFT_78660 [Selaginella moellendorffii]
Length=474

 Score =   234 bits (598),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 152/224 (68%), Gaps = 12/224 (5%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AM NY   ANF  PLPA+PV K+C+ +   P  +S + R +A  ++YYN++G  
Sbjct  250   SAYSYLAMANYPYAANFTMPLPAHPVRKVCQAMVNSPVASSILQRIYAGVNVYYNFTGAA  309

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVV-SKESMFPPSSYSYEETERSCQRMYGVKP  651
             KCF ++D  D HGL GW+WQ+CTEMVMPM   S  SM+PP  +  E   R C   YG  P
Sbjct  310   KCFDLDD--DPHGLSGWNWQSCTEMVMPMSSNSNTSMYPPFEWDGEAWSRFCWENYGAIP  367

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGG---------VLKNISDSIVAL  498
             RP W+TT FGG+ I+ VL+ FGSNI+FSNG+ DPWS G          VL++IS +I+A 
Sbjct  368   RPSWVTTEFGGHDIKSVLRNFGSNIVFSNGLLDPWSGGRQAMNDSFRFVLESISSTILAF  427

Query  497   VTEKGAHHADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             VT++GAHH DFR + K+DP WLI+QRE EV  +++W+ EY++++
Sbjct  428   VTKEGAHHLDFRWSRKDDPQWLIEQRESEVREIKRWLSEYHQNV  471



>gb|EMS49104.1| Lysosomal Pro-X carboxypeptidase [Triticum urartu]
Length=614

 Score =   232 bits (591),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 138/193 (72%), Gaps = 3/193 (2%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   + F+ PLPA P++++C+ ID  P G+S + R +A  ++YYNY+GT 
Sbjct  137   SAYSYLAMVDYPMPSEFLMPLPANPIKEVCRNIDKQPEGSSILERIYAGVNIYYNYTGTV  196

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HG+ GWDWQACTEMVMPM  S+  SMF P  + Y      C + +GV+P
Sbjct  197   DCFDLDD--DPHGMGGWDWQACTEMVMPMSSSEGLSMFLPDEFDYALYADDCVKNFGVRP  254

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP WI+T FGG+ I  VL++FGSNIIF NG+ DPWS GGVLKNIS+S+VA+V   GAHH 
Sbjct  255   RPRWISTEFGGHNISSVLEKFGSNIIFFNGLLDPWSGGGVLKNISESVVAIVAPLGAHHI  314

Query  470   DFRSATKNDPDWL  432
             D R ATK DPDWL
Sbjct  315   DLRPATKEDPDWL  327



>dbj|BAK05623.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=511

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 144/215 (67%), Gaps = 2/215 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +A VY+AM +Y TE+ F+  LPAYPV+++C+ ID   +G    SR   A ++YYNY+G  
Sbjct  292   TAIVYSAMTDYPTESGFLTHLPAYPVKEICRAIDHPKSGKDTFSRIKDALTVYYNYTGNA  351

Query  827   KCFHIEDESDDHGL-HGWDWQACTEMV-MPMVVSKESMFPPSSYSYEETERSCQRMYGVK  654
              CF    E D +G+ +GWDWQACTEM+ M   V   S+ PP  +++ +    C+   G+ 
Sbjct  352   HCFGDASEDDPYGMFNGWDWQACTEMILMSYGVRNRSVLPPEPFNFTKLLDGCRASTGLP  411

Query  653   PRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHH  474
             PRP+WI T FGG  I  VLKR  SNIIF NG++DPWS GGVLK+IS SI+ALV  KG+HH
Sbjct  412   PRPYWIPTEFGGFDIANVLKRSASNIIFFNGLRDPWSSGGVLKDISRSILALVEPKGSHH  471

Query  473   ADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
              D R ++K+DP WL Q REKE  I+  W+ +YY+D
Sbjct  472   VDLRFSSKDDPHWLKQVREKETRIIAHWLNQYYKD  506



>ref|XP_004980174.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Setaria italica]
Length=520

 Score =   226 bits (575),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 148/217 (68%), Gaps = 4/217 (2%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGAS-KISRAFAAASLYYNYSGT  831
             SA VY AM +Y T + F+  LPAYPV +MC+ +D   +G +  ++R  AA  +YYN++G 
Sbjct  299   SAVVYAAMTDYPTPSGFLTALPAYPVREMCRAVDDPSSGGNGTLARVRAAMDVYYNHTGA  358

Query  830   EKCFHIEDESDDHGLH-GWDWQACTEMV-MPMVVSKESMF-PPSSYSYEETERSCQRMYG  660
               CF  E+E D +G++ GW+WQACTEMV M   +S +S+  PP  +++ +   SC+   G
Sbjct  359   AACFRGEEEDDPYGMYDGWNWQACTEMVLMTYGLSNDSILQPPWPFNFTDVIASCRNATG  418

Query  659   VKPRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGA  480
             + PRP WI T FGG  I  VLKR  SNIIF NG++DPWS GGVLK+ISDSI+ALV  KGA
Sbjct  419   LPPRPFWIETEFGGYDIGNVLKRSASNIIFFNGLRDPWSTGGVLKSISDSIIALVEPKGA  478

Query  479   HHADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             HH D R ++++DPDWL Q R KE  I+ +W+ +YY D
Sbjct  479   HHVDLRFSSEDDPDWLKQVRAKETRIIARWLKQYYSD  515



>ref|XP_008779559.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Phoenix dactylifera]
Length=147

 Score =   214 bits (544),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = -3

Query  770  QACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHFGGNRIEQVLKR  591
            QACTEMVMPM  S ESMFP SSY Y E    C   YGV+PRPHWITT +GGNRI+ VLKR
Sbjct  11   QACTEMVMPMTCSNESMFPSSSYDYNEFGDECMAKYGVRPRPHWITTEYGGNRIDAVLKR  70

Query  590  FGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKNDPDWLIQQREKE  411
            FGSNIIFSNGM+DPWSRGGVL+NIS SI+ALVTEKGAHH D R ATK+DP WL++QR++E
Sbjct  71   FGSNIIFSNGMRDPWSRGGVLRNISSSIIALVTEKGAHHLDLRFATKDDPKWLLEQRKQE  130

Query  410  VDILQKWIGEYYRD  369
            +DI+Q WI +Y+ D
Sbjct  131  IDIIQSWIDQYHID  144



>ref|XP_003576298.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Brachypodium 
distachyon]
Length=517

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 143/215 (67%), Gaps = 2/215 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +A  Y+AM +Y T + F+ PLP YPV++MC+ ID   +G    +R   A  +YYN++G E
Sbjct  297   TALTYSAMTDYPTSSGFLTPLPPYPVKEMCRAIDHPKSGNDTFARIKGALDVYYNHTGAE  356

Query  827   KCFHIEDESDDHGLH-GWDWQACTEMV-MPMVVSKESMFPPSSYSYEETERSCQRMYGVK  654
              C     ESD +G+  GWDWQACTEM+ M   V   ++FPP  +++ +    C+   G+ 
Sbjct  357   PCLGDATESDPYGMFDGWDWQACTEMILMTYGVRNGTVFPPEPFNFTDLLAGCRASTGLP  416

Query  653   PRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHH  474
             PRP+WI T FGG  I+ VL+R  SNIIF NG++DPWS GGVLK+IS+SI+ALV  KG+HH
Sbjct  417   PRPYWIPTEFGGFDIKHVLRRSASNIIFFNGLRDPWSSGGVLKSISNSIIALVEPKGSHH  476

Query  473   ADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
              D R +TK DP+WL Q R KE  I+  W+ +YY++
Sbjct  477   VDLRFSTKEDPEWLKQVRIKETRIIAHWLRQYYKE  511



>ref|XP_006663226.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like, partial [Oryza 
brachyantha]
Length=420

 Score =   220 bits (560),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 103/216 (48%), Positives = 143/216 (66%), Gaps = 3/216 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +A VY AM +Y T ++F+  LPAYPV ++C+ ID   +G   ++R   A ++YYN++G  
Sbjct  201   NALVYVAMTDYPTPSSFLTSLPAYPVRQICRAIDQPTSGNETLARIKEAMAIYYNHTGGL  260

Query  827   KCFHIEDESDDHG-LHGWDWQACTEMVMPMV--VSKESMFPPSSYSYEETERSCQRMYGV  657
              CF    + D +G L GW+WQACTEMV+ M   VS  S+FPP  +++ +    C+   G+
Sbjct  261   ACFGGAGDEDPYGMLAGWNWQACTEMVLTMSYGVSGSSIFPPEPFNFTDVLAGCRAYTGL  320

Query  656   KPRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAH  477
              PRP+WI  HFGG  I  VLKR  SNIIF NG++DPWS GGVLK+IS SI+ALV  +G H
Sbjct  321   PPRPYWIEAHFGGFDIVNVLKRSASNIIFFNGLRDPWSAGGVLKSISKSIIALVEPEGGH  380

Query  476   HADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             H D R +TK DP+WL + R KE+ I+  W+ +YY +
Sbjct  381   HVDLRFSTKEDPEWLKKVRRKEMRIIADWLRQYYSE  416



>ref|XP_002962799.1| hypothetical protein SELMODRAFT_78251 [Selaginella moellendorffii]
 gb|EFJ36262.1| hypothetical protein SELMODRAFT_78251 [Selaginella moellendorffii]
Length=470

 Score =   221 bits (563),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 106/213 (50%), Positives = 140/213 (66%), Gaps = 4/213 (2%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AM NY   ANF  PLPAYPV K+C+ +   P  +S + R +A  ++YYN++G  
Sbjct  250   SAYSYLAMANYPYAANFTMPLPAYPVRKVCQAMVNSPVASSILQRIYAGVNVYYNFTGAA  309

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVV-SKESMFPPSSYSYEETERSCQRMYGVKP  651
             KCF ++D  D HGL GW+WQ+CTEMVMPM   S  SM+PP  +  E   R C   YG  P
Sbjct  310   KCFDLDD--DPHGLSGWNWQSCTEMVMPMSSNSSTSMYPPFEWDGEAWSRFCWEKYGAIP  367

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSI-VALVTEKGAHH  474
             RP W+TT FGG+ I+  L+ FGSNI+FSNG+ DPWS G    N S  +  +L+   GAHH
Sbjct  368   RPSWVTTEFGGHDIKSALRNFGSNIVFSNGLLDPWSGGRQAMNDSFRLRSSLIDFDGAHH  427

Query  473   ADFRSATKNDPDWLIQQREKEVDILQKWIGEYY  375
              DFR + K+DP WLI+QRE EV  +++W+ EY+
Sbjct  428   LDFRWSRKDDPQWLIEQRELEVREIKRWLSEYH  460



>gb|EAZ17490.1| hypothetical protein OsJ_33021 [Oryza sativa Japonica Group]
Length=259

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/217 (47%), Positives = 140/217 (65%), Gaps = 5/217 (2%)
 Frame = -3

Query  1004  AFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEK  825
             A +Y +M++Y T +NF+  LPAYPV ++C+ ID   +G   +SR   A ++YYN +G   
Sbjct  35    ALIYGSMMDYPTPSNFLTSLPAYPVREICRAIDKPTSGNDTVSRIKDAMTIYYNSTGGLA  94

Query  824   CFHIEDESDD--HGLH-GWDWQACTEMVMPMV--VSKESMFPPSSYSYEETERSCQRMYG  660
             CF      DD  +G+  GW WQACTE++M M   +   ++FPP  ++       C    G
Sbjct  95    CFPGAGAEDDDPYGMFPGWTWQACTEVIMTMSYGIGNATVFPPDPFNLTAYLAGCLATTG  154

Query  659   VKPRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGA  480
             V PRPHWI ++FGG  I  VLKR GSNIIF NG++DPWS GG+LK+IS+SI+ALV  KG 
Sbjct  155   VPPRPHWIQSYFGGYDIRNVLKRSGSNIIFFNGLRDPWSAGGILKSISNSIIALVEPKGG  214

Query  479   HHADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             HH D R +TK DP+WL + R +E+ I+  W+ +YY D
Sbjct  215   HHVDLRFSTKEDPEWLKKVRRQEMRIIADWLKQYYSD  251



>gb|EYU30781.1| hypothetical protein MIMGU_mgv1a0254691mg, partial [Erythranthe 
guttata]
Length=175

 Score =   206 bits (524),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 118/171 (69%), Gaps = 3/171 (2%)
 Frame = -3

Query  926  KMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDESDDHGLHGWDWQACTEMVM  747
            ++CK ID  P G S + R F   S+YYNY+G  +CF ++D  D HG +GW+WQACTEMVM
Sbjct  4    QVCKKIDRSPNGTSILQRIFKGVSIYYNYTGKVECFDLDD--DPHGTNGWNWQACTEMVM  61

Query  746  PMVVSKE-SMFPPSSYSYEETERSCQRMYGVKPRPHWITTHFGGNRIEQVLKRFGSNIIF  570
            P   SK  SMFP   Y Y   E  C   YGVKPRP WITT FGG+  +  LK FGSNIIF
Sbjct  62   PTSSSKNTSMFPAYDYDYASDEEWCLENYGVKPRPTWITTEFGGHGFKHALKNFGSNIIF  121

Query  569  SNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKNDPDWLIQQRE  417
            SNG+ DPWS G VL++IS++IVALVTEKGAHH D R+AT  DPDW    RE
Sbjct  122  SNGLLDPWSGGSVLEDISETIVALVTEKGAHHLDLRAATAEDPDWAGWSRE  172



>ref|XP_008680725.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Zea mays]
 gb|AFW64865.1| putative serine peptidase S28 family protein [Zea mays]
Length=534

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 143/233 (61%), Gaps = 20/233 (9%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFA------------  864
             SA VY AM +Y T + F+ PLPAYPV  MC+ ID   A +++ S   A            
Sbjct  297   SAVVYAAMTDYPTPSGFLTPLPAYPVRAMCRAIDASRAESAEASSGAANDGNSNSTAQLT  356

Query  863   ------AASLYYNYSGTEKCFHIEDESDDHGLH-GWDWQACTE-MVMPMVVSKESMFPPS  708
                   A  +YYN++G   CF  E++ D HG++ GW+WQACTE MVM   +    +  PS
Sbjct  357   LSQVRDAMDVYYNHTGAAACFRAEEDDDPHGMYDGWNWQACTEVMVMAYGIRDGGVLQPS  416

Query  707   SYSYEETERSCQRMYGVKPRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVL  528
              +++ +   SC+   G+ PRP WI T FGG  I  VLK+  SNI+F NG++DPWS GGVL
Sbjct  417   PFNFTDVVDSCRNYTGLPPRPFWIETEFGGFDIGNVLKKSASNIVFFNGLRDPWSTGGVL  476

Query  527   KNISDSIVALVTEKGAHHADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             K+ISDSI+ALV  KG+HH D R ++K DP+WL Q R KE  I+ +W+ +YY D
Sbjct  477   KSISDSIIALVEPKGSHHVDLRFSSKEDPEWLKQVRVKETRIIARWLKQYYSD  529



>ref|NP_001065793.1| Os11g0156200 [Oryza sativa Japonica Group]
 gb|AAX92949.1| At2g24280/F27D4.19 [Oryza sativa Japonica Group]
 gb|ABA91540.1| Serine carboxypeptidase S28 family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27638.1| Os11g0156200 [Oryza sativa Japonica Group]
Length=511

 Score =   214 bits (545),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/217 (47%), Positives = 140/217 (65%), Gaps = 5/217 (2%)
 Frame = -3

Query  1004  AFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEK  825
             A +Y +M++Y T +NF+  LPAYPV ++C+ ID   +G   +SR   A ++YYN +G   
Sbjct  287   ALIYGSMMDYPTPSNFLTSLPAYPVREICRAIDKPTSGNDTVSRIKDAMTIYYNSTGGLA  346

Query  824   CFHIEDESDD--HGLH-GWDWQACTEMVMPMV--VSKESMFPPSSYSYEETERSCQRMYG  660
             CF      DD  +G+  GW WQACTE++M M   +   ++FPP  ++       C    G
Sbjct  347   CFPGAGAEDDDPYGMFPGWTWQACTEVIMTMSYGIGNATVFPPDPFNLTAYLAGCLATTG  406

Query  659   VKPRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGA  480
             V PRPHWI ++FGG  I  VLKR GSNIIF NG++DPWS GG+LK+IS+SI+ALV  KG 
Sbjct  407   VPPRPHWIQSYFGGYDIRNVLKRSGSNIIFFNGLRDPWSAGGILKSISNSIIALVEPKGG  466

Query  479   HHADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             HH D R +TK DP+WL + R +E+ I+  W+ +YY D
Sbjct  467   HHVDLRFSTKEDPEWLKKVRRQEMRIIADWLKQYYSD  503



>gb|EAY80009.1| hypothetical protein OsI_35177 [Oryza sativa Indica Group]
Length=511

 Score =   214 bits (545),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 101/217 (47%), Positives = 140/217 (65%), Gaps = 5/217 (2%)
 Frame = -3

Query  1004  AFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEK  825
             A +Y +M++Y T +NF+  LPAYPV ++C+ ID   +G   +SR   A ++YYN +G   
Sbjct  287   ALIYGSMMDYPTPSNFLTSLPAYPVREICRAIDKPTSGNDTVSRIKDAMTIYYNSTGGLA  346

Query  824   CFHIEDESDD--HGLH-GWDWQACTEMVMPMV--VSKESMFPPSSYSYEETERSCQRMYG  660
             CF      DD  +G+  GW WQACTE++M M   +   ++FPP  ++       C    G
Sbjct  347   CFPGAGAEDDDPYGMFPGWTWQACTEVIMTMSYGIGNATVFPPDPFNLTAYLADCLATTG  406

Query  659   VKPRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGA  480
             V PRPHWI ++FGG  I  VLKR GSNIIF NG++DPWS GG+LK+IS+SI+ALV  KG 
Sbjct  407   VPPRPHWIQSYFGGYDIRNVLKRSGSNIIFFNGLRDPWSAGGILKSISNSIIALVEPKGG  466

Query  479   HHADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             HH D R +TK DP+WL + R +E+ I+  W+ +YY D
Sbjct  467   HHVDLRFSTKEDPEWLKKVRRQEMRIIADWLKQYYSD  503



>ref|XP_008458663.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Cucumis 
melo]
Length=499

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/208 (47%), Positives = 138/208 (66%), Gaps = 4/208 (2%)
 Frame = -3

Query  977  YATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDESD  798
            YA  A +  P P YPV ++C  IDG   G+  IS+  A     + Y G   C++I   +D
Sbjct  293  YAGAAQYNHP-PRYPVTRICGGIDGASPGSGIISKVAAGV---FAYKGNLPCYNIGPRND  348

Query  797  DHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHFGG  618
                 GW WQ C+EMVMPM  S ++MFPP ++        C ++YGV PRPHW+TT++GG
Sbjct  349  TETDVGWRWQRCSEMVMPMSTSNDTMFPPITFDLRSFIDYCYQLYGVSPRPHWVTTYYGG  408

Query  617  NRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKNDPD  438
            N I+ +L+RFGSNIIFSNG++DP+S GGVL+N+SDS++A+ T  G+H  D   A + DP 
Sbjct  409  NDIKLILQRFGSNIIFSNGLRDPYSSGGVLQNLSDSLLAVHTLNGSHCLDILRANETDPQ  468

Query  437  WLIQQREKEVDILQKWIGEYYRDMDMNQ  354
            WL++QREKEV I++ WI +YY D++ ++
Sbjct  469  WLVEQREKEVSIIEGWISQYYADLEKSK  496



>ref|XP_008798889.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Phoenix 
dactylifera]
Length=478

 Score =   208 bits (529),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 101/214 (47%), Positives = 135/214 (63%), Gaps = 32/214 (15%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   ++F+ PLPA P++++C+ ID +P G   + R FA A          
Sbjct  289   SAYSYLAMVDYPYPSDFLMPLPANPIKEVCRKIDSYPDGTDLLDRIFAGA----------  338

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
                                  CTEMVMPM  S+E SMFP  ++SY   +  C   YGV+P
Sbjct  339   ---------------------CTEMVMPMSSSQENSMFPTYNFSYAAYQDECVHNYGVRP  377

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHA  471
             RP W+TT FGG+ I+  LK FGSNIIFSNG+ DPWS G VL+NIS+SI+ALVTE GAHH 
Sbjct  378   RPRWVTTEFGGHDIKTALKEFGSNIIFSNGLLDPWSGGSVLQNISESIIALVTELGAHHI  437

Query  470   DFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             D R +T  DPDWLI+QR+ E+ +++ WI +YY++
Sbjct  438   DLRPSTNEDPDWLIEQRKSEISLIRGWIYDYYQE  471



>emb|CBI17110.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 131/205 (64%), Gaps = 6/205 (3%)
 Frame = -3

Query  977  YATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDESD  798
            Y T A +  P P YPV   C  IDG P G+  +SR FA       Y G   C+       
Sbjct  201  YCTAAQYNDP-PMYPVTMACSGIDGAPEGSDILSRIFAGV---VAYGGNSSCYTTSHNPT  256

Query  797  DHGLHGWDWQACTEMVMPMVVS-KESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHFG  621
            +    GW WQ C+EMVMP+     ++MFPP+ ++     + C  +YGV PRPHW+TT++G
Sbjct  257  ETS-EGWAWQTCSEMVMPIGRGDNDTMFPPAPFNLTTFIQECTSIYGVSPRPHWVTTYYG  315

Query  620  GNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKNDP  441
            G+ IE +L+RF SNIIFSNG++DP+S GGVLKNISDS++A++T  G+H  D   AT  DP
Sbjct  316  GHNIELILRRFASNIIFSNGLRDPYSSGGVLKNISDSVLAILTVNGSHCLDILPATSTDP  375

Query  440  DWLIQQREKEVDILQKWIGEYYRDM  366
            +WL+ QR+ EV++++ WI +YY D+
Sbjct  376  EWLVMQRKAEVEVIESWIAQYYADL  400



>ref|XP_004145770.1| PREDICTED: lysosomal Pro-X carboxypeptidase [Cucumis sativus]
 gb|KGN46900.1| hypothetical protein Csa_6G149410 [Cucumis sativus]
Length=499

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 138/208 (66%), Gaps = 4/208 (2%)
 Frame = -3

Query  977  YATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDESD  798
            YA  A +  P P YPV ++C  IDG   G+  IS+  A     + Y G   C++I   S+
Sbjct  293  YAGAAQYNHP-PRYPVTRICGGIDGASPGSGIISKVAAGV---FAYKGNLSCYNIGPRSE  348

Query  797  DHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHFGG  618
                 GW WQ C+EMVMP+  + ++MFPP ++  +     C ++YGV  RPHW+TT++GG
Sbjct  349  TETDVGWRWQRCSEMVMPLSTTNDTMFPPITFDLKSFVDYCYQLYGVSSRPHWVTTYYGG  408

Query  617  NRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKNDPD  438
            N I+ +L+RFGSNIIFSNG++DP+S GGVL+N+SDS++A+ T KG+H  D   A + DP 
Sbjct  409  NDIKLILQRFGSNIIFSNGLRDPYSSGGVLQNLSDSLLAVHTPKGSHCLDILRANETDPQ  468

Query  437  WLIQQREKEVDILQKWIGEYYRDMDMNQ  354
            WL++QRE EV I++ WI +YY D++ ++
Sbjct  469  WLVKQRETEVRIIEGWISKYYADLEKSK  496



>gb|KDO78803.1| hypothetical protein CISIN_1g0096312mg, partial [Citrus sinensis]
 gb|KDO78804.1| hypothetical protein CISIN_1g0096312mg, partial [Citrus sinensis]
 gb|KDO78805.1| hypothetical protein CISIN_1g0096312mg, partial [Citrus sinensis]
Length=474

 Score =   206 bits (525),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 123/175 (70%), Gaps = 3/175 (2%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   ++FM PLP YP+ ++CK ID  P   S + R F   S+YYNY+G  
Sbjct  302   SAYSYLAMVDYPYPSDFMMPLPGYPIREVCKKIDNAPDATSILERIFEGVSVYYNYTGNV  361

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HGL GW+WQACTEMVMPM  S++ SMFP   Y+Y   +  C   + V P
Sbjct  362   DCFQLDD--DPHGLDGWNWQACTEMVMPMSSSRDKSMFPAYDYNYSSFKEECWNDFNVIP  419

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEK  486
             RP WITT FGG+ I+ VLK FGSNIIFSNG+ DPWS G VL+N+S++IVALVTE+
Sbjct  420   RPRWITTEFGGHDIKSVLKLFGSNIIFSNGLLDPWSGGSVLQNLSETIVALVTEE  474



>ref|XP_009356964.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X1 [Pyrus 
x bretschneideri]
Length=506

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 132/204 (65%), Gaps = 4/204 (2%)
 Frame = -3

Query  977  YATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDESD  798
            Y   A +  P P+YPV  +C  IDG  +G   +S+ FA    YY   G   C+  E  + 
Sbjct  302  YCEAAQYNSP-PSYPVTVVCGGIDGVSSGNDTLSKIFAGVVAYY---GNRSCYVNEPRNL  357

Query  797  DHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHFGG  618
                 GW WQ C+++V+PM VS ESMFPP  +  +E   SC+ +YGV PRPHW TT+FGG
Sbjct  358  SETDVGWSWQTCSDLVIPMGVSNESMFPPYQFDLQEYIDSCKALYGVPPRPHWATTYFGG  417

Query  617  NRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKNDPD  438
            + I+  L RF SNIIFSNG++DP+S GGVL+NISD++VA++ + G+H  D   +   DPD
Sbjct  418  HDIKLALYRFASNIIFSNGLRDPYSSGGVLENISDTVVAVLAKNGSHCLDVLLSDSTDPD  477

Query  437  WLIQQREKEVDILQKWIGEYYRDM  366
            WL++QR+ EV I++ W+ EYY ++
Sbjct  478  WLVEQRKTEVKIIEGWLAEYYGEL  501



>ref|XP_002450303.1| hypothetical protein SORBIDRAFT_05g003460 [Sorghum bicolor]
 gb|EES09291.1| hypothetical protein SORBIDRAFT_05g003460 [Sorghum bicolor]
Length=553

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 105/239 (44%), Positives = 142/239 (59%), Gaps = 26/239 (11%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGF--PAGASKISRAFA----------  864
             +A V  AM +Y T + F+ PLPAYPV  MC+ ID     A AS  +              
Sbjct  310   NAMVEAAMTDYPTTSGFLTPLPAYPVRAMCRAIDARHQQAAASTSTSGSGNDDGNNSSSS  369

Query  863   ------------AASLYYNYSGTEKCFHIEDESDDHGLH-GWDWQACTE-MVMPMVVSKE  726
                         A ++YYN++G   CF  E++ D +GL+ GW+WQACTE MVM   V   
Sbjct  370   TALLLLSEQVRDAMNVYYNHTGGAACFRAEEDDDPYGLYDGWNWQACTEVMVMAYGVRDG  429

Query  725   SMFPPSSYSYEETERSCQRMYGVKPRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPW  546
             ++  P+ +++ E    C+ + G+ PRP WI T FGG  I  VLK+  SNIIF NG++DPW
Sbjct  430   TVLQPAPFNFTEVVDDCRNVTGLPPRPFWIETEFGGYDIANVLKKSASNIIFFNGLRDPW  489

Query  545   SRGGVLKNISDSIVALVTEKGAHHADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRD  369
             S GGVLK+ISDSI+ALV  KGAHH D R ++K DP+WL + R KE  I+ +W+ +YY D
Sbjct  490   STGGVLKSISDSIIALVEPKGAHHVDLRFSSKEDPEWLKKVRVKETRIIARWLKQYYSD  548



>gb|AAL77662.1| AT5g65760/MPA24_11 [Arabidopsis thaliana]
Length=491

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 125/176 (71%), Gaps = 3/176 (2%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMV+Y   A+FM PLP +P+ ++C+ IDG  + AS + R +A  S+YYNY+G  
Sbjct  292   SAYSYLAMVDYPYPADFMMPLPGHPIREVCRKIDGAGSNASILDRIYAGISVYYNYTGNV  351

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMYGVKP  651
              CF ++D  D HGL GW+WQACTEMVMPM  ++E SMFP   ++Y   +  C   + V P
Sbjct  352   DCFKLDD--DPHGLDGWNWQACTEMVMPMSSNQENSMFPGYGFNYSSYKEECWNTFRVNP  409

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKG  483
             RP W+TT FGG+ I   LK FGSNIIFSNG+ DPWS G VLKN+SD+IVALVT++G
Sbjct  410   RPKWVTTEFGGHDIATTLKSFGSNIIFSNGLLDPWSGGSVLKNLSDTIVALVTKEG  465



>gb|AFW87517.1| putative serine peptidase S28 family protein [Zea mays]
Length=528

 Score =   205 bits (521),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 125/171 (73%), Gaps = 15/171 (9%)
 Frame = -3

Query  1010  WSAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGT  831
             W+AF YTAMV+Y T ANF++ LPAYPV++MCKIIDGFPAGA  + +AFAAASLYYNY+G 
Sbjct  366   WTAFAYTAMVDYPTPANFLQNLPAYPVKEMCKIIDGFPAGADVLDKAFAAASLYYNYTGD  425

Query  830   EKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMY----  663
             + C          G     W +C     PM VS ESMFPPS++SYEE    C + +    
Sbjct  426   QTC---TASMAGSGRLARRW-SCG----PMTVSNESMFPPSTFSYEERSDECFQSWGGGG  477

Query  662   ---GVKPRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNI  519
                GV+PRPHW+TT +GG++IE+VLKRFGSNIIFSNGM+DPWSRGGVLKNI
Sbjct  478   GGGGVRPRPHWVTTEYGGHKIEKVLKRFGSNIIFSNGMRDPWSRGGVLKNI  528



>ref|XP_002315345.1| hypothetical protein POPTR_0010s23860g [Populus trichocarpa]
 gb|EEF01516.1| hypothetical protein POPTR_0010s23860g [Populus trichocarpa]
Length=513

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 139/210 (66%), Gaps = 5/210 (2%)
 Frame = -3

Query  977  YATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDESD  798
            ++  A + +P P YPV+ +CK ID  P G+  + R F+    Y+   G + C++++    
Sbjct  302  FSVAAQYDRP-PRYPVDLVCKGIDSAPEGSDVLDRIFSGIVAYF---GKKPCYNLDAFFS  357

Query  797  DHGLHGWDWQACTEMVMPMVV-SKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHFG  621
               L GW WQ C+E+V+P+   S ++MFP   +  +E    C+  +GV PRPHWITT++G
Sbjct  358  SETLEGWTWQTCSELVIPIGRGSNDTMFPAEPFDLKEYIEECKSAFGVPPRPHWITTYYG  417

Query  620  GNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKNDP  441
            G+  ++VL+RFGSNIIFSNG++DP+S GGVL+NISDSI+A+ T KGAH  D   AT  DP
Sbjct  418  GHHFKEVLRRFGSNIIFSNGLRDPYSSGGVLENISDSILAVYTTKGAHCMDILPATIGDP  477

Query  440  DWLIQQREKEVDILQKWIGEYYRDMDMNQN  351
            DW++ QR  E++I+  WI +YY+D+  N +
Sbjct  478  DWVVLQRNIEIEIINGWILKYYQDLLENSS  507



>gb|KJB55686.1| hypothetical protein B456_009G088900 [Gossypium raimondii]
 gb|KJB55687.1| hypothetical protein B456_009G088900 [Gossypium raimondii]
Length=507

 Score =   201 bits (511),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 140/214 (65%), Gaps = 7/214 (3%)
 Frame = -3

Query  977  YATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIE--DE  804
            Y+  A +  P P+YP+  +C+ IDG P G   + R FA    Y    G   C+ +   + 
Sbjct  294  YSEVAQYDHP-PSYPLNIICRGIDGAPKGTDILGRIFAGVVAYM---GNNSCYDMNEFNR  349

Query  803  SDDHGLHGWDWQACTEMVMPMV-VSKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTH  627
             +D    GW WQ C+EMVMP+   + +SMFPPS ++  +  R C+ ++GV+PRPHW+TT+
Sbjct  350  PNDETYIGWRWQTCSEMVMPIGHENNDSMFPPSPFNLTKFIRKCKSLFGVRPRPHWVTTY  409

Query  626  FGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKN  447
            +GG+ ++ +L RF SNIIFSNG++DP+S GGVL+NISDS+VA+ T  G+H  D     K+
Sbjct  410  YGGHDLKLILHRFASNIIFSNGLRDPYSSGGVLENISDSVVAVYTVNGSHCLDILPEKKS  469

Query  446  DPDWLIQQREKEVDILQKWIGEYYRDMDMNQN*T  345
            DP WLI+QR+ EV I++ WI +YY D+ M ++ T
Sbjct  470  DPVWLIKQRKTEVGIIESWISKYYTDLIMFRDRT  503



>gb|KCW50737.1| hypothetical protein EUGRSUZ_J00408 [Eucalyptus grandis]
Length=500

 Score =   201 bits (510),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 133/214 (62%), Gaps = 12/214 (6%)
 Frame = -3

Query  1001  FVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKC  822
             F+Y  +V Y   +         P++ MC  ++G P     + + FA        +G   C
Sbjct  292   FLYAQVVQYNDPST-------QPLKLMCDAVNGVPPRKGLLQKIFAG---LVAINGNLTC  341

Query  821   FHIEDESDDHG--LHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPR  648
             +     S      L GW WQ CTEMV+PM +++ +MFPP  ++      +C+ ++GV PR
Sbjct  342   YVNAPPSGTFAQTLLGWSWQTCTEMVIPMGITRNTMFPPKPFNLNSFSNACKSVFGVPPR  401

Query  647   PHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHAD  468
             PHW+TT+FGG+ I+ +L RF SNIIFSNG+QDP+S GGVLKNIS ++VA+ T KG+H  D
Sbjct  402   PHWVTTYFGGHDIKLILHRFASNIIFSNGLQDPYSSGGVLKNISSTVVAIYTAKGSHTLD  461

Query  467   FRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
                A K+DPDWL++QR+ EV I++KW+ +YY D+
Sbjct  462   ILGADKSDPDWLVEQRKTEVKIMKKWLAKYYADL  495



>ref|XP_008226847.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Prunus mume]
Length=521

 Score =   201 bits (511),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 95/212 (45%), Positives = 132/212 (62%), Gaps = 4/212 (2%)
 Frame = -3

Query  986  MVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIED  807
            M+ Y   A + +P P YPV  +C  IDG   G   +S+ FA       Y G E C+    
Sbjct  298  MLMYTGAAQYNRP-PRYPVTVVCGGIDGASHGNDTLSKIFAGV---VAYRGNESCYVNPP  353

Query  806  ESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTH  627
            ++      GW WQ C++MVMP+ +S +SMFP + +  +E   SC+  YGV PRPHW TT+
Sbjct  354  KNKSETDVGWRWQTCSDMVMPIGISNDSMFPANQFDLKEYVESCKAQYGVPPRPHWATTY  413

Query  626  FGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKN  447
            FGG+ I+ VL RF SNIIFSNG++DP+S GGVL+NISD++VA+ T+ G+H  D   A   
Sbjct  414  FGGHDIKLVLSRFASNIIFSNGLRDPYSSGGVLENISDTVVAVHTKNGSHCLDIVGANTT  473

Query  446  DPDWLIQQREKEVDILQKWIGEYYRDMDMNQN  351
            DPDWL+ QR+ EV I++ W+  YY ++    N
Sbjct  474  DPDWLVNQRKVEVKIIKGWLSNYYAELRAYSN  505



>ref|XP_010031434.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=506

 Score =   201 bits (510),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 133/214 (62%), Gaps = 12/214 (6%)
 Frame = -3

Query  1001  FVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKC  822
             F+Y  +V Y   +         P++ MC  ++G P     + + FA        +G   C
Sbjct  298   FLYAQVVQYNDPST-------QPLKLMCDAVNGVPPRKGLLQKIFAG---LVAINGNLTC  347

Query  821   FHIEDESDDHG--LHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPR  648
             +     S      L GW WQ CTEMV+PM +++ +MFPP  ++      +C+ ++GV PR
Sbjct  348   YVNAPPSGTFAQTLLGWSWQTCTEMVIPMGITRNTMFPPKPFNLNSFSNACKSVFGVPPR  407

Query  647   PHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHAD  468
             PHW+TT+FGG+ I+ +L RF SNIIFSNG+QDP+S GGVLKNIS ++VA+ T KG+H  D
Sbjct  408   PHWVTTYFGGHDIKLILHRFASNIIFSNGLQDPYSSGGVLKNISSTVVAIYTAKGSHTLD  467

Query  467   FRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
                A K+DPDWL++QR+ EV I++KW+ +YY D+
Sbjct  468   ILGADKSDPDWLVEQRKTEVKIMKKWLAKYYADL  501



>ref|XP_011089978.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Sesamum indicum]
Length=501

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 135/206 (66%), Gaps = 6/206 (3%)
 Frame = -3

Query  977  YATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDES-  801
            Y+  A +  P P YPV  +CK IDG PAG   I R FA      +Y G   C+     + 
Sbjct  295  YSVAAQYNHP-PTYPVTVVCKGIDGAPAGTDVIGRIFAGV---VSYRGNRTCYDTNAYNY  350

Query  800  DDHGLHGWDWQACTEMVMPMVVSK-ESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHF  624
                  GW+WQ C+E+V+P+   + ++MFP + +   E  +SC+  YGV PRPHWITT++
Sbjct  351  PSETSVGWEWQTCSEIVIPIGRGENDTMFPAAPFDLHEFAKSCKDFYGVPPRPHWITTYY  410

Query  623  GGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKND  444
            GG+ I+ VL RFGSNIIFSNG++DP+S GGVL+++S+SIVA+ T KG+H  D   + K D
Sbjct  411  GGHDIKLVLNRFGSNIIFSNGLRDPYSSGGVLEDLSESIVAVTTPKGSHCLDILYSAKTD  470

Query  443  PDWLIQQREKEVDILQKWIGEYYRDM  366
            PDWLI QR++E++I++ W+  YY D+
Sbjct  471  PDWLILQRKREIEIIEGWLKTYYSDL  496



>ref|XP_002324914.2| hypothetical protein POPTR_0018s02600g [Populus trichocarpa]
 gb|EEF03479.2| hypothetical protein POPTR_0018s02600g [Populus trichocarpa]
Length=510

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 129/205 (63%), Gaps = 4/205 (2%)
 Frame = -3

Query  977  YATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDESD  798
            Y   A +  P P+YPV  +CK ID    G   + R FA    Y    G   C+  E   +
Sbjct  302  YMAAAQYDAP-PSYPVTMVCKSIDEPSFGNDILGRIFAGMVAY---QGELPCYVNEPTKE  357

Query  797  DHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHFGG  618
                 GW WQ C +MV+P  +S +SMF P  +        C+  YGV PRPHW+TT+FGG
Sbjct  358  TETDVGWSWQTCADMVIPFGISNDSMFQPYPFDLNAYINDCKDEYGVPPRPHWVTTYFGG  417

Query  617  NRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKNDPD  438
            + I+ +LKRFGSNIIFSNG++DP+S GGVL+NISDS+VA+ T KG+H  D  + TK+DP 
Sbjct  418  HDIKLILKRFGSNIIFSNGLRDPYSSGGVLQNISDSVVAITTVKGSHCLDVLATTKSDPQ  477

Query  437  WLIQQREKEVDILQKWIGEYYRDMD  363
            WL+ QR++EV I++KWI  Y+ D+D
Sbjct  478  WLVAQRKEEVRIIRKWIRNYFSDLD  502



>ref|XP_002271961.1| PREDICTED: lysosomal Pro-X carboxypeptidase isoform X1 [Vitis 
vinifera]
Length=505

 Score =   199 bits (505),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 135/208 (65%), Gaps = 7/208 (3%)
 Frame = -3

Query  980  NYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDES  801
             Y+  A +  P P+YPV  +C  IDG P G+  +SR FA       + G   C++  + +
Sbjct  297  TYSIAAQYDAP-PSYPVTVVCGGIDGAPEGSDILSRIFAGV---VAFRGNMSCYYTSNTT  352

Query  800  D--DHGLHGWDWQACTEMVMPMVVS-KESMFPPSSYSYEETERSCQRMYGVKPRPHWITT  630
            D     + GW WQ C+E+V+P+     ++MFP + ++     + C  +YGV PRPHWITT
Sbjct  353  DYPIETIQGWGWQTCSEIVIPIGRGVNDTMFPLAPFNLTTFSQDCTSLYGVAPRPHWITT  412

Query  629  HFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATK  450
            ++GG+ IE +L+RF SNIIFSNG++DP+S GGVLKNIS+S++A++T  G+H  D   A  
Sbjct  413  YYGGHDIELILRRFASNIIFSNGLRDPYSIGGVLKNISNSVLAILTVNGSHCLDLLPAAS  472

Query  449  NDPDWLIQQREKEVDILQKWIGEYYRDM  366
             DP+WL+ QR+ EV+I++ WI +YY D+
Sbjct  473  TDPEWLVMQRKAEVEIIEGWIAQYYVDL  500



>ref|XP_010267352.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Nelumbo nucifera]
Length=514

 Score =   198 bits (504),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 96/206 (47%), Positives = 131/206 (64%), Gaps = 6/206 (3%)
 Frame = -3

Query  977  YATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDES-  801
            YA  A F +P P   V K+C +IDG P G   +SR FA    Y    G   C+     + 
Sbjct  299  YAETAQFNRP-PENIVNKICDVIDGAPKGTDILSRVFAGVVAYM---GNRSCYDTNYYNY  354

Query  800  DDHGLHGWDWQACTEMVMPMVV-SKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHF  624
               G  GW WQ C+E+VMP+   S ++MFP S +  +   +SCQ +YGV PRPHWITT F
Sbjct  355  PTQGYFGWRWQTCSELVMPIGRGSNDTMFPSSPFDLKNYTKSCQDLYGVPPRPHWITTQF  414

Query  623  GGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKND  444
            GG+ I  VL++F SNIIFSNG++DP+S GGVL NISDSIVA+ T +G+H  D   A+ +D
Sbjct  415  GGHDIRLVLQKFASNIIFSNGLKDPYSSGGVLANISDSIVAIYTNEGSHCMDLYQASAHD  474

Query  443  PDWLIQQREKEVDILQKWIGEYYRDM  366
            P WL+ QR+ E++ ++ WI +YY ++
Sbjct  475  PKWLVMQRQLEIETIKGWIEKYYVEL  500



>ref|XP_010100140.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
 gb|EXB81591.1| Lysosomal Pro-X carboxypeptidase [Morus notabilis]
Length=465

 Score =   197 bits (500),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 133/206 (65%), Gaps = 4/206 (2%)
 Frame = -3

Query  977  YATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDESD  798
            YAT A +  P P YPV  +C  IDG       + + FA  +   +Y     C+  +  + 
Sbjct  258  YATAAQYNHP-PRYPVNVICGAIDGANNDDGILGKIFAGLA---SYRTNRTCYVNQPRNL  313

Query  797  DHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHFGG  618
                 GW+WQ C+EMV+P+ +S  +MFP S +  ++    C+  Y V PRPHW+TT++GG
Sbjct  314  SETDVGWNWQTCSEMVIPIGISNNTMFPASPFELQDFINECKAAYDVPPRPHWVTTYYGG  373

Query  617  NRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKNDPD  438
              I+ +L+RF SNIIFSNG++DP+S GGVL+NIS S+VA+ T KG+H  D   A + DPD
Sbjct  374  KDIKLILRRFASNIIFSNGLRDPYSSGGVLENISKSVVAVTTTKGSHCLDILQAKETDPD  433

Query  437  WLIQQREKEVDILQKWIGEYYRDMDM  360
            WL++QR+ EV+I+++WI +YY D+++
Sbjct  434  WLVKQRKVEVNIIKRWIAQYYFDLEV  459



>ref|XP_006369363.1| hypothetical protein POPTR_0001s22060g [Populus trichocarpa]
 gb|ERP65932.1| hypothetical protein POPTR_0001s22060g [Populus trichocarpa]
Length=576

 Score =   199 bits (505),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 132/209 (63%), Gaps = 7/209 (3%)
 Frame = -3

Query  983  VNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDE  804
            + YA  A +  P P YPV ++CK ID   +G   +SR F     YY   G   C+   + 
Sbjct  350  IMYANAAQYNSP-PTYPVNEVCKGIDDDASGDDILSRIFRGVVAYY---GNRTCYFNNNA  405

Query  803  S--DDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRPHWITT  630
                      W WQ C+EMVM + V   SMF P  + +++    C+ +YGV+PRPHW+TT
Sbjct  406  YAYQSEATLDWSWQTCSEMVMSLGVGNNSMFEPDPFDWKDYIDRCKSLYGVRPRPHWVTT  465

Query  629  HFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSAT-  453
            ++GG+ I+ +L+RFGSNIIFSNG++DP+S GGVL NISDSIVA+ T  G+H  D + A  
Sbjct  466  YYGGHDIKLILQRFGSNIIFSNGLRDPYSSGGVLNNISDSIVAVTTVNGSHCLDIQRANP  525

Query  452  KNDPDWLIQQREKEVDILQKWIGEYYRDM  366
              DPDWL+ QR+KEV+I++ WI +YY D+
Sbjct  526  STDPDWLVMQRKKEVEIIEGWITQYYEDL  554



>ref|XP_006424415.1| hypothetical protein CICLE_v10028929mg [Citrus clementina]
 gb|ESR37655.1| hypothetical protein CICLE_v10028929mg [Citrus clementina]
Length=303

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 128/205 (62%), Gaps = 5/205 (2%)
 Frame = -3

Query  977  YATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDESD  798
            YA  A +  P P YPV  +C  IDG   G   IS+ FA       Y G   C+     ++
Sbjct  99   YAHAAQYNHP-PDYPVSMVCGGIDGAAFGNDIISKIFAGV---VAYKGNMSCYVNPPTNE  154

Query  797  DHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHFGG  618
                 GW WQ C+EMV+P+     +MF P+ ++       C+ +YGV PRPHW+TT++GG
Sbjct  155  TETTVGWRWQRCSEMVIPIGTVNTTMFQPTPFNLSSFIDRCESLYGVSPRPHWVTTYYGG  214

Query  617  NRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHAD-FRSATKNDP  441
              I+ +L+RF SNIIFSNG++DP+S GGVL+NISDS+VA+ T  G+H  D  R+   +DP
Sbjct  215  YDIKLILQRFASNIIFSNGLRDPYSSGGVLENISDSVVAIATINGSHCLDILRANQSSDP  274

Query  440  DWLIQQREKEVDILQKWIGEYYRDM  366
            DWL+ QRE E++I++ WI +YY D+
Sbjct  275  DWLVTQRETEIEIIEGWISKYYADL  299



>gb|EMT30656.1| Lysosomal Pro-X carboxypeptidase [Aegilops tauschii]
Length=485

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 132/213 (62%), Gaps = 18/213 (8%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +A VY+AM +Y TE+ F+  LPAYPV++MC+ ID   +G    SR   A  +YYNY+G  
Sbjct  237   TAIVYSAMTDYPTESGFLTHLPAYPVKEMCRAIDNPKSGKDTFSRVNDALMVYYNYTGNT  296

Query  827   KCFHIEDESDDHGLH-GWDWQACTEMVM------------PMV-----VSKESMFPPSSY  702
              C     E D +G+  GWD+QACTEM++             M+     V   S+ PP  +
Sbjct  297   HCLGDATEHDPYGMFDGWDFQACTEMILMSYGVRNGSACTEMILRSYGVRNGSVLPPEPF  356

Query  701   SYEETERSCQRMYGVKPRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKN  522
             ++ +    C+   G+ PRP+WI T FGG  I  VLKR  SNIIF NG++DPWS GGVLK+
Sbjct  357   NFTKLLDGCRAPPGLPPRPYWIPTEFGGFDIANVLKRSASNIIFFNGLRDPWSSGGVLKD  416

Query  521   ISDSIVALVTEKGAHHADFRSATKNDPDWLIQQ  423
             IS SIVALV  KG+HH D R ++K+DPDWL Q+
Sbjct  417   ISRSIVALVEPKGSHHVDLRFSSKDDPDWLKQE  449



>gb|KCW50735.1| hypothetical protein EUGRSUZ_J00406 [Eucalyptus grandis]
Length=312

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 122/192 (64%), Gaps = 3/192 (2%)
 Frame = -3

Query  941  AYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDESDDHGLHGWDWQAC  762
            A P++ MC  I+G P     + + FA        +G   C+     SD     GW WQ C
Sbjct  119  AQPLKLMCDAINGAPPRKGLLQKIFAG---LVAINGNLTCYVNPSGSDAQTPSGWFWQTC  175

Query  761  TEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHFGGNRIEQVLKRFGS  582
            TEM  P+ +++ +MFPP  ++      +C+  +GV  RP W+TT+FGG+ I+ +L RF S
Sbjct  176  TEMAFPIGITRNTMFPPEPFNLNSFSNACKSEFGVPARPRWVTTYFGGHDIKLILHRFAS  235

Query  581  NIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKNDPDWLIQQREKEVDI  402
            NIIFSNG+QDP+S GGVLKNIS ++VA+ T KG+H  D   A K+DPDWL++QR+ EV I
Sbjct  236  NIIFSNGLQDPYSSGGVLKNISSTVVAIYTAKGSHCLDILGADKSDPDWLVEQRKTEVKI  295

Query  401  LQKWIGEYYRDM  366
            ++KW+ +YY D+
Sbjct  296  MKKWLAKYYADL  307



>ref|XP_007155791.1| hypothetical protein PHAVU_003G232100g [Phaseolus vulgaris]
 gb|ESW27785.1| hypothetical protein PHAVU_003G232100g [Phaseolus vulgaris]
Length=444

 Score =   195 bits (496),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 113/158 (72%), Gaps = 3/158 (2%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             SA+ Y AMVNY   ++F+  LP +P+ ++CK IDG PAG + + R +   ++YYNY+G E
Sbjct  288   SAYSYLAMVNYPYPSDFLMTLPGHPIREVCKKIDGVPAGTNILERIYEGVNVYYNYTGKE  347

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKES-MFPPSSYSYEETERSCQRMYGVKP  651
             KCF ++D  D HG+ GWDWQACTEMVMPM  +++S MFPP  Y+Y   +  C   YGVKP
Sbjct  348   KCFELDD--DPHGMSGWDWQACTEMVMPMSSNQDSSMFPPYEYNYTSFQEECLNDYGVKP  405

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRG  537
             RP WITT FGG+ I   LK+FGSNIIFSNG+ DPWS G
Sbjct  406   RPKWITTEFGGHDIHATLKKFGSNIIFSNGLLDPWSGG  443



>gb|KCW50732.1| hypothetical protein EUGRSUZ_J00405 [Eucalyptus grandis]
Length=476

 Score =   196 bits (498),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 124/190 (65%), Gaps = 7/190 (4%)
 Frame = -3

Query  935  PVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDESDDHGLHGWDWQACTE  756
            PV+++C  IDG       + + FA         G   C+    ++D     GW WQ C+E
Sbjct  289  PVKEICNAIDGASPRNDILGKIFAG---LVASDGNLPCYVNPSQTD----LGWSWQTCSE  341

Query  755  MVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHFGGNRIEQVLKRFGSNI  576
            MVMP+ +++ +MF P  +        C+R YG+ PRPHWITT++GG+ I+ VL RF SNI
Sbjct  342  MVMPIGITENTMFQPEPFDLNSYNNDCKRSYGITPRPHWITTYYGGHDIKLVLHRFASNI  401

Query  575  IFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKNDPDWLIQQREKEVDILQ  396
            IFSNG+QDP+S GGVLKNISD++VA+ T KG+H  D   ATK DPDWL++QR+ E++I+Q
Sbjct  402  IFSNGLQDPYSSGGVLKNISDTVVAVYTAKGSHCLDILPATKADPDWLVKQRKIEIEIIQ  461

Query  395  KWIGEYYRDM  366
            KWI  Y+ D+
Sbjct  462  KWIATYHADL  471



>ref|XP_011657047.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Cucumis sativus]
 gb|KGN46898.1| hypothetical protein Csa_6G149390 [Cucumis sativus]
Length=511

 Score =   196 bits (499),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 132/204 (65%), Gaps = 5/204 (2%)
 Frame = -3

Query  977  YATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDESD  798
            YA+ A +  P P YPV ++C  IDG  +    +S+  A     + + G+  C+  E  ++
Sbjct  308  YASAAQYNHP-PKYPVTRICDAIDGTYSVNGTLSKIAAGV---FAFRGSVSCYINEPRNE  363

Query  797  DHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHFGG  618
                 GW WQ+C+EMVMP + S + MFPPS +  +     C R+YGV PRPHW TT++GG
Sbjct  364  TETDVGWRWQSCSEMVMP-IGSDDDMFPPSPFDLQSVINYCNRLYGVPPRPHWATTYYGG  422

Query  617  NRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKNDPD  438
            + I  VL+RFGSNIIFSNG++DP+S  GVL NISDS++A+ T  G+H  D   A + DP+
Sbjct  423  HDIRLVLQRFGSNIIFSNGLKDPYSIAGVLHNISDSLLAVYTTNGSHCLDILKAHETDPE  482

Query  437  WLIQQREKEVDILQKWIGEYYRDM  366
            WL++QR+ EV I++ WI EYY D+
Sbjct  483  WLVRQRKTEVGIIKGWISEYYADL  506



>gb|EYU41363.1| hypothetical protein MIMGU_mgv1a0060841mg, partial [Erythranthe 
guttata]
Length=164

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 109/155 (70%), Gaps = 7/155 (5%)
 Frame = -3

Query  827  KCFHIEDESDDHGLHGWDWQ----ACTEMVMPMVVSKE-SMFPPSSYSYEETERSCQRMY  663
            +CF ++D  D  G +GW+WQ    ACTEMVMP   SK  SMFP   Y Y   E  C   Y
Sbjct  2    ECFDLDD--DPQGTNGWNWQGQFFACTEMVMPTSSSKNTSMFPAYDYDYASDEEWCLENY  59

Query  662  GVKPRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKG  483
            GVKPRP WITT FGG+  +  LK FGSNIIFSNG+ DPWS G VL++IS++IVALVTEKG
Sbjct  60   GVKPRPTWITTEFGGHGFKHALKNFGSNIIFSNGLLDPWSGGSVLEDISETIVALVTEKG  119

Query  482  AHHADFRSATKNDPDWLIQQREKEVDILQKWIGEY  378
            AHH D R+AT  DPDWL++QR  EV ++Q W+ +Y
Sbjct  120  AHHLDLRAATAEDPDWLVEQRAAEVKLIQSWLDQY  154



>ref|XP_010034183.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
Length=497

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 124/190 (65%), Gaps = 7/190 (4%)
 Frame = -3

Query  935  PVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDESDDHGLHGWDWQACTE  756
            PV+++C  IDG       + + FA         G   C+    ++D     GW WQ C+E
Sbjct  310  PVKEICNAIDGASPRNDILGKIFAG---LVASDGNLPCYVNPSQTD----LGWSWQTCSE  362

Query  755  MVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHFGGNRIEQVLKRFGSNI  576
            MVMP+ +++ +MF P  +        C+R YG+ PRPHWITT++GG+ I+ VL RF SNI
Sbjct  363  MVMPIGITENTMFQPEPFDLNSYNNDCKRSYGITPRPHWITTYYGGHDIKLVLHRFASNI  422

Query  575  IFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKNDPDWLIQQREKEVDILQ  396
            IFSNG+QDP+S GGVLKNISD++VA+ T KG+H  D   ATK DPDWL++QR+ E++I+Q
Sbjct  423  IFSNGLQDPYSSGGVLKNISDTVVAVYTAKGSHCLDILPATKADPDWLVKQRKIEIEIIQ  482

Query  395  KWIGEYYRDM  366
            KWI  Y+ D+
Sbjct  483  KWIATYHADL  492



>gb|KDP43933.1| hypothetical protein JCGZ_05400 [Jatropha curcas]
Length=419

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/206 (43%), Positives = 132/206 (64%), Gaps = 6/206 (3%)
 Frame = -3

Query  977  YATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDESD  798
            YA  A +  P P YPV  +C  ID  P G   + R FA    Y    G + C+ + + +D
Sbjct  211  YAEAAQYNDP-PNYPVSIVCDGIDRAPEGTDILGRIFAGVVAYM---GHKSCYDMNEFND  266

Query  797  --DHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHF  624
              D     W WQ C+E+VMP+   + +MFPP+ ++ +   + C+ ++G+ P+PHW+TT++
Sbjct  267  PTDQTSLAWRWQTCSELVMPIGHDRNTMFPPAPFNLKSYIKECKSLFGILPQPHWVTTYY  326

Query  623  GGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKND  444
            GG  ++ +L RF SNIIFSNG++DP+S GGVL+NISDSIVA+ T  G+H  D +    +D
Sbjct  327  GGQDLKLILHRFASNIIFSNGLRDPYSTGGVLENISDSIVAISTVNGSHCLDIQKEKPSD  386

Query  443  PDWLIQQREKEVDILQKWIGEYYRDM  366
            P+WL+ QR+ EV+I+Q WI +YY D+
Sbjct  387  PNWLVMQRKTEVEIIQGWISKYYTDL  412



>emb|CBI17112.3| unnamed protein product [Vitis vinifera]
Length=624

 Score =   198 bits (503),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 135/208 (65%), Gaps = 7/208 (3%)
 Frame = -3

Query  980  NYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDES  801
             Y+  A +  P P+YPV  +C  IDG P G+  +SR FA       + G   C++  + +
Sbjct  416  TYSIAAQYDAP-PSYPVTVVCGGIDGAPEGSDILSRIFAGV---VAFRGNMSCYYTSNTT  471

Query  800  D--DHGLHGWDWQACTEMVMPMVVS-KESMFPPSSYSYEETERSCQRMYGVKPRPHWITT  630
            D     + GW WQ C+E+V+P+     ++MFP + ++     + C  +YGV PRPHWITT
Sbjct  472  DYPIETIQGWGWQTCSEIVIPIGRGVNDTMFPLAPFNLTTFSQDCTSLYGVAPRPHWITT  531

Query  629  HFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATK  450
            ++GG+ IE +L+RF SNIIFSNG++DP+S GGVLKNIS+S++A++T  G+H  D   A  
Sbjct  532  YYGGHDIELILRRFASNIIFSNGLRDPYSIGGVLKNISNSVLAILTVNGSHCLDLLPAAS  591

Query  449  NDPDWLIQQREKEVDILQKWIGEYYRDM  366
             DP+WL+ QR+ EV+I++ WI +YY D+
Sbjct  592  TDPEWLVMQRKAEVEIIEGWIAQYYVDL  619


 Score = 82.4 bits (202),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = -3

Query  770  QACTEMVMPMVVS-KESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHFGGNRIEQVLK  594
            Q C E VMP+     ++MFP   ++     + C  +YGV P PHW TT++GG+ IE +L 
Sbjct  2    QRCNETVMPLRRGDSDTMFPLVPFNLTTFIQECISIYGVSPWPHWATTYYGGHNIELILH  61

Query  593  RFGSNIIFSNGMQDPWSRGG  534
            RF SNIIFSNG++DP++  G
Sbjct  62   RFASNIIFSNGLRDPYAVPG  81



>ref|XP_006485332.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=511

 Score =   196 bits (497),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 134/205 (65%), Gaps = 5/205 (2%)
 Frame = -3

Query  977  YATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDESD  798
            Y   A + +P P YPV ++C  IDG   G   ++R F+     +   G + C++I +   
Sbjct  300  YTVAAQYDRP-PNYPVNQVCNGIDGASQGTDTVARIFSGIVASW---GKKSCYNIGEFFS  355

Query  797  DHGLHGWDWQACTEMVMPMVVSK-ESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHFG  621
            D  L+GW W+ C+E+VMP+ + K +SMFP   ++ +E   SC+  YGV PR HWITT++G
Sbjct  356  DETLNGWGWKTCSEIVMPIGIGKNKSMFPAEPFNLKEYMDSCKSSYGVVPRTHWITTYYG  415

Query  620  GNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKNDP  441
            G  I  VLKRFGSNIIFS+G+ DP+S  GVL++ISDSI+A+ T+ G+H  D   A K+DP
Sbjct  416  GLDIRVVLKRFGSNIIFSSGLHDPYSTAGVLEDISDSILAVPTKNGSHCLDILPAKKDDP  475

Query  440  DWLIQQREKEVDILQKWIGEYYRDM  366
            DWL  QR+ EV+I+  WI +YY D+
Sbjct  476  DWLTMQRQVEVNIVHAWILKYYADL  500



>ref|XP_009356983.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Pyrus x bretschneideri]
Length=507

 Score =   196 bits (497),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/205 (45%), Positives = 129/205 (63%), Gaps = 5/205 (2%)
 Frame = -3

Query  977  YATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDESD  798
            Y   A +  P P+YPV   C  IDG  +G   +S+ FA    Y   SG   C+  E  + 
Sbjct  302  YCGAAQYNSP-PSYPVTVFCGGIDGVSSGNDTLSKIFAGVVAY---SGNRSCYVNEPRNL  357

Query  797  DHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHFGG  618
                 GW WQ C++MV+P+ VS +SMFPP  +  +E   +C+ +YGV PRPHW+T +FGG
Sbjct  358  SETDVGWSWQTCSDMVIPISVSNDSMFPPYQFDLQEYIDNCKAIYGVPPRPHWVTAYFGG  417

Query  617  NRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHAD-FRSATKNDP  441
            + I+  L RF SNIIFSNG++DP+S  GVL+NISD++VA+  + G+H  D  RS    DP
Sbjct  418  HDIKLALYRFASNIIFSNGLRDPFSGAGVLENISDTVVAVHAKNGSHCLDVLRSNNITDP  477

Query  440  DWLIQQREKEVDILQKWIGEYYRDM  366
            DWL++QR+ EV I++ W+ EYY  +
Sbjct  478  DWLVEQRKTEVKIIEGWLAEYYSKL  502



>ref|XP_010031430.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Eucalyptus 
grandis]
 gb|KCW50723.1| hypothetical protein EUGRSUZ_J00402 [Eucalyptus grandis]
Length=497

 Score =   195 bits (495),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 95/209 (45%), Positives = 137/209 (66%), Gaps = 11/209 (5%)
 Frame = -3

Query  977  YATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIE-DES  801
            Y T A    P P YPV ++C+ IDG     + I    +A  + Y Y  +  C +     S
Sbjct  291  YTTAAQQDNP-PTYPVTRICEGIDGANTTENGILGKISAGVVAY-YWNSNCCLNTPLTVS  348

Query  800  DDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHFG  621
             D    GW WQ C+EMVMP+ +++ SMFPP+ +  ++    C+  YGV PRPHW+TTH+G
Sbjct  349  PD----GWSWQKCSEMVMPLGITRNSMFPPAPFLLDDFMEHCRCEYGVVPRPHWVTTHYG  404

Query  620  GNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKN--  447
            G+ IE +L+RFGSNIIFSNG++DPWS  GVLKNIS+SI+A++T++G+H  D    + +  
Sbjct  405  GHDIELILRRFGSNIIFSNGLRDPWSGAGVLKNISESIIAVITDQGSHCVDIYPESHDTQ  464

Query  446  --DPDWLIQQREKEVDILQKWIGEYYRDM  366
              DPDWL++QR+ EV+I++ WI +YY D+
Sbjct  465  CPDPDWLVKQRKTEVEIIKGWIDQYYADL  493



>ref|XP_006485136.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=498

 Score =   195 bits (495),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 136/216 (63%), Gaps = 13/216 (6%)
 Frame = -3

Query  998  VYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAA-----SLYYNYSG  834
            VY+    Y T +N        PV+++C  I+  P     I    AA      SL Y+   
Sbjct  286  VYSEAAQYDTPSNI-------PVKRICNAIENAPNCGDDILCKIAAGVVEADSLEYD-GN  337

Query  833  TEKCFHIEDESDDHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVK  654
              +C+  ED++ D    GW+WQ+C+EMV+PM   K SM+ P  ++  +  ++C+  YGV 
Sbjct  338  NSRCYINEDKTGDESDEGWEWQSCSEMVVPMGKDKNSMYQPEPWNLTKYIKNCKEQYGVS  397

Query  653  PRPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHH  474
            PRP W+ T++GG+ I+ +L+R  SNIIFSNGM+DP+SRGGVL+NISDSI+AL T+ G+H 
Sbjct  398  PRPSWVLTYYGGHDIKLILRRSTSNIIFSNGMRDPFSRGGVLENISDSIIALSTKYGSHC  457

Query  473  ADFRSATKNDPDWLIQQREKEVDILQKWIGEYYRDM  366
             D   A K+DPDWL+QQR+ EV I+Q WI +YY D 
Sbjct  458  LDLDGAKKSDPDWLVQQRKTEVKIMQGWITQYYDDF  493



>ref|XP_002313555.2| hypothetical protein POPTR_0009s00740g [Populus trichocarpa]
 gb|EEE87510.2| hypothetical protein POPTR_0009s00740g [Populus trichocarpa]
Length=495

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 126/204 (62%), Gaps = 4/204 (2%)
 Frame = -3

Query  977  YATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDESD  798
            YA  A + KP P YPV K+C  IDG   G   + R F     Y    G   C+  E  + 
Sbjct  293  YANAAQYNKP-PTYPVNKVCGGIDGCGFGDDLLGRVFGGLVAY---KGNRSCYVNEPTNQ  348

Query  797  DHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHFGG  618
                 GW WQ C+EMVMP+    +SMFPP  +  +     C+ +Y V PR HW+TT++GG
Sbjct  349  SETSVGWRWQTCSEMVMPIGYGNDSMFPPDPFDLKAYIEDCKSLYDVTPRFHWVTTYYGG  408

Query  617  NRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKNDPD  438
            + I  +L+RF SNIIFSNG++DP+S GGVL+NISD++VA+ T  G+H  D   A + DP+
Sbjct  409  HSIRLILQRFASNIIFSNGLRDPYSSGGVLENISDTVVAVKTVNGSHCLDILFAKETDPE  468

Query  437  WLIQQREKEVDILQKWIGEYYRDM  366
            WL+ QR+ E+ I+++WI +YY D+
Sbjct  469  WLVAQRKTEIKIIKEWINKYYADL  492



>ref|XP_011036743.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Populus euphratica]
Length=514

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 129/205 (63%), Gaps = 4/205 (2%)
 Frame = -3

Query  977  YATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDESD  798
            Y   A +  P P+YPV  +C+ ID    G   + R FA       Y G   C+  +   +
Sbjct  306  YMAAAQYDAP-PSYPVTVICRSIDEPSFGNDILGRIFAGM---VAYRGELPCYVNKPTKE  361

Query  797  DHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHFGG  618
                 GW WQ C +MV+P  +S +SMF P  +        C+  YGV PRPHW+TT+FGG
Sbjct  362  TETDVGWSWQTCADMVIPFGISNDSMFQPYPFDLNVYINDCKDEYGVPPRPHWVTTYFGG  421

Query  617  NRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKNDPD  438
            + I+ +LKRFGSNIIFSNG++DP+S GGVL+NIS+S+VA+ T KG+H  D  + TK+DP 
Sbjct  422  HDIKLILKRFGSNIIFSNGLRDPYSSGGVLQNISESVVAITTVKGSHCLDVLATTKSDPQ  481

Query  437  WLIQQREKEVDILQKWIGEYYRDMD  363
            WL+ QR++EV I++KWI  Y+ D+D
Sbjct  482  WLVAQRKEEVRIIRKWIRNYFSDLD  506



>gb|KJB16582.1| hypothetical protein B456_002G237800 [Gossypium raimondii]
Length=451

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 115/159 (72%), Gaps = 1/159 (1%)
 Frame = -3

Query  1007  SAFVYTAMVNYATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTE  828
             +AF YTAM +Y T +NF+ P+PAYPV++MCK ID   +G    ++ + AAS+YYNYSGT 
Sbjct  293   TAFAYTAMTDYPTPSNFLNPMPAYPVKQMCKAIDDPKSGNDTFAKLYGAASVYYNYSGTA  352

Query  827   KCFHIEDESDDHGLHGWDWQACTEMVMPMVVS-KESMFPPSSYSYEETERSCQRMYGVKP  651
              CF++    D HGL  W WQACTEM+MP   S KES+FP + ++Y     +C+  YGV P
Sbjct  353   TCFNLAYSPDPHGLDMWSWQACTEMIMPTSGSNKESIFPENQWNYSRRAAACKAFYGVHP  412

Query  650   RPHWITTHFGGNRIEQVLKRFGSNIIFSNGMQDPWSRGG  534
             RP+WITT FGG+ I +VLKR+GSN+IF NG++DPWS GG
Sbjct  413   RPNWITTEFGGHDIYRVLKRYGSNMIFFNGLRDPWSGGG  451



>ref|XP_012064654.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Jatropha curcas]
Length=506

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/206 (43%), Positives = 132/206 (64%), Gaps = 6/206 (3%)
 Frame = -3

Query  977  YATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDESD  798
            YA  A +  P P YPV  +C  ID  P G   + R FA    Y    G + C+ + + +D
Sbjct  298  YAEAAQYNDP-PNYPVSIVCDGIDRAPEGTDILGRIFAGVVAYM---GHKSCYDMNEFND  353

Query  797  --DHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHF  624
              D     W WQ C+E+VMP+   + +MFPP+ ++ +   + C+ ++G+ P+PHW+TT++
Sbjct  354  PTDQTSLAWRWQTCSELVMPIGHDRNTMFPPAPFNLKSYIKECKSLFGILPQPHWVTTYY  413

Query  623  GGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKND  444
            GG  ++ +L RF SNIIFSNG++DP+S GGVL+NISDSIVA+ T  G+H  D +    +D
Sbjct  414  GGQDLKLILHRFASNIIFSNGLRDPYSTGGVLENISDSIVAISTVNGSHCLDIQKEKPSD  473

Query  443  PDWLIQQREKEVDILQKWIGEYYRDM  366
            P+WL+ QR+ EV+I+Q WI +YY D+
Sbjct  474  PNWLVMQRKTEVEIIQGWISKYYTDL  499



>ref|XP_006484928.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like [Citrus sinensis]
Length=206

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 127/205 (62%), Gaps = 5/205 (2%)
 Frame = -3

Query  977  YATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDESD  798
            YA  A +  P P YPV  +C  IDG   G   +S+ FA    Y    G   C+     ++
Sbjct  2    YAYAAQYNHP-PDYPVSMVCGGIDGAAFGNDILSKIFAGVVAY---EGNMSCYVNPPTNE  57

Query  797  DHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHFGG  618
                 GW WQ C+EMV+P+     +MF P+ ++       C  +YGV P+PHW+TT++GG
Sbjct  58   TETTVGWRWQRCSEMVIPIGTDNTTMFQPTPFNLSSFIDWCGSLYGVSPQPHWVTTYYGG  117

Query  617  NRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATK-NDP  441
              I+ +L+RF SNIIFSNG++DP+S GGVL+NISDS+VA+ T  G+H  D  +A + +DP
Sbjct  118  YDIKLILQRFASNIIFSNGLRDPYSSGGVLENISDSVVAIPTINGSHCLDILAANQSSDP  177

Query  440  DWLIQQREKEVDILQKWIGEYYRDM  366
            DWL+ QRE E+DI++ W  +YY D+
Sbjct  178  DWLVTQRETEIDIIEGWTSKYYADL  202



>ref|XP_008458666.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Cucumis 
melo]
Length=365

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 130/204 (64%), Gaps = 5/204 (2%)
 Frame = -3

Query  977  YATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDESD  798
            YA+ A +  P P YPV ++C  IDG  +    +S+  A     + + G+  C+  E  ++
Sbjct  162  YASAAQYNHP-PKYPVTRICDAIDGTYSVNGTLSKIAAGV---FAFRGSISCYINEPRNE  217

Query  797  DHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHFGG  618
                 GW WQ+C+EMVMP + S + MFPP  +  +     C R+YGV PRPHW TT++GG
Sbjct  218  TETDVGWRWQSCSEMVMP-ISSDDDMFPPYPFDLQSVINYCNRLYGVPPRPHWATTYYGG  276

Query  617  NRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKNDPD  438
            + I  VL+RFGSNIIFSNG++DP+S  GVL +ISDS++A+ T  G+H  D   A + DP+
Sbjct  277  HDIRLVLQRFGSNIIFSNGLKDPYSIAGVLHSISDSLLAVHTTNGSHCLDILKAHETDPE  336

Query  437  WLIQQREKEVDILQKWIGEYYRDM  366
            WL+ QR+ EV I++ WI EYY D+
Sbjct  337  WLVTQRKTEVGIIKGWISEYYADL  360



>emb|CAN64374.1| hypothetical protein VITISV_018664 [Vitis vinifera]
Length=502

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 131/212 (62%), Gaps = 6/212 (3%)
 Frame = -3

Query  977  YATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDESD  798
            YA  A +  P P YPV  +C  IDG P G+  +SR FA       Y G   C++      
Sbjct  292  YAVAAQYNHP-PRYPVTVVCGGIDGAPEGSDILSRIFAGV---VAYRGNSSCYNTSVNPT  347

Query  797  DHGLHGWDWQACTEMVMPMVVS-KESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHFG  621
            +    GW WQ C+EMVMP+     ++MFPPS ++     ++C  +Y V PRPHWITT++G
Sbjct  348  ETS-EGWRWQTCSEMVMPIGRGDNDTMFPPSPFNLTTFIQACTSLYDVPPRPHWITTYYG  406

Query  620  GNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKNDP  441
            G+ I+ +L RF SNIIFSNG++DP+S  GVLKNIS +++A+ T  G+H  D   A   DP
Sbjct  407  GHDIKLILHRFASNIIFSNGLRDPYSSAGVLKNISHTVLAIHTVNGSHCLDILPAKSTDP  466

Query  440  DWLIQQREKEVDILQKWIGEYYRDMDMNQN*T  345
            +WLI QR+ EV+I++ WI +Y+ D+D  +  T
Sbjct  467  EWLIMQRKTEVEIIESWIAQYHADLDATRKRT  498



>ref|XP_006573176.1| PREDICTED: lysosomal Pro-X carboxypeptidase-like isoform X2 [Glycine 
max]
Length=444

 Score =   192 bits (488),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/205 (44%), Positives = 128/205 (62%), Gaps = 4/205 (2%)
 Frame = -3

Query  977  YATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIEDESD  798
            Y   A + +P P YPV  +C  IDG   G+  +S+ +A         G   C      + 
Sbjct  233  YVYAAQYNQP-PRYPVSMICGGIDGESLGSDILSKIYAGI---VALRGNSTCKVNGPTNV  288

Query  797  DHGLHGWDWQACTEMVMPMVVSKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTHFGG  618
                 GW WQ C+EMV+P+ +  ++MF P  ++       C+  YGV PRPHW+TT++GG
Sbjct  289  SETTVGWRWQTCSEMVIPIGIGNDTMFEPIPFNLTRYAEGCKEQYGVSPRPHWVTTYYGG  348

Query  617  NRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKNDPD  438
            + I+ VL+R GSNIIFSNG++DP+S GGVL NISDSIVA+ T  G+H  D   A ++DP 
Sbjct  349  HNIKLVLRRLGSNIIFSNGLRDPYSIGGVLDNISDSIVAVHTVNGSHCLDLLRANQSDPG  408

Query  437  WLIQQREKEVDILQKWIGEYYRDMD  363
            WL++QR+KEV I+++WI +YY D+D
Sbjct  409  WLVEQRKKEVKIIKRWITQYYADLD  433



>ref|XP_007016017.1| Serine carboxypeptidase S28 family protein [Theobroma cacao]
 gb|EOY33636.1| Serine carboxypeptidase S28 family protein [Theobroma cacao]
Length=505

 Score =   193 bits (491),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/207 (43%), Positives = 133/207 (64%), Gaps = 7/207 (3%)
 Frame = -3

Query  977  YATEANFMKPLPAYPVEKMCKIIDGFPAGASKISRAFAAASLYYNYSGTEKCFHIE--DE  804
            Y+  A +  P P YP+  +C  IDG P G   + R FA       Y G + C+ +   + 
Sbjct  296  YSEAAQYDHP-PTYPLSIVCGGIDGAPKGTDILGRIFAGV---VAYVGNKSCYDMNAYNH  351

Query  803  SDDHGLHGWDWQACTEMVMPMV-VSKESMFPPSSYSYEETERSCQRMYGVKPRPHWITTH  627
              D    GW WQ C+EMVMP+   + +SMFPP+ ++     R C+ ++GV+P+PHW+TT+
Sbjct  352  PSDETYMGWRWQTCSEMVMPIGHGNNDSMFPPAPFNLNRFIRKCKSLFGVQPQPHWVTTY  411

Query  626  FGGNRIEQVLKRFGSNIIFSNGMQDPWSRGGVLKNISDSIVALVTEKGAHHADFRSATKN  447
            +GG+ ++ +L RF SNIIFSNG++DP+S GGVL+NISDS+VA+ T  G+H  D     K+
Sbjct  412  YGGHDLKLILHRFASNIIFSNGLRDPYSSGGVLENISDSVVAVHTIHGSHCLDILPEKKS  471

Query  446  DPDWLIQQREKEVDILQKWIGEYYRDM  366
            DP WL++QR+ EV I++ W+ +YY D+
Sbjct  472  DPQWLVKQRKTEVQIIEAWLAKYYTDL  498



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2543375385617