BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig14142

Length=881
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006358786.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    265   1e-77   Solanum tuberosum [potatoes]
ref|XP_009762059.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    264   4e-77   Nicotiana sylvestris
ref|XP_009762058.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    264   4e-77   Nicotiana sylvestris
ref|XP_004248027.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    263   6e-77   Solanum lycopersicum
ref|XP_009589277.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    261   4e-76   Nicotiana tomentosiformis
ref|XP_009589278.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    261   4e-76   Nicotiana tomentosiformis
ref|XP_011084145.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    260   1e-75   Sesamum indicum [beniseed]
gb|KCW45609.1|  hypothetical protein EUGRSUZ_L00641                     259   3e-75   Eucalyptus grandis [rose gum]
ref|XP_010039950.1|  PREDICTED: LOW QUALITY PROTEIN: probable UDP...    258   5e-75   
ref|XP_006365461.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    257   1e-74   
ref|XP_009622561.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    256   2e-74   Nicotiana tomentosiformis
gb|KJB44757.1|  hypothetical protein B456_007G2711002                   243   3e-74   Gossypium raimondii
ref|XP_008792947.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    255   6e-74   Phoenix dactylifera
ref|XP_009799068.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    254   1e-73   Nicotiana sylvestris
ref|XP_010926674.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    254   2e-73   Elaeis guineensis
ref|XP_004239846.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    253   3e-73   Solanum lycopersicum
ref|XP_010905160.1|  PREDICTED: LOW QUALITY PROTEIN: probable UDP...    253   3e-73   Elaeis guineensis
gb|AGJ98230.1|  PIB17 secret agent protein                              253   5e-73   Petunia x hybrida [garden petunia]
ref|XP_010321405.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    252   5e-73   
gb|KHG06148.1|  putative UDP-N-acetylglucosamine--peptide N-acety...    252   6e-73   Gossypium arboreum [tree cotton]
ref|XP_002522031.1|  o-linked n-acetylglucosamine transferase, og...    252   9e-73   Ricinus communis
ref|XP_007030292.1|  Tetratricopeptide repeat (TPR)-like superfam...    249   1e-72   
ref|XP_007034160.1|  Tetratricopeptide repeat (TPR)-like superfam...    251   1e-72   
emb|CDP10263.1|  unnamed protein product                                250   3e-72   Coffea canephora [robusta coffee]
ref|XP_010550828.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    250   4e-72   Tarenaya hassleriana [spider flower]
ref|XP_008218375.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    250   4e-72   Prunus mume [ume]
ref|XP_007208375.1|  hypothetical protein PRUPE_ppa000862mg             249   1e-71   Prunus persica
ref|XP_008443744.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    249   1e-71   Cucumis melo [Oriental melon]
ref|XP_010102180.1|  putative UDP-N-acetylglucosamine--peptide N-...    248   1e-71   
ref|XP_012089398.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    248   2e-71   Jatropha curcas
ref|XP_009379721.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    248   2e-71   Pyrus x bretschneideri [bai li]
ref|XP_011660251.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    248   3e-71   Cucumis sativus [cucumbers]
ref|XP_004302117.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    248   3e-71   Fragaria vesca subsp. vesca
ref|XP_011038443.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    247   4e-71   Populus euphratica
ref|XP_007143991.1|  hypothetical protein PHAVU_007G119800g             247   5e-71   Phaseolus vulgaris [French bean]
ref|XP_010278452.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    247   5e-71   Nelumbo nucifera [Indian lotus]
ref|XP_008799566.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    247   6e-71   Phoenix dactylifera
ref|XP_007034161.1|  Tetratricopeptide repeat (TPR)-like superfam...    243   6e-71   
ref|XP_008799568.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    246   7e-71   Phoenix dactylifera
ref|XP_002270163.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    246   7e-71   Vitis vinifera
ref|XP_010648955.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    246   7e-71   Vitis vinifera
ref|XP_010648954.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    246   7e-71   Vitis vinifera
ref|XP_006606442.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    246   8e-71   
ref|XP_002319130.2|  O-linked N-acetyl glucosamine transferase fa...    246   9e-71   Populus trichocarpa [western balsam poplar]
emb|CAN80393.1|  hypothetical protein VITISV_001595                     240   9e-71   Vitis vinifera
gb|KHN04963.1|  Putative UDP-N-acetylglucosamine--peptide N-acety...    246   1e-70   Glycine soja [wild soybean]
ref|XP_006606441.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    246   1e-70   Glycine max [soybeans]
ref|XP_009337940.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    246   1e-70   Pyrus x bretschneideri [bai li]
gb|KDO52513.1|  hypothetical protein CISIN_1g0024311mg                  238   1e-70   Citrus sinensis [apfelsine]
ref|XP_004495555.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    245   2e-70   Cicer arietinum [garbanzo]
ref|XP_004495554.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    245   2e-70   
ref|XP_010913107.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    245   2e-70   Elaeis guineensis
ref|XP_010247969.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    244   4e-70   Nelumbo nucifera [Indian lotus]
gb|ACN33532.1|  unknown                                                 225   4e-70   Zea mays [maize]
ref|XP_006443296.1|  hypothetical protein CICLE_v10018711mg             244   6e-70   
gb|KHG03581.1|  putative UDP-N-acetylglucosamine--peptide N-acety...    244   6e-70   Gossypium arboreum [tree cotton]
ref|XP_010674215.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    244   6e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008388750.1|  PREDICTED: LOW QUALITY PROTEIN: probable UDP...    244   7e-70   
gb|KJB71957.1|  hypothetical protein B456_011G150500                    243   8e-70   Gossypium raimondii
gb|KJB71955.1|  hypothetical protein B456_011G150500                    243   8e-70   Gossypium raimondii
gb|KJB71956.1|  hypothetical protein B456_011G150500                    243   1e-69   Gossypium raimondii
ref|XP_010463898.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    243   1e-69   Camelina sativa [gold-of-pleasure]
ref|XP_009392638.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    243   1e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003536152.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    243   1e-69   Glycine max [soybeans]
gb|EYU24294.1|  hypothetical protein MIMGU_mgv1a000982mg                243   1e-69   Erythranthe guttata [common monkey flower]
gb|EYU28505.1|  hypothetical protein MIMGU_mgv1a000777mg                243   2e-69   Erythranthe guttata [common monkey flower]
ref|XP_011002011.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    242   2e-69   Populus euphratica
ref|XP_008777513.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    242   2e-69   Phoenix dactylifera
ref|XP_009399047.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    242   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008777511.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    242   2e-69   
gb|KJB82315.1|  hypothetical protein B456_013G189100                    242   3e-69   Gossypium raimondii
ref|XP_003572530.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    242   3e-69   Brachypodium distachyon [annual false brome]
ref|XP_010485795.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    241   4e-69   Camelina sativa [gold-of-pleasure]
ref|XP_002884434.1|  hypothetical protein ARALYDRAFT_896453             241   4e-69   Arabidopsis lyrata subsp. lyrata
ref|XP_007030291.1|  Tetratricopeptide repeat (TPR)-like superfam...    241   6e-69   
ref|XP_010413233.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    241   6e-69   Camelina sativa [gold-of-pleasure]
ref|XP_006848455.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    241   8e-69   Amborella trichopoda
gb|KFK37851.1|  hypothetical protein AALP_AA3G037400                    240   1e-68   Arabis alpina [alpine rockcress]
dbj|BAJ92905.1|  predicted protein                                      229   1e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006296908.1|  hypothetical protein CARUB_v10012900mg             240   2e-68   
emb|CDY21133.1|  BnaA01g33640D                                          240   2e-68   Brassica napus [oilseed rape]
ref|XP_003590905.1|  O-linked GlcNAc transferase like protein           239   2e-68   Medicago truncatula
emb|CDY29989.1|  BnaC01g40190D                                          239   3e-68   Brassica napus [oilseed rape]
ref|NP_187074.1|  putative UDP-N-acetylglucosamine--peptide N-ace...    238   4e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010673371.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    238   6e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006408212.1|  hypothetical protein EUTSA_v10019996mg             238   7e-68   Eutrema salsugineum [saltwater cress]
ref|XP_009125003.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    238   1e-67   Brassica rapa
ref|XP_002453843.1|  hypothetical protein SORBIDRAFT_04g019560          238   1e-67   Sorghum bicolor [broomcorn]
ref|XP_010549635.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    237   1e-67   Tarenaya hassleriana [spider flower]
dbj|BAJ94917.1|  predicted protein                                      237   2e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002325368.1|  O-linked N-acetyl glucosamine transferase fa...    236   3e-67   
ref|XP_004952491.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    236   3e-67   Setaria italica
ref|XP_006408211.1|  hypothetical protein EUTSA_v10019996mg             236   4e-67   
ref|XP_003590906.1|  O-linked GlcNAc transferase like protein           233   8e-67   
gb|KJB82317.1|  hypothetical protein B456_013G189100                    233   9e-67   Gossypium raimondii
ref|XP_008643950.1|  PREDICTED: uncharacterized protein LOC100381...    233   4e-66   Zea mays [maize]
ref|NP_001167956.1|  uncharacterized protein LOC100381672               233   4e-66   Zea mays [maize]
gb|EEC73199.1|  hypothetical protein OsI_07263                          232   9e-66   Oryza sativa Indica Group [Indian rice]
gb|EEE57013.1|  hypothetical protein OsJ_06783                          232   1e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006647295.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    227   5e-65   
ref|XP_004971037.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    229   6e-65   Setaria italica
gb|AFW71469.1|  hypothetical protein ZEAMMB73_864118                    227   8e-65   
gb|EPS58700.1|  hypothetical protein M569_16113                         211   9e-65   Genlisea aurea
ref|XP_006647294.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    228   1e-64   
ref|XP_006646603.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    228   2e-64   Oryza brachyantha
ref|XP_010239774.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    228   2e-64   Brachypodium distachyon [annual false brome]
ref|XP_010233580.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    228   2e-64   Brachypodium distachyon [annual false brome]
ref|XP_003579571.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    228   2e-64   Brachypodium distachyon [annual false brome]
gb|EEC72025.1|  hypothetical protein OsI_04909                          222   3e-62   Oryza sativa Indica Group [Indian rice]
gb|EEE55882.1|  hypothetical protein OsJ_04532                          221   4e-62   Oryza sativa Japonica Group [Japonica rice]
gb|EMS67442.1|  putative UDP-N-acetylglucosamine--peptide N-acety...    222   1e-61   Triticum urartu
ref|XP_001779704.1|  predicted protein                                  214   2e-59   
gb|EMT18216.1|  Putative UDP-N-acetylglucosamine--peptide N-acety...    209   2e-57   
ref|XP_002966194.1|  peptide-N-acetylglucosaminyltransferase            208   4e-57   
ref|XP_001774513.1|  predicted protein                                  207   4e-57   
gb|KJB44758.1|  hypothetical protein B456_007G2711002                   181   8e-51   Gossypium raimondii
gb|ACN35850.1|  unknown                                                 172   1e-49   Zea mays [maize]
gb|KDO52515.1|  hypothetical protein CISIN_1g0024311mg                  179   1e-48   Citrus sinensis [apfelsine]
gb|KJB82316.1|  hypothetical protein B456_013G189100                    181   1e-47   Gossypium raimondii
ref|XP_005652169.1|  TPR-like protein                                   179   4e-47   Coccomyxa subellipsoidea C-169
gb|ABA27069.1|  TO89-1                                                  141   4e-38   Taraxacum officinale [dandelion]
ref|XP_009800255.1|  PREDICTED: probable UDP-N-acetylglucosamine-...    138   4e-37   Nicotiana sylvestris
emb|CCI46056.1|  unnamed protein product                                140   2e-33   Albugo candida
emb|CCI46057.1|  unnamed protein product                                140   2e-33   Albugo candida
emb|CCA22532.1|  predicted protein putative                             138   1e-32   Albugo laibachii Nc14
ref|XP_008913877.1|  hypothetical protein PPTG_17683                    134   5e-31   Phytophthora parasitica INRA-310
gb|ETL80498.1|  hypothetical protein L917_19015                         134   5e-31   Phytophthora parasitica
gb|ETI33477.1|  hypothetical protein F443_19846                         134   5e-31   Phytophthora parasitica P1569
gb|KIY93470.1|  hypothetical protein MNEG_14491                         122   1e-30   Monoraphidium neglectum
emb|CBJ26401.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosa...    132   1e-30   Ectocarpus siliculosus
ref|WP_041233800.1|  UDP-N-acetylglucosamine--peptide N-acetylglu...    128   2e-30   
gb|ETK73827.1|  hypothetical protein L915_19294                         132   2e-30   Phytophthora parasitica
gb|AIA83498.1|  CAZy families GT41 protein                              121   6e-30   uncultured Azospirillum sp.
ref|XP_005835014.1|  hypothetical protein GUITHDRAFT_68991              127   1e-29   Guillardia theta CCMP2712
ref|XP_005715776.1|  UDP-GlcNAc: peptide-N-acetylglucosaminyltran...    130   1e-29   Chondrus crispus [carageen]
gb|ETI33489.1|  hypothetical protein F443_19842                         129   1e-29   Phytophthora parasitica P1569
gb|AFZ26553.1|  TIGR03032 family protein                                129   2e-29   Cylindrospermum stagnale PCC 7417
emb|CCI13110.1|  putative UDP-N-acetylglucosamine--peptide N-acet...    122   8e-29   Microcystis aeruginosa PCC 9806
ref|WP_043999986.1|  hypothetical protein                               122   2e-28   Microcystis aeruginosa
ref|XP_009838332.1|  hypothetical protein H257_12727                    121   2e-28   Aphanomyces astaci
ref|XP_010844685.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    117   2e-28   Bison bison bison
dbj|BAD21873.1|  putative O-linked N-acetyl glucosamine transferase     125   2e-28   Oryza sativa Japonica Group [Japonica rice]
ref|WP_043995455.1|  UDP-N-acetylglucosamine--peptide N-acetylglu...    122   4e-28   
ref|WP_043996985.1|  UDP-N-acetylglucosamine--peptide N-acetylglu...    121   4e-28   
emb|CCI32984.1|  putative UDP-N-acetylglucosamine--peptide N-acet...    122   5e-28   Microcystis sp. T1-4
emb|CCH99039.1|  TPR repeat protein (modular protein)                   124   8e-28   Microcystis aeruginosa PCC 9717
dbj|BAC32961.1|  unnamed protein product                                115   9e-28   Mus musculus [mouse]
ref|WP_016515527.1|  TPR repeat-containing protein yrrB                 123   1e-27   
emb|CCI04721.1|  TPR repeat protein (modular protein)                   124   1e-27   Microcystis aeruginosa PCC 9443
ref|XP_006896046.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004989820.1|  O-linked N-acetylglucosamine transferase           124   2e-27   Salpingoeca rosetta
emb|CCI18142.1|  TPR repeat protein (modular protein)                   123   2e-27   Microcystis aeruginosa PCC 9807
ref|XP_004872711.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   
ref|XP_004595331.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Ochotona princeps [southern American pika]
gb|ELW48655.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    123   2e-27   Tupaia chinensis
gb|EPY77343.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    123   2e-27   Camelus ferus
ref|XP_007957192.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Orycteropus afer afer
ref|XP_004475866.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Dasypus novemcinctus
ref|XP_005614319.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Equus caballus [domestic horse]
ref|XP_008853783.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Nannospalax galili
ref|XP_008565770.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Galeopterus variegatus [Malayan flying lemur]
ref|XP_004901730.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   
ref|XP_003412774.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Loxodonta africana [African bush elephant]
ref|XP_002930623.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Ailuropoda melanoleuca
ref|XP_010364888.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Rhinopithecus roxellana
ref|XP_009233248.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   
ref|XP_008853784.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Nannospalax galili
ref|XP_008565771.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Galeopterus variegatus [Malayan flying lemur]
ref|NP_001091539.1|  UDP-N-acetylglucosamine--peptide N-acetylglu...    123   2e-27   Bos taurus [bovine]
ref|XP_007089178.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Panthera tigris altaica
ref|XP_006158122.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Tupaia chinensis
ref|XP_005876267.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Myotis brandtii
ref|XP_004901731.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   
ref|XP_004716717.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_003943149.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Saimiri boliviensis boliviensis
ref|XP_003412775.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Loxodonta africana [African bush elephant]
ref|XP_002930622.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Ailuropoda melanoleuca
ref|XP_001493438.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Equus caballus [domestic horse]
ref|XP_010364887.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Rhinopithecus roxellana
ref|XP_007089177.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Panthera tigris altaica
ref|XP_005228084.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Bos taurus [bovine]
ref|XP_003943148.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Saimiri boliviensis boliviensis
ref|XP_009233247.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   
ref|XP_006896045.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_010820151.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Bos taurus [bovine]
ref|XP_005700713.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   
gb|AAI49783.1|  OGT protein                                             123   2e-27   Bos taurus [bovine]
gb|EFB13341.1|  hypothetical protein PANDA_021118                       123   2e-27   Ailuropoda melanoleuca
ref|XP_001493422.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Equus caballus [domestic horse]
ref|XP_004716716.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Echinops telfairi [lesser hedgehog tenrec]
gb|ELR52744.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    123   2e-27   Bos mutus
ref|XP_006158121.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Tupaia chinensis
ref|XP_005876266.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Myotis brandtii
ref|WP_043997209.1|  UDP-N-acetylglucosamine--peptide N-acetylglu...    119   2e-27   
ref|XP_007957191.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Orycteropus afer afer
ref|XP_004475865.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Dasypus novemcinctus
ref|WP_043999373.1|  hypothetical protein                               122   2e-27   
ref|XP_009514691.1|  hypothetical protein PHYSODRAFT_553979             123   2e-27   Phytophthora sojae
gb|EHB13741.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    123   2e-27   Heterocephalus glaber [naked mole rat]
ref|WP_002737372.1|  hypothetical protein                               119   2e-27   Microcystis aeruginosa
ref|XP_008971796.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Pan paniscus [bonobo]
ref|XP_008971795.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   2e-27   Pan paniscus [bonobo]
ref|NP_858059.1|  UDP-N-acetylglucosamine--peptide N-acetylglucos...    123   2e-27   Homo sapiens [man]
gb|AAB63466.1|  O-linked GlcNAc transferase                             122   3e-27   Homo sapiens [man]
ref|XP_007183689.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    122   3e-27   Balaenoptera acutorostrata scammoni
ref|XP_004380198.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    123   3e-27   Trichechus manatus latirostris
ref|XP_004380199.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    122   3e-27   Trichechus manatus latirostris
ref|XP_007183688.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    122   3e-27   Balaenoptera acutorostrata scammoni
ref|XP_003281937.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-N-acetyl...    122   3e-27   
ref|XP_007538312.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    122   3e-27   Erinaceus europaeus [common hedgehog]
ref|XP_007538313.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    122   3e-27   Erinaceus europaeus [common hedgehog]
ref|NP_858058.1|  UDP-N-acetylglucosamine--peptide N-acetylglucos...    122   3e-27   Homo sapiens [man]
emb|CAD97853.1|  hypothetical protein                                   122   3e-27   Homo sapiens [man]
ref|XP_003386934.2|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    122   3e-27   
ref|XP_002806323.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    122   3e-27   
ref|XP_005401731.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    122   3e-27   Chinchilla lanigera
ref|XP_010083629.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    115   4e-27   Pterocles gutturalis
ref|XP_009437528.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-N-acetyl...    122   4e-27   
dbj|BAG05864.1|  TPR repeat protein                                     121   4e-27   Microcystis aeruginosa NIES-843
ref|WP_041805031.1|  TPR repeat-containing protein yrrB                 120   4e-27   
ref|XP_003774996.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    122   5e-27   
gb|AEB61122.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    117   5e-27   Equus caballus [domestic horse]
ref|XP_001362317.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    122   6e-27   Monodelphis domestica
ref|XP_849392.1|  PREDICTED: UDP-N-acetylglucosamine--peptide N-a...    122   6e-27   Canis lupus familiaris [dogs]
ref|XP_538075.2|  PREDICTED: UDP-N-acetylglucosamine--peptide N-a...    122   6e-27   Canis lupus familiaris [dogs]
gb|AHB47810.1|  hypothetical protein W911_04315                         122   6e-27   Hyphomicrobium nitrativorans NL23
ref|NP_001034837.1|  UDP-N-acetylglucosamine--peptide N-acetylglu...    121   7e-27   Sus scrofa [pigs]
dbj|BAQ64644.1|  TPR domain protein                                     121   7e-27   Geminocystis sp. NIES-3709
emb|CEI97390.1|  Putative Family 41 glycosyltransferase (Fragment)      121   9e-27   Rhizopus microsporus
ref|XP_006981186.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    121   1e-26   Peromyscus maniculatus bairdii
ref|NP_001277464.1|  UDP-N-acetylglucosamine--peptide N-acetylglu...    121   1e-26   Mus musculus [mouse]
ref|XP_004694538.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    121   1e-26   Condylura cristata
ref|XP_006908605.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    121   1e-26   Pteropus alecto
ref|XP_003513433.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    121   1e-26   Cricetulus griseus [Chinese hamsters]
ref|XP_007632585.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    121   1e-26   
ref|XP_007651875.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    121   1e-26   Cricetulus griseus [Chinese hamsters]
ref|XP_006908606.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    121   1e-26   Pteropus alecto
ref|XP_005358618.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    121   1e-26   Microtus ochrogaster [prairie voles]
ref|XP_004694539.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    121   1e-26   Condylura cristata
sp|P56558.1|OGT1_RAT  RecName: Full=UDP-N-acetylglucosamine--pept...    121   1e-26   Rattus norvegicus [brown rat]
ref|XP_009512588.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    114   1e-26   Phalacrocorax carbo [common cormorant]
ref|XP_011369723.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    120   1e-26   
ref|XP_004275794.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    121   1e-26   
ref|XP_004275793.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    121   1e-26   Orcinus orca [Orca]
ref|XP_005358617.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    121   1e-26   Microtus ochrogaster [prairie voles]
gb|EMC78787.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    121   1e-26   
ref|WP_036386961.1|  UDP-N-acetylglucosamine--peptide N-acetylglu...    117   1e-26   Microcystis aeruginosa
ref|NP_058803.2|  UDP-N-acetylglucosamine--peptide N-acetylglucos...    121   1e-26   Rattus norvegicus [brown rat]
ref|XP_007632584.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    121   1e-26   
emb|CCI09797.1|  TPR repeat protein (modular protein)                   121   1e-26   Microcystis aeruginosa PCC 7941
ref|XP_005500510.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    121   1e-26   
ref|NP_631883.2|  UDP-N-acetylglucosamine--peptide N-acetylglucos...    121   1e-26   Mus musculus [mouse]
ref|XP_006981185.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    121   1e-26   Peromyscus maniculatus bairdii
emb|CDS09089.1|  hypothetical protein LRAMOSA10449                      121   1e-26   Lichtheimia ramosa
ref|XP_006257118.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    120   1e-26   Rattus norvegicus [brown rat]
gb|KDO26842.1|  hypothetical protein SPRG_08133                         120   1e-26   Saprolegnia parasitica CBS 223.65
ref|XP_003801787.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    120   1e-26   Otolemur garnettii
ref|XP_003801788.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    120   1e-26   Otolemur garnettii
gb|KFP71928.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    120   2e-26   Acanthisitta chloris
ref|XP_009070331.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    120   2e-26   Acanthisitta chloris
gb|AAK39123.1|AF363030_1  UDP-N-acetylglucosaminyltransferase           120   2e-26   Mus musculus [mouse]
ref|XP_004618684.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    120   2e-26   
emb|CDH58327.1|  tpr domain containing protein                          120   2e-26   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_005237951.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    120   2e-26   
ref|XP_007197176.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    120   2e-26   
ref|NP_001277836.1|  O-linked N-acetylglucosamine (GlcNAc) transf...    120   2e-26   Bubalus bubalis [domestic water buffalo]
dbj|GAL92076.1|  TPR domain protein, putative component of TonB s...    120   2e-26   Microcystis aeruginosa NIES-44
ref|XP_002896255.1|  UDP-N-acetylglucosamine-peptide N-acetylgluc...    120   3e-26   Phytophthora infestans T30-4
ref|XP_004621581.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   3e-26   Sorex araneus [Eurasian shrew]
ref|XP_004621580.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   3e-26   Sorex araneus [Eurasian shrew]
gb|KFO13602.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    119   3e-26   Balearica regulorum gibbericeps
ref|XP_010306232.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   3e-26   Balearica regulorum gibbericeps
ref|XP_010290363.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    114   3e-26   Phaethon lepturus
gb|KFW77095.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    119   3e-26   Manacus vitellinus
gb|KFV96900.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    119   3e-26   Eurypyga helias
gb|KFP14140.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    119   3e-26   Egretta garzetta
ref|XP_010606257.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   3e-26   Fukomys damarensis [Damara mole rat]
ref|XP_010158722.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   3e-26   Eurypyga helias
ref|XP_009634890.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   3e-26   Egretta garzetta
ref|XP_008933124.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   3e-26   
ref|XP_010606256.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   3e-26   
ref|XP_006133064.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   4e-26   
ref|XP_005286120.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   4e-26   
ref|XP_006258128.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   4e-26   
gb|KFV86461.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    119   4e-26   
gb|KFQ81816.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    119   4e-26   
gb|KFQ01024.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    119   4e-26   
gb|KFP64516.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    119   4e-26   
gb|KFP28614.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    119   4e-26   
gb|KFO71953.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    119   4e-26   
gb|KFO61056.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    119   4e-26   
ref|XP_003205676.2|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   4e-26   
ref|XP_010208337.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   4e-26   
ref|XP_009956424.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   4e-26   
ref|XP_009683244.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   4e-26   
ref|XP_009580737.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   4e-26   
ref|XP_009570267.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   4e-26   
ref|XP_008634403.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   4e-26   
ref|XP_009463615.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   4e-26   
ref|XP_005148304.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   4e-26   
ref|XP_005046117.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   4e-26   
ref|XP_001232519.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   4e-26   
gb|EOB03451.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    119   4e-26   
ref|XP_006024518.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   4e-26   
ref|XP_009463614.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   4e-26   
ref|XP_005148303.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   4e-26   
ref|XP_005046116.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   4e-26   
ref|XP_004940687.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   4e-26   
ref|XP_005016694.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   4e-26   
ref|XP_005286119.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   4e-26   
ref|WP_045357967.1|  hypothetical protein                               118   5e-26   
gb|KFV41218.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    119   5e-26   
ref|XP_009972477.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   5e-26   
ref|XP_011962284.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    118   5e-26   
ref|XP_008350791.1|  PREDICTED: LOW QUALITY PROTEIN: probable UDP...    118   5e-26   
dbj|GAN07823.1|  TPR-like protein                                       119   5e-26   
ref|XP_005087712.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   6e-26   
ref|WP_043998627.1|  UDP-N-acetylglucosamine--peptide N-acetylglu...    115   6e-26   
gb|AAO17363.1|  O-linked GlcNAc transferase                             119   6e-26   
gb|KFM13177.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    119   6e-26   
ref|XP_009329928.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   6e-26   
gb|KFQ39792.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    119   6e-26   
ref|XP_010189045.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   6e-26   
ref|XP_009329929.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   6e-26   
ref|XP_005484648.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   6e-26   
gb|KFV64034.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    119   6e-26   
ref|XP_007054028.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    113   6e-26   
ref|XP_009285907.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   6e-26   
ref|XP_009894428.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   6e-26   
ref|XP_005419994.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   7e-26   
ref|XP_009285906.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    119   7e-26   
gb|EIE79524.1|  hypothetical protein RO3G_04229                         115   7e-26   
ref|XP_005262365.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    117   7e-26   
gb|KFP84074.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    118   8e-26   
ref|XP_009862732.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    118   8e-26   
ref|XP_009862731.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    118   8e-26   
ref|WP_035264358.1|  hypothetical protein                               117   8e-26   
ref|XP_009037040.1|  putative O-linked GlcNAc transferase               118   9e-26   
ref|WP_004268994.1|  putative UDP-N-acetylglucosamine--peptide N-...    115   9e-26   
ref|XP_008621361.1|  hypothetical protein SDRG_16915                    117   1e-25   
emb|CCH93372.1|  TPR repeat protein (modular protein)                   117   1e-25   
gb|EPB93067.1|  hypothetical protein HMPREF1544_00141                   118   1e-25   
ref|XP_010223010.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    114   2e-25   
gb|KFR16160.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    117   2e-25   
ref|XP_009939790.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    117   2e-25   
emb|CBJ28382.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosa...    117   2e-25   
ref|XP_009818562.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    114   2e-25   
ref|XP_009858570.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    117   2e-25   
ref|XP_009858569.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    117   2e-25   
ref|XP_006868617.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    117   2e-25   
ref|XP_009880056.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-N-acetyl...    117   2e-25   
ref|XP_007228506.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    116   3e-25   
ref|XP_010121427.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    114   3e-25   
emb|CEL57583.1|  putative UDP-N-acetylglucosamine--peptide N-acet...    115   3e-25   
ref|XP_010777294.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    116   3e-25   
ref|XP_007228505.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    116   3e-25   
ref|XP_007228504.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    116   4e-25   
ref|XP_007228503.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    116   4e-25   
ref|XP_007228502.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    116   4e-25   
gb|AKA09672.1|  cytoplasmic O-GlcNAc transferase                        116   4e-25   
gb|KFM81144.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    116   4e-25   
ref|XP_004885644.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    116   4e-25   
gb|KDE05117.1|  hypothetical protein MVLG_04460                         117   4e-25   
ref|WP_034712162.1|  hypothetical protein                               115   4e-25   
ref|XP_002113059.1|  hypothetical protein TRIADDRAFT_56833              116   5e-25   
ref|XP_011369724.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    115   5e-25   
ref|XP_006981187.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    115   5e-25   
ref|XP_008944200.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-N-acetyl...    114   5e-25   
gb|KFU89185.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    115   7e-25   
ref|XP_009995369.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    115   7e-25   
ref|XP_010144276.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    112   8e-25   
emb|CDQ89308.1|  unnamed protein product                                108   8e-25   
gb|KFP06931.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    115   9e-25   
ref|XP_008499914.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    115   9e-25   
ref|WP_013215180.1|  hypothetical protein                               115   9e-25   
gb|KFV08697.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    115   9e-25   
ref|XP_009975997.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    115   9e-25   
emb|CEG81888.1|  Putative Family 41 glycosyltransferase (Fragment)      115   1e-24   
emb|CEI89482.1|  Putative Family 41 glycosyltransferase (Fragment)      115   1e-24   
emb|CEG74043.1|  Putative Family 41 glycosyltransferase (Fragment)      115   1e-24   
ref|WP_045581915.1|  hypothetical protein                               115   1e-24   
ref|WP_034431025.1|  hypothetical protein                               112   1e-24   
ref|XP_003228236.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    115   1e-24   
emb|CCB65555.1|  TPR repeat-containing protein                          114   1e-24   
ref|XP_002189786.2|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    115   1e-24   
ref|XP_009285908.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    114   1e-24   
ref|XP_003228237.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    115   1e-24   
ref|WP_037562320.1|  hypothetical protein                               114   1e-24   
emb|CEP11953.1|  hypothetical protein                                   115   1e-24   
emb|CDH43923.1|  hypothetical protein BN874_140016                      114   1e-24   
gb|KEP54922.1|  glycosyltransferase family 41 protein                   115   1e-24   
ref|WP_042693043.1|  hypothetical protein                               114   1e-24   
pdb|3PE3|A  Chain A, Structure Of Human O-Glcnac Transferase And ...    114   1e-24   
gb|EUC53886.1|  glycosyltransferase family 41 protein                   115   2e-24   
ref|XP_010734518.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    114   2e-24   
ref|XP_006003820.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    114   2e-24   
ref|XP_006003819.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    114   2e-24   
ref|XP_010713308.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    114   2e-24   
ref|XP_010734516.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    114   2e-24   
ref|XP_010734515.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    114   2e-24   
ref|XP_010734512.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    114   2e-24   
ref|XP_009928819.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    114   2e-24   
ref|XP_010734511.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    114   2e-24   
ref|XP_010734514.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    114   2e-24   
ref|XP_004331309.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    110   2e-24   
ref|XP_010734513.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    114   2e-24   
ref|XP_007548515.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    114   2e-24   
ref|XP_007548514.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    114   2e-24   
ref|XP_007548512.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    114   2e-24   
ref|XP_007548511.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    114   2e-24   
ref|XP_006133065.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    114   2e-24   
ref|XP_009306068.1|  PREDICTED: O-linked N-acetylglucosamine tran...    114   2e-24   
ref|NP_001018117.1|  O-linked N-acetylglucosamine transferase iso...    114   3e-24   
gb|AAI63923.1|  O-linked N-acetylglucosamine (GlcNAc) transferase...    114   3e-24   
ref|NP_001018116.1|  O-linked N-acetylglucosamine transferase iso...    114   3e-24   
ref|NP_001018115.1|  O-linked N-acetylglucosamine transferase iso...    114   3e-24   
ref|NP_001017359.1|  O-linked N-acetylglucosamine transferase iso...    114   3e-24   
ref|XP_006632846.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    114   3e-24   
ref|WP_041813042.1|  hypothetical protein                               112   3e-24   
emb|CCD01322.1|  protein of unknown function; putative TPR domain       112   3e-24   
ref|XP_006632845.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    113   3e-24   
emb|CAF99103.1|  unnamed protein product                                113   4e-24   
ref|WP_035576180.1|  MULTISPECIES: hypothetical protein                 113   4e-24   
ref|WP_040134136.1|  hypothetical protein                               112   4e-24   
emb|CCG40098.1|  conserved hypothetical protein                         112   4e-24   
ref|WP_041041384.1|  hypothetical protein                               112   5e-24   
ref|XP_008418228.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    113   5e-24   
ref|XP_008418227.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    113   5e-24   
ref|XP_008418226.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    113   5e-24   
ref|XP_008418224.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    113   5e-24   
ref|NP_001019747.1|  O-linked N-acetylglucosamine (GlcNAc) transf...    113   5e-24   
ref|XP_007907905.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    113   6e-24   
ref|XP_008191442.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    113   6e-24   
ref|XP_007907907.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    112   6e-24   
ref|XP_008191443.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    112   6e-24   
ref|XP_008325525.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    112   7e-24   
ref|XP_002539762.1|  hypothetical protein RCOM_1987210                  108   7e-24   
ref|XP_008325524.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    112   7e-24   
ref|XP_008325523.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    112   7e-24   
ref|XP_008325522.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    112   7e-24   
ref|XP_008325521.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    112   7e-24   
ref|XP_010895106.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    112   7e-24   
ref|XP_008325520.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    112   7e-24   
ref|XP_008325519.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    112   7e-24   
ref|XP_010895100.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    112   7e-24   
ref|XP_010895092.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    112   7e-24   
ref|XP_010895082.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    112   7e-24   
ref|XP_010895075.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    112   7e-24   
ref|XP_010895068.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    112   7e-24   
gb|KIL98584.1|  TPR domain protein putative component of TonB system    112   7e-24   
ref|XP_008873998.1|  hypothetical protein, variant 1                    112   7e-24   
ref|XP_008873997.1|  hypothetical protein H310_09641                    112   7e-24   
ref|XP_316319.4|  AGAP006254-PA                                         112   9e-24   
ref|WP_040580686.1|  hypothetical protein                               112   9e-24   
gb|ACN58689.1|  UDP-N-acetylglucosamine--peptide N-acetylglucosam...    109   9e-24   
ref|WP_035967064.1|  hypothetical protein                               111   1e-23   
gb|EFX74619.1|  hypothetical protein DAPPUDRAFT_324191                  112   1e-23   
gb|EJN09707.1|  putative O-linked N-acetylglucosamine transferase...    111   1e-23   
ref|XP_011478737.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    111   2e-23   
gb|ETN67206.1|  o-linked N-acetylglucosamine transferase, ogt           111   2e-23   
ref|XP_005707969.1|  polypeptide N-acetylglucosaminyltransferase        111   2e-23   
ref|XP_005795421.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    111   2e-23   
ref|XP_005795420.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    111   2e-23   
ref|WP_041421271.1|  hypothetical protein                               110   2e-23   
ref|XP_009306080.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    111   3e-23   
ref|XP_003445937.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    110   3e-23   
ref|XP_001921543.2|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    110   3e-23   
ref|XP_003445936.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    110   3e-23   
ref|XP_005157261.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    110   3e-23   
gb|ADE12438.1|  TPR repeat-containing protein                           110   3e-23   
ref|XP_003970511.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-N-acetyl...    110   3e-23   
ref|XP_008298078.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    110   3e-23   
ref|XP_008298081.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    110   3e-23   
ref|XP_002049989.1|  GJ20442                                            110   3e-23   
ref|XP_008298075.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    110   3e-23   
ref|XP_006781652.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    110   3e-23   
ref|XP_005921339.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    110   3e-23   
ref|XP_004541046.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    110   3e-23   
ref|XP_006781650.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    110   3e-23   
ref|XP_005921337.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    110   3e-23   
ref|XP_004541044.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    110   3e-23   
ref|XP_007426082.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    109   4e-23   
ref|WP_015598087.1|  hypothetical protein                               110   4e-23   
ref|WP_040042262.1|  hypothetical protein                               110   4e-23   
ref|XP_006003821.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    110   5e-23   
ref|WP_012973335.1|  hypothetical protein                               110   5e-23   
emb|CDW56646.1|  UDP N acetylglucosamine peptide                        110   5e-23   
gb|EMS19301.1|  polypeptide N-acetylglucosaminyltransferase, glyc...    110   6e-23   
gb|EGU13187.1|  TPR Domain containing protein                           110   6e-23   
ref|WP_014247500.1|  hypothetical protein                               108   7e-23   
ref|NP_523620.1|  super sex combs, isoform B                            109   7e-23   
gb|KFB36021.1|  hypothetical protein ZHAS_00003004                      109   9e-23   
gb|EPT04325.1|  hypothetical protein FOMPIDRAFT_135167                  109   9e-23   
ref|WP_039852209.1|  hypothetical protein                               108   1e-22   
ref|XP_002063480.1|  GK21381                                            109   1e-22   
gb|EPY02404.1|  hypothetical protein K678_05973                         108   1e-22   
ref|XP_005091490.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    108   1e-22   
ref|XP_007879425.1|  hypothetical protein PFL1_03715                    109   1e-22   
ref|XP_005091488.1|  PREDICTED: UDP-N-acetylglucosamine--peptide ...    109   1e-22   
ref|WP_045585451.1|  hypothetical protein                               108   1e-22   



>ref|XP_006358786.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC-like [Solanum tuberosum]
Length=986

 Score =   265 bits (678),  Expect = 1e-77, Method: Composition-based stats.
 Identities = 119/131 (91%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTDVLWAGLPM+TLPLEKMATRVAGSLCLATGLG+EMIVS++KE
Sbjct  853  LADLFLDTPLCNAHTTGTDVLWAGLPMITLPLEKMATRVAGSLCLATGLGDEMIVSSMKE  912

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALNR KLQDLTNRLKA RM+CPLFDTTRWV+NLERSYFKMWNLYC GQ PQP
Sbjct  913  YEEKAVSLALNRPKLQDLTNRLKAVRMSCPLFDTTRWVRNLERSYFKMWNLYCSGQHPQP  972

Query  511  FKVTENDAEFP  479
            FKVTEND+EFP
Sbjct  973  FKVTENDSEFP  983



>ref|XP_009762059.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC isoform X2 [Nicotiana sylvestris]
Length=994

 Score =   264 bits (675),  Expect = 4e-77, Method: Composition-based stats.
 Identities = 118/131 (90%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTDVLWAGLPM+TLPLEKMATRVAGSLC+ATGLG+EMIVS++KE
Sbjct  859  LADLFLDTPLCNAHTTGTDVLWAGLPMITLPLEKMATRVAGSLCVATGLGDEMIVSSMKE  918

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALNR KLQDLTNRLKA RM+CPLFDTTRWV+NLERSYFKMWNLYC GQ PQP
Sbjct  919  YEEKAVSLALNRPKLQDLTNRLKAVRMSCPLFDTTRWVRNLERSYFKMWNLYCSGQHPQP  978

Query  511  FKVTENDAEFP  479
            FKVTEND+EFP
Sbjct  979  FKVTENDSEFP  989



>ref|XP_009762058.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC isoform X1 [Nicotiana sylvestris]
Length=995

 Score =   264 bits (675),  Expect = 4e-77, Method: Composition-based stats.
 Identities = 118/131 (90%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTDVLWAGLPM+TLPLEKMATRVAGSLC+ATGLG+EMIVS++KE
Sbjct  860  LADLFLDTPLCNAHTTGTDVLWAGLPMITLPLEKMATRVAGSLCVATGLGDEMIVSSMKE  919

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALNR KLQDLTNRLKA RM+CPLFDTTRWV+NLERSYFKMWNLYC GQ PQP
Sbjct  920  YEEKAVSLALNRPKLQDLTNRLKAVRMSCPLFDTTRWVRNLERSYFKMWNLYCSGQHPQP  979

Query  511  FKVTENDAEFP  479
            FKVTEND+EFP
Sbjct  980  FKVTENDSEFP  990



>ref|XP_004248027.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Solanum lycopersicum]
Length=985

 Score =   263 bits (673),  Expect = 6e-77, Method: Composition-based stats.
 Identities = 119/131 (91%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLG EMIVS++KE
Sbjct  852  LADLFLDTPLCNAHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGAEMIVSSMKE  911

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALNR KLQDLTNRLKA RM+CPLFDTTRWV+NLERSYFKMWNLYC GQ PQP
Sbjct  912  YEEKAVSLALNRPKLQDLTNRLKAVRMSCPLFDTTRWVRNLERSYFKMWNLYCSGQHPQP  971

Query  511  FKVTENDAEFP  479
            F+VTEND+EFP
Sbjct  972  FQVTENDSEFP  982



>ref|XP_009589277.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC isoform X1 [Nicotiana tomentosiformis]
Length=995

 Score =   261 bits (668),  Expect = 4e-76, Method: Composition-based stats.
 Identities = 116/131 (89%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTDVLWAGLPM+TLPLEKMATRVAGSLC+ATGLG+EM+VS++KE
Sbjct  860  LADLFLDTPLCNAHTTGTDVLWAGLPMITLPLEKMATRVAGSLCVATGLGDEMVVSSMKE  919

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALNR KLQDLTNRLKA RM+CPLFDT RWV+NLERSYFKMWNLYC GQ PQP
Sbjct  920  YEEKAVSLALNRPKLQDLTNRLKAVRMSCPLFDTARWVRNLERSYFKMWNLYCSGQHPQP  979

Query  511  FKVTENDAEFP  479
            FKVTEND+EFP
Sbjct  980  FKVTENDSEFP  990



>ref|XP_009589278.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC isoform X2 [Nicotiana tomentosiformis]
Length=994

 Score =   261 bits (668),  Expect = 4e-76, Method: Composition-based stats.
 Identities = 116/131 (89%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTDVLWAGLPM+TLPLEKMATRVAGSLC+ATGLG+EM+VS++KE
Sbjct  859  LADLFLDTPLCNAHTTGTDVLWAGLPMITLPLEKMATRVAGSLCVATGLGDEMVVSSMKE  918

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALNR KLQDLTNRLKA RM+CPLFDT RWV+NLERSYFKMWNLYC GQ PQP
Sbjct  919  YEEKAVSLALNRPKLQDLTNRLKAVRMSCPLFDTARWVRNLERSYFKMWNLYCSGQHPQP  978

Query  511  FKVTENDAEFP  479
            FKVTEND+EFP
Sbjct  979  FKVTENDSEFP  989



>ref|XP_011084145.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Sesamum indicum]
Length=991

 Score =   260 bits (664),  Expect = 1e-75, Method: Composition-based stats.
 Identities = 117/131 (89%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATG+GEEMIV+++KE
Sbjct  858  LADLFLDTPLCNAHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGVGEEMIVNSMKE  917

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALNR KLQDLTNRLKAAR+TCPLFDT RWV+NLER+YFKMWNLYC GQ PQP
Sbjct  918  YEEKAVSLALNRPKLQDLTNRLKAARLTCPLFDTARWVRNLERAYFKMWNLYCSGQHPQP  977

Query  511  FKVTENDAEFP  479
            FKV END EFP
Sbjct  978  FKVAENDLEFP  988



>gb|KCW45609.1| hypothetical protein EUGRSUZ_L00641 [Eucalyptus grandis]
Length=950

 Score =   259 bits (661),  Expect = 3e-75, Method: Composition-based stats.
 Identities = 115/131 (88%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATG+GEEMIV+++KE
Sbjct  817  LADLFLDTPLCNAHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGVGEEMIVNSLKE  876

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALNR KL+DL +RLKAAR+TCPLFDTTRWV+NLER+YFKMWNL+C GQ PQP
Sbjct  877  YEEKAVSLALNRPKLEDLKSRLKAARLTCPLFDTTRWVRNLERAYFKMWNLHCSGQHPQP  936

Query  511  FKVTENDAEFP  479
            FKVTEND+EFP
Sbjct  937  FKVTENDSEFP  947



>ref|XP_010039950.1| PREDICTED: LOW QUALITY PROTEIN: probable UDP-N-acetylglucosamine--peptide 
N-acetylglucosaminyltransferase SEC [Eucalyptus 
grandis]
Length=992

 Score =   258 bits (659),  Expect = 5e-75, Method: Composition-based stats.
 Identities = 115/131 (88%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATG+GEEMIV+++KE
Sbjct  859  LADLFLDTPLCNAHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGVGEEMIVNSLKE  918

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALNR KL+DL +RLKAAR+TCPLFDTTRWV+NLER+YFKMWNL+C GQ PQP
Sbjct  919  YEEKAVSLALNRPKLEDLKSRLKAARLTCPLFDTTRWVRNLERAYFKMWNLHCSGQHPQP  978

Query  511  FKVTENDAEFP  479
            FKVTEND+EFP
Sbjct  979  FKVTENDSEFP  989



>ref|XP_006365461.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC-like [Solanum tuberosum]
Length=979

 Score =   257 bits (657),  Expect = 1e-74, Method: Composition-based stats.
 Identities = 116/131 (89%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADL LDTPLCN HTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATG+GEEM+VS++KE
Sbjct  846  LADLCLDTPLCNAHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGVGEEMVVSSMKE  905

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALNR KLQDLTNRLKA R++CPLFDT RWV+NLERSYFKMWNLYC GQ PQP
Sbjct  906  YEEKAVSLALNRPKLQDLTNRLKAVRLSCPLFDTERWVRNLERSYFKMWNLYCSGQHPQP  965

Query  511  FKVTENDAEFP  479
            FKVTEND EFP
Sbjct  966  FKVTENDMEFP  976



>ref|XP_009622561.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Nicotiana tomentosiformis]
Length=985

 Score =   256 bits (655),  Expect = 2e-74, Method: Composition-based stats.
 Identities = 115/131 (88%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADL LDTPLCN HTTGTDVLWAGLPM+TLPLEKMATRVAGSLCLATG+GEEM+VS++KE
Sbjct  852  LADLCLDTPLCNAHTTGTDVLWAGLPMITLPLEKMATRVAGSLCLATGVGEEMVVSSMKE  911

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALNR KLQDLTNRLKA R++CPLFDT RWV+NLERSYFKMWNLYC GQ PQP
Sbjct  912  YEEKAVSLALNRPKLQDLTNRLKAVRLSCPLFDTGRWVRNLERSYFKMWNLYCSGQHPQP  971

Query  511  FKVTENDAEFP  479
            FKVTEND EFP
Sbjct  972  FKVTENDMEFP  982



>gb|KJB44757.1| hypothetical protein B456_007G2711002, partial [Gossypium raimondii]
Length=354

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADL LDTPLCN HTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIV+++KE
Sbjct  221  LADLCLDTPLCNAHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVNSMKE  280

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE+AVSLALNR KLQ LTN+LKAAR+TCPLFDT RWV+NLERSYFKMWNLYC GQQPQ 
Sbjct  281  YEERAVSLALNRLKLQALTNKLKAARLTCPLFDTARWVRNLERSYFKMWNLYCSGQQPQH  340

Query  511  FKVTENDAEFP  479
            FKVTEND +FP
Sbjct  341  FKVTENDFDFP  351



>ref|XP_008792947.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Phoenix dactylifera]
Length=999

 Score =   255 bits (652),  Expect = 6e-74, Method: Composition-based stats.
 Identities = 115/131 (88%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCNGHTTGTDVLWAGLPM+TLPLEKMATRVAGSLCLATG+GEEMIVS++KE
Sbjct  866  LADLFLDTPLCNGHTTGTDVLWAGLPMITLPLEKMATRVAGSLCLATGVGEEMIVSSLKE  925

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAV+LA N  KLQ LTN+LKAARMTCPLFDT RWV NLER+YFKMWNLYC G+ PQP
Sbjct  926  YEEKAVALAENPGKLQALTNKLKAARMTCPLFDTARWVCNLERAYFKMWNLYCSGRHPQP  985

Query  511  FKVTENDAEFP  479
            FKVTENDAEFP
Sbjct  986  FKVTENDAEFP  996



>ref|XP_009799068.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Nicotiana sylvestris]
Length=985

 Score =   254 bits (650),  Expect = 1e-73, Method: Composition-based stats.
 Identities = 114/131 (87%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADL LDTPLCN HTTGTDVLWAGLPM+TLPLEKMATRVAGSLCLATG+GEEM+VS++KE
Sbjct  852  LADLCLDTPLCNAHTTGTDVLWAGLPMITLPLEKMATRVAGSLCLATGVGEEMVVSSMKE  911

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALNR KLQDLTNRLKA R++CPLFDT RWV+NLERSYFKMWNLYC GQ PQP
Sbjct  912  YEEKAVSLALNRPKLQDLTNRLKAVRLSCPLFDTGRWVRNLERSYFKMWNLYCSGQHPQP  971

Query  511  FKVTENDAEFP  479
            FKVTEN+ EFP
Sbjct  972  FKVTENNMEFP  982



>ref|XP_010926674.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Elaeis guineensis]
Length=1009

 Score =   254 bits (648),  Expect = 2e-73, Method: Composition-based stats.
 Identities = 112/131 (85%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LADLFLDTPLCNGHTTGTD+LWAGLPM+TLPLEKMATRVAGSLCLATG+GEEM+VS++KE
Sbjct  876   LADLFLDTPLCNGHTTGTDILWAGLPMITLPLEKMATRVAGSLCLATGVGEEMVVSSLKE  935

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
             YEEKAV+LA N  KLQ LTN+LKAARMTCPLFDT RWV NLER+YFKMWNLYC G+ PQP
Sbjct  936   YEEKAVALAENPAKLQALTNKLKAARMTCPLFDTARWVHNLERAYFKMWNLYCSGRHPQP  995

Query  511   FKVTENDAEFP  479
             FKVTE+DAEFP
Sbjct  996   FKVTEHDAEFP  1006



>ref|XP_004239846.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC isoform X1 [Solanum lycopersicum]
Length=979

 Score =   253 bits (646),  Expect = 3e-73, Method: Composition-based stats.
 Identities = 114/131 (87%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADL LDTPLCN HTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATG+GEEM+VS++KE
Sbjct  846  LADLCLDTPLCNAHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGVGEEMVVSSMKE  905

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALNR KLQDLT +LKA R++CPLFDT RWV+NLERSYFKMWNLYC GQ PQP
Sbjct  906  YEEKAVSLALNRPKLQDLTKKLKAVRLSCPLFDTGRWVRNLERSYFKMWNLYCSGQHPQP  965

Query  511  FKVTENDAEFP  479
            FKVTEND EFP
Sbjct  966  FKVTENDMEFP  976



>ref|XP_010905160.1| PREDICTED: LOW QUALITY PROTEIN: probable UDP-N-acetylglucosamine--peptide 
N-acetylglucosaminyltransferase SEC [Elaeis guineensis]
Length=1006

 Score =   253 bits (646),  Expect = 3e-73, Method: Composition-based stats.
 Identities = 113/131 (86%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LADLF+DTPLCNGHTTGTDVLWAGLPM+TLPL+KMATRVAGSLCLATG+GEEMIVS++KE
Sbjct  873   LADLFIDTPLCNGHTTGTDVLWAGLPMITLPLDKMATRVAGSLCLATGVGEEMIVSSLKE  932

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
             YEEKAV+LA N TKLQ LTN+LKAARMTCPLFDT RWV NLER+YFKMWNLYC G+ PQP
Sbjct  933   YEEKAVALAENPTKLQALTNKLKAARMTCPLFDTARWVCNLERAYFKMWNLYCSGRHPQP  992

Query  511   FKVTENDAEFP  479
             FKVTEND EFP
Sbjct  993   FKVTENDTEFP  1003



>gb|AGJ98230.1| PIB17 secret agent protein, partial [Petunia x hybrida]
Length=967

 Score =   253 bits (645),  Expect = 5e-73, Method: Composition-based stats.
 Identities = 113/131 (86%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADL LDTPLCN HTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATG+GEEM+VS++KE
Sbjct  832  LADLCLDTPLCNAHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGVGEEMVVSSMKE  891

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YE+KAVSLALNR+KLQDLTNRLKA R++CPLFDT RWV+NLERSYFKMW+LYC GQ PQP
Sbjct  892  YEDKAVSLALNRSKLQDLTNRLKAVRLSCPLFDTGRWVRNLERSYFKMWSLYCSGQHPQP  951

Query  511  FKVTENDAEFP  479
            FKVTEN+ EFP
Sbjct  952  FKVTENNMEFP  962



>ref|XP_010321405.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC isoform X2 [Solanum lycopersicum]
Length=950

 Score =   252 bits (644),  Expect = 5e-73, Method: Composition-based stats.
 Identities = 114/131 (87%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADL LDTPLCN HTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATG+GEEM+VS++KE
Sbjct  817  LADLCLDTPLCNAHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGVGEEMVVSSMKE  876

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALNR KLQDLT +LKA R++CPLFDT RWV+NLERSYFKMWNLYC GQ PQP
Sbjct  877  YEEKAVSLALNRPKLQDLTKKLKAVRLSCPLFDTGRWVRNLERSYFKMWNLYCSGQHPQP  936

Query  511  FKVTENDAEFP  479
            FKVTEND EFP
Sbjct  937  FKVTENDMEFP  947



>gb|KHG06148.1| putative UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC -like protein [Gossypium arboreum]
Length=950

 Score =   252 bits (644),  Expect = 6e-73, Method: Composition-based stats.
 Identities = 115/131 (88%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADL LDTPLCN HTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIV+++KE
Sbjct  817  LADLCLDTPLCNAHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVNSMKE  876

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE+AVSLALNR KLQ LTN+LKAAR+TCPLFDT RWV+NLERSYFKMWNLYC GQQPQ 
Sbjct  877  YEERAVSLALNRPKLQALTNKLKAARLTCPLFDTARWVRNLERSYFKMWNLYCSGQQPQH  936

Query  511  FKVTENDAEFP  479
            FKVTEND +FP
Sbjct  937  FKVTENDFDFP  947



>ref|XP_002522031.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus 
communis]
 gb|EEF40435.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus 
communis]
Length=979

 Score =   252 bits (643),  Expect = 9e-73, Method: Composition-based stats.
 Identities = 113/131 (86%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPMVTLPLEKMATRVAGSLCLATGLG+EMIVS++KE
Sbjct  846  LADLFLDTPLCNAHTTGTDILWAGLPMVTLPLEKMATRVAGSLCLATGLGDEMIVSSMKE  905

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALNR KLQ LTN+LKA RMTCPLFDT RWV+NLER+YFKMWN++C GQQPQ 
Sbjct  906  YEEKAVSLALNRPKLQALTNKLKAVRMTCPLFDTPRWVQNLERAYFKMWNIHCSGQQPQH  965

Query  511  FKVTENDAEFP  479
            FKVTE+D+EFP
Sbjct  966  FKVTEDDSEFP  976



>ref|XP_007030292.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
2 [Theobroma cacao]
 gb|EOY10794.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
2 [Theobroma cacao]
Length=744

 Score =   249 bits (635),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/132 (87%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  874  CLADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVK  695
             LADLFLDTPLCN HTTGTD+LWAGLPMVTLPLEKMATRVAGSLCLATG GEEMIVS++K
Sbjct  610  ALADLFLDTPLCNAHTTGTDILWAGLPMVTLPLEKMATRVAGSLCLATGFGEEMIVSSMK  669

Query  694  EYEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQ  515
            EYEE+AVSLALNR KLQ LTN+LKAAR+TCPLFDT RWV+NLERSYFKMWNLYC GQQPQ
Sbjct  670  EYEERAVSLALNRPKLQALTNKLKAARLTCPLFDTARWVRNLERSYFKMWNLYCSGQQPQ  729

Query  514  PFKVTENDAEFP  479
             FKVTEND +FP
Sbjct  730  HFKVTENDYDFP  741



>ref|XP_007034160.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY05086.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
Length=997

 Score =   251 bits (642),  Expect = 1e-72, Method: Composition-based stats.
 Identities = 114/131 (87%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTDVLWAGLPMVTLPL+KMATRVAGSLCLATG+GEEMIVS +KE
Sbjct  864  LADLFLDTPLCNAHTTGTDVLWAGLPMVTLPLDKMATRVAGSLCLATGVGEEMIVSCLKE  923

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALNR KLQDL+N+LK ARMTCPLFDT RWV+NLER+YFKMWNL C G QPQP
Sbjct  924  YEEKAVSLALNRPKLQDLSNKLKEARMTCPLFDTLRWVRNLERAYFKMWNLCCLGHQPQP  983

Query  511  FKVTENDAEFP  479
            FKVTE+D EFP
Sbjct  984  FKVTESDQEFP  994



>emb|CDP10263.1| unnamed protein product [Coffea canephora]
Length=1016

 Score =   250 bits (639),  Expect = 3e-72, Method: Composition-based stats.
 Identities = 112/131 (85%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LADLFLDTPLCN HTTGTD+LWAGLPMVTLPLEKMATRVAGSL LATG GEEMIVS++KE
Sbjct  883   LADLFLDTPLCNAHTTGTDILWAGLPMVTLPLEKMATRVAGSLALATGFGEEMIVSSMKE  942

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
             YEE+AVSLALNR KLQDLT RLKAARMTCPLFDT RWV+NL+R+YFKMWN+YC GQ PQ 
Sbjct  943   YEERAVSLALNRPKLQDLTERLKAARMTCPLFDTARWVQNLDRAYFKMWNIYCSGQHPQH  1002

Query  511   FKVTENDAEFP  479
             FKV END EFP
Sbjct  1003  FKVAENDLEFP  1013



>ref|XP_010550828.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Tarenaya hassleriana]
Length=975

 Score =   250 bits (638),  Expect = 4e-72, Method: Composition-based stats.
 Identities = 111/131 (85%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLD+PLCNGHTTGTDVLWAGLP+VTLPLEKMATRVAGSLCLATGLG+EMIV+++KE
Sbjct  842  LADLFLDSPLCNGHTTGTDVLWAGLPVVTLPLEKMATRVAGSLCLATGLGDEMIVNSIKE  901

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE+AVSLALNRTKLQ LTN+LK  R+TCPLFDT RWV+NLERSYFKMWNL+C GQQPQ 
Sbjct  902  YEERAVSLALNRTKLQALTNKLKEVRLTCPLFDTERWVRNLERSYFKMWNLHCSGQQPQH  961

Query  511  FKVTENDAEFP  479
            FKV E+D EFP
Sbjct  962  FKVAEDDVEFP  972



>ref|XP_008218375.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Prunus mume]
Length=979

 Score =   250 bits (638),  Expect = 4e-72, Method: Composition-based stats.
 Identities = 112/131 (85%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSN+KE
Sbjct  846  LADLFLDTPLCNAHTTGTDILWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNMKE  905

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALN +KL  L N+LKAAR+TCPLFDT RWV+NLER+YFKMWNL+C GQ+PQ 
Sbjct  906  YEEKAVSLALNPSKLHALANKLKAARLTCPLFDTARWVRNLERAYFKMWNLHCSGQKPQH  965

Query  511  FKVTENDAEFP  479
            FKV END EFP
Sbjct  966  FKVAENDLEFP  976



>ref|XP_007208375.1| hypothetical protein PRUPE_ppa000862mg [Prunus persica]
 gb|EMJ09574.1| hypothetical protein PRUPE_ppa000862mg [Prunus persica]
Length=979

 Score =   249 bits (635),  Expect = 1e-71, Method: Composition-based stats.
 Identities = 112/131 (85%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSN+KE
Sbjct  846  LADLFLDTPLCNAHTTGTDILWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNMKE  905

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALN  KL  L N+LKAAR+TCPLFDT RWV+NLER+YFKMWNL+C GQ+PQ 
Sbjct  906  YEEKAVSLALNPPKLHALANKLKAARLTCPLFDTARWVRNLERAYFKMWNLHCSGQKPQH  965

Query  511  FKVTENDAEFP  479
            FKV END EFP
Sbjct  966  FKVAENDLEFP  976



>ref|XP_008443744.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Cucumis melo]
Length=985

 Score =   249 bits (635),  Expect = 1e-71, Method: Composition-based stats.
 Identities = 111/131 (85%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPM+TLPLEKMATRVAGSLCLATGLG+EMIVS++KE
Sbjct  852  LADLFLDTPLCNAHTTGTDILWAGLPMITLPLEKMATRVAGSLCLATGLGDEMIVSSMKE  911

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAV+LALNR KLQ LTN+LKA RMTCPLFDT RWV+NLERSYFKMWNL+C GQ+PQ 
Sbjct  912  YEEKAVTLALNRPKLQALTNKLKAVRMTCPLFDTARWVRNLERSYFKMWNLHCSGQRPQH  971

Query  511  FKVTENDAEFP  479
            FKVTEN+ E+P
Sbjct  972  FKVTENNLEYP  982



>ref|XP_010102180.1| putative UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Morus notabilis]
 gb|EXB93123.1| putative UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Morus notabilis]
Length=1016

 Score =   248 bits (634),  Expect = 1e-71, Method: Composition-based stats.
 Identities = 112/131 (85%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LADLFLDTPLCN HTTGTD+LWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVS++KE
Sbjct  884   LADLFLDTPLCNAHTTGTDILWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSSMKE  943

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
             YEEKAV LALNR KLQ LTN+LKAAR+ CPLFDT RWV+NLE +YFKMWNL+C GQ+PQ 
Sbjct  944   YEEKAVYLALNRPKLQALTNKLKAARLHCPLFDTERWVRNLESAYFKMWNLHCSGQRPQH  1003

Query  511   FKVTENDAEFP  479
             FKVTEND+EFP
Sbjct  1004  FKVTENDSEFP  1014



>ref|XP_012089398.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Jatropha curcas]
 gb|KDP23757.1| hypothetical protein JCGZ_23590 [Jatropha curcas]
Length=974

 Score =   248 bits (633),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 109/131 (83%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPMVTLPLEKMATRVAGSLC+ATGLG+EMIVS++KE
Sbjct  841  LADLFLDTPLCNAHTTGTDILWAGLPMVTLPLEKMATRVAGSLCVATGLGDEMIVSSMKE  900

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE+AVSLALNR+KLQ LTN+LKA RM+CPLFDT RWV+NLER+YFKMWN++C GQQP+ 
Sbjct  901  YEERAVSLALNRSKLQALTNKLKAVRMSCPLFDTARWVRNLERAYFKMWNIHCLGQQPRH  960

Query  511  FKVTENDAEFP  479
            FKV END+EFP
Sbjct  961  FKVAENDSEFP  971



>ref|XP_009379721.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Pyrus x bretschneideri]
Length=979

 Score =   248 bits (632),  Expect = 2e-71, Method: Composition-based stats.
 Identities = 111/131 (85%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPMVTLPLEKMATRVAGSLCLATGLG+EMIVS++KE
Sbjct  846  LADLFLDTPLCNAHTTGTDILWAGLPMVTLPLEKMATRVAGSLCLATGLGDEMIVSSMKE  905

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALN  KL  LT++LKAAR+TCPLFDT RWV+NLERSYFKMWNL+C GQ+PQ 
Sbjct  906  YEEKAVSLALNPAKLHALTSKLKAARLTCPLFDTARWVRNLERSYFKMWNLHCSGQKPQH  965

Query  511  FKVTENDAEFP  479
            FKVTEN+ EFP
Sbjct  966  FKVTENNLEFP  976



>ref|XP_011660251.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Cucumis sativus]
 gb|KGN66727.1| hypothetical protein Csa_1G665390 [Cucumis sativus]
Length=985

 Score =   248 bits (632),  Expect = 3e-71, Method: Composition-based stats.
 Identities = 111/131 (85%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPM+TLPLEKMATRVAGSLCLATGLG+EMIVS++KE
Sbjct  852  LADLFLDTPLCNAHTTGTDILWAGLPMITLPLEKMATRVAGSLCLATGLGDEMIVSSMKE  911

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAV+LALNR KLQ LTN+LKA RMTCPLFDT RWV+NLERSYFKMWNL+C GQ PQ 
Sbjct  912  YEEKAVTLALNRPKLQALTNKLKAVRMTCPLFDTARWVRNLERSYFKMWNLHCSGQPPQH  971

Query  511  FKVTENDAEFP  479
            FKVTEN+ E+P
Sbjct  972  FKVTENNLEYP  982



>ref|XP_004302117.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Fragaria vesca subsp. vesca]
Length=966

 Score =   248 bits (632),  Expect = 3e-71, Method: Composition-based stats.
 Identities = 112/131 (85%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLG+EMIV+++KE
Sbjct  833  LADLFLDTPLCNAHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGDEMIVNSMKE  892

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALN  KLQ LTN+LKA RMTCPLFDT RWV+NLERSYFKMWNL+C GQ+PQ 
Sbjct  893  YEEKAVSLALNPPKLQALTNKLKAVRMTCPLFDTARWVRNLERSYFKMWNLHCSGQRPQH  952

Query  511  FKVTENDAEFP  479
            FKV END++FP
Sbjct  953  FKVAENDSDFP  963



>ref|XP_011038443.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Populus euphratica]
Length=980

 Score =   247 bits (630),  Expect = 4e-71, Method: Composition-based stats.
 Identities = 109/131 (83%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPMVT+PLEKMATRVAGSLCLATGLG+EMIVS++KE
Sbjct  850  LADLFLDTPLCNAHTTGTDILWAGLPMVTMPLEKMATRVAGSLCLATGLGDEMIVSSMKE  909

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE+AVSLALNR KLQ LTNRLKAARMTCPLFDT RWV+NL+R+YFKMW+++C GQQP  
Sbjct  910  YEERAVSLALNRPKLQSLTNRLKAARMTCPLFDTRRWVRNLDRAYFKMWSIHCSGQQPHH  969

Query  511  FKVTENDAEFP  479
            FKV END +FP
Sbjct  970  FKVVENDFDFP  980



>ref|XP_007143991.1| hypothetical protein PHAVU_007G119800g [Phaseolus vulgaris]
 gb|ESW15985.1| hypothetical protein PHAVU_007G119800g [Phaseolus vulgaris]
Length=989

 Score =   247 bits (630),  Expect = 5e-71, Method: Composition-based stats.
 Identities = 112/131 (85%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVS++KE
Sbjct  856  LADLFLDTPLCNAHTTGTDILWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSSMKE  915

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE+AVSLALNR KLQ LT++LKA RMTCPLFDT RWV+NLERSYF+MWNL+C GQ+PQ 
Sbjct  916  YEERAVSLALNRPKLQALTSKLKAVRMTCPLFDTARWVRNLERSYFRMWNLHCSGQRPQH  975

Query  511  FKVTENDAEFP  479
            FKVTEND E P
Sbjct  976  FKVTENDLECP  986



>ref|XP_010278452.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Nelumbo nucifera]
Length=988

 Score =   247 bits (630),  Expect = 5e-71, Method: Composition-based stats.
 Identities = 110/131 (84%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPM+TLPLEKMATRVAGSLCLATG+GEEMIVS++KE
Sbjct  855  LADLFLDTPLCNAHTTGTDILWAGLPMITLPLEKMATRVAGSLCLATGVGEEMIVSSMKE  914

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAV LA +R KLQ LTN+LK+ R+TCPLFDT RWV+NLER+YFKMWNLYC G  PQP
Sbjct  915  YEEKAVLLAESRPKLQALTNKLKSVRLTCPLFDTERWVRNLERAYFKMWNLYCSGGHPQP  974

Query  511  FKVTENDAEFP  479
            FKVTENDAEFP
Sbjct  975  FKVTENDAEFP  985



>ref|XP_008799566.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC isoform X1 [Phoenix dactylifera]
 ref|XP_008799567.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC isoform X2 [Phoenix dactylifera]
Length=1007

 Score =   247 bits (630),  Expect = 6e-71, Method: Composition-based stats.
 Identities = 112/131 (85%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LADLFLDTPLCNGHTTGTDVLWAGLPM+TLPLEKMATRVAGSLCLATG+GE MIVS++KE
Sbjct  875   LADLFLDTPLCNGHTTGTDVLWAGLPMITLPLEKMATRVAGSLCLATGVGEGMIVSSLKE  934

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
             YEEKAV+LA N  KLQ LTN+LKAARM CPLFDT RWV NLER+YFKMWNLY  G+ PQP
Sbjct  935   YEEKAVALAENPAKLQALTNKLKAARMICPLFDTARWVCNLERAYFKMWNLYSSGRHPQP  994

Query  511   FKVTENDAEFP  479
             FKVTENDAEFP
Sbjct  995   FKVTENDAEFP  1005



>ref|XP_007034161.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
2 [Theobroma cacao]
 gb|EOY05087.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
2 [Theobroma cacao]
Length=706

 Score =   243 bits (621),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTDVLWAGLPMVTLPL+KMATRVAGSLCLATG+GEEMIVS +KE
Sbjct  573  LADLFLDTPLCNAHTTGTDVLWAGLPMVTLPLDKMATRVAGSLCLATGVGEEMIVSCLKE  632

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALNR KLQDL+N+LK ARMTCPLFDT RWV+NLER+YFKMWNL C G QPQP
Sbjct  633  YEEKAVSLALNRPKLQDLSNKLKEARMTCPLFDTLRWVRNLERAYFKMWNLCCLGHQPQP  692

Query  511  FKVTENDAEFP  479
            FKVTE+D EFP
Sbjct  693  FKVTESDQEFP  703



>ref|XP_008799568.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC isoform X3 [Phoenix dactylifera]
Length=936

 Score =   246 bits (628),  Expect = 7e-71, Method: Composition-based stats.
 Identities = 112/131 (85%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCNGHTTGTDVLWAGLPM+TLPLEKMATRVAGSLCLATG+GE MIVS++KE
Sbjct  804  LADLFLDTPLCNGHTTGTDVLWAGLPMITLPLEKMATRVAGSLCLATGVGEGMIVSSLKE  863

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAV+LA N  KLQ LTN+LKAARM CPLFDT RWV NLER+YFKMWNLY  G+ PQP
Sbjct  864  YEEKAVALAENPAKLQALTNKLKAARMICPLFDTARWVCNLERAYFKMWNLYSSGRHPQP  923

Query  511  FKVTENDAEFP  479
            FKVTENDAEFP
Sbjct  924  FKVTENDAEFP  934



>ref|XP_002270163.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC isoform X3 [Vitis vinifera]
 emb|CBI28662.3| unnamed protein product [Vitis vinifera]
Length=986

 Score =   246 bits (629),  Expect = 7e-71, Method: Composition-based stats.
 Identities = 109/131 (83%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVS++KE
Sbjct  853  LADLFLDTPLCNAHTTGTDILWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSSMKE  912

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLA+NR KLQ LTN+LKA RM+CPLFDT RWV+NLER+YFKMWN++C G +PQ 
Sbjct  913  YEEKAVSLAMNRPKLQALTNKLKAVRMSCPLFDTARWVRNLERAYFKMWNVHCSGSRPQH  972

Query  511  FKVTENDAEFP  479
            FKV END +FP
Sbjct  973  FKVAENDVDFP  983



>ref|XP_010648955.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC isoform X2 [Vitis vinifera]
Length=991

 Score =   246 bits (629),  Expect = 7e-71, Method: Composition-based stats.
 Identities = 109/131 (83%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVS++KE
Sbjct  858  LADLFLDTPLCNAHTTGTDILWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSSMKE  917

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLA+NR KLQ LTN+LKA RM+CPLFDT RWV+NLER+YFKMWN++C G +PQ 
Sbjct  918  YEEKAVSLAMNRPKLQALTNKLKAVRMSCPLFDTARWVRNLERAYFKMWNVHCSGSRPQH  977

Query  511  FKVTENDAEFP  479
            FKV END +FP
Sbjct  978  FKVAENDVDFP  988



>ref|XP_010648954.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC isoform X1 [Vitis vinifera]
Length=992

 Score =   246 bits (629),  Expect = 7e-71, Method: Composition-based stats.
 Identities = 109/131 (83%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVS++KE
Sbjct  859  LADLFLDTPLCNAHTTGTDILWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSSMKE  918

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLA+NR KLQ LTN+LKA RM+CPLFDT RWV+NLER+YFKMWN++C G +PQ 
Sbjct  919  YEEKAVSLAMNRPKLQALTNKLKAVRMSCPLFDTARWVRNLERAYFKMWNVHCSGSRPQH  978

Query  511  FKVTENDAEFP  479
            FKV END +FP
Sbjct  979  FKVAENDVDFP  989



>ref|XP_006606442.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC-like isoform X2 [Glycine max]
Length=939

 Score =   246 bits (628),  Expect = 8e-71, Method: Composition-based stats.
 Identities = 111/131 (85%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLD+PLCN HTTGTD+LWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVS+++E
Sbjct  806  LADLFLDSPLCNAHTTGTDILWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSSMEE  865

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YE++AVSLALNR KLQ LTN+LKA RMTCPLFDT RWV+NLERSYFKMWNL+C GQ+PQ 
Sbjct  866  YEDRAVSLALNRPKLQALTNKLKAVRMTCPLFDTARWVRNLERSYFKMWNLHCSGQRPQH  925

Query  511  FKVTENDAEFP  479
            FKVTEND E P
Sbjct  926  FKVTENDLECP  936



>ref|XP_002319130.2| O-linked N-acetyl glucosamine transferase family protein [Populus 
trichocarpa]
 gb|EEE95053.2| O-linked N-acetyl glucosamine transferase family protein [Populus 
trichocarpa]
Length=980

 Score =   246 bits (628),  Expect = 9e-71, Method: Composition-based stats.
 Identities = 109/131 (83%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPMVT+PLEKMATRVAGSLCLATGLG+EMIVS++KE
Sbjct  850  LADLFLDTPLCNAHTTGTDILWAGLPMVTMPLEKMATRVAGSLCLATGLGDEMIVSSMKE  909

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE+AVSLALNR KLQ LTNRLKAARMTCPLFDT RWV+NL+R+YFKMW+++C GQQP  
Sbjct  910  YEERAVSLALNRPKLQSLTNRLKAARMTCPLFDTRRWVRNLDRAYFKMWSIHCSGQQPHH  969

Query  511  FKVTENDAEFP  479
            FKV END +FP
Sbjct  970  FKVAENDFDFP  980



>emb|CAN80393.1| hypothetical protein VITISV_001595 [Vitis vinifera]
Length=566

 Score =   240 bits (612),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = -2

Query  877  KCLADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNV  698
              LADLFLDTPLCN HTTGTD+LWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVS++
Sbjct  431  SALADLFLDTPLCNAHTTGTDILWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSSM  490

Query  697  KEYEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP  518
            KEYEEKAVSLA+NR KLQ LTN+LKA RM+CPLFDT RWV+NLER+YFKMWN++C G +P
Sbjct  491  KEYEEKAVSLAMNRPKLQALTNKLKAVRMSCPLFDTARWVRNLERAYFKMWNVHCSGSRP  550

Query  517  QPFKVTENDAEFP  479
            Q FKV END +FP
Sbjct  551  QHFKVAENDVDFP  563



>gb|KHN04963.1| Putative UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Glycine soja]
Length=988

 Score =   246 bits (628),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 111/131 (85%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLD+PLCN HTTGTD+LWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVS+++E
Sbjct  855  LADLFLDSPLCNAHTTGTDILWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSSMEE  914

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YE++AVSLALNR KLQ LTN+LKA RMTCPLFDT RWV+NLERSYFKMWNL+C GQ+PQ 
Sbjct  915  YEDRAVSLALNRPKLQALTNKLKAVRMTCPLFDTARWVRNLERSYFKMWNLHCSGQRPQH  974

Query  511  FKVTENDAEFP  479
            FKVTEND E P
Sbjct  975  FKVTENDLECP  985



>ref|XP_006606441.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC-like isoform X1 [Glycine max]
Length=988

 Score =   246 bits (628),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 111/131 (85%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLD+PLCN HTTGTD+LWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVS+++E
Sbjct  855  LADLFLDSPLCNAHTTGTDILWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSSMEE  914

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YE++AVSLALNR KLQ LTN+LKA RMTCPLFDT RWV+NLERSYFKMWNL+C GQ+PQ 
Sbjct  915  YEDRAVSLALNRPKLQALTNKLKAVRMTCPLFDTARWVRNLERSYFKMWNLHCSGQRPQH  974

Query  511  FKVTENDAEFP  479
            FKVTEND E P
Sbjct  975  FKVTENDLECP  985



>ref|XP_009337940.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Pyrus x bretschneideri]
Length=979

 Score =   246 bits (627),  Expect = 1e-70, Method: Composition-based stats.
 Identities = 111/131 (85%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPMVTLPLEKMATRVAGSLCLATGLG+EMIVS++KE
Sbjct  846  LADLFLDTPLCNAHTTGTDILWAGLPMVTLPLEKMATRVAGSLCLATGLGDEMIVSSMKE  905

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALN  KL+ L  +LKAAR+TCPLFDT RWV+NLERSYFKMWNL+C GQ+PQ 
Sbjct  906  YEEKAVSLALNPPKLRALATKLKAARLTCPLFDTARWVRNLERSYFKMWNLHCSGQKPQH  965

Query  511  FKVTENDAEFP  479
            FKVTEND EFP
Sbjct  966  FKVTENDLEFP  976



>gb|KDO52513.1| hypothetical protein CISIN_1g0024311mg, partial [Citrus sinensis]
 gb|KDO52514.1| hypothetical protein CISIN_1g0024311mg, partial [Citrus sinensis]
Length=503

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPM+TLPLEKMATRVAGSLCLATGLGEEMIV+++KE
Sbjct  370  LADLFLDTPLCNAHTTGTDILWAGLPMITLPLEKMATRVAGSLCLATGLGEEMIVNSMKE  429

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE+AVSLAL+R KLQ LTN+LK+ R+TCPLFDT RWVKNLERSYFKMW+L+C GQ+PQ 
Sbjct  430  YEERAVSLALDRQKLQALTNKLKSVRLTCPLFDTARWVKNLERSYFKMWSLHCSGQKPQH  489

Query  511  FKVTENDAEFP  479
            FKVTEND +FP
Sbjct  490  FKVTENDLDFP  500



>ref|XP_004495555.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC-like isoform X2 [Cicer arietinum]
Length=986

 Score =   245 bits (626),  Expect = 2e-70, Method: Composition-based stats.
 Identities = 110/131 (84%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPMVTLPLEKMATRVAGSLCL+TGLGEEMIVS++KE
Sbjct  853  LADLFLDTPLCNAHTTGTDILWAGLPMVTLPLEKMATRVAGSLCLSTGLGEEMIVSSMKE  912

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YE++AVSLALNR KLQ LT++LKA RMTCPLFDTTRWV+NL+R+YFKMWNL+C GQ+PQ 
Sbjct  913  YEDRAVSLALNRPKLQALTDKLKAVRMTCPLFDTTRWVRNLDRAYFKMWNLHCSGQRPQH  972

Query  511  FKVTENDAEFP  479
            FKVTEND E P
Sbjct  973  FKVTENDLECP  983



>ref|XP_004495554.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC-like isoform X1 [Cicer arietinum]
Length=1023

 Score =   245 bits (626),  Expect = 2e-70, Method: Composition-based stats.
 Identities = 110/131 (84%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LADLFLDTPLCN HTTGTD+LWAGLPMVTLPLEKMATRVAGSLCL+TGLGEEMIVS++KE
Sbjct  890   LADLFLDTPLCNAHTTGTDILWAGLPMVTLPLEKMATRVAGSLCLSTGLGEEMIVSSMKE  949

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
             YE++AVSLALNR KLQ LT++LKA RMTCPLFDTTRWV+NL+R+YFKMWNL+C GQ+PQ 
Sbjct  950   YEDRAVSLALNRPKLQALTDKLKAVRMTCPLFDTTRWVRNLDRAYFKMWNLHCSGQRPQH  1009

Query  511   FKVTENDAEFP  479
             FKVTEND E P
Sbjct  1010  FKVTENDLECP  1020



>ref|XP_010913107.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Elaeis guineensis]
Length=1005

 Score =   245 bits (625),  Expect = 2e-70, Method: Composition-based stats.
 Identities = 108/131 (82%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LADLFLDTPLCN HTTGTD+LWAGLPM+TLPLEKMATRVAGSLCLATG+GEEMIVS++K+
Sbjct  872   LADLFLDTPLCNAHTTGTDILWAGLPMITLPLEKMATRVAGSLCLATGVGEEMIVSSMKD  931

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
             YE+KAV+LA N +KL+ LTN+LK ARMTCPLFDT RWV+NLER+YFKMWNL+C GQ PQP
Sbjct  932   YEDKAVALAQNPSKLEALTNKLKKARMTCPLFDTRRWVRNLERAYFKMWNLHCSGQHPQP  991

Query  511   FKVTENDAEFP  479
             FKVTEND EFP
Sbjct  992   FKVTENDNEFP  1002



>ref|XP_010247969.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Nelumbo nucifera]
Length=991

 Score =   244 bits (623),  Expect = 4e-70, Method: Composition-based stats.
 Identities = 109/131 (83%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTDVLWAGLP++TLPLEKMATRVAGSLCLATG+GEEMIVS++KE
Sbjct  858  LADLFLDTPLCNAHTTGTDVLWAGLPIITLPLEKMATRVAGSLCLATGVGEEMIVSSMKE  917

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YE+KAV  A NR KLQ LTN+LKA R+TCPLFDT RWV+NLER+YFKMWNLYC G  PQP
Sbjct  918  YEDKAVFFAENRPKLQALTNKLKAVRLTCPLFDTARWVRNLERAYFKMWNLYCSGGHPQP  977

Query  511  FKVTENDAEFP  479
            FKV ENDAEFP
Sbjct  978  FKVIENDAEFP  988



>gb|ACN33532.1| unknown [Zea mays]
Length=144

 Score =   225 bits (574),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPM+TLPLEKMATRVAGSLC+ATGLGEEMIVS++K+
Sbjct  11   LADLFLDTPLCNAHTTGTDILWAGLPMITLPLEKMATRVAGSLCVATGLGEEMIVSSMKK  70

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YE++AV LALN  KLQ LTN+LK  RMTCPLFDT RWV+NLER+Y+KMWNLYC  + P+P
Sbjct  71   YEDRAVELALNPVKLQALTNKLKEVRMTCPLFDTARWVRNLERAYYKMWNLYCSSRHPEP  130

Query  511  FKVTENDAEFP  479
            FKV E+D E P
Sbjct  131  FKVVEDDNESP  141



>ref|XP_006443296.1| hypothetical protein CICLE_v10018711mg [Citrus clementina]
 ref|XP_006479007.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC-like [Citrus sinensis]
 gb|ESR56536.1| hypothetical protein CICLE_v10018711mg [Citrus clementina]
Length=973

 Score =   244 bits (622),  Expect = 6e-70, Method: Composition-based stats.
 Identities = 109/131 (83%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPM+TLPLEKMATRVAGSLCLATGLGEEMIV+++KE
Sbjct  840  LADLFLDTPLCNAHTTGTDILWAGLPMITLPLEKMATRVAGSLCLATGLGEEMIVNSMKE  899

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE+AVSLAL+R KLQ LTN+LK+ R+TCPLFDT RWVKNLERSYFKMW+L C GQ+PQ 
Sbjct  900  YEERAVSLALDRQKLQALTNKLKSVRLTCPLFDTARWVKNLERSYFKMWSLLCSGQKPQH  959

Query  511  FKVTENDAEFP  479
            FKVTEND +FP
Sbjct  960  FKVTENDLDFP  970



>gb|KHG03581.1| putative UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC -like protein [Gossypium arboreum]
Length=966

 Score =   244 bits (622),  Expect = 6e-70, Method: Composition-based stats.
 Identities = 110/131 (84%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADL LDTPLCN HTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIV+++KE
Sbjct  833  LADLCLDTPLCNAHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVNSMKE  892

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE+AV+LALNR KLQ LT +LK AR+TCPLFDT RWV+NLER+Y KMWNLYC GQQPQ 
Sbjct  893  YEEQAVTLALNRPKLQALTKKLKEARLTCPLFDTARWVRNLERAYLKMWNLYCSGQQPQH  952

Query  511  FKVTENDAEFP  479
            FKVTEND +FP
Sbjct  953  FKVTENDFDFP  963



>ref|XP_010674215.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Beta vulgaris subsp. vulgaris]
Length=980

 Score =   244 bits (622),  Expect = 6e-70, Method: Composition-based stats.
 Identities = 106/132 (80%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCNGHTTGTD+LWAGLPM+TLPLEKMATRVAGSLCLATGLG+EMIV++++E
Sbjct  847  LADLFLDTPLCNGHTTGTDILWAGLPMITLPLEKMATRVAGSLCLATGLGDEMIVNSMEE  906

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE+AVSLALN +KLQ L ++LK+ R+TCPLFDTTRWVKNL+R+YFKMWNLYC GQ PQ 
Sbjct  907  YEERAVSLALNPSKLQSLRDQLKSVRLTCPLFDTTRWVKNLDRAYFKMWNLYCTGQHPQA  966

Query  511  FKVTENDAEFPA  476
            FKVTEND + P+
Sbjct  967  FKVTENDVDLPS  978



>ref|XP_008388750.1| PREDICTED: LOW QUALITY PROTEIN: probable UDP-N-acetylglucosamine--peptide 
N-acetylglucosaminyltransferase SEC [Malus domestica]
Length=982

 Score =   244 bits (622),  Expect = 7e-70, Method: Composition-based stats.
 Identities = 110/131 (84%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPMVTLPLEKMATRVAGSLCLATGLG+EMIVS++KE
Sbjct  849  LADLFLDTPLCNAHTTGTDILWAGLPMVTLPLEKMATRVAGSLCLATGLGDEMIVSSMKE  908

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALN  KL  LT++LKAAR+TCPLFDT RWV+NLERSYFKMWNL+C GQ+P  
Sbjct  909  YEEKAVSLALNPPKLXALTSKLKAARLTCPLFDTXRWVRNLERSYFKMWNLHCSGQKPXH  968

Query  511  FKVTENDAEFP  479
            FKVTEN+ EFP
Sbjct  969  FKVTENNLEFP  979



>gb|KJB71957.1| hypothetical protein B456_011G150500 [Gossypium raimondii]
 gb|KJB71958.1| hypothetical protein B456_011G150500 [Gossypium raimondii]
Length=922

 Score =   243 bits (620),  Expect = 8e-70, Method: Composition-based stats.
 Identities = 110/130 (85%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATG+GEEMIVS++KE
Sbjct  792  LADLFLDTPLCNAHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGVGEEMIVSSLKE  851

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALNR KLQ+L+++LKAARMTCPLFDT RWV+NLER+YFKMW++Y  GQQPQ 
Sbjct  852  YEEKAVSLALNRPKLQELSDKLKAARMTCPLFDTARWVRNLERAYFKMWSVYRSGQQPQH  911

Query  511  FKVTENDAEF  482
             +VTEND EF
Sbjct  912  IRVTENDEEF  921



>gb|KJB71955.1| hypothetical protein B456_011G150500 [Gossypium raimondii]
Length=1001

 Score =   243 bits (621),  Expect = 8e-70, Method: Composition-based stats.
 Identities = 110/130 (85%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATG+GEEMIVS++KE
Sbjct  871  LADLFLDTPLCNAHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGVGEEMIVSSLKE  930

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALNR KLQ+L+++LKAARMTCPLFDT RWV+NLER+YFKMW++Y  GQQPQ 
Sbjct  931  YEEKAVSLALNRPKLQELSDKLKAARMTCPLFDTARWVRNLERAYFKMWSVYRSGQQPQH  990

Query  511  FKVTENDAEF  482
             +VTEND EF
Sbjct  991  IRVTENDEEF  1000



>gb|KJB71956.1| hypothetical protein B456_011G150500 [Gossypium raimondii]
Length=995

 Score =   243 bits (621),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 110/130 (85%), Positives = 122/130 (94%), Gaps = 0/130 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATG+GEEMIVS++KE
Sbjct  865  LADLFLDTPLCNAHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGVGEEMIVSSLKE  924

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALNR KLQ+L+++LKAARMTCPLFDT RWV+NLER+YFKMW++Y  GQQPQ 
Sbjct  925  YEEKAVSLALNRPKLQELSDKLKAARMTCPLFDTARWVRNLERAYFKMWSVYRSGQQPQH  984

Query  511  FKVTENDAEF  482
             +VTEND EF
Sbjct  985  IRVTENDEEF  994



>ref|XP_010463898.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Camelina sativa]
Length=978

 Score =   243 bits (620),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 109/131 (83%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD+ LDTPLCNGHTTGTDVLWAG+PM+TLPLEKMATRVAGSLCLATGLG EMIV+N++E
Sbjct  845  LADVILDTPLCNGHTTGTDVLWAGVPMITLPLEKMATRVAGSLCLATGLGHEMIVNNLEE  904

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALN+ KL+ LT  LKA+R+TCPLFDT RWVKNLERSYFKMWNL+C GQQPQ 
Sbjct  905  YEEKAVSLALNKPKLEALTKELKASRLTCPLFDTMRWVKNLERSYFKMWNLHCSGQQPQH  964

Query  511  FKVTENDAEFP  479
            FKV END EFP
Sbjct  965  FKVLENDLEFP  975



>ref|XP_009392638.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Musa acuminata subsp. malaccensis]
Length=1002

 Score =   243 bits (620),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 110/131 (84%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTDVLWAG+P++TLPLEKMATRVAGSLCLATG+GEEMIVS++KE
Sbjct  869  LADLFLDTPLCNAHTTGTDVLWAGVPIITLPLEKMATRVAGSLCLATGVGEEMIVSSMKE  928

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAV+LA N  KLQ LTNRLK ARMTCPLFDT RWV+NLER+YFKMWNLYC GQ PQ 
Sbjct  929  YEEKAVALAQNPLKLQALTNRLKEARMTCPLFDTIRWVRNLERAYFKMWNLYCTGQHPQH  988

Query  511  FKVTENDAEFP  479
            FKVTEN  EFP
Sbjct  989  FKVTENSDEFP  999



>ref|XP_003536152.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC-like [Glycine max]
 gb|KHN14794.1| Putative UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Glycine soja]
Length=988

 Score =   243 bits (620),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 109/131 (83%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLD+PLCN HTTGTD+LWAGLPMVTLPLEKMATRVAGSLCLATGLG+EMIVS++KE
Sbjct  855  LADLFLDSPLCNAHTTGTDILWAGLPMVTLPLEKMATRVAGSLCLATGLGDEMIVSSMKE  914

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YE++AVSLALNR KL+ LTN+LKA R+TCPLFDT RWV+NLERSYFKMWNL+C GQ+PQ 
Sbjct  915  YEDRAVSLALNRPKLKALTNKLKAVRLTCPLFDTARWVRNLERSYFKMWNLHCSGQRPQH  974

Query  511  FKVTENDAEFP  479
            FKVTEND E P
Sbjct  975  FKVTENDLECP  985



>gb|EYU24294.1| hypothetical protein MIMGU_mgv1a000982mg [Erythranthe guttata]
Length=923

 Score =   243 bits (619),  Expect = 1e-69, Method: Composition-based stats.
 Identities = 110/131 (84%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LA+LFLDTPLCN HTTGTD+LWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIV ++KE
Sbjct  790  LANLFLDTPLCNAHTTGTDILWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVHSMKE  849

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAV LALN +KL+DLTNRLKA R+TCPLFDT RWV+NLERSYFKMWN+ C GQ PQ 
Sbjct  850  YEEKAVYLALNPSKLRDLTNRLKAVRLTCPLFDTARWVRNLERSYFKMWNMQCAGQNPQH  909

Query  511  FKVTENDAEFP  479
            FKV END EFP
Sbjct  910  FKVAENDMEFP  920



>gb|EYU28505.1| hypothetical protein MIMGU_mgv1a000777mg [Erythranthe guttata]
Length=988

 Score =   243 bits (619),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 110/131 (84%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LA+LFLDTPLCN HTTGTD+LWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIV ++KE
Sbjct  855  LANLFLDTPLCNAHTTGTDILWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVHSMKE  914

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAV LALN +KL+DLTNRLKA R+TCPLFDT RWV+NLERSYFKMWN+ C GQ PQ 
Sbjct  915  YEEKAVYLALNPSKLRDLTNRLKAVRLTCPLFDTARWVRNLERSYFKMWNMQCAGQNPQH  974

Query  511  FKVTENDAEFP  479
            FKV END EFP
Sbjct  975  FKVAENDMEFP  985



>ref|XP_011002011.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Populus euphratica]
Length=979

 Score =   242 bits (618),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 108/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPMVT+PLEKMATRVAGSLCLATGLG+EMIVS++KE
Sbjct  846  LADLFLDTPLCNAHTTGTDILWAGLPMVTMPLEKMATRVAGSLCLATGLGDEMIVSSMKE  905

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE+AVSLALN+ KLQ LTNRLKA RMTCPLFDT RWV+NLER+YFKMWN++C GQQP  
Sbjct  906  YEERAVSLALNKPKLQSLTNRLKAVRMTCPLFDTKRWVRNLERAYFKMWNIHCSGQQPYH  965

Query  511  FKVTENDAEFP  479
            FKV END + P
Sbjct  966  FKVAENDFDCP  976



>ref|XP_008777513.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC isoform X2 [Phoenix dactylifera]
Length=975

 Score =   242 bits (618),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 107/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPM+TLPLEKMATRVAGSLCLATG+GEEMIVS++KE
Sbjct  842  LADLFLDTPLCNAHTTGTDILWAGLPMITLPLEKMATRVAGSLCLATGVGEEMIVSSMKE  901

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YE+KAV+LA N  KL+ LTN+LK ARMTCPLFDT RWV+NLER+YFKMWNL+C GQ P P
Sbjct  902  YEDKAVALAQNPLKLEALTNKLKEARMTCPLFDTRRWVRNLERAYFKMWNLHCSGQHPHP  961

Query  511  FKVTENDAEFP  479
            FKVTEND +FP
Sbjct  962  FKVTENDNDFP  972



>ref|XP_009399047.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Musa acuminata subsp. malaccensis]
Length=998

 Score =   242 bits (618),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 109/131 (83%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCNGHTTGTDVLWAGLP++TLPLEKMATRVAGSLCLATGLG+EMIV+++KE
Sbjct  865  LADLFLDTPLCNGHTTGTDVLWAGLPIITLPLEKMATRVAGSLCLATGLGDEMIVNSLKE  924

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE+AV+LA N +KLQ LTNRLKA RMTCPLFDT RWV NLER+YFKMW LYC G  PQP
Sbjct  925  YEERAVTLAENPSKLQALTNRLKAVRMTCPLFDTKRWVLNLERAYFKMWYLYCSGNHPQP  984

Query  511  FKVTENDAEFP  479
            FKV END EFP
Sbjct  985  FKVMENDNEFP  995



>ref|XP_008777511.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC isoform X1 [Phoenix dactylifera]
 ref|XP_008777512.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC isoform X1 [Phoenix dactylifera]
Length=1005

 Score =   242 bits (618),  Expect = 2e-69, Method: Composition-based stats.
 Identities = 107/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LADLFLDTPLCN HTTGTD+LWAGLPM+TLPLEKMATRVAGSLCLATG+GEEMIVS++KE
Sbjct  872   LADLFLDTPLCNAHTTGTDILWAGLPMITLPLEKMATRVAGSLCLATGVGEEMIVSSMKE  931

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
             YE+KAV+LA N  KL+ LTN+LK ARMTCPLFDT RWV+NLER+YFKMWNL+C GQ P P
Sbjct  932   YEDKAVALAQNPLKLEALTNKLKEARMTCPLFDTRRWVRNLERAYFKMWNLHCSGQHPHP  991

Query  511   FKVTENDAEFP  479
             FKVTEND +FP
Sbjct  992   FKVTENDNDFP  1002



>gb|KJB82315.1| hypothetical protein B456_013G189100 [Gossypium raimondii]
Length=990

 Score =   242 bits (618),  Expect = 3e-69, Method: Composition-based stats.
 Identities = 109/131 (83%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADL LDTPLCN HTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGE+MIV+++KE
Sbjct  857  LADLCLDTPLCNAHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEDMIVNSMKE  916

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE+AV+LALNR KLQ LT +LK AR+TCPLFDT RWV+NLER+Y KMWNLYC GQQPQ 
Sbjct  917  YEEQAVTLALNRPKLQALTKKLKEARLTCPLFDTARWVRNLERAYLKMWNLYCSGQQPQH  976

Query  511  FKVTENDAEFP  479
            FKVTEND +FP
Sbjct  977  FKVTENDFDFP  987



>ref|XP_003572530.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Brachypodium distachyon]
Length=1001

 Score =   242 bits (617),  Expect = 3e-69, Method: Composition-based stats.
 Identities = 104/131 (79%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPM+TLPLEKMATRVAGSLCLATGLGEEMIVS+++E
Sbjct  868  LADLFLDTPLCNAHTTGTDILWAGLPMITLPLEKMATRVAGSLCLATGLGEEMIVSSMQE  927

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YE++AV+LA N   LQ LTN+LK+ RMTCPLFDT RWV+NLER+Y+KMWNLYCCG+ P+P
Sbjct  928  YEDRAVALAQNPADLQALTNKLKSVRMTCPLFDTARWVRNLERAYYKMWNLYCCGRDPEP  987

Query  511  FKVTENDAEFP  479
            FKV E+D EFP
Sbjct  988  FKVKEDDGEFP  998



>ref|XP_010485795.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Camelina sativa]
Length=978

 Score =   241 bits (616),  Expect = 4e-69, Method: Composition-based stats.
 Identities = 108/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD+ LDTPLCNGHTTGTDVLWAG+PM+TLPLEKMATRVAGSLCLATGLG EMIV+N+++
Sbjct  845  LADVILDTPLCNGHTTGTDVLWAGVPMITLPLEKMATRVAGSLCLATGLGHEMIVNNLED  904

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALN+ KL+ LT  LKA+R+TCPLFDT RWVKNLERSYFKMWNL+C GQQPQ 
Sbjct  905  YEEKAVSLALNKPKLEALTKELKASRLTCPLFDTRRWVKNLERSYFKMWNLHCSGQQPQH  964

Query  511  FKVTENDAEFP  479
            FKV END EFP
Sbjct  965  FKVLENDLEFP  975



>ref|XP_002884434.1| hypothetical protein ARALYDRAFT_896453 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60693.1| hypothetical protein ARALYDRAFT_896453 [Arabidopsis lyrata subsp. 
lyrata]
Length=977

 Score =   241 bits (616),  Expect = 4e-69, Method: Composition-based stats.
 Identities = 108/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD+ LDTPLCNGHTTGTDVLWAG+PM+TLPLEKMATRVAGSLCLATGLG EMIV++++E
Sbjct  844  LADVILDTPLCNGHTTGTDVLWAGVPMITLPLEKMATRVAGSLCLATGLGHEMIVNSLEE  903

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALN+ KLQ LT  L+A+R+TCPLFDT RWVKNLERSYFKMWNL+C GQQPQ 
Sbjct  904  YEEKAVSLALNKPKLQALTKELRASRLTCPLFDTMRWVKNLERSYFKMWNLHCSGQQPQH  963

Query  511  FKVTENDAEFP  479
            FKV END EFP
Sbjct  964  FKVLENDLEFP  974



>ref|XP_007030291.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY10793.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 
1 [Theobroma cacao]
Length=996

 Score =   241 bits (615),  Expect = 6e-69, Method: Composition-based stats.
 Identities = 108/122 (89%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPMVTLPLEKMATRVAGSLCLATG GEEMIVS++KE
Sbjct  859  LADLFLDTPLCNAHTTGTDILWAGLPMVTLPLEKMATRVAGSLCLATGFGEEMIVSSMKE  918

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE+AVSLALNR KLQ LTN+LKAAR+TCPLFDT RWV+NLERSYFKMWNLYC GQQPQ 
Sbjct  919  YEERAVSLALNRPKLQALTNKLKAARLTCPLFDTARWVRNLERSYFKMWNLYCSGQQPQH  978

Query  511  FK  506
            FK
Sbjct  979  FK  980



>ref|XP_010413233.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Camelina sativa]
Length=977

 Score =   241 bits (615),  Expect = 6e-69, Method: Composition-based stats.
 Identities = 108/131 (82%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD+ LDTPLCNGHTTGTDVLWAG+PM+TLPLEKMATRVAGSLCLATGLG EMIV+N++E
Sbjct  844  LADVILDTPLCNGHTTGTDVLWAGVPMITLPLEKMATRVAGSLCLATGLGHEMIVNNLEE  903

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAV+LALN+ KL+ LT  LKA R+TCPLFDT RWVKNLERSYFKMWNL+C GQQPQ 
Sbjct  904  YEEKAVALALNKPKLEALTKELKATRLTCPLFDTMRWVKNLERSYFKMWNLHCSGQQPQH  963

Query  511  FKVTENDAEFP  479
            FKV END EFP
Sbjct  964  FKVLENDLEFP  974



>ref|XP_006848455.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Amborella trichopoda]
 gb|ERN10036.1| hypothetical protein AMTR_s00013p00247130 [Amborella trichopoda]
Length=985

 Score =   241 bits (614),  Expect = 8e-69, Method: Composition-based stats.
 Identities = 109/131 (83%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTDVLWAGLPM+T PLEKMATRVAGSLCLATG+GEEMIV ++KE
Sbjct  852  LADLFLDTPLCNAHTTGTDVLWAGLPMITRPLEKMATRVAGSLCLATGVGEEMIVGSLKE  911

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAV  A NR +LQ LTN+LKAARMTCPLFDT RWV NLER+YFKMWNLYC G QPQ 
Sbjct  912  YEEKAVFFAENRPRLQALTNKLKAARMTCPLFDTARWVTNLERAYFKMWNLYCSGSQPQH  971

Query  511  FKVTENDAEFP  479
            FKV EN+AEFP
Sbjct  972  FKVMENNAEFP  982



>gb|KFK37851.1| hypothetical protein AALP_AA3G037400 [Arabis alpina]
Length=979

 Score =   240 bits (612),  Expect = 1e-68, Method: Composition-based stats.
 Identities = 107/131 (82%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD+ LDTPLCNGHTTGTDVLWAG+P++TLPLEKMATRVAGSLCLATGLG EMIV+++++
Sbjct  846  LADVILDTPLCNGHTTGTDVLWAGVPIITLPLEKMATRVAGSLCLATGLGHEMIVNSLED  905

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALN+ KLQ LT  L+A+R+TCPLFDT RWVKNLERSYFKMWNL+C GQQPQ 
Sbjct  906  YEEKAVSLALNKPKLQALTKELRASRLTCPLFDTMRWVKNLERSYFKMWNLHCSGQQPQH  965

Query  511  FKVTENDAEFP  479
            FKVTEND EFP
Sbjct  966  FKVTENDLEFP  976



>dbj|BAJ92905.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=368

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPM+TLPLEKMATRVAGSLCLATGLG+EMIVS+ KE
Sbjct  235  LADLFLDTPLCNAHTTGTDILWAGLPMITLPLEKMATRVAGSLCLATGLGDEMIVSSTKE  294

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YE++AV LA N  KLQ LTN+LK  R+TCPLFDT RWV+NL+R+YFKMWN+YC G+ P+P
Sbjct  295  YEDRAVELATNPAKLQALTNKLKEVRLTCPLFDTARWVRNLDRAYFKMWNIYCSGRHPEP  354

Query  511  FKVTENDAEFP  479
            FKV E+D+EFP
Sbjct  355  FKVKEDDSEFP  365



>ref|XP_006296908.1| hypothetical protein CARUB_v10012900mg [Capsella rubella]
 gb|EOA29806.1| hypothetical protein CARUB_v10012900mg [Capsella rubella]
Length=967

 Score =   240 bits (612),  Expect = 2e-68, Method: Composition-based stats.
 Identities = 106/131 (81%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD+ LDTPLCNGHTTGTDVLWAG+PM+TLPLEKMATRVAGSLCLATGLG EMIV++++E
Sbjct  834  LADVILDTPLCNGHTTGTDVLWAGVPMITLPLEKMATRVAGSLCLATGLGHEMIVNSLEE  893

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEK+VSLALN+ KL+ LT  L+A+R+TCPLFDTTRWVKNLERSYFKMWN++C GQQPQ 
Sbjct  894  YEEKSVSLALNKPKLEALTKELRASRLTCPLFDTTRWVKNLERSYFKMWNIHCSGQQPQH  953

Query  511  FKVTENDAEFP  479
            FKV END EFP
Sbjct  954  FKVLENDLEFP  964



>emb|CDY21133.1| BnaA01g33640D [Brassica napus]
Length=975

 Score =   240 bits (612),  Expect = 2e-68, Method: Composition-based stats.
 Identities = 107/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD+ LDTPLCNGHTTGTDVLWAG+PM+TLPLEKMATRVAGSLCLATGLG EMIV++++E
Sbjct  842  LADVILDTPLCNGHTTGTDVLWAGVPMITLPLEKMATRVAGSLCLATGLGHEMIVNSLEE  901

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALN+ KLQ LT  L+A+R+TCPLFDT RWVKNLERSYFKMWNL+C GQ+PQ 
Sbjct  902  YEEKAVSLALNKPKLQALTKELRASRLTCPLFDTMRWVKNLERSYFKMWNLHCSGQKPQH  961

Query  511  FKVTENDAEFP  479
            FKV END EFP
Sbjct  962  FKVVENDLEFP  972



>ref|XP_003590905.1| O-linked GlcNAc transferase like protein [Medicago truncatula]
 gb|AES61156.1| peptide-N-acetylglucosaminyltransferase [Medicago truncatula]
Length=986

 Score =   239 bits (611),  Expect = 2e-68, Method: Composition-based stats.
 Identities = 106/131 (81%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPMVTLPLEKMATRVAGSLC++TGLGEEMIVS++KE
Sbjct  853  LADLFLDTPLCNAHTTGTDILWAGLPMVTLPLEKMATRVAGSLCISTGLGEEMIVSSMKE  912

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YE++AVSLALNR KLQ LT++LK+ R+TCPLFDT RWV+NL+R+YFKMWNL+C GQ+PQ 
Sbjct  913  YEDRAVSLALNRPKLQALTDKLKSVRLTCPLFDTNRWVRNLDRAYFKMWNLHCTGQRPQH  972

Query  511  FKVTENDAEFP  479
            FKVTEND E P
Sbjct  973  FKVTENDNECP  983



>emb|CDY29989.1| BnaC01g40190D [Brassica napus]
Length=976

 Score =   239 bits (609),  Expect = 3e-68, Method: Composition-based stats.
 Identities = 106/131 (81%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD+ LDTPLCNGHTTGTDVLWAG+PM+TLPLEKMATRVAGSLCLATGLG EMIV++++E
Sbjct  843  LADVILDTPLCNGHTTGTDVLWAGVPMITLPLEKMATRVAGSLCLATGLGHEMIVNSLEE  902

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLA+N+ KLQ LT  L+A+R+TCPLFDT RWVKNLERSYFKMWNL+C GQ+PQ 
Sbjct  903  YEEKAVSLAMNKPKLQALTKELRASRLTCPLFDTMRWVKNLERSYFKMWNLHCSGQKPQH  962

Query  511  FKVTENDAEFP  479
            FKV END EFP
Sbjct  963  FKVVENDLEFP  973



>ref|NP_187074.1| putative UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Arabidopsis thaliana]
 sp|Q9M8Y0.1|SEC_ARATH RecName: Full=Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC; AltName: Full=Protein SECRET 
AGENT [Arabidopsis thaliana]
 gb|AAF26789.1|AC016829_13 putative O-linked GlcNAc transferase [Arabidopsis thaliana]
 gb|AAL60196.1|AF441079_1 O-linked N-acetyl glucosamine transferase [Arabidopsis thaliana]
 gb|AAM13988.1| putative O-linked GlcNAc transferase [Arabidopsis thaliana]
 gb|AAM51415.1| putative O-linked GlcNAc transferase [Arabidopsis thaliana]
 dbj|BAE98963.1| O-linked GlcNAc transferase like protein [Arabidopsis thaliana]
 gb|AEE74056.1| putative UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Arabidopsis thaliana]
 gb|AHL38781.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=977

 Score =   238 bits (608),  Expect = 4e-68, Method: Composition-based stats.
 Identities = 107/131 (82%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD+ LDTPLCNGHTTGTDVLWAG+PM+TLPLEKMATRVAGSLCLATGLG  MIV++++E
Sbjct  844  LADVILDTPLCNGHTTGTDVLWAGVPMITLPLEKMATRVAGSLCLATGLGHGMIVNSLEE  903

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALN+ KLQ LT  L+A+R+TCPLFDT RWVKNLERSYFKMWNL+C GQQPQ 
Sbjct  904  YEEKAVSLALNKPKLQALTKELRASRLTCPLFDTMRWVKNLERSYFKMWNLHCSGQQPQH  963

Query  511  FKVTENDAEFP  479
            FKV END EFP
Sbjct  964  FKVLENDLEFP  974



>ref|XP_010673371.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Beta vulgaris subsp. vulgaris]
Length=1025

 Score =   238 bits (608),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LADL LDTPLCNGHTTGTDVLWAGLPM+TLPLEKMATRVAGSLCLATG+GEEM+ +++++
Sbjct  892   LADLCLDTPLCNGHTTGTDVLWAGLPMLTLPLEKMATRVAGSLCLATGVGEEMVANSLRD  951

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
             YEEKAVSLALNR KL++LTNRLKAAR+TCPLFDT RWV+NLER++FKMWNLYC GQ PQP
Sbjct  952   YEEKAVSLALNRPKLRELTNRLKAARLTCPLFDTARWVRNLERAFFKMWNLYCVGQHPQP  1011

Query  511   FKVTENDAEFP  479
             FKVTEND E P
Sbjct  1012  FKVTENDLECP  1022



>ref|XP_006408212.1| hypothetical protein EUTSA_v10019996mg [Eutrema salsugineum]
 gb|ESQ49665.1| hypothetical protein EUTSA_v10019996mg [Eutrema salsugineum]
Length=977

 Score =   238 bits (607),  Expect = 7e-68, Method: Composition-based stats.
 Identities = 107/131 (82%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD+ LDTPLCNGHTTGTDVLWAG+PM+TLPLEKMATRVAGSLCLATGLG EMIV++++E
Sbjct  844  LADVILDTPLCNGHTTGTDVLWAGVPMITLPLEKMATRVAGSLCLATGLGHEMIVNSLEE  903

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALN+ KLQ LT  L+A+R+TCPLFDT RWVKNLERSYFKMWNL+C  QQPQ 
Sbjct  904  YEEKAVSLALNKPKLQALTKELRASRLTCPLFDTMRWVKNLERSYFKMWNLHCSRQQPQH  963

Query  511  FKVTENDAEFP  479
            FKV END EFP
Sbjct  964  FKVMENDLEFP  974



>ref|XP_009125003.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Brassica rapa]
Length=975

 Score =   238 bits (606),  Expect = 1e-67, Method: Composition-based stats.
 Identities = 106/131 (81%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD+ LDTPLCNGHTTGTDVLWAG+PM+TLPLEKMATRVAGSLCLATGLG EMIV++++E
Sbjct  842  LADVILDTPLCNGHTTGTDVLWAGVPMITLPLEKMATRVAGSLCLATGLGHEMIVNSLEE  901

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALN+ KLQ LT  L+A+R+TCPLFDT RWVKNLERSYFKMWNL+C GQ+PQ 
Sbjct  902  YEEKAVSLALNKPKLQALTKELRASRLTCPLFDTMRWVKNLERSYFKMWNLHCSGQKPQH  961

Query  511  FKVTENDAEFP  479
            FKV E D EFP
Sbjct  962  FKVVEKDMEFP  972



>ref|XP_002453843.1| hypothetical protein SORBIDRAFT_04g019560 [Sorghum bicolor]
 gb|EES06819.1| hypothetical protein SORBIDRAFT_04g019560 [Sorghum bicolor]
Length=1011

 Score =   238 bits (606),  Expect = 1e-67, Method: Composition-based stats.
 Identities = 104/131 (79%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LADLFLDTPLCN HTTGTD+LWAGLPM+TLPLEKMATRVAGSLC+ATGLGEEMIVS++KE
Sbjct  878   LADLFLDTPLCNAHTTGTDILWAGLPMITLPLEKMATRVAGSLCVATGLGEEMIVSSMKE  937

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
             YE++AV LALN  KLQ LTN+LK  RMTCPLFDT RWV+NLER+Y+KMWNLYC  + P+P
Sbjct  938   YEDRAVDLALNPVKLQALTNKLKEVRMTCPLFDTARWVRNLERAYYKMWNLYCSSRHPEP  997

Query  511   FKVTENDAEFP  479
             FKV E+D EFP
Sbjct  998   FKVLEDDNEFP  1008



>ref|XP_010549635.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Tarenaya hassleriana]
Length=977

 Score =   237 bits (605),  Expect = 1e-67, Method: Composition-based stats.
 Identities = 104/132 (79%), Positives = 121/132 (92%), Gaps = 0/132 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD+ LDTPLCNGHTTGTDVLWAG+PM+TLPLEKMATRVAGSLCLATGLG EMIV++++E
Sbjct  844  LADVILDTPLCNGHTTGTDVLWAGVPMITLPLEKMATRVAGSLCLATGLGHEMIVNSLEE  903

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLA+N+ KLQ LT +L+  R+TCPLFDT RWVKNLER+YF+MWNL+C GQQPQ 
Sbjct  904  YEEKAVSLAMNKPKLQALTEKLRTNRLTCPLFDTMRWVKNLERAYFRMWNLHCSGQQPQH  963

Query  511  FKVTENDAEFPA  476
            FKVTEND E+P+
Sbjct  964  FKVTENDLEYPS  975



>dbj|BAJ94917.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=986

 Score =   237 bits (604),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 102/131 (78%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPM+TLPLEKMATRVAGSLCLATGLG+EMIVS+ KE
Sbjct  853  LADLFLDTPLCNAHTTGTDILWAGLPMITLPLEKMATRVAGSLCLATGLGDEMIVSSTKE  912

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YE++AV LA N  KLQ LTN+LK  R+TCPLFDT RWV+NL+R+YFKMWN+YC G+ P+P
Sbjct  913  YEDRAVELATNPAKLQALTNKLKEVRLTCPLFDTARWVRNLDRAYFKMWNIYCSGRHPEP  972

Query  511  FKVTENDAEFP  479
            FKV E+D+EFP
Sbjct  973  FKVKEDDSEFP  983



>ref|XP_002325368.1| O-linked N-acetyl glucosamine transferase family protein [Populus 
trichocarpa]
 gb|EEE99749.1| O-linked N-acetyl glucosamine transferase family protein [Populus 
trichocarpa]
Length=873

 Score =   236 bits (601),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPMVT+PLEKMATRVAGSLCLATGLG+EMIVS++KE
Sbjct  740  LADLFLDTPLCNAHTTGTDILWAGLPMVTMPLEKMATRVAGSLCLATGLGDEMIVSSMKE  799

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE+AVSLALN+ KLQ LTNRLKA RMTCPLFDT RWV+NLER+YFKMWN++C GQQP  
Sbjct  800  YEERAVSLALNKPKLQSLTNRLKAFRMTCPLFDTKRWVRNLERAYFKMWNIHCSGQQPHH  859

Query  511  FKVTENDAEFP  479
            FKV END + P
Sbjct  860  FKVAENDFDCP  870



>ref|XP_004952491.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC-like [Setaria italica]
Length=1011

 Score =   236 bits (603),  Expect = 3e-67, Method: Composition-based stats.
 Identities = 103/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LADLFLDTPLCN HTTGTD+LWAGLPM+TLPLEKMATRVAGSLC+ATGLGEEMIVS++KE
Sbjct  878   LADLFLDTPLCNAHTTGTDILWAGLPMITLPLEKMATRVAGSLCVATGLGEEMIVSSMKE  937

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
             YEE+AV LALN  KLQ LT++LK  RMTCPLFDT RWV+NLER+Y+KMWNLYC G+ P+P
Sbjct  938   YEERAVELALNPAKLQALTSKLKEVRMTCPLFDTARWVRNLERAYYKMWNLYCSGRHPEP  997

Query  511   FKVTENDAEFP  479
             FKV E+++ FP
Sbjct  998   FKVEEDNSTFP  1008



>ref|XP_006408211.1| hypothetical protein EUTSA_v10019996mg [Eutrema salsugineum]
 gb|ESQ49664.1| hypothetical protein EUTSA_v10019996mg [Eutrema salsugineum]
Length=951

 Score =   236 bits (601),  Expect = 4e-67, Method: Composition-based stats.
 Identities = 107/131 (82%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD+ LDTPLCNGHTTGTDVLWAG+PM+TLPLEKMATRVAGSLCLATGLG EMIV++++E
Sbjct  818  LADVILDTPLCNGHTTGTDVLWAGVPMITLPLEKMATRVAGSLCLATGLGHEMIVNSLEE  877

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLALN+ KLQ LT  L+A+R+TCPLFDT RWVKNLERSYFKMWNL+C  QQPQ 
Sbjct  878  YEEKAVSLALNKPKLQALTKELRASRLTCPLFDTMRWVKNLERSYFKMWNLHCSRQQPQH  937

Query  511  FKVTENDAEFP  479
            FKV END EFP
Sbjct  938  FKVMENDLEFP  948



>ref|XP_003590906.1| O-linked GlcNAc transferase like protein [Medicago truncatula]
Length=744

 Score =   233 bits (594),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPMVTLPLEKMATRVAGSLC++TGLGEEMIVS++KE
Sbjct  611  LADLFLDTPLCNAHTTGTDILWAGLPMVTLPLEKMATRVAGSLCISTGLGEEMIVSSMKE  670

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YE++AVSLALNR KLQ LT++LK+ R+TCPLFDT RWV+NL+R+YFKMWNL+C GQ+PQ 
Sbjct  671  YEDRAVSLALNRPKLQALTDKLKSVRLTCPLFDTNRWVRNLDRAYFKMWNLHCTGQRPQH  730

Query  511  FKVTENDAEFP  479
            FKVTEND E P
Sbjct  731  FKVTENDNECP  741



>gb|KJB82317.1| hypothetical protein B456_013G189100 [Gossypium raimondii]
Length=796

 Score =   233 bits (595),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADL LDTPLCN HTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGE+MIV+++KE
Sbjct  663  LADLCLDTPLCNAHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEDMIVNSMKE  722

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE+AV+LALNR KLQ LT +LK AR+TCPLFDT RWV+NLER+Y KMWNLYC GQQPQ 
Sbjct  723  YEEQAVTLALNRPKLQALTKKLKEARLTCPLFDTARWVRNLERAYLKMWNLYCSGQQPQH  782

Query  511  FKVTENDAEFP  479
            FKVTEND +FP
Sbjct  783  FKVTENDFDFP  793



>ref|XP_008643950.1| PREDICTED: uncharacterized protein LOC100381672 isoform X1 [Zea 
mays]
Length=1026

 Score =   233 bits (595),  Expect = 4e-66, Method: Composition-based stats.
 Identities = 102/131 (78%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LADLFLDTPLCN HTTGTD+LWAGLPM+TLPLEKMATRVAGSLC+ATGLGEEMIVS++K+
Sbjct  893   LADLFLDTPLCNAHTTGTDILWAGLPMITLPLEKMATRVAGSLCVATGLGEEMIVSSMKK  952

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
             YE++AV LALN  KLQ LTN+LK  RMTCPLFDT RWV+NLER+Y+KMWNLYC  + P+P
Sbjct  953   YEDRAVELALNPVKLQALTNKLKEVRMTCPLFDTARWVRNLERAYYKMWNLYCSSRHPEP  1012

Query  511   FKVTENDAEFP  479
             FKV E+D E P
Sbjct  1013  FKVVEDDNESP  1023



>ref|NP_001167956.1| uncharacterized protein LOC100381672 [Zea mays]
 gb|ACN26645.1| unknown [Zea mays]
Length=1009

 Score =   233 bits (595),  Expect = 4e-66, Method: Composition-based stats.
 Identities = 102/131 (78%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LADLFLDTPLCN HTTGTD+LWAGLPM+TLPLEKMATRVAGSLC+ATGLGEEMIVS++K+
Sbjct  876   LADLFLDTPLCNAHTTGTDILWAGLPMITLPLEKMATRVAGSLCVATGLGEEMIVSSMKK  935

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
             YE++AV LALN  KLQ LTN+LK  RMTCPLFDT RWV+NLER+Y+KMWNLYC  + P+P
Sbjct  936   YEDRAVELALNPVKLQALTNKLKEVRMTCPLFDTARWVRNLERAYYKMWNLYCSSRHPEP  995

Query  511   FKVTENDAEFP  479
             FKV E+D E P
Sbjct  996   FKVVEDDNESP  1006



>gb|EEC73199.1| hypothetical protein OsI_07263 [Oryza sativa Indica Group]
Length=1004

 Score =   232 bits (592),  Expect = 9e-66, Method: Composition-based stats.
 Identities = 105/133 (79%), Positives = 117/133 (88%), Gaps = 2/133 (2%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSN--V  698
             LADLFLDTPLCN HTTGTD+LWAGLPM+TLPLEKMATRVAGSLCLATGLGEEMIVS   +
Sbjct  869   LADLFLDTPLCNAHTTGTDILWAGLPMITLPLEKMATRVAGSLCLATGLGEEMIVSRQVM  928

Query  697   KEYEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP  518
             KEYE++AV LALN  KLQ LTN+LK  RMTCPLFDT RWV+NLER+Y+KMWNLYC G+  
Sbjct  929   KEYEDRAVDLALNPAKLQALTNKLKEVRMTCPLFDTARWVRNLERAYYKMWNLYCSGRHR  988

Query  517   QPFKVTENDAEFP  479
             +PFKV E+D EFP
Sbjct  989   EPFKVIEDDNEFP  1001



>gb|EEE57013.1| hypothetical protein OsJ_06783 [Oryza sativa Japonica Group]
Length=1004

 Score =   232 bits (591),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 105/133 (79%), Positives = 117/133 (88%), Gaps = 2/133 (2%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSN--V  698
             LADLFLDTPLCN HTTGTD+LWAGLPM+TLPLEKMATRVAGSLCLATGLGEEMIVS   +
Sbjct  869   LADLFLDTPLCNAHTTGTDILWAGLPMITLPLEKMATRVAGSLCLATGLGEEMIVSRQVM  928

Query  697   KEYEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP  518
             KEYE++AV LALN  KLQ LTN+LK  RMTCPLFDT RWV+NLER+Y+KMWNLYC G+  
Sbjct  929   KEYEDRAVDLALNPAKLQALTNKLKEVRMTCPLFDTARWVRNLERAYYKMWNLYCSGRHR  988

Query  517   QPFKVTENDAEFP  479
             +PFKV E+D EFP
Sbjct  989   EPFKVIEDDNEFP  1001



>ref|XP_006647295.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC-like isoform X2 [Oryza brachyantha]
Length=669

 Score =   227 bits (578),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPM+TLPLEKMATRVAGSLCLATGLGEEM+VS++KE
Sbjct  536  LADLFLDTPLCNAHTTGTDILWAGLPMITLPLEKMATRVAGSLCLATGLGEEMVVSSMKE  595

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YE++AV LA+N  KLQ LTN+LK  RMTCPLFDT RWV+NLER+Y+KMWNLYC  +  +P
Sbjct  596  YEDRAVDLAVNPGKLQALTNKLKEVRMTCPLFDTARWVRNLERAYYKMWNLYCSSRHREP  655

Query  511  FKVTENDAEFP  479
            FKV E+D EFP
Sbjct  656  FKVREDDTEFP  666



>ref|XP_004971037.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC-like [Setaria italica]
Length=971

 Score =   229 bits (585),  Expect = 6e-65, Method: Composition-based stats.
 Identities = 103/130 (79%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCNGHTTGTDVLWAGLPM+TLPLEKMATRVAGSLCLATG+GEE+IV ++ E
Sbjct  838  LADLFLDTPLCNGHTTGTDVLWAGLPMITLPLEKMATRVAGSLCLATGVGEEIIVDSLTE  897

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE+AV LA N +KLQ LTNRLKA RMTCPLFDT+RWVKNL+R+Y KMW+LYC G  PQ 
Sbjct  898  YEERAVFLATNPSKLQALTNRLKAVRMTCPLFDTSRWVKNLDRAYLKMWHLYCSGSHPQH  957

Query  511  FKVTENDAEF  482
            FKV E+D +F
Sbjct  958  FKVVEDDNQF  967



>gb|AFW71469.1| hypothetical protein ZEAMMB73_864118 [Zea mays]
Length=706

 Score =   227 bits (578),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPM+TLPLEKMATRVAGSLC+ATGLGEEMIVS++K+
Sbjct  573  LADLFLDTPLCNAHTTGTDILWAGLPMITLPLEKMATRVAGSLCVATGLGEEMIVSSMKK  632

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YE++AV LALN  KLQ LTN+LK  RMTCPLFDT RWV+NLER+Y+KMWNLYC  + P+P
Sbjct  633  YEDRAVELALNPVKLQALTNKLKEVRMTCPLFDTARWVRNLERAYYKMWNLYCSSRHPEP  692

Query  511  FKVTENDAEFP  479
            FKV E+D E P
Sbjct  693  FKVVEDDNESP  703



>gb|EPS58700.1| hypothetical protein M569_16113, partial [Genlisea aurea]
Length=128

 Score =   211 bits (537),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = -2

Query  847  PLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKEYEEKAVSL  668
            PLCN HTTGTDVLWAG+PM+TLPLEKMATRVAGSLCLATG+GEEMIV ++KEYE++AVSL
Sbjct  9    PLCNAHTTGTDVLWAGIPMITLPLEKMATRVAGSLCLATGVGEEMIVKSMKEYEDRAVSL  68

Query  667  ALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQPFKVTEND  491
            ALN +KL+DLT++LKA R++CPLFDT RWV+NLER+Y KMW LYC GQQP+PFKVTEND
Sbjct  69   ALNPSKLRDLTSKLKAVRLSCPLFDTARWVRNLERAYLKMWKLYCNGQQPKPFKVTEND  127



>ref|XP_006647294.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC-like isoform X1 [Oryza brachyantha]
Length=779

 Score =   228 bits (580),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPM+TLPLEKMATRVAGSLCLATGLGEEM+VS++KE
Sbjct  646  LADLFLDTPLCNAHTTGTDILWAGLPMITLPLEKMATRVAGSLCLATGLGEEMVVSSMKE  705

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YE++AV LA+N  KLQ LTN+LK  RMTCPLFDT RWV+NLER+Y+KMWNLYC  +  +P
Sbjct  706  YEDRAVDLAVNPGKLQALTNKLKEVRMTCPLFDTARWVRNLERAYYKMWNLYCSSRHREP  765

Query  511  FKVTENDAEFP  479
            FKV E+D EFP
Sbjct  766  FKVREDDTEFP  776



>ref|XP_006646603.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC-like [Oryza brachyantha]
Length=978

 Score =   228 bits (582),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 101/131 (77%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCNGHTTGTD+LWAGLPM+TLPL+KMATRVAGSLCLATG+GEEM+V++++E
Sbjct  845  LADLFLDTPLCNGHTTGTDILWAGLPMITLPLQKMATRVAGSLCLATGIGEEMVVNSLEE  904

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEEKAVSLA N  KL+ L N+LKA RMTCPLFDT RWVKNLER+Y  MWNL+C G+ P+ 
Sbjct  905  YEEKAVSLAENPWKLEALRNKLKAVRMTCPLFDTARWVKNLERAYLHMWNLHCSGRNPRH  964

Query  511  FKVTENDAEFP  479
            FKV E+DA+FP
Sbjct  965  FKVLEDDAQFP  975



>ref|XP_010239774.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC isoform X2 [Brachypodium distachyon]
Length=977

 Score =   228 bits (581),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 100/131 (76%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPM+TL LEKMATRVAGSLCLATGLG+EMIVS+ KE
Sbjct  844  LADLFLDTPLCNAHTTGTDILWAGLPMITLALEKMATRVAGSLCLATGLGDEMIVSSTKE  903

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YE++AV LA N  +L+ LTN+LK AR+TCPLFDT RWV+NL+R+YFKMWNLYC G+ P+ 
Sbjct  904  YEDRAVELATNPAELRILTNKLKQARLTCPLFDTARWVRNLDRAYFKMWNLYCSGRHPES  963

Query  511  FKVTENDAEFP  479
            FKV E+D EFP
Sbjct  964  FKVKEDDNEFP  974



>ref|XP_010233580.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Brachypodium distachyon]
Length=976

 Score =   228 bits (581),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 101/129 (78%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCNGHTTGTD+LWAGLPM+TLPLEKMATRVAGSLC ATG+GEEMIVS++KE
Sbjct  843  LADLFLDTPLCNGHTTGTDILWAGLPMITLPLEKMATRVAGSLCRATGIGEEMIVSSLKE  902

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE+AV LA N +KLQ LTN+LKA RMTCPLFDT+RWVKNL+R+Y KMW+LYC G+ PQ 
Sbjct  903  YEERAVFLAKNPSKLQALTNKLKAVRMTCPLFDTSRWVKNLDRAYLKMWHLYCLGRHPQH  962

Query  511  FKVTENDAE  485
            FKV E++ +
Sbjct  963  FKVLEDNTQ  971



>ref|XP_003579571.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC isoform X1 [Brachypodium distachyon]
Length=983

 Score =   228 bits (581),  Expect = 2e-64, Method: Composition-based stats.
 Identities = 100/131 (76%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPM+TL LEKMATRVAGSLCLATGLG+EMIVS+ KE
Sbjct  850  LADLFLDTPLCNAHTTGTDILWAGLPMITLALEKMATRVAGSLCLATGLGDEMIVSSTKE  909

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YE++AV LA N  +L+ LTN+LK AR+TCPLFDT RWV+NL+R+YFKMWNLYC G+ P+ 
Sbjct  910  YEDRAVELATNPAELRILTNKLKQARLTCPLFDTARWVRNLDRAYFKMWNLYCSGRHPES  969

Query  511  FKVTENDAEFP  479
            FKV E+D EFP
Sbjct  970  FKVKEDDNEFP  980



>gb|EEC72025.1| hypothetical protein OsI_04909 [Oryza sativa Indica Group]
Length=890

 Score =   222 bits (565),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 97/129 (75%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -2

Query  865  DLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKEYE  686
            D+F   PLCNGHTTGTD+LWAGLPM+TLPLEKMATRVAGSLCLATG+GEEM+V++++EYE
Sbjct  761  DIFNTCPLCNGHTTGTDILWAGLPMITLPLEKMATRVAGSLCLATGIGEEMVVNSLEEYE  820

Query  685  EKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQPFK  506
            E+AVSLA N  KL+ LTN+LKA RMTCPLFDT RWVKNLER+Y  MWNL+C G+ PQ FK
Sbjct  821  ERAVSLAENPLKLEALTNKLKAVRMTCPLFDTARWVKNLERAYLHMWNLHCSGRHPQHFK  880

Query  505  VTENDAEFP  479
            V E+DA+FP
Sbjct  881  VLEDDAQFP  889



>gb|EEE55882.1| hypothetical protein OsJ_04532 [Oryza sativa Japonica Group]
Length=885

 Score =   221 bits (563),  Expect = 4e-62, Method: Composition-based stats.
 Identities = 97/129 (75%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -2

Query  865  DLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKEYE  686
            D+F   PLCNGHTTGTD+LWAGLPM+TLPLEKMATRVAGSLCLATG+GEEM+V++++EYE
Sbjct  756  DIFNTCPLCNGHTTGTDILWAGLPMITLPLEKMATRVAGSLCLATGIGEEMVVNSLEEYE  815

Query  685  EKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQPFK  506
            E+AVSLA N  KL+ LTN+LKA RMTCPLFDT RWVKNLER+Y  MWNL+C G+ PQ FK
Sbjct  816  ERAVSLAENPLKLEALTNKLKAVRMTCPLFDTARWVKNLERAYLHMWNLHCSGRHPQHFK  875

Query  505  VTENDAEFP  479
            V E+DA+FP
Sbjct  876  VLEDDAQFP  884



>gb|EMS67442.1| putative UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Triticum urartu]
Length=1206

 Score =   222 bits (566),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 96/123 (78%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LADLFLDTPLCN HTTGTD+LWAGLPM+TLPLEKMATRVAGSLCLATGLG+EMIVS+ KE
Sbjct  958   LADLFLDTPLCNAHTTGTDILWAGLPMITLPLEKMATRVAGSLCLATGLGDEMIVSSTKE  1017

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
             YE++AV LA N  KLQ LTN+LK  R+TCPLFDT RWV+NL+R+YFKMWN+YC G+ P+P
Sbjct  1018  YEDRAVELATNPAKLQALTNKLKEVRLTCPLFDTARWVRNLDRAYFKMWNIYCSGRHPEP  1077

Query  511   FKV  503
             FK+
Sbjct  1078  FKL  1080



>ref|XP_001779704.1| predicted protein [Physcomitrella patens]
 gb|EDQ55500.1| predicted protein [Physcomitrella patens]
Length=922

 Score =   214 bits (544),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 94/131 (72%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLD+PLCN HTTGTDVLWAGLPMVTLPLEKMATRVA SLC A G GEEM+VS+++E
Sbjct  789  LADLFLDSPLCNAHTTGTDVLWAGLPMVTLPLEKMATRVAMSLCYAAGFGEEMVVSSMQE  848

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE+AV LA     L+ LT  L+A+R++ PLFDT RWV+N ERS+FKMWNLYC G  PQP
Sbjct  849  YEERAVMLATTPAILKTLTANLRASRLSSPLFDTIRWVRNFERSFFKMWNLYCSGAHPQP  908

Query  511  FKVTENDAEFP  479
            FKV E+D +FP
Sbjct  909  FKVFEDDVQFP  919



>gb|EMT18216.1| Putative UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Aegilops tauschii]
Length=986

 Score =   209 bits (531),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 96/148 (65%), Positives = 111/148 (75%), Gaps = 25/148 (17%)
 Frame = -2

Query  871  LADLFLDT-------------------------PLCNGHTTGTDVLWAGLPMVTLPLEKM  767
            LADLFLDT                         PLCN HTTGTD+LWAGLPM+TLPLEKM
Sbjct  757  LADLFLDTHIGSYFILILGLYFWSVFVNFPHHRPLCNAHTTGTDILWAGLPMITLPLEKM  816

Query  766  ATRVAGSLCLATGLGEEMIVSNVKEYEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTT  587
            ATRVAGSLCLATGLG+EMIVS+ KEYE++AV LA N  KLQ LTN+LK  R+TCPLFDT 
Sbjct  817  ATRVAGSLCLATGLGDEMIVSSTKEYEDRAVELATNPAKLQALTNKLKEVRLTCPLFDTA  876

Query  586  RWVKNLERSYFKMWNLYCCGQQPQPFKV  503
            RWV+NL+R+YFKMWN+YC G+ P+PFK+
Sbjct  877  RWVRNLDRAYFKMWNIYCSGRHPEPFKL  904



>ref|XP_002966194.1| peptide-N-acetylglucosaminyltransferase [Selaginella moellendorffii]
 gb|EFJ32221.1| peptide-N-acetylglucosaminyltransferase [Selaginella moellendorffii]
Length=985

 Score =   208 bits (529),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 93/132 (70%), Positives = 110/132 (83%), Gaps = 1/132 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTDVLWAGLPM+TLPLEKMATRVA SLC A G G+EM+V  ++E
Sbjct  853  LADLFLDTPLCNAHTTGTDVLWAGLPMITLPLEKMATRVAMSLCYAAGFGDEMVVKKMQE  912

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YE++AV LA N   L+ LT+RL++ R+TCPLFDT RWV N ER YFKMWNLYC G+QPQ 
Sbjct  913  YEDRAVMLAENPKALESLTSRLRSVRLTCPLFDTERWVVNAERCYFKMWNLYCDGKQPQA  972

Query  511  FKVTENDAEFPA  476
            FKV E++ +FP+
Sbjct  973  FKVAESE-DFPS  983



>ref|XP_001774513.1| predicted protein [Physcomitrella patens]
 gb|EDQ60737.1| predicted protein [Physcomitrella patens]
Length=932

 Score =   207 bits (527),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 92/131 (70%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLD+PLCN HTTGTDVLWAGLPMVTLPLEKMATRVA SLC A G GEEM+VS+++E
Sbjct  799  LADLFLDSPLCNAHTTGTDVLWAGLPMVTLPLEKMATRVAMSLCYAAGFGEEMVVSSMQE  858

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE+AV LA N   L+ LT  L+A+R++ PLFDT RWV+N ERS+FKMWNL C G  P+ 
Sbjct  859  YEERAVMLATNPAILKALTANLRASRLSSPLFDTIRWVRNFERSFFKMWNLNCSGAHPRA  918

Query  511  FKVTENDAEFP  479
            FKV E+D +FP
Sbjct  919  FKVVEDDLQFP  929



>gb|KJB44758.1| hypothetical protein B456_007G2711002, partial [Gossypium raimondii]
Length=321

 Score =   181 bits (460),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 88/100 (88%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = -2

Query  874  CLADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVK  695
             LADL LDTPLCN HTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIV+++K
Sbjct  220  ALADLCLDTPLCNAHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVNSMK  279

Query  694  EYEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVK  575
            EYEE+AVSLALNR KLQ LTN+LKAAR+TCPLFDT RWVK
Sbjct  280  EYEERAVSLALNRLKLQALTNKLKAARLTCPLFDTARWVK  319



>gb|ACN35850.1| unknown [Zea mays]
Length=108

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -2

Query  793  MVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKEYEEKAVSLALNRTKLQDLTNRLKAAR  614
            M+TLPLEKMATRVAGSLC+ATGLGEEMIVS++K+YE++AV LALN  KLQ LTN+LK  R
Sbjct  1    MITLPLEKMATRVAGSLCVATGLGEEMIVSSMKKYEDRAVELALNPVKLQALTNKLKEVR  60

Query  613  MTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQPFKVTENDAEFP  479
            MTCPLFDT RWV+NLER+Y+KMWNLYC  + P+PFKV E+D E P
Sbjct  61   MTCPLFDTARWVRNLERAYYKMWNLYCSSRHPEPFKVVEDDNESP  105



>gb|KDO52515.1| hypothetical protein CISIN_1g0024311mg, partial [Citrus sinensis]
Length=468

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTPLCN HTTGTD+LWAGLPM+TLPLEKMATRVAGSLCLATGLGEEMIV+++KE
Sbjct  370  LADLFLDTPLCNAHTTGTDILWAGLPMITLPLEKMATRVAGSLCLATGLGEEMIVNSMKE  429

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWV  578
            YEE+AVSLAL+R KLQ LTN+LK+ R+TCPLFDT RWV
Sbjct  430  YEERAVSLALDRQKLQALTNKLKSVRLTCPLFDTARWV  467



>gb|KJB82316.1| hypothetical protein B456_013G189100 [Gossypium raimondii]
Length=956

 Score =   181 bits (460),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 83/98 (85%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADL LDTPLCN HTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGE+MIV+++KE
Sbjct  857  LADLCLDTPLCNAHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEDMIVNSMKE  916

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWV  578
            YEE+AV+LALNR KLQ LT +LK AR+TCPLFDT RWV
Sbjct  917  YEEQAVTLALNRPKLQALTKKLKEARLTCPLFDTARWV  954



>ref|XP_005652169.1| TPR-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE27625.1| TPR-like protein [Coccomyxa subellipsoidea C-169]
Length=945

 Score =   179 bits (455),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 78/123 (63%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            +AD+FLDTPLCN HTTG DVLW G PMVTLPLE+MA+RVA SLC ATGLG EM+VS+  E
Sbjct  822  IADVFLDTPLCNAHTTGCDVLWGGCPMVTLPLERMASRVAASLCYATGLGHEMVVSSQHE  881

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YE++AV L LN      L  RLK AR+TCPLFDT  WV +LE+ +F+MW+++C G+ P+P
Sbjct  882  YEDRAVELGLNHAMRLSLRERLKRARLTCPLFDTAGWVPDLEKVFFRMWDVHCEGRGPRP  941

Query  511  FKV  503
            F+V
Sbjct  942  FEV  944



>gb|ABA27069.1| TO89-1 [Taraxacum officinale]
Length=89

 Score =   141 bits (355),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADL LDTPLCN HT GTDVLWAGLPMVTLPLEKMATRVAGSLCLATG+GEEMIV+++KE
Sbjct  8    LADLCLDTPLCNAHTAGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGVGEEMIVNSMKE  67

Query  691  YEEKAVSLALNRTKLQDLTNRL  626
            YEE+AV LALNR KL++L N+L
Sbjct  68   YEERAVYLALNRAKLEELKNKL  89



>ref|XP_009800255.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC [Nicotiana sylvestris]
Length=86

 Score =   138 bits (348),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = -2

Query  703  NVKEYEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQ  524
            ++KEYEEKAVSLALNR KLQDLTNRLKA R++CPLFDT RWV+NLERSYFKMWNLYC GQ
Sbjct  9    SMKEYEEKAVSLALNRPKLQDLTNRLKAVRLSCPLFDTGRWVRNLERSYFKMWNLYCSGQ  68

Query  523  QPQPFKVTENDAEFP  479
             PQPFKVTEN+ EFP
Sbjct  69   HPQPFKVTENNMEFP  83



>emb|CCI46056.1| unnamed protein product [Albugo candida]
Length=965

 Score =   140 bits (354),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 66/125 (53%), Positives = 84/125 (67%), Gaps = 1/125 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTP CN HTTG D+LW G PM+TL  ++MATRVA SL  A  L +EMI  ++KE
Sbjct  824  LADLFLDTPECNAHTTGCDILWGGTPMITLAKDRMATRVASSLLRAAHL-DEMITYSLKE  882

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE AV+LA +  + + +  +L+  R+TCPLFDT RWV+N E      W  + CGQ PQ 
Sbjct  883  YEELAVALATDSKRWKAIKQKLECNRITCPLFDTQRWVRNFETGLQLAWKRHECGQDPQH  942

Query  511  FKVTE  497
              V +
Sbjct  943  IDVPD  947



>emb|CCI46057.1| unnamed protein product [Albugo candida]
Length=996

 Score =   140 bits (354),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 66/125 (53%), Positives = 84/125 (67%), Gaps = 1/125 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTP CN HTTG D+LW G PM+TL  ++MATRVA SL  A  L +EMI  ++KE
Sbjct  855  LADLFLDTPECNAHTTGCDILWGGTPMITLAKDRMATRVASSLLRAAHL-DEMITYSLKE  913

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE AV+LA +  + + +  +L+  R+TCPLFDT RWV+N E      W  + CGQ PQ 
Sbjct  914  YEELAVALATDSKRWKAIKQKLECNRITCPLFDTQRWVRNFETGLQLAWKRHECGQDPQH  973

Query  511  FKVTE  497
              V +
Sbjct  974  IDVPD  978



>emb|CCA22532.1| predicted protein putative [Albugo laibachii Nc14]
Length=968

 Score =   138 bits (348),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 64/125 (51%), Positives = 85/125 (68%), Gaps = 1/125 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTP CN HTTG D+LW G PM+TL  ++MATRVA SL  A  L +EMI ++++E
Sbjct  824  LADLFLDTPECNAHTTGCDILWGGTPMITLAKDRMATRVASSLLRAANL-DEMITNSLEE  882

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE AV+LA +  + + + ++L+ +R +CPLFDT RWV+NLE      W  Y  GQ P  
Sbjct  883  YEELAVTLATDTKRWRAIKDKLERSRTSCPLFDTQRWVRNLETGLMMAWERYESGQPPDH  942

Query  511  FKVTE  497
              V +
Sbjct  943  IDVCD  947



>ref|XP_008913877.1| hypothetical protein PPTG_17683 [Phytophthora parasitica INRA-310]
 gb|ETM33702.1| hypothetical protein L914_19091 [Phytophthora parasitica]
 gb|ETN00826.1| hypothetical protein PPTG_17683 [Phytophthora parasitica INRA-310]
 gb|ETO62266.1| hypothetical protein F444_19833 [Phytophthora parasitica P1976]
 gb|ETP03369.1| hypothetical protein F441_19697 [Phytophthora parasitica CJ01A1]
Length=1013

 Score =   134 bits (336),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 64/125 (51%), Positives = 83/125 (66%), Gaps = 1/125 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTP CN HTTG D+LW G PMVT+P ++MATRVA SL  A  +  E+I ++++E
Sbjct  825  LADLFLDTPECNAHTTGCDILWGGTPMVTMPKDRMATRVASSLLRAANM-SELITNSLEE  883

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE AV+LA +  +L +L  RL+  R+ CPLFDT RWV+NLE      W  +  G  P  
Sbjct  884  YEELAVALASDMDRLWELRRRLEDERLHCPLFDTQRWVRNLETGLCMAWERHENGLAPDH  943

Query  511  FKVTE  497
              V +
Sbjct  944  IDVPD  948



>gb|ETL80498.1| hypothetical protein L917_19015 [Phytophthora parasitica]
Length=1013

 Score =   134 bits (336),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 64/125 (51%), Positives = 83/125 (66%), Gaps = 1/125 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTP CN HTTG D+LW G PMVT+P ++MATRVA SL  A  +  E+I ++++E
Sbjct  825  LADLFLDTPECNAHTTGCDILWGGTPMVTMPKDRMATRVASSLLRAANM-SELITNSLEE  883

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE AV+LA +  +L +L  RL+  R+ CPLFDT RWV+NLE      W  +  G  P  
Sbjct  884  YEELAVALASDMDRLWELRRRLEDERLHCPLFDTQRWVRNLETGLCMAWERHENGLAPDH  943

Query  511  FKVTE  497
              V +
Sbjct  944  IDVPD  948



>gb|ETI33477.1| hypothetical protein F443_19846 [Phytophthora parasitica P1569]
Length=1013

 Score =   134 bits (336),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 64/125 (51%), Positives = 83/125 (66%), Gaps = 1/125 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTP CN HTTG D+LW G PMVT+P ++MATRVA SL  A  +  E+I ++++E
Sbjct  825  LADLFLDTPECNAHTTGCDILWGGTPMVTMPKDRMATRVASSLLRAANM-SELITNSLEE  883

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE AV+LA +  +L +L  RL+  R+ CPLFDT RWV+NLE      W  +  G  P  
Sbjct  884  YEELAVALASDMDRLWELRRRLEDERLHCPLFDTQRWVRNLETGLCMAWERHENGLAPDH  943

Query  511  FKVTE  497
              V +
Sbjct  944  IDVPD  948



>gb|KIY93470.1| hypothetical protein MNEG_14491 [Monoraphidium neglectum]
Length=99

 Score =   122 bits (305),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = -2

Query  793  MVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKEYEEKAVSLALNRTKLQDLTNRLKAAR  614
            MVTLPLE+MA+RVA SL  ATGLG EM+VS+  EYE +AV L L+  K   L  RL+AAR
Sbjct  1    MVTLPLERMASRVAASLACATGLGREMVVSSQAEYEARAVELGLDAAKRGALRARLEAAR  60

Query  613  MTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQPFKVTE  497
            +TCPLFDT RWV++LER   +MW ++  G+ P+ F++T+
Sbjct  61   LTCPLFDTRRWVRDLERVLLRMWEIHTEGKGPRTFEITD  99



>emb|CBJ26401.1| UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase, 
family GT41 [Ectocarpus siliculosus]
Length=1080

 Score =   132 bits (333),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 65/126 (52%), Positives = 86/126 (68%), Gaps = 1/126 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGL-GEEMIVSNVK  695
            LADLFLDTP CN HTTG D+LW+G PM+T+   KMATRVA SL  A G  G  +IV +++
Sbjct  824  LADLFLDTPSCNAHTTGCDILWSGTPMLTMAGSKMATRVAPSLLKAAGAEGTGLIVESLE  883

Query  694  EYEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQ  515
            EYEE+AVSLA +  KL ++ +RL+ +R +CPLFDT RWV+N+E         +  G  P+
Sbjct  884  EYEERAVSLATDPEKLFEIRSRLEESRHSCPLFDTQRWVRNMEAGLAMAHERFQAGLDPE  943

Query  514  PFKVTE  497
              KV +
Sbjct  944  DLKVDD  949



>ref|WP_041233800.1| UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC (fragment) [Cylindrospermum stagnale]
Length=390

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 87/128 (68%), Gaps = 1/128 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDT   N HT+ TD LWAGLP++T P    A+RVA SL  A GL  E++ +N++E
Sbjct  264  LADLFLDTLYYNAHTSATDALWAGLPVITCPGTTFASRVAASLLTAVGL-PELVTANLQE  322

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YE+ A++LA +  +L  L  +L   R T PLFDT+R+ +NLE++Y KMW +Y  G+ PQ 
Sbjct  323  YEQLAINLAKSPGELLQLKQKLAQNRTTHPLFDTSRFTRNLEQAYSKMWEVYAAGKSPQS  382

Query  511  FKVTENDA  488
             +V++  A
Sbjct  383  IQVSDIQA  390



>gb|ETK73827.1| hypothetical protein L915_19294 [Phytophthora parasitica]
 gb|ETL27248.1| hypothetical protein L916_19189 [Phytophthora parasitica]
 gb|ETP31487.1| hypothetical protein F442_19652 [Phytophthora parasitica P10297]
Length=1013

 Score =   132 bits (331),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 61/109 (56%), Positives = 78/109 (72%), Gaps = 1/109 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTP CN HTTG D+LW G PMVT+P ++MATRVA SL  A  +  E+I ++++E
Sbjct  825  LADLFLDTPECNAHTTGCDILWGGTPMVTMPKDRMATRVASSLLRAANM-SELITNSLEE  883

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMW  545
            YEE AV+LA +  +L +L  RL+  R+ CPLFDT RWV+NLE      W
Sbjct  884  YEELAVALASDMDRLWELRRRLEDERLHCPLFDTQRWVRNLETGLCMAW  932



>gb|AIA83498.1| CAZy families GT41 protein, partial [uncultured Azospirillum 
sp.]
Length=137

 Score =   121 bits (303),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 82/132 (62%), Gaps = 1/132 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDT   N HTT +  LWAGLP++T      A RVA SL  A GL  E+IV   + 
Sbjct  7    LADLFLDTLPYNAHTTASGALWAGLPVLTRRGTTFAGRVAASLLRAAGL-PELIVDGQEA  65

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YE +AV+LA +  +L+DL  RL   R  CPLFDT R+ ++LE +Y  MW+++  G  P+P
Sbjct  66   YEAEAVALARSPGRLRDLRQRLALNRPVCPLFDTPRFTRHLEAAYRAMWDIHRAGGAPRP  125

Query  511  FKVTENDAEFPA  476
              VT  DA  PA
Sbjct  126  ITVTAEDAGGPA  137



>ref|XP_005835014.1| hypothetical protein GUITHDRAFT_68991 [Guillardia theta CCMP2712]
 gb|EKX48034.1| hypothetical protein GUITHDRAFT_68991 [Guillardia theta CCMP2712]
Length=493

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 83/119 (70%), Gaps = 1/119 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD++LDT + NGHTTG+D LWAG+PMVTL  +   +RV  SL  A G+ +EMI +++  
Sbjct  355  LADVYLDTHIYNGHTTGSDFLWAGVPMVTLQGDTFPSRVGASLARAVGM-QEMIATDLAG  413

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQ  515
            YEEKAV L  N+  L+++  +LKAAR+T PLFDT RWV + E +  +MW  +  G +P+
Sbjct  414  YEEKAVELGNNKEALEEMKAKLKAARLTAPLFDTARWVGSFEDALTRMWERHARGLEPE  472



>ref|XP_005715776.1| UDP-GlcNAc: peptide-N-acetylglucosaminyltransferase, family GT41 
[Chondrus crispus]
 emb|CDF35957.1| UDP-GlcNAc: peptide-N-acetylglucosaminyltransferase, family GT41 
[Chondrus crispus]
Length=991

 Score =   130 bits (326),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 61/118 (52%), Positives = 79/118 (67%), Gaps = 1/118 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            L DLFLDTP CN HT GTDVLW+G+PM+T P    A+RVA SL  A G+  E+I S++  
Sbjct  825  LGDLFLDTPTCNAHTIGTDVLWSGVPMITCPGSLFASRVAASLLTAAGV-PELIASDMNA  883

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP  518
            YE+ AV LA NR KLQ +  R++ +R + PLFDT RWV+N+E  Y+  W  +  G  P
Sbjct  884  YEDLAVDLATNRPKLQAIRARIENSRSSNPLFDTARWVRNVEGLYWGAWKNFQAGNAP  941



>gb|ETI33489.1| hypothetical protein F443_19842, partial [Phytophthora parasitica 
P1569]
Length=759

 Score =   129 bits (323),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 83/125 (66%), Gaps = 1/125 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTP CN HTTG D+LW G PMVT+P ++MATRVA SL  A  +  E+I ++++E
Sbjct  571  LADLFLDTPECNAHTTGCDILWGGTPMVTMPKDRMATRVASSLLRAANMS-ELITNSLEE  629

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE AV+LA +  +L +L  RL+  R+ CPLFDT RWV+NLE      W  +  G  P  
Sbjct  630  YEELAVALASDMDRLWELRRRLEDERLHCPLFDTQRWVRNLETGLCMAWERHENGLAPDH  689

Query  511  FKVTE  497
              V +
Sbjct  690  IDVPD  694



>gb|AFZ26553.1| TIGR03032 family protein [Cylindrospermum stagnale PCC 7417]
Length=1083

 Score =   129 bits (325),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 62/128 (48%), Positives = 87/128 (68%), Gaps = 1/128 (1%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LADLFLDT   N HT+ TD LWAGLP++T P    A+RVA SL  A GL  E++ +N++E
Sbjct  957   LADLFLDTLYYNAHTSATDALWAGLPVITCPGTTFASRVAASLLTAVGL-PELVTANLQE  1015

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
             YE+ A++LA +  +L  L  +L   R T PLFDT+R+ +NLE++Y KMW +Y  G+ PQ 
Sbjct  1016  YEQLAINLAKSPGELLQLKQKLAQNRTTHPLFDTSRFTRNLEQAYSKMWEVYAAGKSPQS  1075

Query  511   FKVTENDA  488
              +V++  A
Sbjct  1076  IQVSDIQA  1083



>emb|CCI13110.1| putative UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC (fragment) [Microcystis aeruginosa PCC 9806]
Length=288

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 82/123 (67%), Gaps = 1/123 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDT   N HTTG+D LWAGLP++T P     +RV  SL  A GL  E+I  N++E
Sbjct  165  LADLFLDTLYYNAHTTGSDALWAGLPIITCPGTTFPSRVGASLLTAIGL-PELITKNLEE  223

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            Y+  A++LA +  KL ++  +L   R+T PLFDT R+ +NLE++Y  MW++Y  G+ P+ 
Sbjct  224  YKNLAINLAKSPDKLHEIKQKLAQNRLTYPLFDTLRFTRNLEKAYRTMWDIYAAGKSPEM  283

Query  511  FKV  503
             ++
Sbjct  284  IRI  286



>ref|WP_043999986.1| hypothetical protein, partial [Microcystis aeruginosa]
Length=345

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 82/123 (67%), Gaps = 1/123 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDT   N HTTG+D LWAGLP++T P     +RV  SL  A GL  E+I  N++E
Sbjct  222  LADLFLDTLYYNAHTTGSDALWAGLPIITCPGTTFPSRVGASLLTAIGL-PELITKNLEE  280

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            Y+  A++LA +  KL ++  +L   R+T PLFDT R+ +NLE++Y  MW++Y  G+ P+ 
Sbjct  281  YKNLAINLAKSPDKLHEIKQKLAQNRLTYPLFDTLRFTRNLEKAYRTMWDIYAAGKSPEM  340

Query  511  FKV  503
             ++
Sbjct  341  IRI  343



>ref|XP_009838332.1| hypothetical protein H257_12727 [Aphanomyces astaci]
 gb|ETV72264.1| hypothetical protein H257_12727 [Aphanomyces astaci]
Length=281

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 79/115 (69%), Gaps = 1/115 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDT   NGHT G D+LW+G PM+T     MA+RVA SL LA  L  E+I   ++E
Sbjct  151  LADLFLDTATSNGHTIGCDILWSGTPMITQTGHHMASRVASSLLLAVDL-PELIADTLEE  209

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCG  527
            YEE AV+LAL+  KL +L  +L+A+R TCPLFDTTRWV+N E +    W+ +  G
Sbjct  210  YEELAVALALDMDKLWELRKKLEASRTTCPLFDTTRWVRNWETAMLLAWSGHDGG  264



>ref|XP_010844685.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit-like [Bison bison bison]
Length=154

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  25   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  83

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
            YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  84   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  143

Query  517  --QPFKVTEN  494
              +P +VTE+
Sbjct  144  MIKPVEVTES  153



>dbj|BAD21873.1| putative O-linked N-acetyl glucosamine transferase [Oryza sativa 
Japonica Group]
 dbj|BAD21878.1| putative O-linked N-acetyl glucosamine transferase [Oryza sativa 
Japonica Group]
Length=953

 Score =   125 bits (315),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 52/80 (65%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -2

Query  718  EMIVSNVKEYEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNL  539
            ++ +  +KEYE++AV LALN  KLQ LTN+LK  RMTCPLFDT RWV+NLER+Y+KMWNL
Sbjct  871  DLFLDTMKEYEDRAVDLALNPAKLQALTNKLKEVRMTCPLFDTARWVRNLERAYYKMWNL  930

Query  538  YCCGQQPQPFKVTENDAEFP  479
            YC G+  +PFKV E+D EFP
Sbjct  931  YCSGRHREPFKVIEDDNEFP  950



>ref|WP_043995455.1| UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC (fragment) [Microcystis aeruginosa]
Length=388

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 83/123 (67%), Gaps = 1/123 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLF+DT   N HTTG+D LWAGLP++T   E   +RV GSL  A GL  E+I  N++E
Sbjct  265  LADLFIDTLYYNAHTTGSDALWAGLPIITCLGETFPSRVGGSLLTAIGL-PELITKNLEE  323

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            Y+  A++LA +  KL ++  +L   R+T PLFDT R+ +NLE++Y  MW++Y  G+ P+ 
Sbjct  324  YKNLAINLAKSPDKLHEIKQKLAQNRLTYPLFDTLRFTQNLEKAYRTMWDIYAAGKSPEM  383

Query  511  FKV  503
             ++
Sbjct  384  IRI  386



>ref|WP_043996985.1| UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC (fragment) [Microcystis aeruginosa]
Length=388

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 83/123 (67%), Gaps = 1/123 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLF+DT   N HTTG+D LWAGLP++T   E   +RV  SL  ATGL  E+I  N++E
Sbjct  265  LADLFIDTLYYNAHTTGSDALWAGLPIITCLGETFPSRVGASLLTATGL-PELITKNLEE  323

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            Y+  A++LA +  KL ++  +L   R+T PLFDT R+ +NLE++Y  MW++Y  G+ P+ 
Sbjct  324  YKNLAINLAKSPDKLHEIKQKLAQNRLTYPLFDTLRFTRNLEKAYRTMWDIYAAGKSPEM  383

Query  511  FKV  503
             ++
Sbjct  384  IRI  386



>emb|CCI32984.1| putative UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC (fragment) [Microcystis sp. T1-4]
Length=450

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 82/123 (67%), Gaps = 1/123 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDT   N HTTG+D LWAGLP++T P     +RV  SL  A GL  E+I  N++E
Sbjct  327  LADLFLDTLYYNAHTTGSDALWAGLPIITCPGATFPSRVGASLLTAIGL-PELITKNLEE  385

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            Y+  A++LA +  KL ++  +L   R+T PLFDT R+ +NLE++Y  MW++Y  G+ P+ 
Sbjct  386  YKNLAINLAKSPDKLHEIKQKLAQNRLTYPLFDTLRFTRNLEKAYRTMWDIYAAGKSPEM  445

Query  511  FKV  503
             ++
Sbjct  446  IRI  448



>emb|CCH99039.1| TPR repeat protein (modular protein) [Microcystis aeruginosa 
PCC 9717]
Length=1039

 Score =   124 bits (311),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 57/123 (46%), Positives = 82/123 (67%), Gaps = 1/123 (1%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LADLFLDT   N HTTG+D LWAGLP++T P     +RV  SL  A GL  E+I  N++E
Sbjct  916   LADLFLDTLYYNAHTTGSDALWAGLPIITCPGATFPSRVGASLLTAMGL-PELITKNLEE  974

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
             Y+  A++LA +  KL ++  +L   R+T PLFDT R+ +NLE++Y  MW++Y  G+ P+ 
Sbjct  975   YKNLAINLAKSPDKLHEIKQKLAQNRLTYPLFDTLRFTRNLEKAYRTMWDIYAAGKSPEM  1034

Query  511   FKV  503
              ++
Sbjct  1035  IRI  1037



>dbj|BAC32961.1| unnamed protein product [Mus musculus]
Length=153

 Score =   115 bits (289),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  + +E
Sbjct  24   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKSRQE  82

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
            YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  83   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  142

Query  517  --QPFKVTEN  494
              +P +VTE+
Sbjct  143  MIKPVEVTES  152



>ref|WP_016515527.1| TPR repeat-containing protein yrrB [Microcystis aeruginosa]
 gb|EPF21979.1| TPR repeat-containing protein yrrB [Microcystis aeruginosa SPC777]
 gb|EPF22069.1| TPR repeat-containing protein yrrB [Microcystis aeruginosa SPC777]
Length=711

 Score =   123 bits (308),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 83/124 (67%), Gaps = 1/124 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDT   N HTTG+D LWAGLP++T   E   +RV  SL  A GL  E+I  N++E
Sbjct  588  LADLFLDTLYYNAHTTGSDALWAGLPIITCLEETFPSRVGASLLTAIGL-PELITKNLEE  646

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            Y+  A++LA +  KLQ++  +L   R+T PLFDT R+ +NLE++Y  MW++Y  G+ P+ 
Sbjct  647  YKNLAINLAKSPHKLQEIKQKLAQNRLTYPLFDTLRFTRNLEKAYRTMWDIYAAGKSPEM  706

Query  511  FKVT  500
             ++ 
Sbjct  707  IRIA  710



>emb|CCI04721.1| TPR repeat protein (modular protein) [Microcystis aeruginosa 
PCC 9443]
Length=1040

 Score =   124 bits (310),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 57/123 (46%), Positives = 83/123 (67%), Gaps = 1/123 (1%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LADLF+DT   N HTTG+D LWAGLP++T   E   +RV  SL  ATGL  E+I  N++E
Sbjct  917   LADLFIDTLYYNAHTTGSDALWAGLPIITCLGETFPSRVGASLLTATGL-PELITKNLEE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
             Y+  A++LA +  KL ++  +L   R+T PLFDT R+ +NLE++Y  MW++Y  G+ P+ 
Sbjct  976   YKNLAINLAKSPDKLHEIKQKLAQNRLTYPLFDTLRFTRNLEKAYRTMWDIYAAGKSPEM  1035

Query  511   FKV  503
              ++
Sbjct  1036  IRI  1038



>ref|XP_006896046.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit-like isoform X2 [Elephantulus 
edwardii]
Length=1036

 Score =   123 bits (309),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTVELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPLEVTES  1035



>ref|XP_004989820.1| O-linked N-acetylglucosamine transferase [Salpingoeca rosetta]
 gb|EGD78144.1| O-linked N-acetylglucosamine transferase [Salpingoeca rosetta]
Length=1496

 Score =   124 bits (310),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/112 (54%), Positives = 77/112 (69%), Gaps = 1/112 (1%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LADL LDT  CNGHTTG D+LWAG PM+TLP + +A+RVA SL  A G   E+I S+ ++
Sbjct  1119  LADLCLDTHACNGHTTGMDILWAGTPMLTLPGDTLASRVASSLVTALGC-PELIASSRQD  1177

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLY  536
             Y  KAV L  N  KL D+ ++++ AR   PLFDT    ++LERSYF MWN Y
Sbjct  1178  YFNKAVDLCRNPRKLLDMQHKVRHARTRAPLFDTRLLTRHLERSYFAMWNNY  1229



>emb|CCI18142.1| TPR repeat protein (modular protein) [Microcystis aeruginosa 
PCC 9807]
Length=1039

 Score =   123 bits (309),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 57/123 (46%), Positives = 83/123 (67%), Gaps = 1/123 (1%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LADLF+DT   N HTTG+D LWAGLP++T   E   +RV GSL  A GL  E+I  N++E
Sbjct  916   LADLFIDTLYYNAHTTGSDALWAGLPIITCLGETFPSRVGGSLLTAIGL-PELITKNLEE  974

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
             Y+  A++LA +  KL ++  +L   R+T PLFDT R+ +NLE++Y  MW++Y  G+ P+ 
Sbjct  975   YKNLAINLAKSPDKLHEIKQKLAQNRLTYPLFDTLRFTQNLEKAYRTMWDIYAAGKSPEM  1034

Query  511   FKV  503
              ++
Sbjct  1035  IRI  1037



>ref|XP_004872711.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit-like, partial [Heterocephalus 
glaber]
Length=984

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  855  LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  913

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
            YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  914  YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  973

Query  517  --QPFKVTEN  494
              +P +VTE+
Sbjct  974  MIKPVEVTES  983



>ref|XP_004595331.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit [Ochotona princeps]
Length=1007

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  878   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  936

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  937   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  996

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  997   MIKPVEVTES  1006



>gb|ELW48655.1| UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit [Tupaia chinensis]
Length=1007

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  878   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  936

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  937   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  996

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  997   MIKPVEVTES  1006



>gb|EPY77343.1| UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
subunit isoform 1 [Camelus ferus]
Length=892

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  763  LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  821

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
            YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  822  YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  881

Query  517  --QPFKVTEN  494
              +P +VTE+
Sbjct  882  MIKPVEVTES  891



>ref|XP_007957192.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Orycteropus afer 
afer]
Length=1036

 Score =   123 bits (309),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>ref|XP_004475866.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform 2 [Dasypus novemcinctus]
Length=1036

 Score =   123 bits (309),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>ref|XP_005614319.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X4 [Equus caballus]
Length=1029

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  900   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  958

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  959   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1018

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1019  MIKPVEVTES  1028



>ref|XP_008853783.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Nannospalax galili]
Length=1046

 Score =   123 bits (309),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>ref|XP_008565770.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Galeopterus variegatus]
Length=1046

 Score =   123 bits (309),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>ref|XP_004901730.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit-like isoform X1 [Heterocephalus 
glaber]
Length=1046

 Score =   123 bits (309),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>ref|XP_003412774.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Loxodonta africana]
Length=1046

 Score =   123 bits (309),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>ref|XP_002930623.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Ailuropoda melanoleuca]
 ref|XP_004000670.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Felis catus]
 ref|XP_004396643.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform 1 [Odobenus rosmarus 
divergens]
 ref|XP_004777301.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Mustela putorius 
furo]
 ref|XP_004821764.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Mustela putorius 
furo]
 ref|XP_006749503.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Leptonychotes weddellii]
 ref|XP_008710465.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Ursus maritimus]
Length=1046

 Score =   123 bits (309),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>ref|XP_010364888.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Rhinopithecus roxellana]
 ref|XP_011798475.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Colobus angolensis 
palliatus]
Length=1036

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>ref|XP_009233248.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Pongo abelii]
Length=1036

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>ref|XP_008853784.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Nannospalax galili]
Length=1036

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>ref|XP_008565771.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Galeopterus variegatus]
Length=1036

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>ref|NP_001091539.1| UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit [Bos taurus]
 ref|XP_005900873.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Bos mutus]
 ref|XP_006050882.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Bubalus bubalis]
 gb|AAI40543.1| OGT protein [Bos taurus]
 tpg|DAA12921.1| TPA: O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl 
transferase) 
[Bos taurus]
Length=1036

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>ref|XP_007089178.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Panthera tigris altaica]
Length=1036

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>ref|XP_006158122.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Tupaia chinensis]
Length=1036

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>ref|XP_005876267.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Myotis brandtii]
 ref|XP_006082934.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Myotis lucifugus]
 ref|XP_006753520.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Myotis davidii]
 ref|XP_007990227.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Chlorocebus sabaeus]
Length=1036

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>ref|XP_004901731.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit-like isoform X2 [Heterocephalus 
glaber]
Length=1036

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>ref|XP_004716717.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Echinops telfairi]
Length=1036

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>ref|XP_003943149.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Saimiri boliviensis 
boliviensis]
Length=1036

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>ref|XP_003412775.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Loxodonta africana]
Length=1036

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>ref|XP_002930622.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Ailuropoda melanoleuca]
 ref|XP_004000671.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Felis catus]
 ref|XP_004396644.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform 2 [Odobenus rosmarus 
divergens]
 ref|XP_004777302.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Mustela putorius 
furo]
 ref|XP_004821765.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Mustela putorius 
furo]
 ref|XP_006749504.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Leptonychotes weddellii]
 ref|XP_008710466.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Ursus maritimus]
Length=1036

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>ref|XP_001493438.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoformX2 [Equus caballus]
 ref|XP_002720148.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Oryctolagus cuniculus]
 ref|XP_002763024.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Callithrix jacchus]
 ref|XP_003471043.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform 1 [Cavia porcellus]
 ref|XP_003917912.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Papio anubis]
 ref|XP_004022226.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Ovis aries]
 ref|XP_004439900.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform 2 [Ceratotherium simum 
simum]
 ref|XP_004646843.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Octodon degus]
 ref|XP_005339999.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Ictidomys tridecemlineatus]
 ref|XP_005401730.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Chinchilla lanigera]
 ref|XP_005593977.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Macaca fascicularis]
 ref|XP_005614318.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X3 [Equus caballus]
 ref|XP_005673770.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Sus scrofa]
 ref|XP_005954853.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Pantholops hodgsonii]
 ref|XP_006189855.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Camelus ferus]
 ref|XP_006217705.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Vicugna pacos]
 ref|XP_007461648.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Lipotes vexillifer]
 ref|XP_008155830.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Eptesicus fuscus]
 ref|XP_010971898.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Camelus bactrianus]
 ref|XP_010977066.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Camelus dromedarius]
 ref|XP_011847461.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Mandrillus leucophaeus]
 ref|XP_011916151.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Cercocebus atys]
 ref|XP_011731044.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Macaca nemestrina]
 ref|XP_011997692.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Ovis aries musimon]
Length=1036

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>ref|XP_010364887.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Rhinopithecus roxellana]
 ref|XP_011798474.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Colobus angolensis 
palliatus]
Length=1046

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>ref|XP_007089177.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Panthera tigris altaica]
Length=1046

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>ref|XP_005228084.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Bos taurus]
 ref|XP_005900872.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Bos mutus]
Length=1046

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>ref|XP_003943148.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Saimiri boliviensis 
boliviensis]
Length=1046

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>ref|XP_009233247.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Pongo abelii]
Length=1046

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>ref|XP_006896045.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit-like isoform X1 [Elephantulus 
edwardii]
Length=1046

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTVELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPLEVTES  1045



>ref|XP_010820151.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Bos taurus]
Length=921

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  792  LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  850

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
            YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  851  YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  910

Query  517  --QPFKVTEN  494
              +P +VTE+
Sbjct  911  MIKPVEVTES  920



>ref|XP_005700713.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit [Capra hircus]
Length=919

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  790  LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  848

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
            YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  849  YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  908

Query  517  --QPFKVTEN  494
              +P +VTE+
Sbjct  909  MIKPVEVTES  918



>gb|AAI49783.1| OGT protein [Bos taurus]
Length=908

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  779  LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  837

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
            YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  838  YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  897

Query  517  --QPFKVTEN  494
              +P +VTE+
Sbjct  898  MIKPVEVTES  907



>gb|EFB13341.1| hypothetical protein PANDA_021118, partial [Ailuropoda melanoleuca]
Length=1037

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  908   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  966

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  967   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1026

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1027  MIKPVEVTES  1036



>ref|XP_001493422.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoformX1 [Equus caballus]
 ref|XP_002720149.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Oryctolagus cuniculus]
 ref|XP_002763023.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Callithrix jacchus]
 ref|XP_003471044.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform 2 [Cavia porcellus]
 ref|XP_003917911.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Papio anubis]
 ref|XP_004022227.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Ovis aries]
 ref|XP_004439899.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform 1 [Ceratotherium simum 
simum]
 ref|XP_004646842.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Octodon degus]
 ref|XP_005339998.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Ictidomys tridecemlineatus]
 ref|XP_005401729.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Chinchilla lanigera]
 ref|XP_005593976.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Macaca fascicularis]
 ref|XP_005673769.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Sus scrofa]
 ref|XP_005954852.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Pantholops hodgsonii]
 ref|XP_006189854.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Camelus ferus]
 ref|XP_006217704.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Vicugna pacos]
 ref|XP_007461647.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Lipotes vexillifer]
 ref|XP_008155829.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Eptesicus fuscus]
 ref|XP_010971897.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Camelus bactrianus]
 ref|XP_010977065.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Camelus dromedarius]
 ref|XP_011847460.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Mandrillus leucophaeus]
 ref|XP_011916150.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Cercocebus atys]
 ref|XP_011731043.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Macaca nemestrina]
 ref|XP_011997691.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Ovis aries musimon]
 sp|P81436.2|OGT1_RABIT RecName: Full=UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit; AltName: Full=O-GlcNAc transferase 
subunit p110; AltName: Full=O-linked N-acetylglucosamine 
transferase 110 kDa subunit; Short=OGT [Oryctolagus cuniculus]
 gb|EHH60982.1| UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit [Macaca fascicularis]
Length=1046

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>ref|XP_004716716.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Echinops telfairi]
Length=1046

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>gb|ELR52744.1| UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit, partial [Bos mutus]
Length=1037

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  908   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  966

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  967   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1026

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1027  MIKPVEVTES  1036



>ref|XP_006158121.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Tupaia chinensis]
Length=1046

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>ref|XP_005876266.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Myotis brandtii]
 ref|XP_006082933.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Myotis lucifugus]
 ref|XP_006753519.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Myotis davidii]
 ref|XP_007990226.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Chlorocebus sabaeus]
 gb|ELK37988.1| UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit [Myotis davidii]
 gb|EPQ13933.1| UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit [Myotis brandtii]
Length=1046

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>ref|WP_043997209.1| UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC (fragment) [Microcystis aeruginosa]
Length=388

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 80/123 (65%), Gaps = 1/123 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDT   N HTTG+D LWAGLP++T P     +RV  SL  A GL  E+I  N++E
Sbjct  265  LADLFLDTLYYNAHTTGSDALWAGLPIITCPGATFPSRVGASLLTAIGL-PELITKNLEE  323

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            Y+  A++LA +  KL  +  +L   R+T PLFDT  + +NLE++Y  MW++Y  G+ P+ 
Sbjct  324  YKNLAINLAKSPDKLHKIKQKLAQNRLTYPLFDTLHFTRNLEKAYRTMWDIYAAGKSPEM  383

Query  511  FKV  503
             ++
Sbjct  384  IRI  386



>ref|XP_007957191.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Orycteropus afer 
afer]
Length=1046

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>ref|XP_004475865.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform 1 [Dasypus novemcinctus]
Length=1046

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>ref|WP_043999373.1| hypothetical protein [Microcystis aeruginosa]
Length=712

 Score =   122 bits (306),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 82/124 (66%), Gaps = 1/124 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDT   N HTTG+D LWAGLP++T P     +RV  SL  A GL  E+I  N++E
Sbjct  589  LADLFLDTLYYNAHTTGSDALWAGLPIITCPGATFPSRVGASLLTAMGL-PELITKNLEE  647

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            Y+  A++LA +  KL ++  +L   R+T PLFDT R+ +NLE++Y  MW++Y  G+ P+ 
Sbjct  648  YKNLAINLAKSPDKLHEIKQKLAQNRLTYPLFDTLRFTRNLEKAYRTMWDIYAAGKSPEM  707

Query  511  FKVT  500
             ++ 
Sbjct  708  IRIA  711



>ref|XP_009514691.1| hypothetical protein PHYSODRAFT_553979 [Phytophthora sojae]
 gb|EGZ27416.1| hypothetical protein PHYSODRAFT_553979 [Phytophthora sojae]
Length=986

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 64/125 (51%), Positives = 83/125 (66%), Gaps = 1/125 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDTP CN HTTG D+LW G PMVT+P ++MATRVA SL  A  +  E+I ++++E
Sbjct  823  LADLFLDTPECNAHTTGCDILWGGTPMVTMPKDRMATRVASSLLRAANM-SELITNSLEE  881

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YEE AV+LA +  +L +L  RL+  R+ CPLFDT RWV+NLE      W  +  G  P  
Sbjct  882  YEELAVALASDMDRLWELRRRLEDERLRCPLFDTERWVRNLETGLVMAWERHENGLAPDN  941

Query  511  FKVTE  497
              V +
Sbjct  942  IDVPD  946



>gb|EHB13741.1| UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit [Heterocephalus glaber]
Length=1270

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  1141  LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  1199

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  1200  YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1259

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1260  MIKPVEVTES  1269


 Score = 71.2 bits (173),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEM  713
            LAD+ LDT LCNGHTTG DVLWAG PMVT+P E +A+RVA S  +A    E++
Sbjct  868  LADVCLDTLLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQEVAEQYSEKL  920



>ref|WP_002737372.1| hypothetical protein [Microcystis aeruginosa]
 gb|ELP54715.1| TPR domain protein [Microcystis aeruginosa TAIHU98]
Length=388

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 80/123 (65%), Gaps = 1/123 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDT   N HTTG+D LWAGLP++T P     +RV  SL  A GL  E+I  N++E
Sbjct  265  LADLFLDTLYYNAHTTGSDALWAGLPIITCPGATFPSRVGASLLTAIGL-PELITKNLEE  323

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            Y+  A++LA +  KL  +  +L   R+T PLFDT  + +NLE++Y  MW++Y  G+ P+ 
Sbjct  324  YKNLAINLAKSPDKLHKIKQKLAQNRLTYPLFDTLHFTRNLEKAYRTMWDIYAAGKSPEM  383

Query  511  FKV  503
             ++
Sbjct  384  IRI  386



>ref|XP_008971796.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X4 [Pan paniscus]
Length=1013

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  884   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  942

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  943   YEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1002

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1003  MIKPVEVTES  1012



>ref|XP_008971795.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X3 [Pan paniscus]
Length=1023

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  894   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  952

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  953   YEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1012

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1013  MIKPVEVTES  1022



>ref|NP_858059.1| UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform 2 [Homo sapiens]
 ref|XP_003820180.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Pan paniscus]
 ref|XP_004064414.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform 2 [Gorilla gorilla gorilla]
 ref|XP_008069103.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Tarsius syrichta]
 gb|AAH14434.1| O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl 
transferase) 
[Homo sapiens]
 emb|CAC86127.1| UDP-N-acatylglucosamine: polypeptide-N-acetylglucosaminyl transferase 
[Homo sapiens]
 gb|EAX05287.1| O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl 
transferase), 
isoform CRA_c [Homo sapiens]
 gb|ABM84549.1| O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl 
transferase) 
[synthetic construct]
 gb|ABM87847.1| O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl 
transferase) 
[synthetic construct]
 dbj|BAH24112.1| O-linked N-acetylglucosamine (GlcNAc) transferase [synthetic 
construct]
Length=1036

 Score =   123 bits (308),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>gb|AAB63466.1| O-linked GlcNAc transferase [Homo sapiens]
 gb|AAF31458.1| HRNT1 [Homo sapiens]
 emb|CAC86129.1| UDP-N-acetylglucosamine: polypeptide-N-acetylglucosaminyl transferase 
[Homo sapiens]
 gb|EAX05285.1| O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl 
transferase), 
isoform CRA_a [Homo sapiens]
Length=920

 Score =   122 bits (307),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  791  LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  849

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
            YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  850  YEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  909

Query  517  --QPFKVTEN  494
              +P +VTE+
Sbjct  910  MIKPVEVTES  919



>ref|XP_007183689.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Balaenoptera acutorostrata 
scammoni]
Length=1036

 Score =   122 bits (307),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKRIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>ref|XP_004380198.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform 1 [Trichechus manatus 
latirostris]
Length=1046

 Score =   123 bits (308),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTVELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>ref|XP_004380199.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform 2 [Trichechus manatus 
latirostris]
Length=1036

 Score =   122 bits (307),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTVELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>ref|XP_007183688.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Balaenoptera acutorostrata 
scammoni]
Length=1046

 Score =   122 bits (307),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLKRIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>ref|XP_003281937.1| PREDICTED: LOW QUALITY PROTEIN: UDP-N-acetylglucosamine--peptide 
N-acetylglucosaminyltransferase 110 kDa subunit [Nomascus 
leucogenys]
Length=1050

 Score =   122 bits (307),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  921   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  979

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  980   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1039

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1040  MIKPVEVTES  1049



>ref|XP_007538312.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Erinaceus europaeus]
Length=1046

 Score =   122 bits (307),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLRKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>ref|XP_007538313.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Erinaceus europaeus]
Length=1036

 Score =   122 bits (307),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLRKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>ref|NP_858058.1| UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform 1 [Homo sapiens]
 ref|XP_003820179.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Pan paniscus]
 ref|XP_004064413.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform 1 [Gorilla gorilla gorilla]
 ref|XP_008069102.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Tarsius syrichta]
 sp|O15294.3|OGT1_HUMAN RecName: Full=UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit; AltName: Full=O-GlcNAc transferase 
subunit p110; AltName: Full=O-linked N-acetylglucosamine 
transferase 110 kDa subunit; Short=OGT [Homo sapiens]
 emb|CAC86128.1| UDP-N-acetylglucosamine: polypeptide-N-acetylglucosaminyl transferase 
[Homo sapiens]
 gb|AAH38180.1| O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl 
transferase) 
[Homo sapiens]
 emb|CAD89970.1| hypothetical protein [Homo sapiens]
 gb|EAX05286.1| O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl 
transferase), 
isoform CRA_b [Homo sapiens]
Length=1046

 Score =   122 bits (307),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>emb|CAD97853.1| hypothetical protein [Homo sapiens]
Length=1046

 Score =   122 bits (307),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>ref|XP_003386934.2| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit-like [Amphimedon queenslandica]
Length=1025

 Score =   122 bits (307),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 58/118 (49%), Positives = 82/118 (69%), Gaps = 1/118 (1%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG P++TLPLE +A+RVA S  ++ G   E++ S+ +E
Sbjct  905   LADMCLDTPLCNGHTTGMDVLWAGTPVLTLPLETLASRVAASQLISLGF-PELVASSRQE  963

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP  518
             YE+ AV+   N  KL+ L  R++ AR+T  LFDT ++ ++LE  +F+ W  +  G  P
Sbjct  964   YEDIAVTYGNNPAKLKALKTRVQDARLTSSLFDTKKYTQDLEGIFFRAWERHEQGLPP  1021



>ref|XP_002806323.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit [Macaca mulatta]
Length=963

 Score =   122 bits (307),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  834  LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  892

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
            YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  893  YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  952

Query  517  --QPFKVTEN  494
              +P +VTE+
Sbjct  953  MIKPVEVTES  962



>ref|XP_005401731.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X3 [Chinchilla lanigera]
Length=950

 Score =   122 bits (307),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  821  LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  879

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
            YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  880  YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  939

Query  517  --QPFKVTEN  494
              +P +VTE+
Sbjct  940  MIKPVEVTES  949



>ref|XP_010083629.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit-like [Pterocles gutturalis]
Length=187

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 84/130 (65%), Gaps = 5/130 (4%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  + +E
Sbjct  58   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKSRQE  116

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
            YE+ AV L  +   L+ +  ++   R++ PLF+T ++  +LER Y +MW+ Y  G +P  
Sbjct  117  YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTVDLERLYLQMWDHYAAGNKPDH  176

Query  517  --QPFKVTEN  494
              +P + TE+
Sbjct  177  MIKPVEATES  186



>ref|XP_009437528.1| PREDICTED: LOW QUALITY PROTEIN: UDP-N-acetylglucosamine--peptide 
N-acetylglucosaminyltransferase 110 kDa subunit [Pan troglodytes]
Length=907

 Score =   122 bits (306),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  778  LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  836

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
            YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  837  YEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  896

Query  517  --QPFKVTEN  494
              +P +VTE+
Sbjct  897  MIKPVEVTES  906



>dbj|BAG05864.1| TPR repeat protein [Microcystis aeruginosa NIES-843]
Length=631

 Score =   121 bits (303),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 82/124 (66%), Gaps = 1/124 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDT   N HTTG+D LWAGLP++T P     +RV  SL  A GL  E+I  N++E
Sbjct  508  LADLFLDTLYYNAHTTGSDALWAGLPIITCPGATFPSRVGASLLTAIGL-PELITKNLEE  566

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            Y+  A++LA +  KLQ++  +L   R+T PLFDT  + +NLE++Y  MW++Y  G+ P+ 
Sbjct  567  YKNLAINLAKSPDKLQEIKQKLAQNRLTYPLFDTLLFTRNLEKAYRTMWDIYAAGKSPEM  626

Query  511  FKVT  500
             ++ 
Sbjct  627  IRIA  630



>ref|WP_041805031.1| TPR repeat-containing protein yrrB, partial [Microcystis aeruginosa]
Length=628

 Score =   120 bits (302),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 82/124 (66%), Gaps = 1/124 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDT   N HTTG+D LWAGLP++T P     +RV  SL  A GL  E+I  N++E
Sbjct  505  LADLFLDTLYYNAHTTGSDALWAGLPIITCPGATFPSRVGASLLTAIGL-PELITKNLEE  563

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            Y+  A++LA +  KLQ++  +L   R+T PLFDT  + +NLE++Y  MW++Y  G+ P+ 
Sbjct  564  YKNLAINLAKSPDKLQEIKQKLAQNRLTYPLFDTLLFTRNLEKAYRTMWDIYAAGKSPEM  623

Query  511  FKVT  500
             ++ 
Sbjct  624  IRIA  627



>ref|XP_003774996.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit [Sarcophilus harrisii]
Length=1075

 Score =   122 bits (306),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  946   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  1004

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW+ Y  G +P  
Sbjct  1005  YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWDHYAAGNKPDH  1064

Query  517   --QPFKVTEN  494
               +P + TE+
Sbjct  1065  MIKPVEATES  1074



>gb|AEB61122.1| UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kda subunit-like protein, partial [Equus caballus]
Length=313

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  184  LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  242

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
            YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  243  YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  302

Query  517  --QPFKVTEN  494
              +P +VTE+
Sbjct  303  MIKPVEVTES  312



>ref|XP_001362317.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit [Monodelphis domestica]
Length=1035

 Score =   122 bits (305),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  906   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  964

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW+ Y  G +P  
Sbjct  965   YEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMELERLYLQMWDHYAAGNKPDH  1024

Query  517   --QPFKVTEN  494
               +P + TE+
Sbjct  1025  MIKPVEATES  1034



>ref|XP_849392.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoformX2 [Canis lupus familiaris]
Length=1046

 Score =   122 bits (305),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N ++
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQD  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>ref|XP_538075.2| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoformX1 [Canis lupus familiaris]
Length=1036

 Score =   122 bits (305),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N ++
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQD  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>gb|AHB47810.1| hypothetical protein W911_04315 [Hyphomicrobium nitrativorans 
NL23]
Length=1094

 Score =   122 bits (305),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 82/126 (65%), Gaps = 1/126 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             ADLFLDT  CN HTT +D LWAGLP++T   E  A RVA SL  A  L +E+I  +V +
Sbjct  695  FADLFLDTAPCNAHTTASDALWAGLPVLTSLGETFAGRVAASLLSAMEL-DELIARDVHD  753

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            YE  A+ LA +R +L  +  ++ A R T PLFD+TR+ KNLERSY  M ++   G+ P+P
Sbjct  754  YERIALQLAGDRGRLDTIRRKIAAVRDTSPLFDSTRYTKNLERSYETMVDIMRNGEAPRP  813

Query  511  FKVTEN  494
            F V E+
Sbjct  814  FTVAED  819



>ref|NP_001034837.1| UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit [Sus scrofa]
 sp|Q27HV0.1|OGT1_PIG RecName: Full=UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit; AltName: Full=O-GlcNAc transferase 
subunit p110; AltName: Full=O-linked N-acetylglucosamine 
transferase 110 kDa subunit; Short=OGT [Sus scrofa]
 gb|ABD61726.1| O-linked N-acetylglucosamine transferase [Sus scrofa]
Length=1046

 Score =   121 bits (304),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             +E+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   FEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>dbj|BAQ64644.1| TPR domain protein [Geminocystis sp. NIES-3709]
Length=916

 Score =   121 bits (304),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 60/127 (47%), Positives = 88/127 (69%), Gaps = 4/127 (3%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLF+DT  CN HTT +D LWAGLP++T   E  ATRVA SL  A GL  E+I +N+++
Sbjct  791  LADLFIDTLYCNAHTTASDCLWAGLPLITWQGETFATRVASSLLTAIGL-PELITTNLED  849

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            Y++ A++LA +  KLQ +  +L   R+T PLFDT  + ++LE++Y KMW++Y   +Q +P
Sbjct  850  YQKLAITLARSSRKLQAIKKKLAKNRLTYPLFDTPVFTRHLEKAYQKMWDIY---EQQKP  906

Query  511  FKVTEND  491
             ++ E D
Sbjct  907  PEMIEID  913



>emb|CEI97390.1| Putative Family 41 glycosyltransferase (Fragment) [Rhizopus microsporus]
Length=1112

 Score =   121 bits (304),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 62/137 (45%), Positives = 81/137 (59%), Gaps = 20/137 (15%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLP--LEKMATRVAGSLCLATGLGEEMIVSNV  698
             +AD+FLDTP CN HTT  D+LW+G P+VT P  L KM +RV  S+ +ATG GEEMIV++ 
Sbjct  946   VADIFLDTPECNAHTTAADILWSGTPIVTYPKYLHKMCSRVGASIAMATGYGEEMIVTDE  1005

Query  697   KEYEEKAVSLALNRT------------------KLQDLTNRLKAARMTCPLFDTTRWVKN  572
             ++YE KAV LAL+ T                  KL DL  RL   R    LFDT RW +N
Sbjct  1006  QQYEAKAVELALSLTYTYTPAPGSNIIQRRGHGKLMDLRKRLFLTREHSRLFDTLRWTQN  1065

Query  571   LERSYFKMWNLYCCGQQ  521
             LE+ Y + W  +   ++
Sbjct  1066  LEKGYDEAWRRWVTAEE  1082



>ref|XP_006981186.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Peromyscus maniculatus 
bairdii]
Length=1036

 Score =   121 bits (303),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  + +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKSRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>ref|NP_001277464.1| UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform 2 [Mus musculus]
 ref|XP_011245805.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Mus musculus]
 gb|EDL14137.1| O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl 
transferase), 
isoform CRA_a [Mus musculus]
Length=1036

 Score =   121 bits (303),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  + +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKSRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>ref|XP_004694538.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Condylura cristata]
Length=1046

 Score =   121 bits (303),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  + +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKSRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>ref|XP_006908605.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Pteropus alecto]
 ref|XP_011369721.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Pteropus vampyrus]
 gb|ELK15671.1| UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit [Pteropus alecto]
Length=1046

 Score =   121 bits (303),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  + +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKSRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>ref|XP_003513433.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Cricetulus griseus]
Length=1046

 Score =   121 bits (303),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  + +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKSRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>ref|XP_007632585.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Cricetulus griseus]
Length=1036

 Score =   121 bits (303),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  + +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKSRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>ref|XP_007651875.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Cricetulus griseus]
Length=1036

 Score =   121 bits (303),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  + +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKSRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>ref|XP_006908606.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Pteropus alecto]
 ref|XP_011369722.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Pteropus vampyrus]
Length=1036

 Score =   121 bits (303),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  + +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKSRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>ref|XP_005358618.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Microtus ochrogaster]
Length=1036

 Score =   121 bits (303),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  + +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKSRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>ref|XP_004694539.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X2 [Condylura cristata]
Length=1036

 Score =   121 bits (303),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  + +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKSRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>sp|P56558.1|OGT1_RAT RecName: Full=UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit; AltName: Full=O-GlcNAc transferase 
subunit p110; AltName: Full=O-linked N-acetylglucosamine 
transferase 110 kDa subunit; Short=OGT [Rattus norvegicus]
 gb|AAC53121.1| O-GlcNAc transferase, p110 subunit [Rattus norvegicus]
Length=1036

 Score =   121 bits (303),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  + +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKSRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>ref|XP_009512588.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit-like [Phalacrocorax carbo]
Length=187

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 84/130 (65%), Gaps = 5/130 (4%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  + +E
Sbjct  58   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKSRQE  116

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
            YE+ AV L  +   L+ +  ++   R++ PLF+T ++  +LER Y +MW+ Y  G +P  
Sbjct  117  YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMDLERLYLQMWDHYAAGNKPDH  176

Query  517  --QPFKVTEN  494
              +P + +E+
Sbjct  177  MIKPVEASES  186



>ref|XP_011369723.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X3 [Pteropus vampyrus]
Length=919

 Score =   120 bits (302),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  + +E
Sbjct  790  LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKSRQE  848

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
            YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  849  YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  908

Query  517  --QPFKVTEN  494
              +P +VTE+
Sbjct  909  MIKPVEVTES  918



>ref|XP_004275794.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform 2 [Orcinus orca]
Length=1036

 Score =   121 bits (303),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 82/130 (63%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLW+G PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWSGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R + PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRTSSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>ref|XP_004275793.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform 1 [Orcinus orca]
Length=1046

 Score =   121 bits (303),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 82/130 (63%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLW+G PMVT+P E +A+RVA S     G   E+I  N +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWSGTPMVTMPGETLASRVAASQLTCLGC-LELIAKNRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R + PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLKKIRGKVWKQRTSSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>ref|XP_005358617.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Microtus ochrogaster]
Length=1046

 Score =   121 bits (303),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  + +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKSRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>gb|EMC78787.1| UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit, partial [Columba livia]
Length=1036

 Score =   121 bits (303),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 59/130 (45%), Positives = 84/130 (65%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  + +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKSRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++  +LER Y +MW+ Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTTDLERLYLQMWDHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P + TE+
Sbjct  1026  MIKPVEATES  1035



>ref|WP_036386961.1| UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
SEC (fragment) [Microcystis aeruginosa]
Length=388

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 81/123 (66%), Gaps = 1/123 (1%)
 Frame = -2

Query  871  LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
            LADLFLDT   N HTTG+D LWAGLP++T   E   +RV  SL  A GL  E+I  N++E
Sbjct  265  LADLFLDTLYYNAHTTGSDALWAGLPIITCLEETFPSRVGASLLTAIGL-PELITKNLEE  323

Query  691  YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
            Y+  A++LA +  KL ++  +L   R+T PLFDT  + +NLE++Y  MW++Y  G+ P+ 
Sbjct  324  YKNLAINLAKSPDKLHEIKQKLAQNRLTYPLFDTLLFTRNLEKAYRTMWDIYAAGKSPEM  383

Query  511  FKV  503
             ++
Sbjct  384  IRI  386



>ref|NP_058803.2| UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit [Rattus norvegicus]
 ref|XP_006257120.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Rattus norvegicus]
 gb|EDL95887.1| O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl 
transferase), 
isoform CRA_b [Rattus norvegicus]
 gb|EDL95888.1| O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl 
transferase), 
isoform CRA_b [Rattus norvegicus]
Length=1036

 Score =   121 bits (303),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  + +E
Sbjct  907   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKSRQE  965

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  966   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1025

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1026  MIKPVEVTES  1035



>ref|XP_007632584.1| PREDICTED: UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 
110 kDa subunit isoform X1 [Cricetulus griseus]
Length=1046

 Score =   121 bits (303),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 60/130 (46%), Positives = 83/130 (64%), Gaps = 5/130 (4%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LAD+ LDTPLCNGHTTG DVLWAG PMVT+P E +A+RVA S     G   E+I  + +E
Sbjct  917   LADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVAASQLTCLGC-LELIAKSRQE  975

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQP--  518
             YE+ AV L  +   L+ +  ++   R++ PLF+T ++   LER Y +MW  Y  G +P  
Sbjct  976   YEDIAVKLGTDLEYLKKIRGKVWKQRISSPLFNTKQYTMELERLYLQMWEHYAAGNKPDH  1035

Query  517   --QPFKVTEN  494
               +P +VTE+
Sbjct  1036  MIKPVEVTES  1045



>emb|CCI09797.1| TPR repeat protein (modular protein) [Microcystis aeruginosa 
PCC 7941]
Length=1038

 Score =   121 bits (303),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 56/123 (46%), Positives = 80/123 (65%), Gaps = 1/123 (1%)
 Frame = -2

Query  871   LADLFLDTPLCNGHTTGTDVLWAGLPMVTLPLEKMATRVAGSLCLATGLGEEMIVSNVKE  692
             LADLFLDT   N HTTG+D LWAGLP++T P     +RV  SL  A GL  E+I  N++E
Sbjct  915   LADLFLDTLYYNAHTTGSDALWAGLPIITCPGATFPSRVGASLLTAIGL-PELITKNLEE  973

Query  691   YEEKAVSLALNRTKLQDLTNRLKAARMTCPLFDTTRWVKNLERSYFKMWNLYCCGQQPQP  512
             Y+  A++LA +  KL  +  +L   R+T PLFDT  + +NLE++Y  MW++Y  G+ P+ 
Sbjct  974   YKNLAINLAKSPDKLHKIKQKLAQNRLTYPLFDTLHFTRNLEKAYRTMWDIYAAGKSPEM  1033

Query  511   FKV  503
              ++
Sbjct  1034  IRI  1036



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1991073159785