BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig14087

Length=902
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006353432.1|  PREDICTED: uncharacterized protein LOC102583...    327   4e-101   Solanum tuberosum [potatoes]
ref|XP_004240914.1|  PREDICTED: uncharacterized protein LOC101246145    326   8e-101   Solanum lycopersicum
emb|CDP13987.1|  unnamed protein product                                318   1e-99    Coffea canephora [robusta coffee]
ref|XP_009587726.1|  PREDICTED: uncharacterized protein LOC104085415    323   2e-99    Nicotiana tomentosiformis
ref|XP_009799471.1|  PREDICTED: uncharacterized protein LOC104245548    317   2e-97    Nicotiana sylvestris
ref|XP_007163566.1|  hypothetical protein PHAVU_001G2449001g            289   4e-94    Phaseolus vulgaris [French bean]
ref|XP_009369204.1|  PREDICTED: uncharacterized protein LOC103958637    307   2e-93    Pyrus x bretschneideri [bai li]
ref|XP_008369281.1|  PREDICTED: uncharacterized protein LOC103432852    305   5e-93    Malus domestica [apple tree]
ref|XP_011084880.1|  PREDICTED: uncharacterized protein LOC105167...    303   7e-92    Sesamum indicum [beniseed]
ref|XP_011084881.1|  PREDICTED: uncharacterized protein LOC105167...    302   7e-92    Sesamum indicum [beniseed]
ref|XP_010658247.1|  PREDICTED: uncharacterized protein LOC100241...    302   1e-91    Vitis vinifera
ref|XP_002273020.1|  PREDICTED: uncharacterized protein LOC100241...    302   1e-91    Vitis vinifera
ref|XP_010658245.1|  PREDICTED: uncharacterized protein LOC100241...    302   1e-91    Vitis vinifera
ref|XP_010658246.1|  PREDICTED: uncharacterized protein LOC100241...    302   1e-91    Vitis vinifera
gb|KHN31294.1|  hypothetical protein glysoja_022948                     298   1e-91    Glycine soja [wild soybean]
emb|CAN60362.1|  hypothetical protein VITISV_024684                     301   1e-91    Vitis vinifera
ref|XP_010257084.1|  PREDICTED: uncharacterized protein LOC104597...    300   5e-91    Nelumbo nucifera [Indian lotus]
gb|KHN04776.1|  hypothetical protein glysoja_031876                     298   5e-91    Glycine soja [wild soybean]
ref|XP_002315147.1|  hypothetical protein POPTR_0010s19320g             300   6e-91    Populus trichocarpa [western balsam poplar]
gb|EYU43434.1|  hypothetical protein MIMGU_mgv1a001986mg                297   7e-91    Erythranthe guttata [common monkey flower]
ref|XP_003552278.1|  PREDICTED: uncharacterized protein LOC100788...    300   9e-91    Glycine max [soybeans]
ref|XP_006601947.1|  PREDICTED: uncharacterized protein LOC100788...    299   9e-91    Glycine max [soybeans]
ref|XP_006591388.1|  PREDICTED: uncharacterized protein LOC100804...    298   1e-90    Glycine max [soybeans]
gb|KDO68907.1|  hypothetical protein CISIN_1g002690mg                   291   1e-90    Citrus sinensis [apfelsine]
ref|XP_003538476.2|  PREDICTED: uncharacterized protein LOC100804...    299   2e-90    Glycine max [soybeans]
ref|XP_006435779.1|  hypothetical protein CICLE_v10030686mg             298   5e-90    Citrus clementina [clementine]
gb|KGN45802.1|  hypothetical protein Csa_6G012270                       293   5e-90    Cucumis sativus [cucumbers]
gb|KDO68906.1|  hypothetical protein CISIN_1g002690mg                   291   6e-90    Citrus sinensis [apfelsine]
ref|XP_011035907.1|  PREDICTED: uncharacterized protein LOC105133...    296   1e-89    Populus euphratica
ref|XP_011035906.1|  PREDICTED: uncharacterized protein LOC105133...    296   2e-89    Populus euphratica
ref|XP_010105429.1|  UDP-sugar pyrophospharylase                        291   4e-89    
ref|XP_006353433.1|  PREDICTED: uncharacterized protein LOC102583...    294   6e-89    
ref|XP_012086982.1|  PREDICTED: uncharacterized protein LOC105645861    295   9e-89    Jatropha curcas
ref|XP_007219560.1|  hypothetical protein PRUPE_ppa001281mg             293   2e-88    Prunus persica
gb|KDO68901.1|  hypothetical protein CISIN_1g002690mg                   293   2e-88    Citrus sinensis [apfelsine]
ref|XP_004500507.1|  PREDICTED: uncharacterized protein LOC101505226    293   3e-88    
gb|KDO68900.1|  hypothetical protein CISIN_1g002690mg                   293   3e-88    Citrus sinensis [apfelsine]
ref|XP_004138414.2|  PREDICTED: uncharacterized protein LOC101221986    293   4e-88    Cucumis sativus [cucumbers]
ref|XP_002528323.1|  conserved hypothetical protein                     293   5e-88    Ricinus communis
ref|XP_009386480.1|  PREDICTED: uncharacterized protein LOC103973588    291   9e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008233789.1|  PREDICTED: uncharacterized protein LOC103332812    291   1e-87    Prunus mume [ume]
ref|XP_010257085.1|  PREDICTED: uncharacterized protein LOC104597...    290   3e-87    Nelumbo nucifera [Indian lotus]
ref|XP_008441479.1|  PREDICTED: UDP-sugar pyrophosphorylase             290   5e-87    Cucumis melo [Oriental melon]
ref|XP_010031181.1|  PREDICTED: uncharacterized protein LOC104421052    290   6e-87    Eucalyptus grandis [rose gum]
gb|KCW50445.1|  hypothetical protein EUGRSUZ_J00183                     290   9e-87    Eucalyptus grandis [rose gum]
ref|XP_004307650.1|  PREDICTED: uncharacterized protein LOC101304420    286   8e-86    Fragaria vesca subsp. vesca
gb|KEH34804.1|  UDP-glucose pyrophosphorylase                           285   2e-85    Medicago truncatula
ref|XP_003600957.1|  hypothetical protein MTR_3g071440                  285   2e-85    Medicago truncatula
gb|KDO68902.1|  hypothetical protein CISIN_1g002690mg                   285   3e-85    Citrus sinensis [apfelsine]
gb|KJB74378.1|  hypothetical protein B456_011G291300                    284   5e-85    Gossypium raimondii
ref|XP_007008906.1|  UDP-glucose pyrophosphorylase 3 isoform 3          282   3e-84    
gb|KHG20503.1|  UDP-sugar pyrophospharylase                             281   1e-83    Gossypium arboreum [tree cotton]
ref|XP_010693077.1|  PREDICTED: uncharacterized protein LOC104906066    278   2e-82    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008811681.1|  PREDICTED: uncharacterized protein LOC103722...    275   9e-82    
ref|XP_010427407.1|  PREDICTED: uncharacterized protein LOC104712252    260   2e-81    Camelina sativa [gold-of-pleasure]
ref|XP_010907871.1|  PREDICTED: uncharacterized protein LOC105034415    275   2e-81    Elaeis guineensis
ref|XP_008811677.1|  PREDICTED: uncharacterized protein LOC103722...    275   2e-81    
ref|XP_006655397.1|  PREDICTED: UDP-sugar pyrophosphorylase-like        269   1e-79    Oryza brachyantha
ref|XP_006403031.1|  hypothetical protein EUTSA_v10005783mg             269   3e-79    Eutrema salsugineum [saltwater cress]
ref|XP_008656382.1|  PREDICTED: uncharacterized protein LOC103635...    268   7e-79    Zea mays [maize]
emb|CAB87858.1|  putative protein                                       267   1e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010554677.1|  PREDICTED: uncharacterized protein LOC104824329    267   1e-78    Tarenaya hassleriana [spider flower]
ref|NP_567031.1|  UDP-glucose pyrophosphorylase 3                       267   1e-78    Arabidopsis thaliana [mouse-ear cress]
gb|KFK34847.1|  hypothetical protein AALP_AA5G200800                    266   2e-78    Arabis alpina [alpine rockcress]
gb|EMS56381.1|  hypothetical protein TRIUR3_23522                       261   4e-78    Triticum urartu
ref|XP_010536381.1|  PREDICTED: uncharacterized protein LOC104811372    266   4e-78    Tarenaya hassleriana [spider flower]
ref|XP_009116297.1|  PREDICTED: uncharacterized protein LOC103841...    265   6e-78    Brassica rapa
ref|XP_009116298.1|  PREDICTED: uncharacterized protein LOC103841...    265   6e-78    Brassica rapa
emb|CDY66808.1|  BnaA09g55090D                                          265   9e-78    Brassica napus [oilseed rape]
ref|XP_002878057.1|  hypothetical protein ARALYDRAFT_486043             264   2e-77    
ref|XP_006403032.1|  hypothetical protein EUTSA_v10005783mg             264   2e-77    Eutrema salsugineum [saltwater cress]
ref|XP_010516200.1|  PREDICTED: uncharacterized protein LOC104791893    263   4e-77    Camelina sativa [gold-of-pleasure]
emb|CDX72178.1|  BnaC08g26960D                                          262   1e-76    
ref|XP_010427408.1|  PREDICTED: uncharacterized protein LOC104712253    261   2e-76    Camelina sativa [gold-of-pleasure]
gb|AAT47007.1|  unknown protein                                         260   2e-76    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ85276.1|  predicted protein                                      259   6e-76    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006292431.1|  hypothetical protein CARUB_v10018646mg             260   6e-76    Capsella rubella
ref|XP_003566160.2|  PREDICTED: UDP-sugar pyrophosphorylase             259   7e-76    Brachypodium distachyon [annual false brome]
gb|EEE64040.1|  hypothetical protein OsJ_18869                          261   9e-76    Oryza sativa Japonica Group [Japonica rice]
gb|AFW82285.1|  hypothetical protein ZEAMMB73_228026                    260   9e-76    
gb|EEC79378.1|  hypothetical protein OsI_20285                          258   2e-75    Oryza sativa Indica Group [Indian rice]
gb|ERN08982.1|  hypothetical protein AMTR_s00153p00036670               255   4e-74    Amborella trichopoda
ref|XP_011624475.1|  PREDICTED: uncharacterized protein LOC18437115     255   4e-74    Amborella trichopoda
ref|XP_010504480.1|  PREDICTED: uncharacterized protein LOC104781...    253   2e-73    Camelina sativa [gold-of-pleasure]
ref|XP_010504481.1|  PREDICTED: uncharacterized protein LOC104781...    253   2e-73    Camelina sativa [gold-of-pleasure]
gb|KDO68903.1|  hypothetical protein CISIN_1g002690mg                   252   3e-73    Citrus sinensis [apfelsine]
ref|XP_010257086.1|  PREDICTED: uncharacterized protein LOC104597...    252   3e-73    Nelumbo nucifera [Indian lotus]
ref|XP_008811680.1|  PREDICTED: uncharacterized protein LOC103722...    247   2e-71    
ref|NP_001055800.2|  Os05g0468600                                       246   4e-71    
ref|XP_007008905.1|  UDP-glucose pyrophosphorylase 3 isoform 2          245   9e-71    
ref|XP_008354177.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    215   2e-60    
gb|KDO68904.1|  hypothetical protein CISIN_1g002690mg                   211   2e-58    Citrus sinensis [apfelsine]
ref|XP_007008904.1|  UDP-glucose pyrophosphorylase 3 isoform 1          209   8e-58    
gb|KJB74379.1|  hypothetical protein B456_011G291300                    207   5e-57    Gossypium raimondii
ref|XP_007008907.1|  UDP-glucose pyrophosphorylase 3 isoform 4          204   3e-56    
ref|XP_008656383.1|  PREDICTED: uncharacterized protein LOC103635...    202   2e-55    
ref|XP_002988988.1|  hypothetical protein SELMODRAFT_159835             179   2e-47    
ref|XP_002975099.1|  hypothetical protein SELMODRAFT_150184             177   7e-47    
gb|EPS73539.1|  hypothetical protein M569_01218                         164   8e-47    Genlisea aurea
ref|XP_002949328.1|  hypothetical protein VOLCADRAFT_59132              158   5e-40    Volvox carteri f. nagariensis
emb|CCB89762.1|  putative uncharacterized protein                       150   6e-37    Simkania negevensis Z
ref|WP_041419450.1|  hypothetical protein                               146   3e-36    
ref|XP_011402066.1|  hypothetical protein F751_6536                     135   1e-32    Auxenochlorella protothecoides
ref|WP_006340614.1|  hypothetical protein                               134   2e-31    Parachlamydia acanthamoebae
ref|XP_007515057.1|  predicted protein                                  134   3e-31    Bathycoccus prasinos
ref|XP_003057529.1|  predicted protein                                  132   1e-30    Micromonas pusilla CCMP1545
ref|WP_013924194.1|  hypothetical protein                               132   1e-30    Parachlamydia acanthamoebae
gb|KIA76347.1|  hypothetical protein DB43_AK00070                       132   1e-30    Parachlamydia acanthamoebae
ref|XP_003082504.1|  unnamed protein product                            131   2e-30    
emb|CEG00018.1|  UTP--glucose-1-phosphate uridylyltransferase           131   2e-30    Ostreococcus tauri
ref|XP_001420890.1|  predicted protein                                  130   4e-30    Ostreococcus lucimarinus CCE9901
ref|XP_002502005.1|  predicted protein                                  124   1e-28    Micromonas commoda
gb|KIC73590.1|  hypothetical protein DB44_BC00180                       122   4e-27    Candidatus Protochlamydia amoebophila
emb|CAF23048.1|  hypothetical protein pc0324                            122   4e-27    Candidatus Protochlamydia amoebophila UWE25
ref|WP_044045343.1|  hypothetical protein                               122   4e-27    
ref|WP_039356565.1|  hypothetical protein                               121   4e-27    
ref|WP_042282241.1|  hypothetical protein                               121   6e-27    
ref|WP_042103582.1|  hypothetical protein                               119   4e-26    
gb|KIC75402.1|  hypothetical protein DB42_AC00080                       116   3e-25    Neochlamydia sp. EPS4
ref|WP_044881648.1|  hypothetical protein                               116   3e-25    
gb|KIC72534.1|  hypothetical protein DB41_KJ00090                       116   3e-25    Neochlamydia sp. TUME1
ref|WP_039386373.1|  hypothetical protein                               116   3e-25    
ref|WP_042240571.1|  hypothetical protein                               116   3e-25    
emb|CDZ79581.1|  hypothetical protein BN1013_00075                      114   1e-24    Candidatus Rubidus massiliensis
gb|AAY31019.1|  low photochemical bleaching 1 protein                   114   2e-24    Chlamydomonas reinhardtii
gb|AAY31018.1|  low photochemical bleaching 1 protein                   114   2e-24    Chlamydomonas reinhardtii
ref|WP_032125914.1|  hypothetical protein                               113   3e-24    
gb|EKE08140.1|  hypothetical protein ACD_17C00324G0001                  105   5e-24    uncultured bacterium
gb|KJB74377.1|  hypothetical protein B456_011G291300                    109   6e-23    Gossypium raimondii
emb|CDR34196.1|  Conserved hypothetical protein                         107   4e-22    Criblamydia sequanensis CRIB-18
ref|WP_041017774.1|  hypothetical protein                               107   4e-22    
ref|XP_005850851.1|  hypothetical protein CHLNCDRAFT_140453             101   6e-21    Chlorella variabilis
ref|XP_005651201.1|  nucleotide-diphospho-sugar transferase             102   3e-20    Coccomyxa subellipsoidea C-169
gb|EKE21602.1|  hypothetical protein ACD_7C00172G0003                 89.0    6e-17    uncultured bacterium
gb|ADI37750.1|  conserved hypothetical protein                        79.7    3e-13    Waddlia chondrophila WSU 86-1044
ref|WP_041941704.1|  hypothetical protein                             79.3    4e-13    
ref|XP_011084882.1|  PREDICTED: uncharacterized protein LOC105167...  77.8    1e-12    Sesamum indicum [beniseed]



>ref|XP_006353432.1| PREDICTED: uncharacterized protein LOC102583756 isoform X1 [Solanum 
tuberosum]
Length=870

 Score =   327 bits (838),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKFH GSIS GSELQIEVAEF WRDVQLDGSLIILAENV+GS  
Sbjct  686  LILLHPALGPLWEVTRQKFHRGSISRGSELQIEVAEFLWRDVQLDGSLIILAENVLGSPR  745

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++ENGETVL YGKRC RCKL+NVK+LNDGIDWN+R+NLYWKHDV RFE+VKVILHGNAEF
Sbjct  746  IDENGETVLHYGKRCGRCKLENVKILNDGIDWNARENLYWKHDVQRFEAVKVILHGNAEF  805

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA+DVILQGNHVFEVPDGYKMKIT G+SG  V+L  IEN+ M+SG+WFWNYKIMG H+QL
Sbjct  806  EAVDVILQGNHVFEVPDGYKMKITTGDSGLAVELKPIENKLMESGSWFWNYKIMGNHVQL  865

Query  361  ELV  353
            ELV
Sbjct  866  ELV  868



>ref|XP_004240914.1| PREDICTED: uncharacterized protein LOC101246145 [Solanum lycopersicum]
Length=867

 Score =   326 bits (836),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEVIRQKF+ GSIS+GSEL IEVAEF WRDVQLDGSLIILAENV+GS  
Sbjct  683  LILLHPALGPLWEVIRQKFYRGSISKGSELLIEVAEFLWRDVQLDGSLIILAENVLGSPR  742

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++ENGETVL YGKRC RCKL+NVK+LNDGIDWN+R+NLYWKHDV RFE+VKVILHGNAEF
Sbjct  743  IDENGETVLHYGKRCGRCKLENVKILNDGIDWNARENLYWKHDVQRFEAVKVILHGNAEF  802

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA+DVILQGNHVFEVPDGYKMKIT G+SG  V+L  IEN+ M+SG+WFWNYKIMG H+QL
Sbjct  803  EAVDVILQGNHVFEVPDGYKMKITTGDSGLAVELKPIENKLMESGSWFWNYKIMGNHVQL  862

Query  361  ELVE  350
            ELVE
Sbjct  863  ELVE  866



>emb|CDP13987.1| unnamed protein product [Coffea canephora]
Length=651

 Score =   318 bits (814),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKFHGGSIS GSELQ+EVAEF WRDVQL GSLIILAEN+MGS +
Sbjct  467  LILLHPALGPLWEVTRQKFHGGSISMGSELQVEVAEFVWRDVQLHGSLIILAENIMGSMI  526

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +NENGETVLQYGKRC RCKL+NVKV+N GIDWNS DNLYWKHDV R E+VKVILHGNAEF
Sbjct  527  INENGETVLQYGKRCGRCKLENVKVVNKGIDWNSGDNLYWKHDVDRIEAVKVILHGNAEF  586

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EAMDV LQGNH+FEVPDGY+M++T G SG +VQL AIE + ++SG+WFW+YKI GTHIQL
Sbjct  587  EAMDVTLQGNHLFEVPDGYRMRVTSGKSGLQVQLRAIEEKWVESGSWFWSYKIEGTHIQL  646

Query  361  ELVE  350
            ELVE
Sbjct  647  ELVE  650



>ref|XP_009587726.1| PREDICTED: uncharacterized protein LOC104085415 [Nicotiana tomentosiformis]
Length=871

 Score =   323 bits (827),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKFH GSIS GSELQIEVAEF WRDVQLDGSLIILAEN++GST 
Sbjct  687  LILLHPALGPLWEVTRQKFHRGSISRGSELQIEVAEFLWRDVQLDGSLIILAENILGSTT  746

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++ENGET+LQYGKRC RCKL+NVK+LNDGI+WNS++NLYWKHDV RFE+VKVILHGNAEF
Sbjct  747  IDENGETILQYGKRCGRCKLENVKILNDGINWNSKENLYWKHDVERFEAVKVILHGNAEF  806

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV+LQGNHVFEVP+GYKMKIT G+SG  V+L  IE + M+ G+WFWNYKIMG H+QL
Sbjct  807  EAADVMLQGNHVFEVPNGYKMKITTGDSGLAVELKPIEKKLMECGSWFWNYKIMGKHVQL  866

Query  361  ELVE  350
            ELVE
Sbjct  867  ELVE  870



>ref|XP_009799471.1| PREDICTED: uncharacterized protein LOC104245548 [Nicotiana sylvestris]
Length=875

 Score =   317 bits (813),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPA+GPLWEV RQKF+ GSIS GSELQIEVAEF WRDVQLDGSLIILAEN++GST 
Sbjct  691  LILLHPAVGPLWEVTRQKFYRGSISRGSELQIEVAEFLWRDVQLDGSLIILAENILGSTT  750

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++ENGET+LQYGKRC RCKL+NVK+LNDGI+WNS++NLYWKHDV RFE+V V+LHGNAEF
Sbjct  751  IDENGETILQYGKRCGRCKLENVKILNDGINWNSKENLYWKHDVQRFEAVNVLLHGNAEF  810

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV+LQGNHVFEVP+GYKMKIT G+SG  V+L  IE + M+ G+WFWNYKIMG H+QL
Sbjct  811  EAADVVLQGNHVFEVPNGYKMKITTGDSGLAVELKPIEKKLMECGSWFWNYKIMGKHVQL  870

Query  361  ELVE  350
            ELVE
Sbjct  871  ELVE  874



>ref|XP_007163566.1| hypothetical protein PHAVU_001G2449001g, partial [Phaseolus vulgaris]
 gb|ESW35560.1| hypothetical protein PHAVU_001G2449001g, partial [Phaseolus vulgaris]
Length=199

 Score =   289 bits (739),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV +QKF+GGS+SEGSELQIEVAEF+WR+VQL+GSLII+AENVMGS  
Sbjct  15   LILLHPALGPLWEVTKQKFYGGSVSEGSELQIEVAEFFWRNVQLNGSLIIIAENVMGSMK  74

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +NE+GE++L YG+RC +CKL+NVKVLN GIDWN   N+YWKHDV R E +++ILHGNAEF
Sbjct  75   INESGESILHYGQRCGKCKLQNVKVLNKGIDWNCGRNIYWKHDVQRSEMLQIILHGNAEF  134

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV+LQGNHVFEVPDG+++KI PG+ G  +QL+ I+   M+SG+W WNY++ G+H+QL
Sbjct  135  EATDVVLQGNHVFEVPDGHRLKIMPGSPGLAIQLDPIDQDRMESGSWHWNYRVQGSHVQL  194

Query  361  ELVES  347
            +LVES
Sbjct  195  DLVES  199



>ref|XP_009369204.1| PREDICTED: uncharacterized protein LOC103958637 [Pyrus x bretschneideri]
Length=871

 Score =   307 bits (786),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF+GGS+SEGSELQ+EVAEF WR+VQLDGSL++ A+NVMGST 
Sbjct  687  LILLHPALGPLWEVTRQKFYGGSVSEGSELQVEVAEFLWRNVQLDGSLLVEADNVMGSTR  746

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +++NGE +LQYG RC RCKL+NVKVLNDGIDWN  DN+YWKHDV R E+ KV+LHGNAEF
Sbjct  747  IDQNGEPILQYGHRCGRCKLQNVKVLNDGIDWNFEDNVYWKHDVQRLEACKVVLHGNAEF  806

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DVILQGNH FEVP+GYKMKIT G+SG   +L+ IE   MDSG+WFW Y+I GTHIQL
Sbjct  807  EATDVILQGNHTFEVPNGYKMKITAGDSGLATRLDPIEQNMMDSGSWFWEYRIKGTHIQL  866

Query  361  ELVE  350
            ELVE
Sbjct  867  ELVE  870



>ref|XP_008369281.1| PREDICTED: uncharacterized protein LOC103432852 [Malus domestica]
Length=872

 Score =   305 bits (782),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF+GGS+SEGSELQ+EVAEF WR+VQLDGSLI+ A+NVMGST 
Sbjct  688  LILLHPALGPLWEVTRQKFYGGSVSEGSELQVEVAEFLWRNVQLDGSLIVEADNVMGSTR  747

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +++NGE +LQYG RC RCKL+NVKVLNDGIDWN  DN+YWKHDV R E+ KV+LHGNAEF
Sbjct  748  IDQNGEPILQYGHRCGRCKLQNVKVLNDGIDWNFEDNVYWKHDVQRLEACKVVLHGNAEF  807

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DVILQGNH FEVP+GYKMKIT G+SG   +L+ IE   MDSG+WFW Y++ GTHIQL
Sbjct  808  EATDVILQGNHTFEVPNGYKMKITAGDSGLAARLDPIELNMMDSGSWFWEYRVKGTHIQL  867

Query  361  ELVE  350
            ELVE
Sbjct  868  ELVE  871



>ref|XP_011084880.1| PREDICTED: uncharacterized protein LOC105167026 isoform X1 [Sesamum 
indicum]
Length=867

 Score =   303 bits (775),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF  GSI+ GSELQIEVAEF WR+VQLDGSL++LAEN +GS  
Sbjct  683  LILLHPALGPLWEVTRQKFRCGSIAMGSELQIEVAEFLWRNVQLDGSLLVLAENAVGSIE  742

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +NENGE ++QYG+RC+RCKL+NVK+LN+GIDW+SRDN+YWKHDV RFE++KVILHGNAEF
Sbjct  743  INENGEPIIQYGRRCARCKLENVKILNNGIDWSSRDNVYWKHDVQRFEALKVILHGNAEF  802

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV++QGN+VF VPDG+KM++T G SG +VQL  IE   MDSGTWFWNYKI GTHI+L
Sbjct  803  EATDVVIQGNYVFNVPDGHKMQVTSGISGLDVQLKPIEEDLMDSGTWFWNYKIRGTHIEL  862

Query  361  ELVE  350
            EL+E
Sbjct  863  ELIE  866



>ref|XP_011084881.1| PREDICTED: uncharacterized protein LOC105167026 isoform X2 [Sesamum 
indicum]
Length=866

 Score =   302 bits (774),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF  GSI+ GSELQIEVAEF WR+VQLDGSL++LAEN +GS  
Sbjct  682  LILLHPALGPLWEVTRQKFRCGSIAMGSELQIEVAEFLWRNVQLDGSLLVLAENAVGSIE  741

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +NENGE ++QYG+RC+RCKL+NVK+LN+GIDW+SRDN+YWKHDV RFE++KVILHGNAEF
Sbjct  742  INENGEPIIQYGRRCARCKLENVKILNNGIDWSSRDNVYWKHDVQRFEALKVILHGNAEF  801

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV++QGN+VF VPDG+KM++T G SG +VQL  IE   MDSGTWFWNYKI GTHI+L
Sbjct  802  EATDVVIQGNYVFNVPDGHKMQVTSGISGLDVQLKPIEEDLMDSGTWFWNYKIRGTHIEL  861

Query  361  ELVE  350
            EL+E
Sbjct  862  ELIE  865



>ref|XP_010658247.1| PREDICTED: uncharacterized protein LOC100241552 isoform X3 [Vitis 
vinifera]
Length=861

 Score =   302 bits (773),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            L+LLHPALGPLWEV RQKF+GGSIS GSELQ+E+AEF WR+VQLDGS+I++AENVMGST 
Sbjct  677  LVLLHPALGPLWEVSRQKFYGGSISMGSELQLEIAEFLWRNVQLDGSMIVIAENVMGSTR  736

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++ENGE +LQYG RC RCKL+NVKV N GI+WNS DN+YWKHDV RFE++K+ILHGNAEF
Sbjct  737  IDENGEPMLQYGHRCGRCKLQNVKVQNKGINWNSGDNIYWKHDVQRFEALKIILHGNAEF  796

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DVILQ NHVFEVP+GYKMKI+  N G  V LN IE + MDSG+WFWNYKI GTHI L
Sbjct  797  EATDVILQRNHVFEVPNGYKMKISSKNPGLAVDLNPIEEKMMDSGSWFWNYKISGTHIHL  856

Query  361  ELVE  350
            ELVE
Sbjct  857  ELVE  860



>ref|XP_002273020.1| PREDICTED: uncharacterized protein LOC100241552 isoform X4 [Vitis 
vinifera]
 emb|CBI25447.3| unnamed protein product [Vitis vinifera]
Length=860

 Score =   302 bits (773),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            L+LLHPALGPLWEV RQKF+GGSIS GSELQ+E+AEF WR+VQLDGS+I++AENVMGST 
Sbjct  676  LVLLHPALGPLWEVSRQKFYGGSISMGSELQLEIAEFLWRNVQLDGSMIVIAENVMGSTR  735

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++ENGE +LQYG RC RCKL+NVKV N GI+WNS DN+YWKHDV RFE++K+ILHGNAEF
Sbjct  736  IDENGEPMLQYGHRCGRCKLQNVKVQNKGINWNSGDNIYWKHDVQRFEALKIILHGNAEF  795

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DVILQ NHVFEVP+GYKMKI+  N G  V LN IE + MDSG+WFWNYKI GTHI L
Sbjct  796  EATDVILQRNHVFEVPNGYKMKISSKNPGLAVDLNPIEEKMMDSGSWFWNYKISGTHIHL  855

Query  361  ELVE  350
            ELVE
Sbjct  856  ELVE  859



>ref|XP_010658245.1| PREDICTED: uncharacterized protein LOC100241552 isoform X1 [Vitis 
vinifera]
Length=873

 Score =   302 bits (773),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            L+LLHPALGPLWEV RQKF+GGSIS GSELQ+E+AEF WR+VQLDGS+I++AENVMGST 
Sbjct  689  LVLLHPALGPLWEVSRQKFYGGSISMGSELQLEIAEFLWRNVQLDGSMIVIAENVMGSTR  748

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++ENGE +LQYG RC RCKL+NVKV N GI+WNS DN+YWKHDV RFE++K+ILHGNAEF
Sbjct  749  IDENGEPMLQYGHRCGRCKLQNVKVQNKGINWNSGDNIYWKHDVQRFEALKIILHGNAEF  808

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DVILQ NHVFEVP+GYKMKI+  N G  V LN IE + MDSG+WFWNYKI GTHI L
Sbjct  809  EATDVILQRNHVFEVPNGYKMKISSKNPGLAVDLNPIEEKMMDSGSWFWNYKISGTHIHL  868

Query  361  ELVE  350
            ELVE
Sbjct  869  ELVE  872



>ref|XP_010658246.1| PREDICTED: uncharacterized protein LOC100241552 isoform X2 [Vitis 
vinifera]
Length=872

 Score =   302 bits (773),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            L+LLHPALGPLWEV RQKF+GGSIS GSELQ+E+AEF WR+VQLDGS+I++AENVMGST 
Sbjct  688  LVLLHPALGPLWEVSRQKFYGGSISMGSELQLEIAEFLWRNVQLDGSMIVIAENVMGSTR  747

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++ENGE +LQYG RC RCKL+NVKV N GI+WNS DN+YWKHDV RFE++K+ILHGNAEF
Sbjct  748  IDENGEPMLQYGHRCGRCKLQNVKVQNKGINWNSGDNIYWKHDVQRFEALKIILHGNAEF  807

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DVILQ NHVFEVP+GYKMKI+  N G  V LN IE + MDSG+WFWNYKI GTHI L
Sbjct  808  EATDVILQRNHVFEVPNGYKMKISSKNPGLAVDLNPIEEKMMDSGSWFWNYKISGTHIHL  867

Query  361  ELVE  350
            ELVE
Sbjct  868  ELVE  871



>gb|KHN31294.1| hypothetical protein glysoja_022948 [Glycine soja]
Length=690

 Score =   298 bits (762),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV +QKF+GGSISEGSELQIEVAEF+WR+VQL+GSLII++ENVMGS  
Sbjct  506  LILLHPALGPLWEVTKQKFYGGSISEGSELQIEVAEFFWRNVQLNGSLIIISENVMGSMK  565

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +NENGE++L YG+RC RCKL+NVKVLN GIDW   +N+YWKHDV R E +++ILHGNAEF
Sbjct  566  INENGESILHYGQRCGRCKLQNVKVLNKGIDWTCGENIYWKHDVQRSEVLQIILHGNAEF  625

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV+LQGNHVFEVPDGYK+KITPG+ G  ++L+ I+   M+SG+W W+YKI G+HIQL
Sbjct  626  EATDVVLQGNHVFEVPDGYKLKITPGSPGLAIKLDPIDQDMMESGSWHWDYKIEGSHIQL  685

Query  361  ELVES  347
            ELVES
Sbjct  686  ELVES  690



>emb|CAN60362.1| hypothetical protein VITISV_024684 [Vitis vinifera]
Length=866

 Score =   301 bits (772),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            L+LLHPALGPLWEV RQKF+GGSIS GSELQ+E+AEF WR+VQLDGS+I++AENVMGST 
Sbjct  682  LVLLHPALGPLWEVSRQKFYGGSISMGSELQLEIAEFLWRNVQLDGSMIVIAENVMGSTR  741

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++ENGE +LQYG RC RCKL+NVKV N GI+WNS DN+YWKHDV RFE++K+ILHGNAEF
Sbjct  742  IDENGEPMLQYGHRCGRCKLQNVKVQNKGINWNSGDNIYWKHDVQRFEALKIILHGNAEF  801

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DVILQ NHVFEVP+GYKMKI+  N G  V LN IE + MDSG+WFWNYKI GTHI L
Sbjct  802  EATDVILQRNHVFEVPNGYKMKISSKNPGLAVDLNPIEEKMMDSGSWFWNYKISGTHIHL  861

Query  361  ELVE  350
            ELVE
Sbjct  862  ELVE  865



>ref|XP_010257084.1| PREDICTED: uncharacterized protein LOC104597312 isoform X1 [Nelumbo 
nucifera]
Length=875

 Score =   300 bits (769),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF+ GSIS+GSELQ+EVAEF WRDVQLDGSLI++AEN+MGST 
Sbjct  691  LILLHPALGPLWEVTRQKFYRGSISDGSELQVEVAEFLWRDVQLDGSLIVVAENIMGSTR  750

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++E GE +L YG RC RCKL+NVKVLN GIDW+S +N+YWK DV RFE++KVILHGNAEF
Sbjct  751  IDEAGEPILIYGHRCGRCKLQNVKVLNRGIDWSSSENIYWKLDVQRFEALKVILHGNAEF  810

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV+LQGNHVFEVP+GYKM+IT GNSGF V+L+ IE   MD G+WFW YK+ GTHIQL
Sbjct  811  EAKDVVLQGNHVFEVPNGYKMQITAGNSGFSVRLDPIEKGMMDCGSWFWKYKLRGTHIQL  870

Query  361  ELVE  350
            E++E
Sbjct  871  EMIE  874



>gb|KHN04776.1| hypothetical protein glysoja_031876 [Glycine soja]
Length=772

 Score =   298 bits (764),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LIL+HPALGPLWEV +QKF+GGSISEGSELQIEVAEF+WR+VQL+GSLII+AENVMGS  
Sbjct  588  LILVHPALGPLWEVTKQKFYGGSISEGSELQIEVAEFFWRNVQLNGSLIIIAENVMGSMK  647

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +NEN E++L YG+RC RCKL+NVKVLN GIDW   +N+YWKHDV R E +++ILHGNAEF
Sbjct  648  INENSESILHYGQRCGRCKLQNVKVLNKGIDWTCDENIYWKHDVQRSEVLQIILHGNAEF  707

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV+LQGNHVFEVPDGYK+KI PG+SG  +QL+ I+   M+SG+W W+YKI G+HIQL
Sbjct  708  EATDVVLQGNHVFEVPDGYKLKIMPGSSGLAIQLDPIDQDMMESGSWHWDYKIEGSHIQL  767

Query  361  ELVES  347
            ELVES
Sbjct  768  ELVES  772



>ref|XP_002315147.1| hypothetical protein POPTR_0010s19320g [Populus trichocarpa]
 gb|EEF01318.1| hypothetical protein POPTR_0010s19320g [Populus trichocarpa]
Length=877

 Score =   300 bits (768),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 137/185 (74%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHPALGPLWEV RQKF+GGSIS+GSELQIEVAEF WR+VQLDGSLII+AENVMGST 
Sbjct  693  LIYLHPALGPLWEVTRQKFNGGSISKGSELQIEVAEFSWRNVQLDGSLIIIAENVMGSTR  752

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++ NGE +LQYG RC RC+L+NVKV+N GI+W+  DN+YWKHDV RFE++KVILHGNAEF
Sbjct  753  IDPNGEPILQYGNRCGRCRLQNVKVVNKGINWSFGDNIYWKHDVQRFEALKVILHGNAEF  812

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA +V +QGN +FE+PDGYKMKIT G+SG +VQLN +E + MDSG+W WNYKI G+HIQL
Sbjct  813  EADNVTIQGNQIFEIPDGYKMKITSGDSGLQVQLNPLEQKIMDSGSWHWNYKIHGSHIQL  872

Query  361  ELVES  347
            ELVE+
Sbjct  873  ELVET  877



>gb|EYU43434.1| hypothetical protein MIMGU_mgv1a001986mg [Erythranthe guttata]
Length=730

 Score =   297 bits (760),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF GGSIS+GSELQIEVAEF WR+VQLDGSLIILAENV+GST 
Sbjct  546  LILLHPALGPLWEVTRQKFLGGSISKGSELQIEVAEFLWRNVQLDGSLIILAENVVGSTK  605

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
             NE GE +LQYG+RC+RCKL+NV+V+N GIDWNS DNLYWKH+V RF ++KVILHGNAEF
Sbjct  606  TNEIGEPILQYGRRCARCKLENVRVVNGGIDWNSEDNLYWKHEVQRFGTLKVILHGNAEF  665

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV++QGNHVF+VPDG+K+KIT G SG E++L  IE+  MDSGTWFW YK+ GTH++L
Sbjct  666  EATDVVIQGNHVFDVPDGHKLKITSGISGLEMKLKPIEDELMDSGTWFWKYKLNGTHVEL  725

Query  361  ELVE  350
            E V+
Sbjct  726  ESVD  729



>ref|XP_003552278.1| PREDICTED: uncharacterized protein LOC100788781 isoform X1 [Glycine 
max]
Length=857

 Score =   300 bits (767),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV +QKF+GGSISEGSELQIEVAEF+WR+VQL+GSLII++ENVMGS  
Sbjct  673  LILLHPALGPLWEVTKQKFYGGSISEGSELQIEVAEFFWRNVQLNGSLIIISENVMGSMK  732

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +NENGE++L YG+RC RCKL+NVKVLN GIDW   +N+YWKHDV R E +++ILHGNAEF
Sbjct  733  INENGESILHYGQRCGRCKLQNVKVLNKGIDWTCGENIYWKHDVQRSEVLQIILHGNAEF  792

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV+LQGNHVFEVPDGYK+KITPG+ G  ++L+ I+   M+SG+W W+YKI G+HIQL
Sbjct  793  EATDVVLQGNHVFEVPDGYKLKITPGSPGLAIKLDPIDQDMMESGSWHWDYKIEGSHIQL  852

Query  361  ELVES  347
            ELVES
Sbjct  853  ELVES  857



>ref|XP_006601947.1| PREDICTED: uncharacterized protein LOC100788781 isoform X2 [Glycine 
max]
Length=843

 Score =   299 bits (766),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV +QKF+GGSISEGSELQIEVAEF+WR+VQL+GSLII++ENVMGS  
Sbjct  659  LILLHPALGPLWEVTKQKFYGGSISEGSELQIEVAEFFWRNVQLNGSLIIISENVMGSMK  718

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +NENGE++L YG+RC RCKL+NVKVLN GIDW   +N+YWKHDV R E +++ILHGNAEF
Sbjct  719  INENGESILHYGQRCGRCKLQNVKVLNKGIDWTCGENIYWKHDVQRSEVLQIILHGNAEF  778

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV+LQGNHVFEVPDGYK+KITPG+ G  ++L+ I+   M+SG+W W+YKI G+HIQL
Sbjct  779  EATDVVLQGNHVFEVPDGYKLKITPGSPGLAIKLDPIDQDMMESGSWHWDYKIEGSHIQL  838

Query  361  ELVES  347
            ELVES
Sbjct  839  ELVES  843



>ref|XP_006591388.1| PREDICTED: uncharacterized protein LOC100804343 isoform X2 [Glycine 
max]
Length=837

 Score =   298 bits (764),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LIL+HPALGPLWEV +QKF+GGSISEGSELQIEVAEF+WR+VQL+GSLII+AENVMGS  
Sbjct  653  LILVHPALGPLWEVTKQKFYGGSISEGSELQIEVAEFFWRNVQLNGSLIIIAENVMGSMK  712

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +NEN E++L YG+RC RCKL+NVKVLN GIDW   +N+YWKHDV R E +++ILHGNAEF
Sbjct  713  INENSESILHYGQRCGRCKLQNVKVLNKGIDWTCDENIYWKHDVQRSEVLQIILHGNAEF  772

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV+LQGNHVFEVPDGYK+KI PG+SG  +QL+ I+   M+SG+W W+YKI G+HIQL
Sbjct  773  EATDVVLQGNHVFEVPDGYKLKIMPGSSGLAIQLDPIDQDMMESGSWHWDYKIEGSHIQL  832

Query  361  ELVES  347
            ELVES
Sbjct  833  ELVES  837



>gb|KDO68907.1| hypothetical protein CISIN_1g002690mg [Citrus sinensis]
Length=548

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALG LWEV RQKF GGS+S+GSELQIEVAEF WR+VQLDGSLII+AENVMGST 
Sbjct  364  LILLHPALGLLWEVTRQKFKGGSVSKGSELQIEVAEFLWRNVQLDGSLIIVAENVMGSTR  423

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            + +NGE++LQYG RC RCKL NVKVLN GIDW+  DN YWKHDV  FE++KVILHGNAEF
Sbjct  424  IADNGESILQYGYRCGRCKLNNVKVLNKGIDWDCGDNTYWKHDVQWFEALKVILHGNAEF  483

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV LQGNHVFEVPDG+K+KIT GNSG  VQL+ IE   MD+G+W WNYKI G+HI L
Sbjct  484  EASDVTLQGNHVFEVPDGHKLKITSGNSGLVVQLDPIEQNMMDTGSWHWNYKINGSHIVL  543

Query  361  ELVE  350
            ELVE
Sbjct  544  ELVE  547



>ref|XP_003538476.2| PREDICTED: uncharacterized protein LOC100804343 isoform X1 [Glycine 
max]
Length=863

 Score =   299 bits (765),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LIL+HPALGPLWEV +QKF+GGSISEGSELQIEVAEF+WR+VQL+GSLII+AENVMGS  
Sbjct  679  LILVHPALGPLWEVTKQKFYGGSISEGSELQIEVAEFFWRNVQLNGSLIIIAENVMGSMK  738

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +NEN E++L YG+RC RCKL+NVKVLN GIDW   +N+YWKHDV R E +++ILHGNAEF
Sbjct  739  INENSESILHYGQRCGRCKLQNVKVLNKGIDWTCDENIYWKHDVQRSEVLQIILHGNAEF  798

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV+LQGNHVFEVPDGYK+KI PG+SG  +QL+ I+   M+SG+W W+YKI G+HIQL
Sbjct  799  EATDVVLQGNHVFEVPDGYKLKIMPGSSGLAIQLDPIDQDMMESGSWHWDYKIEGSHIQL  858

Query  361  ELVES  347
            ELVES
Sbjct  859  ELVES  863



>ref|XP_006435779.1| hypothetical protein CICLE_v10030686mg [Citrus clementina]
 ref|XP_006486288.1| PREDICTED: UDP-sugar pyrophosphorylase-like [Citrus sinensis]
 gb|ESR49019.1| hypothetical protein CICLE_v10030686mg [Citrus clementina]
Length=868

 Score =   298 bits (762),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALG LWEV RQKF GGS+S+GSELQIEVAEF WR+VQLDGSLII+AENVMGST 
Sbjct  684  LILLHPALGLLWEVTRQKFKGGSVSKGSELQIEVAEFLWRNVQLDGSLIIVAENVMGSTR  743

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            + +NGE++LQYG RC RCKL NVKVLN GIDW+  DN YWKHDV RFE++KVILHGNAEF
Sbjct  744  IADNGESILQYGYRCGRCKLNNVKVLNKGIDWDCGDNTYWKHDVQRFEALKVILHGNAEF  803

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV LQGNHVFEVPDG+K+KIT GNSG  VQL+ IE   MD+G+W WNYKI G+HI L
Sbjct  804  EASDVTLQGNHVFEVPDGHKLKITSGNSGLVVQLDPIEQNMMDTGSWHWNYKINGSHIVL  863

Query  361  ELVE  350
            ELVE
Sbjct  864  ELVE  867



>gb|KGN45802.1| hypothetical protein Csa_6G012270 [Cucumis sativus]
Length=645

 Score =   293 bits (749),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF GGSIS GSELQ+EVAEF WR+VQLDGSLI+L+ENVMGS  
Sbjct  461  LILLHPALGPLWEVTRQKFSGGSISRGSELQVEVAEFLWRNVQLDGSLIVLSENVMGSLK  520

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++ENGE+++ YG+RC RCKL+N+KVLN GIDWN  DN+YWK +V R E  K+ILHGNAEF
Sbjct  521  IDENGESLIHYGQRCGRCKLENIKVLNKGIDWNGEDNVYWKLEVQRHEGCKIILHGNAEF  580

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA  V+LQGNHVFEVPDGYK+KI+PG SGFE QL+ IE    D+G+W+WNYKI G+HI+L
Sbjct  581  EATGVVLQGNHVFEVPDGYKLKISPGTSGFEAQLDQIELDKQDTGSWYWNYKIEGSHIKL  640

Query  361  ELVE  350
            E VE
Sbjct  641  EYVE  644



>gb|KDO68906.1| hypothetical protein CISIN_1g002690mg [Citrus sinensis]
Length=612

 Score =   291 bits (746),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALG LWEV RQKF GGS+S+GSELQIEVAEF WR+VQLDGSLII+AENVMGST 
Sbjct  428  LILLHPALGLLWEVTRQKFKGGSVSKGSELQIEVAEFLWRNVQLDGSLIIVAENVMGSTR  487

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            + +NGE++LQYG RC RCKL NVKVLN GIDW+  DN YWKHDV  FE++KVILHGNAEF
Sbjct  488  IADNGESILQYGYRCGRCKLNNVKVLNKGIDWDCGDNTYWKHDVQWFEALKVILHGNAEF  547

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV LQGNHVFEVPDG+K+KIT GNSG  VQL+ IE   MD+G+W WNYKI G+HI L
Sbjct  548  EASDVTLQGNHVFEVPDGHKLKITSGNSGLVVQLDPIEQNMMDTGSWHWNYKINGSHIVL  607

Query  361  ELVE  350
            ELVE
Sbjct  608  ELVE  611



>ref|XP_011035907.1| PREDICTED: uncharacterized protein LOC105133562 isoform X2 [Populus 
euphratica]
Length=863

 Score =   296 bits (759),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHPALGPLWEV RQKF+GGSIS+GSELQIEVAEF WR+VQLDGSLII+AENVMGST 
Sbjct  679  LIFLHPALGPLWEVTRQKFNGGSISKGSELQIEVAEFSWRNVQLDGSLIIIAENVMGSTR  738

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++ NG+ +LQYG RC RC+L+NVKV+N GI+W+  DN+YWKHDV RFE+++VILHGNAEF
Sbjct  739  IDPNGDPILQYGNRCGRCRLQNVKVVNKGINWSFGDNIYWKHDVQRFEALEVILHGNAEF  798

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA +V +QGN +FE+PDGYKMKIT G+SG +VQLN +E + MDSG+W WNYKI G HIQL
Sbjct  799  EADNVTIQGNQIFEIPDGYKMKITSGDSGLQVQLNPLEQKIMDSGSWHWNYKIHGPHIQL  858

Query  361  ELVE  350
            ELVE
Sbjct  859  ELVE  862



>ref|XP_011035906.1| PREDICTED: uncharacterized protein LOC105133562 isoform X1 [Populus 
euphratica]
Length=877

 Score =   296 bits (759),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHPALGPLWEV RQKF+GGSIS+GSELQIEVAEF WR+VQLDGSLII+AENVMGST 
Sbjct  693  LIFLHPALGPLWEVTRQKFNGGSISKGSELQIEVAEFSWRNVQLDGSLIIIAENVMGSTR  752

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++ NG+ +LQYG RC RC+L+NVKV+N GI+W+  DN+YWKHDV RFE+++VILHGNAEF
Sbjct  753  IDPNGDPILQYGNRCGRCRLQNVKVVNKGINWSFGDNIYWKHDVQRFEALEVILHGNAEF  812

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA +V +QGN +FE+PDGYKMKIT G+SG +VQLN +E + MDSG+W WNYKI G HIQL
Sbjct  813  EADNVTIQGNQIFEIPDGYKMKITSGDSGLQVQLNPLEQKIMDSGSWHWNYKIHGPHIQL  872

Query  361  ELVE  350
            ELVE
Sbjct  873  ELVE  876



>ref|XP_010105429.1| UDP-sugar pyrophospharylase [Morus notabilis]
 gb|EXC04704.1| UDP-sugar pyrophospharylase [Morus notabilis]
Length=655

 Score =   291 bits (744),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWE+ RQKF+GGSIS+GSELQ+EVAEF WR++QLDGSL+I A++VMGST 
Sbjct  471  LILLHPALGPLWEITRQKFYGGSISKGSELQVEVAEFLWRNIQLDGSLVIEADSVMGSTR  530

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++ENGE +LQYG RC RC+L+NVKVLN GIDWN  D++YWKH V RFE+ K+ILHGNAEF
Sbjct  531  IDENGEHILQYGHRCGRCRLENVKVLNKGIDWNCGDSVYWKHAVQRFEACKIILHGNAEF  590

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV +QGNH+FEVPDGYK+K+T  +SG +V+L  I    MDSG+W+WNYKI GTHIQL
Sbjct  591  EATDVTIQGNHIFEVPDGYKLKVTSESSGMQVKLYPIGKNMMDSGSWYWNYKINGTHIQL  650

Query  361  ELVE  350
            EL E
Sbjct  651  ELAE  654



>ref|XP_006353433.1| PREDICTED: uncharacterized protein LOC102583756 isoform X2 [Solanum 
tuberosum]
Length=838

 Score =   294 bits (753),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = -2

Query  865  EVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENGETVLQYG  686
            E+   KFH GSIS GSELQIEVAEF WRDVQLDGSLIILAENV+GS  ++ENGETVL YG
Sbjct  666  EIKLPKFHRGSISRGSELQIEVAEFLWRDVQLDGSLIILAENVLGSPRIDENGETVLHYG  725

Query  685  KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQGNHV  506
            KRC RCKL+NVK+LNDGIDWN+R+NLYWKHDV RFE+VKVILHGNAEFEA+DVILQGNHV
Sbjct  726  KRCGRCKLENVKILNDGIDWNARENLYWKHDVQRFEAVKVILHGNAEFEAVDVILQGNHV  785

Query  505  FEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQLELV  353
            FEVPDGYKMKIT G+SG  V+L  IEN+ M+SG+WFWNYKIMG H+QLELV
Sbjct  786  FEVPDGYKMKITTGDSGLAVELKPIENKLMESGSWFWNYKIMGNHVQLELV  836



>ref|XP_012086982.1| PREDICTED: uncharacterized protein LOC105645861 [Jatropha curcas]
 gb|KDP44727.1| hypothetical protein JCGZ_01227 [Jatropha curcas]
Length=881

 Score =   295 bits (754),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHPALGPLW V RQKFH GSISEGSELQ+EVAEF WR+V+LDGSLI++A N+MGST 
Sbjct  697  LIFLHPALGPLWNVTRQKFHKGSISEGSELQVEVAEFLWRNVELDGSLIVIAANIMGSTR  756

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++ NGE +LQYG RC RC+L+NVKV+N+GIDW+S +N+YWKH V RFE+ KVILHGNAEF
Sbjct  757  IDANGEPILQYGHRCGRCRLQNVKVVNEGIDWSSGENVYWKHKVQRFEACKVILHGNAEF  816

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA +V L+GNHVFEVPDGYKM++  GNSG EVQLN IE   M SG+WFWNYK+ GT+IQL
Sbjct  817  EANNVTLEGNHVFEVPDGYKMQVKSGNSGLEVQLNRIEPSMMGSGSWFWNYKLKGTNIQL  876

Query  361  ELVE  350
            ELVE
Sbjct  877  ELVE  880



>ref|XP_007219560.1| hypothetical protein PRUPE_ppa001281mg [Prunus persica]
 gb|EMJ20759.1| hypothetical protein PRUPE_ppa001281mg [Prunus persica]
Length=864

 Score =   293 bits (750),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF+ GSIS+GSELQ+EVAEF WR+VQLDGSLII A+N+MGST 
Sbjct  680  LILLHPALGPLWEVTRQKFYEGSISKGSELQVEVAEFLWRNVQLDGSLIIEADNIMGSTK  739

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +++NGE +LQYG RC RCKL+NVKVLN+GIDW   DN+YWKHDV R E+ KV+LHGNAEF
Sbjct  740  IDQNGEPLLQYGHRCGRCKLQNVKVLNEGIDWTFGDNVYWKHDVQRIEACKVVLHGNAEF  799

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DVILQGNH+FEVP+ YKMKIT G+SG  V+L+ IE   MDSG+W+W Y I GTHIQL
Sbjct  800  EATDVILQGNHIFEVPNSYKMKITQGDSGLVVRLDPIEQNMMDSGSWYWEYSIKGTHIQL  859

Query  361  ELVE  350
            E+VE
Sbjct  860  EMVE  863



>gb|KDO68901.1| hypothetical protein CISIN_1g002690mg [Citrus sinensis]
Length=864

 Score =   293 bits (750),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALG LWEV RQKF GGS+S+GSELQIEVAEF WR+VQLDGSLII+AENVMGST 
Sbjct  680  LILLHPALGLLWEVTRQKFKGGSVSKGSELQIEVAEFLWRNVQLDGSLIIVAENVMGSTR  739

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            + +NGE++LQYG RC RCKL NVKVLN GIDW+  DN YWKHDV  FE++KVILHGNAEF
Sbjct  740  IADNGESILQYGYRCGRCKLNNVKVLNKGIDWDCGDNTYWKHDVQWFEALKVILHGNAEF  799

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV LQGNHVFEVPDG+K+KIT GNSG  VQL+ IE   MD+G+W WNYKI G+HI L
Sbjct  800  EASDVTLQGNHVFEVPDGHKLKITSGNSGLVVQLDPIEQNMMDTGSWHWNYKINGSHIVL  859

Query  361  ELVE  350
            ELVE
Sbjct  860  ELVE  863



>ref|XP_004500507.1| PREDICTED: uncharacterized protein LOC101505226 [Cicer arietinum]
Length=878

 Score =   293 bits (750),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/185 (72%), Positives = 161/185 (87%), Gaps = 0/185 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF+GGSISEGSELQIEVAEF+WR+VQL+GSL+I+AENVMGS  
Sbjct  694  LILLHPALGPLWEVTRQKFYGGSISEGSELQIEVAEFFWRNVQLNGSLVIIAENVMGSMK  753

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++E+G+++L  G+RC RCKL+NVKVLN GIDW+   N+YWKHDVHR E +++ILHGNAEF
Sbjct  754  IDESGQSILHNGQRCGRCKLQNVKVLNKGIDWSYGGNVYWKHDVHRSEVLQIILHGNAEF  813

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV+LQGNHVFEVPDGYK+KI PG+ G  +QL+ IE   MDSG+W W+YKI G HI+L
Sbjct  814  EATDVVLQGNHVFEVPDGYKLKIMPGSPGLAIQLDPIEQGMMDSGSWHWDYKIEGYHIKL  873

Query  361  ELVES  347
            ELVES
Sbjct  874  ELVES  878



>gb|KDO68900.1| hypothetical protein CISIN_1g002690mg [Citrus sinensis]
Length=892

 Score =   293 bits (750),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALG LWEV RQKF GGS+S+GSELQIEVAEF WR+VQLDGSLII+AENVMGST 
Sbjct  708  LILLHPALGLLWEVTRQKFKGGSVSKGSELQIEVAEFLWRNVQLDGSLIIVAENVMGSTR  767

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            + +NGE++LQYG RC RCKL NVKVLN GIDW+  DN YWKHDV  FE++KVILHGNAEF
Sbjct  768  IADNGESILQYGYRCGRCKLNNVKVLNKGIDWDCGDNTYWKHDVQWFEALKVILHGNAEF  827

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV LQGNHVFEVPDG+K+KIT GNSG  VQL+ IE   MD+G+W WNYKI G+HI L
Sbjct  828  EASDVTLQGNHVFEVPDGHKLKITSGNSGLVVQLDPIEQNMMDTGSWHWNYKINGSHIVL  887

Query  361  ELVE  350
            ELVE
Sbjct  888  ELVE  891



>ref|XP_004138414.2| PREDICTED: uncharacterized protein LOC101221986 [Cucumis sativus]
Length=870

 Score =   293 bits (749),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF GGSIS GSELQ+EVAEF WR+VQLDGSLI+L+ENVMGS  
Sbjct  686  LILLHPALGPLWEVTRQKFSGGSISRGSELQVEVAEFLWRNVQLDGSLIVLSENVMGSLK  745

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++ENGE+++ YG+RC RCKL+N+KVLN GIDWN  DN+YWK +V R E  K+ILHGNAEF
Sbjct  746  IDENGESLIHYGQRCGRCKLENIKVLNKGIDWNGEDNVYWKLEVQRHEGCKIILHGNAEF  805

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA  V+LQGNHVFEVPDGYK+KI+PG SGFE QL+ IE    D+G+W+WNYKI G+HI+L
Sbjct  806  EATGVVLQGNHVFEVPDGYKLKISPGTSGFEAQLDQIELDKQDTGSWYWNYKIEGSHIKL  865

Query  361  ELVE  350
            E VE
Sbjct  866  EYVE  869



>ref|XP_002528323.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34081.1| conserved hypothetical protein [Ricinus communis]
Length=884

 Score =   293 bits (749),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHPALGPLWEV RQKF GGSIS GSELQ+EVAEF WR+V+LDGSLI++AEN MGST 
Sbjct  700  LIFLHPALGPLWEVTRQKFSGGSISRGSELQVEVAEFLWRNVELDGSLIVIAENAMGSTR  759

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++ NGE +LQYG RC RCKL+N+KVLN GI+W+S +N+YWKH+V RFE+ K+ILHGNAEF
Sbjct  760  IHSNGEPILQYGHRCGRCKLQNIKVLNQGINWSSGENVYWKHNVQRFEAFKIILHGNAEF  819

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA +V ++GN VFEVPDGYKMKIT G SG +VQLN IE   MDSG+WFWNYK+ GTHI L
Sbjct  820  EASNVTIEGNQVFEVPDGYKMKITSGYSGLDVQLNTIEPIMMDSGSWFWNYKLNGTHILL  879

Query  361  ELVE  350
            ELVE
Sbjct  880  ELVE  883



>ref|XP_009386480.1| PREDICTED: uncharacterized protein LOC103973588 [Musa acuminata 
subsp. malaccensis]
Length=870

 Score =   291 bits (746),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHPALGPLWE+ RQKF+GGSISEGSELQIEVAEF WR+VQL GSLII+A+N+MGS  
Sbjct  686  LIFLHPALGPLWEITRQKFYGGSISEGSELQIEVAEFVWRNVQLSGSLIIVADNIMGSAR  745

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +N+N E VL YG+RC+RCKL+NVKVLN GIDW S +N+YWKHDV R E++K+ILHGNAEF
Sbjct  746  MNQNNEPVLHYGQRCARCKLQNVKVLNRGIDWMSSENVYWKHDVQRLETMKIILHGNAEF  805

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA+DV+LQGNHVFEVPDGYKM I P NSGF ++L+ I    M++G+WFW Y++ GTHI L
Sbjct  806  EAVDVVLQGNHVFEVPDGYKMCIIPENSGFMIRLDPIREDEMETGSWFWKYEMKGTHINL  865

Query  361  ELVE  350
            E+VE
Sbjct  866  EMVE  869



>ref|XP_008233789.1| PREDICTED: uncharacterized protein LOC103332812 [Prunus mume]
Length=864

 Score =   291 bits (746),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF+ GSIS+ SELQ+EVAEF WR+VQLDGSLII A+N+MGST 
Sbjct  680  LILLHPALGPLWEVTRQKFYEGSISKASELQVEVAEFLWRNVQLDGSLIIEADNIMGSTK  739

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +++NGE +LQYG RC RCKL+NVKVLN+GIDW   DN+YWKHDV R E+ KV+LHGNAEF
Sbjct  740  IDQNGEPLLQYGHRCGRCKLQNVKVLNEGIDWTFGDNVYWKHDVQRIEACKVVLHGNAEF  799

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DVILQGNH+FEVP+ YKMKIT G+SG  V+L+ IE   MDSG+W+W Y I GTHIQL
Sbjct  800  EATDVILQGNHIFEVPNSYKMKITQGDSGLVVRLDPIEQNMMDSGSWYWEYSIKGTHIQL  859

Query  361  ELVE  350
            E+VE
Sbjct  860  EMVE  863



>ref|XP_010257085.1| PREDICTED: uncharacterized protein LOC104597312 isoform X2 [Nelumbo 
nucifera]
Length=872

 Score =   290 bits (743),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 159/184 (86%), Gaps = 3/184 (2%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF+ GSIS+GSELQ+EVAEF WRDVQLDGSLI++AEN+MGST 
Sbjct  691  LILLHPALGPLWEVTRQKFYRGSISDGSELQVEVAEFLWRDVQLDGSLIVVAENIMGSTR  750

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++E GE +L YG RC RCKL+NVKVLN GIDW+S +N+YWK DV RFE++KVILHGNAEF
Sbjct  751  IDEAGEPILIYGHRCGRCKLQNVKVLNRGIDWSSSENIYWKLDVQRFEALKVILHGNAEF  810

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV+LQGNHVFEVP+GYKM+IT GNS   V+L+ IE   MD G+WFW YK+ GTHIQL
Sbjct  811  EAKDVVLQGNHVFEVPNGYKMQITAGNS---VRLDPIEKGMMDCGSWFWKYKLRGTHIQL  867

Query  361  ELVE  350
            E++E
Sbjct  868  EMIE  871



>ref|XP_008441479.1| PREDICTED: UDP-sugar pyrophosphorylase [Cucumis melo]
Length=870

 Score =   290 bits (741),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF GGSIS GSELQ+EVAEF WR+VQLDGSLI+L+ENVMGS  
Sbjct  686  LILLHPALGPLWEVTRQKFSGGSISRGSELQVEVAEFLWRNVQLDGSLIVLSENVMGSLK  745

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++ENGE+++ YG+RC RCKL++VKVLN GIDWN  DN+YWK +V R E  K+ILHGNAEF
Sbjct  746  IDENGESLIHYGQRCGRCKLEDVKVLNKGIDWNVEDNIYWKLEVQRHEGCKIILHGNAEF  805

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA  V+LQGNHVFEVPDGYK+KI PG SGFE QL  IE    D+G+W+WNYKI G+HI+L
Sbjct  806  EATGVVLQGNHVFEVPDGYKLKIAPGTSGFEAQLGQIELDKQDTGSWYWNYKIEGSHIKL  865

Query  361  ELVE  350
            E VE
Sbjct  866  EYVE  869



>ref|XP_010031181.1| PREDICTED: uncharacterized protein LOC104421052 [Eucalyptus grandis]
Length=876

 Score =   290 bits (741),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV+RQKF GGSIS+GSEL +EVAEF WRDVQL+GSLII AENVMGST 
Sbjct  692  LILLHPALGPLWEVLRQKFCGGSISKGSELIVEVAEFLWRDVQLEGSLIIEAENVMGSTG  751

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            + +NG+ +LQYG RC RCKL+NVKVLN+GIDWN   N++WKHDV R ES+KVILHGNAEF
Sbjct  752  IGKNGDLILQYGHRCGRCKLQNVKVLNEGIDWNFSGNVFWKHDVQRSESLKVILHGNAEF  811

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV  QGNHVFEVPDG+KMKITPG SGF VQL  +    +DSG+W+W YKI G HI L
Sbjct  812  EATDVSFQGNHVFEVPDGHKMKITPGISGFSVQLETLAPNMVDSGSWYWKYKINGKHIGL  871

Query  361  ELVE  350
            ELVE
Sbjct  872  ELVE  875



>gb|KCW50445.1| hypothetical protein EUGRSUZ_J00183 [Eucalyptus grandis]
Length=917

 Score =   290 bits (741),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV+RQKF GGSIS+GSEL +EVAEF WRDVQL+GSLII AENVMGST 
Sbjct  733  LILLHPALGPLWEVLRQKFCGGSISKGSELIVEVAEFLWRDVQLEGSLIIEAENVMGSTG  792

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            + +NG+ +LQYG RC RCKL+NVKVLN+GIDWN   N++WKHDV R ES+KVILHGNAEF
Sbjct  793  IGKNGDLILQYGHRCGRCKLQNVKVLNEGIDWNFSGNVFWKHDVQRSESLKVILHGNAEF  852

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV  QGNHVFEVPDG+KMKITPG SGF VQL  +    +DSG+W+W YKI G HI L
Sbjct  853  EATDVSFQGNHVFEVPDGHKMKITPGISGFSVQLETLAPNMVDSGSWYWKYKINGKHIGL  912

Query  361  ELVE  350
            ELVE
Sbjct  913  ELVE  916



>ref|XP_004307650.1| PREDICTED: uncharacterized protein LOC101304420 [Fragaria vesca 
subsp. vesca]
Length=876

 Score =   286 bits (733),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF+GGSI +GSELQ+EVAEF WR+VQLDGSLII A+NVMGS+ 
Sbjct  692  LILLHPALGPLWEVTRQKFYGGSIRKGSELQVEVAEFLWRNVQLDGSLIIEADNVMGSSR  751

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++E+GE +LQYG RC RC+L+NV+V N+GIDWN  DN+YWK+DV R E+ KV+LHGNAEF
Sbjct  752  VDEDGEPILQYGHRCGRCRLQNVRVSNEGIDWNFEDNIYWKNDVQRIEACKVVLHGNAEF  811

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DVIL+GNH+FEVP+GYKMKI PG+SG  + L+ I    MDSG+W+W Y I  THIQL
Sbjct  812  EATDVILKGNHIFEVPNGYKMKIMPGDSGLAIGLDPIAENMMDSGSWYWKYGINDTHIQL  871

Query  361  ELVE  350
            ELVE
Sbjct  872  ELVE  875



>gb|KEH34804.1| UDP-glucose pyrophosphorylase [Medicago truncatula]
Length=863

 Score =   285 bits (730),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 160/185 (86%), Gaps = 0/185 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF+GGSIS+GSELQIEVAE +WR+VQ++GSL+I AEN+MGS  
Sbjct  679  LILLHPALGPLWEVTRQKFNGGSISKGSELQIEVAELFWRNVQVNGSLVIKAENIMGSMK  738

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++E+GE++L +G+RC RCKL+NVKVLN+GIDW+   N+YWKHDV R E +++ILHGNAEF
Sbjct  739  IDESGESILHHGQRCGRCKLQNVKVLNEGIDWSYGGNVYWKHDVKRSEVLQIILHGNAEF  798

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV+LQGNHVFEVPDGYK+KI PG+ G  +QL+ IE   MDSG+W W+YKI G+HI+L
Sbjct  799  EATDVVLQGNHVFEVPDGYKLKIMPGSPGLAIQLDPIEEGMMDSGSWHWDYKIEGSHIKL  858

Query  361  ELVES  347
            E VES
Sbjct  859  EFVES  863



>ref|XP_003600957.1| hypothetical protein MTR_3g071440 [Medicago truncatula]
 gb|AES71208.1| UDP-glucose pyrophosphorylase [Medicago truncatula]
Length=868

 Score =   285 bits (730),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 160/185 (86%), Gaps = 0/185 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF+GGSIS+GSELQIEVAE +WR+VQ++GSL+I AEN+MGS  
Sbjct  684  LILLHPALGPLWEVTRQKFNGGSISKGSELQIEVAELFWRNVQVNGSLVIKAENIMGSMK  743

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++E+GE++L +G+RC RCKL+NVKVLN+GIDW+   N+YWKHDV R E +++ILHGNAEF
Sbjct  744  IDESGESILHHGQRCGRCKLQNVKVLNEGIDWSYGGNVYWKHDVKRSEVLQIILHGNAEF  803

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV+LQGNHVFEVPDGYK+KI PG+ G  +QL+ IE   MDSG+W W+YKI G+HI+L
Sbjct  804  EATDVVLQGNHVFEVPDGYKLKIMPGSPGLAIQLDPIEEGMMDSGSWHWDYKIEGSHIKL  863

Query  361  ELVES  347
            E VES
Sbjct  864  EFVES  868



>gb|KDO68902.1| hypothetical protein CISIN_1g002690mg [Citrus sinensis]
Length=862

 Score =   285 bits (728),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 155/184 (84%), Gaps = 2/184 (1%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALG LWEV RQKF GGS+S+GSELQIEVAEF WR+  LDGSLII+AENVMGST 
Sbjct  680  LILLHPALGLLWEVTRQKFKGGSVSKGSELQIEVAEFLWRN--LDGSLIIVAENVMGSTR  737

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            + +NGE++LQYG RC RCKL NVKVLN GIDW+  DN YWKHDV  FE++KVILHGNAEF
Sbjct  738  IADNGESILQYGYRCGRCKLNNVKVLNKGIDWDCGDNTYWKHDVQWFEALKVILHGNAEF  797

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV LQGNHVFEVPDG+K+KIT GNSG  VQL+ IE   MD+G+W WNYKI G+HI L
Sbjct  798  EASDVTLQGNHVFEVPDGHKLKITSGNSGLVVQLDPIEQNMMDTGSWHWNYKINGSHIVL  857

Query  361  ELVE  350
            ELVE
Sbjct  858  ELVE  861



>gb|KJB74378.1| hypothetical protein B456_011G291300 [Gossypium raimondii]
Length=869

 Score =   284 bits (727),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHPALGP+WEV RQKF GGSIS+GSELQ+EVAEF WR++QLDGS+II+AEN+MGST 
Sbjct  685  LIFLHPALGPVWEVTRQKFSGGSISKGSELQVEVAEFLWRNIQLDGSMIIVAENIMGSTR  744

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +++ GE +LQ+G RC RCKL NV VLNDG+DW S DN+YWKHD+ R E++KVILHGNAEF
Sbjct  745  IDDKGELILQHGHRCGRCKLCNVTVLNDGVDWTSGDNVYWKHDIRRSEALKVILHGNAEF  804

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA +VI+QGNHVFEVPDGYKMKIT G+SG  VQ++ I    MD+G+WFW Y   G+HI L
Sbjct  805  EAYNVIIQGNHVFEVPDGYKMKITAGDSGLVVQMDLIPQNLMDNGSWFWKYDTKGSHILL  864

Query  361  ELVE  350
            ELVE
Sbjct  865  ELVE  868



>ref|XP_007008906.1| UDP-glucose pyrophosphorylase 3 isoform 3, partial [Theobroma 
cacao]
 gb|EOY17716.1| UDP-glucose pyrophosphorylase 3 isoform 3, partial [Theobroma 
cacao]
Length=876

 Score =   282 bits (722),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHPALGPLWEV RQKF GGSIS+GSELQIEVAEF WR+VQL+GS+II A+N+MGST 
Sbjct  692  LIFLHPALGPLWEVTRQKFSGGSISKGSELQIEVAEFLWRNVQLEGSMIIAADNIMGSTR  751

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++ENGE  L+YG R  RCKL NVKVLNDGIDW+S DN+YWKHDV RFE++KVILHGNAEF
Sbjct  752  VDENGEPTLRYGHRYGRCKLHNVKVLNDGIDWSSGDNVYWKHDVRRFEALKVILHGNAEF  811

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA +V +QGNH+FEVPDGY+MKIT G+ G  +QL+ +    MD G+WFW Y I G HI L
Sbjct  812  EASNVTIQGNHLFEVPDGYRMKITSGDPGLALQLDPLPQSLMDRGSWFWKYNINGCHILL  871

Query  361  ELVE  350
            EL+E
Sbjct  872  ELIE  875



>gb|KHG20503.1| UDP-sugar pyrophospharylase [Gossypium arboreum]
Length=875

 Score =   281 bits (718),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 154/184 (84%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHPALGP+WEV RQKF GGSIS+GSELQ+EVAEF WR+VQLDGS+II+AEN++GS  
Sbjct  691  LIFLHPALGPVWEVTRQKFSGGSISKGSELQVEVAEFLWRNVQLDGSMIIVAENIIGSIR  750

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +++ GE +LQ+G RC RCKL NV VLNDGIDW S DN+YWKHD+ R E++KVILHGNAEF
Sbjct  751  IDDKGEPILQHGHRCGRCKLCNVTVLNDGIDWTSGDNVYWKHDICRSEALKVILHGNAEF  810

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA +VI+QGNHVFEVPDGYKMKIT G+SG  VQ++ I    MD+G+WFW Y   G+HI L
Sbjct  811  EAYNVIIQGNHVFEVPDGYKMKITSGDSGLVVQMDLIPQNLMDNGSWFWKYDTNGSHILL  870

Query  361  ELVE  350
            ELVE
Sbjct  871  ELVE  874



>ref|XP_010693077.1| PREDICTED: uncharacterized protein LOC104906066 [Beta vulgaris 
subsp. vulgaris]
Length=875

 Score =   278 bits (710),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHPALGPLWEV RQKFHGGSIS+GSELQIE+AEF+W+DVQL+GSLII+A+NVMG+  
Sbjct  691  LIFLHPALGPLWEVSRQKFHGGSISKGSELQIEIAEFFWKDVQLNGSLIIVADNVMGAMK  750

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
             +++GE +L+YG RC+RCKL+NV+VLN GIDW S  N+YW+H+VHR E +KV+LHGNAEF
Sbjct  751  ADKSGEPLLEYGHRCARCKLQNVRVLNKGIDWESGLNMYWRHEVHRNECLKVMLHGNAEF  810

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA+DV L+GNHVFEVPDG+++KIT  NSG   QL  IE+   DSG+W+W YK+ G H++L
Sbjct  811  EAIDVTLEGNHVFEVPDGHRLKITSTNSGISKQLGPIEDSKKDSGSWYWKYKMDGAHVKL  870

Query  361  ELVE  350
            E+VE
Sbjct  871  EMVE  874



>ref|XP_008811681.1| PREDICTED: uncharacterized protein LOC103722778 isoform X3 [Phoenix 
dactylifera]
Length=841

 Score =   275 bits (703),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHP LGPLWE+ RQKF GGSIS+GSELQIEVAEF WRDVQL+GSLII+AEN+MGS  
Sbjct  657  LIFLHPGLGPLWEITRQKFFGGSISKGSELQIEVAEFLWRDVQLEGSLIIVAENIMGSIR  716

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +++NGE VLQYG RC RCKL+NVKV N GIDW S +N+YWKHDV R E +K+ILHGNAEF
Sbjct  717  MSQNGEPVLQYGDRCGRCKLQNVKVQNKGIDWTSPNNVYWKHDVQRLECLKIILHGNAEF  776

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV+LQG+HVFEVP G +M I+   +G   +L  I    MDSG+WFW YKI GTHI L
Sbjct  777  EATDVVLQGSHVFEVPSGCRMCISSDTTGIVGKLEPIREDLMDSGSWFWKYKIKGTHIHL  836

Query  361  ELVE  350
            E++E
Sbjct  837  EMIE  840



>ref|XP_010427407.1| PREDICTED: uncharacterized protein LOC104712252 [Camelina sativa]
Length=310

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF GGSIS  SE+Q+E+AE  W +VQ+DGSLII AEN MGST 
Sbjct  123  LILLHPALGPLWEVSRQKFKGGSISSCSEVQLEIAELSWNNVQVDGSLIITAENAMGSTT  182

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +N++GE +LQYG RC +CKL NVKV+N GIDWNS+ N+YW++DV+R E+ K+ILHGNAEF
Sbjct  183  INDHGEPILQYGLRCGKCKLHNVKVVNRGIDWNSKSNVYWRNDVNRLETCKIILHGNAEF  242

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA +V ++GNHVFEVPDG+ MKIT GN+G  + L A++   +++G+W+W+Y++ G+HI L
Sbjct  243  EASNVTVEGNHVFEVPDGHIMKITQGNAGLSINLEAMKEGVLETGSWYWDYQLNGSHIHL  302

Query  361  ELVE  350
            + VE
Sbjct  303  QQVE  306



>ref|XP_010907871.1| PREDICTED: uncharacterized protein LOC105034415 [Elaeis guineensis]
Length=868

 Score =   275 bits (702),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHP LGPLWE+ RQKF GGSIS+GSELQIEVAEF WRDVQL+GSLII+AEN+MGS  
Sbjct  684  LIFLHPGLGPLWEITRQKFFGGSISKGSELQIEVAEFLWRDVQLEGSLIIVAENIMGSIR  743

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +++NGE  LQYG RC RCKL+NVKV N GIDW S +N+YWKHDV R E +K+ILHGNAEF
Sbjct  744  MSQNGEPTLQYGNRCGRCKLQNVKVQNKGIDWTSSNNVYWKHDVQRLECLKIILHGNAEF  803

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV+LQG+HVFEVP GY+M I+   +G  V+L  I    MD+G+WFW YKI GTHI L
Sbjct  804  EATDVVLQGSHVFEVPSGYRMCISSDTTGNIVKLEHIREDLMDNGSWFWKYKIKGTHIYL  863

Query  361  ELVE  350
            E++E
Sbjct  864  EMIE  867



>ref|XP_008811677.1| PREDICTED: uncharacterized protein LOC103722778 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008811678.1| PREDICTED: uncharacterized protein LOC103722778 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008811679.1| PREDICTED: uncharacterized protein LOC103722778 isoform X1 [Phoenix 
dactylifera]
Length=867

 Score =   275 bits (702),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 148/184 (80%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHP LGPLWE+ RQKF GGSIS+GSELQIEVAEF WRDVQL+GSLII+AEN+MGS  
Sbjct  683  LIFLHPGLGPLWEITRQKFFGGSISKGSELQIEVAEFLWRDVQLEGSLIIVAENIMGSIR  742

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +++NGE VLQYG RC RCKL+NVKV N GIDW S +N+YWKHDV R E +K+ILHGNAEF
Sbjct  743  MSQNGEPVLQYGDRCGRCKLQNVKVQNKGIDWTSPNNVYWKHDVQRLECLKIILHGNAEF  802

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV+LQG+HVFEVP G +M I+   +G   +L  I    MDSG+WFW YKI GTHI L
Sbjct  803  EATDVVLQGSHVFEVPSGCRMCISSDTTGIVGKLEPIREDLMDSGSWFWKYKIKGTHIHL  862

Query  361  ELVE  350
            E++E
Sbjct  863  EMIE  866



>ref|XP_006655397.1| PREDICTED: UDP-sugar pyrophosphorylase-like [Oryza brachyantha]
Length=818

 Score =   269 bits (687),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHPALGP W+++RQKF GGS+S+GSELQIEVAEF W+DV+LDGSLI+LA+N+MG T 
Sbjct  634  LIFLHPALGPFWDIMRQKFVGGSVSQGSELQIEVAEFLWKDVELDGSLIVLADNIMGLTK  693

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
             N  GE ++ YG RC RCKL++VK++N+GI+W+S +N+YWKHDV R ESVK+ILHGNAEF
Sbjct  694  KNNTGEQIMHYGTRCGRCKLRSVKIVNEGINWSSANNVYWKHDVERSESVKIILHGNAEF  753

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV+LQGNH+FEVP G++M+I    +GF V+L+ I    MDSGTW+W Y + G H++L
Sbjct  754  EAKDVVLQGNHIFEVPSGHRMRIIQEAAGFVVKLDPISEEVMDSGTWYWKYAVDGAHVKL  813

Query  361  ELVE  350
            E+VE
Sbjct  814  EMVE  817



>ref|XP_006403031.1| hypothetical protein EUTSA_v10005783mg [Eutrema salsugineum]
 gb|ESQ44484.1| hypothetical protein EUTSA_v10005783mg [Eutrema salsugineum]
Length=886

 Score =   269 bits (687),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            +ILLHPALGPLWEV RQKF GGSIS  SELQ+E+AE  W +VQ+DGSLII AEN MGST 
Sbjct  699  IILLHPALGPLWEVSRQKFKGGSISNCSELQLEIAEVSWNNVQVDGSLIITAENAMGSTT  758

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +NENGE +LQYG RC +CKL NVKV+N GIDW S+ N+YW++DV+R E+ K+ILHGNAEF
Sbjct  759  INENGEPILQYGLRCGKCKLHNVKVVNQGIDWKSKSNVYWRNDVNRLETCKIILHGNAEF  818

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA +V +QGN VFEVPDG+++KIT GNSG  + L AI    M++G+W+WNY++ G+HI L
Sbjct  819  EASNVTIQGNQVFEVPDGHRLKITQGNSGLSINLEAIREEVMETGSWYWNYQLDGSHINL  878

Query  361  ELVE  350
            E VE
Sbjct  879  EQVE  882



>ref|XP_008656382.1| PREDICTED: uncharacterized protein LOC103635785 isoform X1 [Zea 
mays]
Length=872

 Score =   268 bits (684),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHPALGP W++IRQKF GGS+S+GSELQIEVAEF W+DV+LDGS IILA+NVMGST 
Sbjct  688  LIFLHPALGPFWDIIRQKFVGGSVSKGSELQIEVAEFLWKDVELDGSFIILADNVMGSTK  747

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
             ++NGE +L YG RC RC+L++VK++N+GI+W S +N+YWKHDV R ESVK+ILHGNAEF
Sbjct  748  NSKNGEQILHYGSRCGRCRLQSVKIVNEGINWTSPNNVYWKHDVERSESVKIILHGNAEF  807

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV+L+GNHVFEVPDG++M I    +GF V+L+ I +  MDSGTW W Y + G H++L
Sbjct  808  EAKDVVLKGNHVFEVPDGHRMCIIQDRAGFVVKLDLIRDELMDSGTWHWKYAVDGVHVKL  867

Query  361  ELVE  350
             +VE
Sbjct  868  NMVE  871



>emb|CAB87858.1| putative protein [Arabidopsis thaliana]
Length=871

 Score =   267 bits (683),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF GGSIS  SELQ+E+AEF W +VQ+DGSLI+ AEN MGST 
Sbjct  684  LILLHPALGPLWEVSRQKFKGGSISSCSELQLEIAEFSWNNVQVDGSLIVTAENAMGSTT  743

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
             N+NGE +LQYG RC +CKL NV V+N GIDWNS+ N+YW++DV+R E+ K+ILHGNAEF
Sbjct  744  PNDNGEPILQYGLRCGKCKLHNVNVVNRGIDWNSKSNVYWRNDVNRLETCKIILHGNAEF  803

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA +V ++G+HVFEVPDG+K+KIT GN+G  + L A++   M++G+W+WNY++ G+HI L
Sbjct  804  EASNVTIEGHHVFEVPDGHKLKITSGNAGLSINLEALKEEVMETGSWYWNYQLNGSHIHL  863

Query  361  ELVE  350
            + VE
Sbjct  864  QQVE  867



>ref|XP_010554677.1| PREDICTED: uncharacterized protein LOC104824329 [Tarenaya hassleriana]
Length=877

 Score =   267 bits (683),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHPALGPLWEV RQKF GGSIS+ SELQ+E+AEF W +V++DGSLII AEN MGST 
Sbjct  685  LIFLHPALGPLWEVSRQKFSGGSISKCSELQLEIAEFSWSNVEVDGSLIIRAENAMGSTR  744

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++EN E +LQYG+RC +CKL NVKV+N GIDWN   N+YWKH+V R E+ K++LHGNAEF
Sbjct  745  IDENEEPILQYGQRCGKCKLHNVKVVNRGIDWNCEANVYWKHEVCRLETCKIVLHGNAEF  804

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA++V +QG HVFEVPD +++KITPGNSG  + L  I+   M++GTW+W Y++ GTH+Q+
Sbjct  805  EAVNVTIQGGHVFEVPDSHRLKITPGNSGLNIDLEPIKQELMETGTWYWKYQLKGTHVQI  864

Query  361  ELVE  350
            E  E
Sbjct  865  EQAE  868



>ref|NP_567031.1| UDP-glucose pyrophosphorylase 3 [Arabidopsis thaliana]
 gb|AEE79469.1| UDP-glucose pyrophosphorylase 3 [Arabidopsis thaliana]
Length=883

 Score =   267 bits (683),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF GGSIS  SELQ+E+AEF W +VQ+DGSLI+ AEN MGST 
Sbjct  696  LILLHPALGPLWEVSRQKFKGGSISSCSELQLEIAEFSWNNVQVDGSLIVTAENAMGSTT  755

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
             N+NGE +LQYG RC +CKL NV V+N GIDWNS+ N+YW++DV+R E+ K+ILHGNAEF
Sbjct  756  PNDNGEPILQYGLRCGKCKLHNVNVVNRGIDWNSKSNVYWRNDVNRLETCKIILHGNAEF  815

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA +V ++G+HVFEVPDG+K+KIT GN+G  + L A++   M++G+W+WNY++ G+HI L
Sbjct  816  EASNVTIEGHHVFEVPDGHKLKITSGNAGLSINLEALKEEVMETGSWYWNYQLNGSHIHL  875

Query  361  ELVE  350
            + VE
Sbjct  876  QQVE  879



>gb|KFK34847.1| hypothetical protein AALP_AA5G200800 [Arabis alpina]
Length=870

 Score =   266 bits (681),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF GGSIS  SELQ+E+AEF W +VQ+DGSLII AEN MGS  
Sbjct  683  LILLHPALGPLWEVSRQKFKGGSISSCSELQLEIAEFSWNNVQVDGSLIISAENAMGSAT  742

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            L++NGE +LQYG RC RCKL NVKV+N GIDWNS+ N+YW++DV+R E+ K+ILHG+AEF
Sbjct  743  LHKNGEPILQYGLRCGRCKLHNVKVVNRGIDWNSKSNVYWRNDVNRLETCKIILHGDAEF  802

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA +V +QGN VFEVPDG+++KIT GNSG  + L A++   M++G+W+WNY++ G+HI L
Sbjct  803  EASNVTIQGNQVFEVPDGHRLKITRGNSGLCINLEAMKEEIMETGSWYWNYQLNGSHIHL  862

Query  361  ELVE  350
            E V+
Sbjct  863  EQVQ  866



>gb|EMS56381.1| hypothetical protein TRIUR3_23522 [Triticum urartu]
Length=630

 Score =   261 bits (667),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            +I LHPALGP W++I+QKF GGSIS+GSELQIEVAEF W+DV+LDGSLIILA+N+MGST 
Sbjct  446  IIFLHPALGPFWDIIKQKFIGGSISKGSELQIEVAEFLWQDVELDGSLIILADNIMGSTK  505

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
             N +GE +L YG RC RCKL+NVK++N+GI W+S  N+YWKH V R ES+K+ILHGNAEF
Sbjct  506  RNTDGEQILHYGARCGRCKLQNVKIVNEGISWDSPINVYWKHHVERSESLKIILHGNAEF  565

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA D++L+GNH+FEVPDG++M I    +GF V+L+ I    MDSGTW+W Y + G H++L
Sbjct  566  EAKDILLKGNHMFEVPDGHRMCIIQDEAGFVVKLDPISKEMMDSGTWYWEYTVDGAHVKL  625

Query  361  ELVE  350
             +V+
Sbjct  626  NMVD  629



>ref|XP_010536381.1| PREDICTED: uncharacterized protein LOC104811372 [Tarenaya hassleriana]
Length=896

 Score =   266 bits (680),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 150/182 (82%), Gaps = 1/182 (1%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHPALGPLWEV+RQKF  GSIS+ SELQ+EVAEF+W +VQ+DGSLI++AEN MGST 
Sbjct  707  LIFLHPALGPLWEVMRQKFSRGSISKCSELQLEVAEFWWNNVQVDGSLIVMAENAMGSTR  766

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +NENGE +L YG RC +CKL+NV++LN GIDWN + N+YWKH VHR E+ K++LHGNAEF
Sbjct  767  INENGEPILHYGHRCGKCKLQNVEILNRGIDWNCKTNVYWKHHVHRLETCKIVLHGNAEF  826

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNS-GFEVQLNAIENRSMDSGTWFWNYKIMGTHIQ  365
            EA +V +QG+ VFEVPDG+++KITP NS G +++L  I+   M SGTW W YK+ GTHIQ
Sbjct  827  EASNVTIQGDQVFEVPDGHRLKITPANSGGVDMKLEPIKEELMSSGTWGWKYKLQGTHIQ  886

Query  364  LE  359
            L+
Sbjct  887  LQ  888



>ref|XP_009116297.1| PREDICTED: uncharacterized protein LOC103841505 isoform X1 [Brassica 
rapa]
Length=874

 Score =   265 bits (678),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 152/186 (82%), Gaps = 3/186 (2%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF GGSIS  SELQ+E+AEF W +V++DGSL+I AEN MGST 
Sbjct  684  LILLHPALGPLWEVSRQKFKGGSISSCSELQLEIAEFSWNNVEVDGSLVINAENAMGSTT  743

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +NE GE +LQYG RC +CKL NVKV+N GIDWNS+ N+YW++DV+R E+ K+ILHGNAEF
Sbjct  744  INEKGEPILQYGLRCGKCKLHNVKVVNRGIDWNSKSNVYWRNDVNRLETCKIILHGNAEF  803

Query  541  EAMDVILQGNHVFEVPDGYKMKITPG---NSGFEVQLNAIENRSMDSGTWFWNYKIMGTH  371
            EA +V ++GNHVFEVPDG+++KIT G   +SG  + L AIE    ++G+W+WNYK+ G+H
Sbjct  804  EASNVTIEGNHVFEVPDGHRLKITRGRSPDSGLSINLEAIEEEVRETGSWYWNYKLNGSH  863

Query  370  IQLELV  353
            IQLE V
Sbjct  864  IQLEQV  869



>ref|XP_009116298.1| PREDICTED: uncharacterized protein LOC103841505 isoform X2 [Brassica 
rapa]
Length=872

 Score =   265 bits (678),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 151/184 (82%), Gaps = 1/184 (1%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF GGSIS  SELQ+E+AEF W +V++DGSL+I AEN MGST 
Sbjct  684  LILLHPALGPLWEVSRQKFKGGSISSCSELQLEIAEFSWNNVEVDGSLVINAENAMGSTT  743

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +NE GE +LQYG RC +CKL NVKV+N GIDWNS+ N+YW++DV+R E+ K+ILHGNAEF
Sbjct  744  INEKGEPILQYGLRCGKCKLHNVKVVNRGIDWNSKSNVYWRNDVNRLETCKIILHGNAEF  803

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNS-GFEVQLNAIENRSMDSGTWFWNYKIMGTHIQ  365
            EA +V ++GNHVFEVPDG+++KIT G S G  + L AIE    ++G+W+WNYK+ G+HIQ
Sbjct  804  EASNVTIEGNHVFEVPDGHRLKITRGRSPGLSINLEAIEEEVRETGSWYWNYKLNGSHIQ  863

Query  364  LELV  353
            LE V
Sbjct  864  LEQV  867



>emb|CDY66808.1| BnaA09g55090D [Brassica napus]
Length=866

 Score =   265 bits (676),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 152/186 (82%), Gaps = 3/186 (2%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF GGSIS  SELQ+E+AEF W +V++DGSL+I AEN MGST 
Sbjct  676  LILLHPALGPLWEVSRQKFKGGSISSCSELQLEIAEFSWNNVEVDGSLVINAENAMGSTT  735

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +NE GE +LQYG RC +CKL NVKV+N GIDWNS+ N+YW++DV+R E+ K+ILHGNAEF
Sbjct  736  INEKGEPILQYGLRCGKCKLHNVKVVNRGIDWNSKSNVYWRNDVNRLETCKIILHGNAEF  795

Query  541  EAMDVILQGNHVFEVPDGYKMKITPG---NSGFEVQLNAIENRSMDSGTWFWNYKIMGTH  371
            EA +V ++GNHVFEVPDG+++KIT G   +SG  + L AIE    ++G+W+WNYK+ G+H
Sbjct  796  EASNVTIEGNHVFEVPDGHRLKITRGRSPDSGLSINLEAIEEEVRETGSWYWNYKLNGSH  855

Query  370  IQLELV  353
            IQLE V
Sbjct  856  IQLEQV  861



>ref|XP_002878057.1| hypothetical protein ARALYDRAFT_486043 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54316.1| hypothetical protein ARALYDRAFT_486043 [Arabidopsis lyrata subsp. 
lyrata]
Length=883

 Score =   264 bits (675),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            +ILLHPALGPLWEV RQKF GGSIS  SELQ+E+AEF W +VQ+DGSLII AEN MGST 
Sbjct  696  IILLHPALGPLWEVSRQKFKGGSISSCSELQLEIAEFSWNNVQVDGSLIITAENAMGSTT  755

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
             N+NGE +LQYG RC +CKL NV+V+N GIDWNS+ N+YW++DV+R E+ K+ILHGNAEF
Sbjct  756  PNDNGEPILQYGLRCGKCKLHNVRVVNRGIDWNSKSNVYWRNDVNRLETCKIILHGNAEF  815

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA +V ++ +HVFEVPDG+K+KITPGN+G  + L  ++    ++G+W+WNY++ G+HI L
Sbjct  816  EASNVAIEEHHVFEVPDGHKLKITPGNAGLSINLETLKEEVKETGSWYWNYQLNGSHIHL  875

Query  361  ELVE  350
            + VE
Sbjct  876  QQVE  879



>ref|XP_006403032.1| hypothetical protein EUTSA_v10005783mg [Eutrema salsugineum]
 gb|ESQ44485.1| hypothetical protein EUTSA_v10005783mg [Eutrema salsugineum]
Length=888

 Score =   264 bits (675),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 150/186 (81%), Gaps = 2/186 (1%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            +ILLHPALGPLWEV RQKF GGSIS  SELQ+E+AE  W +VQ+DGSLII AEN MGST 
Sbjct  699  IILLHPALGPLWEVSRQKFKGGSISNCSELQLEIAEVSWNNVQVDGSLIITAENAMGSTT  758

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +NENGE +LQYG RC +CKL NVKV+N GIDW S+ N+YW++DV+R E+ K+ILHGNAEF
Sbjct  759  INENGEPILQYGLRCGKCKLHNVKVVNQGIDWKSKSNVYWRNDVNRLETCKIILHGNAEF  818

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNS--GFEVQLNAIENRSMDSGTWFWNYKIMGTHI  368
            EA +V +QGN VFEVPDG+++KIT GNS  G  + L AI    M++G+W+WNY++ G+HI
Sbjct  819  EASNVTIQGNQVFEVPDGHRLKITQGNSDLGLSINLEAIREEVMETGSWYWNYQLDGSHI  878

Query  367  QLELVE  350
             LE VE
Sbjct  879  NLEQVE  884



>ref|XP_010516200.1| PREDICTED: uncharacterized protein LOC104791893 [Camelina sativa]
Length=885

 Score =   263 bits (672),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF GGSIS  SE+Q+E+AE  W +VQ+DGSLII AEN MGST 
Sbjct  698  LILLHPALGPLWEVSRQKFKGGSISSCSEVQLEIAELSWNNVQVDGSLIITAENAMGSTT  757

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +N++GE +LQYG RC +CKL NVKV+N GIDWNS+ N+YW++DV+R E+ K+ILHGNAEF
Sbjct  758  INDHGEPILQYGLRCGKCKLHNVKVMNRGIDWNSKSNVYWRNDVNRLETCKIILHGNAEF  817

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA +V ++GNHVFEVPDG+ +KIT GN+G  + L A++   +++G+W+W+YK+ G+HI L
Sbjct  818  EASNVTIEGNHVFEVPDGHILKITQGNAGLSIHLEAMKEEVLETGSWYWDYKLNGSHIHL  877

Query  361  ELVE  350
            + VE
Sbjct  878  QQVE  881



>emb|CDX72178.1| BnaC08g26960D [Brassica napus]
Length=867

 Score =   262 bits (669),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 151/186 (81%), Gaps = 3/186 (2%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF GGSIS  SELQ+E+AEF W +V++ GSLII AEN MGST 
Sbjct  677  LILLHPALGPLWEVSRQKFKGGSISSCSELQLEIAEFSWNNVEVHGSLIINAENAMGSTT  736

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +NE  E +LQYG RC +CKL NVKV+N GIDWNS+ N+YW++DV+R E+ K+ILHGNAEF
Sbjct  737  INEKAEPILQYGLRCGKCKLHNVKVVNRGIDWNSKSNVYWRNDVNRLETCKIILHGNAEF  796

Query  541  EAMDVILQGNHVFEVPDGYKMKITPG---NSGFEVQLNAIENRSMDSGTWFWNYKIMGTH  371
            EA +V ++GNHVFEVPDG+++KIT G   +SG  + L AIE   M++G+W+WNYK+ G+H
Sbjct  797  EASNVTIEGNHVFEVPDGHRLKITRGRSPDSGLSINLEAIEEEVMETGSWYWNYKLNGSH  856

Query  370  IQLELV  353
            I+LE V
Sbjct  857  IRLEQV  862



>ref|XP_010427408.1| PREDICTED: uncharacterized protein LOC104712253 [Camelina sativa]
Length=889

 Score =   261 bits (667),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF GGSIS  SE+Q+E+AE  W +VQ+DGSLII AEN MGST 
Sbjct  702  LILLHPALGPLWEVSRQKFKGGSISSCSEVQLEIAELSWNNVQVDGSLIITAENAMGSTT  761

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +N++GE +LQYG RC +CKL NVKV+N GIDWNS+ N+YW++DV+R E+ K+ILHGNAEF
Sbjct  762  INDHGEPILQYGLRCGKCKLHNVKVVNRGIDWNSKSNVYWRNDVNRLETCKIILHGNAEF  821

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA +V ++GNHVFEVPDG+ MKIT GN+G  + L A++   +++G+W+W+Y++ G+HI L
Sbjct  822  EASNVTVEGNHVFEVPDGHIMKITQGNAGLSINLEAMKEGVLETGSWYWDYQLNGSHIHL  881

Query  361  ELVE  350
            + VE
Sbjct  882  QQVE  885



>gb|AAT47007.1| unknown protein [Oryza sativa Japonica Group]
Length=808

 Score =   260 bits (664),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 147/184 (80%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHPALGP W++ RQKF GGS+S+GSELQIEVAEF W+DV+LDGSLI+LA+N+MGST 
Sbjct  624  LIFLHPALGPFWDITRQKFVGGSVSQGSELQIEVAEFLWQDVELDGSLIVLADNIMGSTN  683

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
             N  GE ++ YG RC RCKL++VK++N GI+W+S +N+YWKHDV R ESVK+ILH NAEF
Sbjct  684  KNNTGEQIMHYGARCGRCKLQSVKIVNKGINWSSANNVYWKHDVERSESVKIILHENAEF  743

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV+L+GNH+FEVP G++M+I      F  +L+ I    MDSGTW+W Y + G H++L
Sbjct  744  EAKDVVLKGNHIFEVPTGHRMRIVQDGPEFVAKLDPISKEMMDSGTWYWKYAVDGAHVKL  803

Query  361  ELVE  350
            E+VE
Sbjct  804  EMVE  807



>dbj|BAJ85276.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=854

 Score =   259 bits (663),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHPALGP W++++QKF GGSI++GSELQIEVAEF W DV+LDGSLIILA+N+MGST 
Sbjct  670  LIFLHPALGPFWDIVKQKFIGGSIAKGSELQIEVAEFLWEDVELDGSLIILADNIMGSTK  729

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
             N +GE +L YG RC RCKL+NVK++N+GI+W+S  N+YWKH V R ES+K+ILHGNAEF
Sbjct  730  RNTDGEQILHYGARCGRCKLQNVKIVNEGINWDSPSNVYWKHHVERSESLKIILHGNAEF  789

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV L+GNH+FEVPDG++M +    +GF  +L+ I   +MDSG+W+W Y + G H++L
Sbjct  790  EAKDVFLKGNHMFEVPDGHRMCVFQDEAGFVGKLDPISKETMDSGSWYWEYSVDGAHVKL  849

Query  361  ELVE  350
             +VE
Sbjct  850  NMVE  853



>ref|XP_006292431.1| hypothetical protein CARUB_v10018646mg [Capsella rubella]
 gb|EOA25329.1| hypothetical protein CARUB_v10018646mg [Capsella rubella]
Length=879

 Score =   260 bits (664),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF GGSIS  SE+Q+E+AE  W +VQ+DGSLI+ AEN MGST 
Sbjct  692  LILLHPALGPLWEVSRQKFMGGSISSCSEVQLEIAELSWNNVQVDGSLIVTAENAMGSTT  751

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +N++GE +LQYG RC +CKL NVKV+N GIDWNS+ N+YW++DV+R E+ K+ILHGNAEF
Sbjct  752  INDHGEQILQYGLRCGKCKLHNVKVVNRGIDWNSKSNVYWRNDVNRLETCKIILHGNAEF  811

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA +V ++GNHVFEVPDG+ +KIT GN+G  + L A++   +++G+W+W+Y++ G+HI L
Sbjct  812  EASNVTVEGNHVFEVPDGHILKITQGNAGLSINLEAMKEEVLETGSWYWDYQLNGSHIHL  871

Query  361  ELVE  350
            + VE
Sbjct  872  QQVE  875



>ref|XP_003566160.2| PREDICTED: UDP-sugar pyrophosphorylase [Brachypodium distachyon]
Length=865

 Score =   259 bits (663),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHPALGP W++I+QKF GGSIS+GSELQIEVAEF W++V+LDGSLII+A+N+MGST 
Sbjct  681  LIFLHPALGPFWDIIKQKFVGGSISKGSELQIEVAEFLWKNVELDGSLIIVADNIMGSTK  740

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
             N +GE +L YG R  RCKL+NVK++N+GI+W S  N+YWKHDV R ES+K+ILHGNAEF
Sbjct  741  RNTHGEQILHYGARSGRCKLQNVKIVNEGINWGSPSNVYWKHDVERSESLKIILHGNAEF  800

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV+L+GN++FEVPDG++M +    +GF V+L+ I N SMDSGTW+W Y++ G  ++L
Sbjct  801  EAKDVLLKGNNMFEVPDGHRMCLIQDKAGFAVKLDPISNESMDSGTWYWQYRVDGAQVKL  860

Query  361  ELVE  350
             +V+
Sbjct  861  NIVD  864



>gb|EEE64040.1| hypothetical protein OsJ_18869 [Oryza sativa Japonica Group]
Length=1033

 Score =   261 bits (666),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 147/184 (80%), Gaps = 0/184 (0%)
 Frame = -2

Query  901   LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
             LI LHPALGP W++ RQKF GGS+S+GSELQIEVAEF W+DV+LDGSLI+LA+N+MGST 
Sbjct  849   LIFLHPALGPFWDITRQKFVGGSVSQGSELQIEVAEFLWQDVELDGSLIVLADNIMGSTN  908

Query  721   LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
              N  GE ++ YG RC RCKL++VK++N GI+W+S +N+YWKHDV R ESVK+ILH NAEF
Sbjct  909   KNNTGEQIMHYGARCGRCKLQSVKIVNKGINWSSANNVYWKHDVERSESVKIILHENAEF  968

Query  541   EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
             EA DV+L+GNH+FEVP G++M+I      F  +L+ I    MDSGTW+W Y + G H++L
Sbjct  969   EAKDVVLKGNHIFEVPTGHRMRIVQDGPEFVAKLDPISKEMMDSGTWYWKYAVDGAHVKL  1028

Query  361   ELVE  350
             E+VE
Sbjct  1029  EMVE  1032



>gb|AFW82285.1| hypothetical protein ZEAMMB73_228026 [Zea mays]
Length=964

 Score =   260 bits (665),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 146/178 (82%), Gaps = 0/178 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHPALGP W++IRQKF GGS+S+GSELQIEVAEF W+DV+LDGS IILA+NVMGST 
Sbjct  765  LIFLHPALGPFWDIIRQKFVGGSVSKGSELQIEVAEFLWKDVELDGSFIILADNVMGSTK  824

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
             ++NGE +L YG RC RC+L++VK++N+GI+W S +N+YWKHDV R ESVK+ILHGNAEF
Sbjct  825  NSKNGEQILHYGSRCGRCRLQSVKIVNEGINWTSPNNVYWKHDVERSESVKIILHGNAEF  884

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHI  368
            EA DV+L+GNHVFEVPDG++M I    +GF V+L+ I +  MDSGTW W Y + G H 
Sbjct  885  EAKDVVLKGNHVFEVPDGHRMCIIQDRAGFVVKLDLIRDELMDSGTWHWKYAVDGVHF  942



>gb|EEC79378.1| hypothetical protein OsI_20285 [Oryza sativa Indica Group]
Length=860

 Score =   258 bits (660),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 146/184 (79%), Gaps = 0/184 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHPALGP W++ RQKF GGS+S+GSELQIEVAEF W+DV+LDGSLI+LA+N+MGST 
Sbjct  676  LIFLHPALGPFWDITRQKFVGGSVSQGSELQIEVAEFLWQDVELDGSLIVLADNIMGSTN  735

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
             N  GE ++ YG RC RCKL++VK++N GI+W+S +N+YWKHDV R ESVK+ILH NAEF
Sbjct  736  KNNTGEQIMHYGARCGRCKLRSVKIVNKGINWSSANNVYWKHDVERSESVKIILHENAEF  795

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV+L+GNH+FEVP G++M+I      F  +L+ I    MD GTW+W Y + G H++L
Sbjct  796  EAKDVVLKGNHIFEVPTGHRMRIVQDGPEFVAKLDPISKEMMDGGTWYWKYAVDGAHVKL  855

Query  361  ELVE  350
            E+VE
Sbjct  856  EMVE  859



>gb|ERN08982.1| hypothetical protein AMTR_s00153p00036670 [Amborella trichopoda]
Length=904

 Score =   255 bits (652),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 145/183 (79%), Gaps = 0/183 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            ++LLHPALGPLWEV RQKFHGG IS+GSELQIE+ EF WR+V+L+GSLII+AENV+GS  
Sbjct  720  IVLLHPALGPLWEVTRQKFHGGQISKGSELQIELTEFSWRNVELNGSLIIVAENVLGSVQ  779

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
             +ENG+ ++ YG RC RC L+N+ ++N GIDWN   N YWKH+V RFE +KV+LHGNAE 
Sbjct  780  TDENGDPLIHYGYRCGRCLLENIMIINKGIDWNCPGNTYWKHEVQRFECLKVVLHGNAEL  839

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV ++GNH FEVP+GY+++IT GN+G   ++  I+   MD+G+WFW Y +  +HI L
Sbjct  840  EAKDVTIEGNHTFEVPNGYRLQITGGNAGLSCKMIPIQTEMMDTGSWFWKYGLKDSHIHL  899

Query  361  ELV  353
            E+V
Sbjct  900  EMV  902



>ref|XP_011624475.1| PREDICTED: uncharacterized protein LOC18437115 [Amborella trichopoda]
Length=901

 Score =   255 bits (652),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 145/183 (79%), Gaps = 0/183 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            ++LLHPALGPLWEV RQKFHGG IS+GSELQIE+ EF WR+V+L+GSLII+AENV+GS  
Sbjct  717  IVLLHPALGPLWEVTRQKFHGGQISKGSELQIELTEFSWRNVELNGSLIIVAENVLGSVQ  776

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
             +ENG+ ++ YG RC RC L+N+ ++N GIDWN   N YWKH+V RFE +KV+LHGNAE 
Sbjct  777  TDENGDPLIHYGYRCGRCLLENIMIINKGIDWNCPGNTYWKHEVQRFECLKVVLHGNAEL  836

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV ++GNH FEVP+GY+++IT GN+G   ++  I+   MD+G+WFW Y +  +HI L
Sbjct  837  EAKDVTIEGNHTFEVPNGYRLQITGGNAGLSCKMIPIQTEMMDTGSWFWKYGLKDSHIHL  896

Query  361  ELV  353
            E+V
Sbjct  897  EMV  899



>ref|XP_010504480.1| PREDICTED: uncharacterized protein LOC104781493 isoform X1 [Camelina 
sativa]
Length=885

 Score =   253 bits (646),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 149/184 (81%), Gaps = 1/184 (1%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF GGSIS  SE+Q+E+AE  W +VQ+DGSLII AEN MGST 
Sbjct  699  LILLHPALGPLWEVSRQKFKGGSISSCSEVQLEIAELSWNNVQVDGSLIITAENAMGSTT  758

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +N++GE +LQYG RC +CKL NVKV+N GIDWNS+ N+YW++DV+R ES K+ILHGNAEF
Sbjct  759  INDHGEPILQYGLRCGKCKLHNVKVVNRGIDWNSKSNVYWRNDVNRLESCKIILHGNAEF  818

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA +V ++GNHVFEVPDG+ +KIT GN+   + L A++    + G+W+W+YK+ G+HI L
Sbjct  819  EASNVTVEGNHVFEVPDGHILKITQGNAVL-INLEAMKEEVSEKGSWYWDYKLNGSHIHL  877

Query  361  ELVE  350
            + VE
Sbjct  878  QQVE  881



>ref|XP_010504481.1| PREDICTED: uncharacterized protein LOC104781493 isoform X2 [Camelina 
sativa]
Length=885

 Score =   253 bits (646),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 149/184 (81%), Gaps = 1/184 (1%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF GGSIS  SE+Q+E+AE  W +VQ+DGSLII AEN MGST 
Sbjct  699  LILLHPALGPLWEVSRQKFKGGSISSCSEVQLEIAELSWNNVQVDGSLIITAENAMGSTT  758

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +N++GE +LQYG RC +CKL NVKV+N GIDWNS+ N+YW++DV+R ES K+ILHGNAEF
Sbjct  759  INDHGEPILQYGLRCGKCKLHNVKVVNRGIDWNSKSNVYWRNDVNRLESCKIILHGNAEF  818

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA +V ++GNHVFEVPDG+ +KIT GN+   + L A++    + G+W+W+YK+ G+HI L
Sbjct  819  EASNVTVEGNHVFEVPDGHILKITQGNAVL-INLEAMKEEVSEKGSWYWDYKLNGSHIHL  877

Query  361  ELVE  350
            + VE
Sbjct  878  QQVE  881



>gb|KDO68903.1| hypothetical protein CISIN_1g002690mg [Citrus sinensis]
Length=834

 Score =   252 bits (644),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALG LWEV RQKF GGS+S+GSELQIEVAEF WR+VQLDGSLII+AENVMGST 
Sbjct  680  LILLHPALGLLWEVTRQKFKGGSVSKGSELQIEVAEFLWRNVQLDGSLIIVAENVMGSTR  739

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            + +NGE++LQYG RC RCKL NVKVLN GIDW+  DN YWKHDV  FE++KVILHGNAEF
Sbjct  740  IADNGESILQYGYRCGRCKLNNVKVLNKGIDWDCGDNTYWKHDVQWFEALKVILHGNAEF  799

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGF  452
            EA DV LQGNHVFEVPDG+K+KIT GNSGF
Sbjct  800  EASDVTLQGNHVFEVPDGHKLKITSGNSGF  829



>ref|XP_010257086.1| PREDICTED: uncharacterized protein LOC104597312 isoform X3 [Nelumbo 
nucifera]
Length=855

 Score =   252 bits (644),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF+ GSIS+GSELQ+EVAEF WRDVQLDGSLI++AEN+MGST 
Sbjct  691  LILLHPALGPLWEVTRQKFYRGSISDGSELQVEVAEFLWRDVQLDGSLIVVAENIMGSTR  750

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++E GE +L YG RC RCKL+NVKVLN GIDW+S +N+YWK DV RFE++KVILHGNAEF
Sbjct  751  IDEAGEPILIYGHRCGRCKLQNVKVLNRGIDWSSSENIYWKLDVQRFEALKVILHGNAEF  810

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSG  455
            EA DV+LQGNHVFEVP+GYKM+IT GNSG
Sbjct  811  EAKDVVLQGNHVFEVPNGYKMQITAGNSG  839



>ref|XP_008811680.1| PREDICTED: uncharacterized protein LOC103722778 isoform X2 [Phoenix 
dactylifera]
Length=857

 Score =   247 bits (631),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 139/184 (76%), Gaps = 10/184 (5%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHP LGPLWE+ RQKF GGSIS+GSELQIE          L+GSLII+AEN+MGS  
Sbjct  683  LIFLHPGLGPLWEITRQKFFGGSISKGSELQIE----------LEGSLIIVAENIMGSIR  732

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +++NGE VLQYG RC RCKL+NVKV N GIDW S +N+YWKHDV R E +K+ILHGNAEF
Sbjct  733  MSQNGEPVLQYGDRCGRCKLQNVKVQNKGIDWTSPNNVYWKHDVQRLECLKIILHGNAEF  792

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGTHIQL  362
            EA DV+LQG+HVFEVP G +M I+   +G   +L  I    MDSG+WFW YKI GTHI L
Sbjct  793  EATDVVLQGSHVFEVPSGCRMCISSDTTGIVGKLEPIREDLMDSGSWFWKYKIKGTHIHL  852

Query  361  ELVE  350
            E++E
Sbjct  853  EMIE  856



>ref|NP_001055800.2| Os05g0468600 [Oryza sativa Japonica Group]
 dbj|BAF17714.2| Os05g0468600 [Oryza sativa Japonica Group]
Length=850

 Score =   246 bits (629),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 145/191 (76%), Gaps = 8/191 (4%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHPALGP W++ RQKF GGS+S+GSELQIEVAEF W+DV+LDGSLI+LA+N+MGST 
Sbjct  629  LIFLHPALGPFWDITRQKFVGGSVSQGSELQIEVAEFLWQDVELDGSLIVLADNIMGSTN  688

Query  721  LNENGETVLQYGK--------RCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKV  566
             N  GE ++ Y +        RC RCKL++VK++N GI+W+S +N+YWKHDV R ESVK+
Sbjct  689  KNNTGEQIMHYDETQNSMVVERCGRCKLQSVKIVNKGINWSSANNVYWKHDVERSESVKI  748

Query  565  ILHGNAEFEAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYK  386
            ILH NAEFEA DV+L+GNH+FEVP G++M+I      F  +L+ I    MDSGTW+W Y 
Sbjct  749  ILHENAEFEAKDVVLKGNHIFEVPTGHRMRIVQDGPEFVAKLDPISKEMMDSGTWYWKYA  808

Query  385  IMGTHIQLELV  353
            + G H++LE+ 
Sbjct  809  VDGAHVKLEMA  819



>ref|XP_007008905.1| UDP-glucose pyrophosphorylase 3 isoform 2, partial [Theobroma 
cacao]
 gb|EOY17715.1| UDP-glucose pyrophosphorylase 3 isoform 2, partial [Theobroma 
cacao]
Length=840

 Score =   245 bits (626),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHPALGPLWEV RQKF GGSIS+GSELQIEVAEF WR+VQL+GS+II A+N+MGST 
Sbjct  691  LIFLHPALGPLWEVTRQKFSGGSISKGSELQIEVAEFLWRNVQLEGSMIIAADNIMGSTR  750

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++ENGE  L+YG R  RCKL NVKVLNDGIDW+S DN+YWKHDV RFE++KVILHGNAEF
Sbjct  751  VDENGEPTLRYGHRYGRCKLHNVKVLNDGIDWSSGDNVYWKHDVRRFEALKVILHGNAEF  810

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSG  455
            EA +V +QGNH+FEVPDGY+MKIT G+ G
Sbjct  811  EASNVTIQGNHLFEVPDGYRMKITSGDPG  839



>ref|XP_008354177.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103417800 
[Malus domestica]
Length=686

 Score =   215 bits (548),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALGPLWEV RQKF+GGSISEGSELQ+EVAEF WR+VQLDGSLI+ A NVMGST 
Sbjct  547  LILLHPALGPLWEVTRQKFYGGSISEGSELQVEVAEFLWRNVQLDGSLIVEAXNVMGSTR  606

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++++GE +LQYG RC RCKL+NVKVLNDGIDWN  DN+YWKHDV R E+ KV+LHGNAEF
Sbjct  607  IDQSGEPILQYGHRCGRCKLQNVKVLNDGIDWNFEDNVYWKHDVKRIEACKVVLHGNAEF  666

Query  541  EAMDVILQ  518
             A DV LQ
Sbjct  667  GATDVTLQ  674



>gb|KDO68904.1| hypothetical protein CISIN_1g002690mg [Citrus sinensis]
Length=811

 Score =   211 bits (536),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LILLHPALG LWEV RQKF GGS+S+GSELQIEVAEF WR+VQLDGSLII+AENVMGST 
Sbjct  680  LILLHPALGLLWEVTRQKFKGGSVSKGSELQIEVAEFLWRNVQLDGSLIIVAENVMGSTR  739

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            + +NGE++LQYG RC RCKL NVKVLN GIDW+  DN YWKHDV  FE++KVILHGNAEF
Sbjct  740  IADNGESILQYGYRCGRCKLNNVKVLNKGIDWDCGDNTYWKHDVQWFEALKVILHGNAEF  799

Query  541  EAMDVILQ  518
            EA DV LQ
Sbjct  800  EASDVTLQ  807



>ref|XP_007008904.1| UDP-glucose pyrophosphorylase 3 isoform 1 [Theobroma cacao]
 gb|EOY17714.1| UDP-glucose pyrophosphorylase 3 isoform 1 [Theobroma cacao]
Length=830

 Score =   209 bits (532),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHPALGPLWEV RQKF GGSIS+GSELQIEVAEF WR+VQL+GS+II A+N+MGST 
Sbjct  694  LIFLHPALGPLWEVTRQKFSGGSISKGSELQIEVAEFLWRNVQLEGSMIIAADNIMGSTR  753

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            ++ENGE  L+YG R  RCKL NVKVLNDGIDW+S DN+YWKHDV RFE++KVILHGNAEF
Sbjct  754  VDENGEPTLRYGHRYGRCKLHNVKVLNDGIDWSSGDNVYWKHDVRRFEALKVILHGNAEF  813

Query  541  EAMDVILQGNHVF  503
            EA +V +Q   + 
Sbjct  814  EASNVTIQAAAIL  826



>gb|KJB74379.1| hypothetical protein B456_011G291300 [Gossypium raimondii]
Length=821

 Score =   207 bits (526),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHPALGP+WEV RQKF GGSIS+GSELQ+EVAEF WR++QLDGS+II+AEN+MGST 
Sbjct  685  LIFLHPALGPVWEVTRQKFSGGSISKGSELQVEVAEFLWRNIQLDGSMIIVAENIMGSTR  744

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +++ GE +LQ+G RC RCKL NV VLNDG+DW S DN+YWKHD+ R E++KVILHGNAEF
Sbjct  745  IDDKGELILQHGHRCGRCKLCNVTVLNDGVDWTSGDNVYWKHDIRRSEALKVILHGNAEF  804

Query  541  EAMDVILQ  518
            EA +VI+Q
Sbjct  805  EAYNVIIQ  812



>ref|XP_007008907.1| UDP-glucose pyrophosphorylase 3 isoform 4, partial [Theobroma 
cacao]
 gb|EOY17717.1| UDP-glucose pyrophosphorylase 3 isoform 4, partial [Theobroma 
cacao]
Length=833

 Score =   204 bits (520),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHPALGPLWEV RQKF GGSIS+GSELQIEVAEF WR+VQL+GS+II A+N+MGST 
Sbjct  691  LIFLHPALGPLWEVTRQKFSGGSISKGSELQIEVAEFLWRNVQLEGSMIIAADNIMGSTR  750

Query  721  LNENGETVLQYG-KRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAE  545
            ++ENGE  L+YG  R  RCKL NVKVLNDGIDW+S DN+YWKHDV RFE++KVILHGNAE
Sbjct  751  VDENGEPTLRYGHSRYGRCKLHNVKVLNDGIDWSSGDNVYWKHDVRRFEALKVILHGNAE  810

Query  544  FEAMDVILQ  518
            FEA +V +Q
Sbjct  811  FEASNVTIQ  819



>ref|XP_008656383.1| PREDICTED: uncharacterized protein LOC103635785 isoform X2 [Zea 
mays]
Length=827

 Score =   202 bits (514),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHPALGP W++IRQKF GGS+S+GSELQIEVAEF W+DV+LDGS IILA+NVMGST 
Sbjct  688  LIFLHPALGPFWDIIRQKFVGGSVSKGSELQIEVAEFLWKDVELDGSFIILADNVMGSTK  747

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
             ++NGE +L YG RC RC+L++VK++N+GI+W S +N+YWKHDV R ESVK+ILHGNAEF
Sbjct  748  NSKNGEQILHYGSRCGRCRLQSVKIVNEGINWTSPNNVYWKHDVERSESVKIILHGNAEF  807

Query  541  EAMDVILQ  518
            EA DV+L+
Sbjct  808  EAKDVVLK  815



>ref|XP_002988988.1| hypothetical protein SELMODRAFT_159835 [Selaginella moellendorffii]
 gb|EFJ10017.1| hypothetical protein SELMODRAFT_159835 [Selaginella moellendorffii]
Length=742

 Score =   179 bits (455),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 125/185 (68%), Gaps = 10/185 (5%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            + LLHPA+GPLW + RQK +GGSI +GSE+Q+E++E  W +V + GSL++ AEN+MG+  
Sbjct  551  IALLHPAIGPLWNIFRQKIYGGSIRKGSEVQLEISELSWTNVDVSGSLVVEAENIMGTVK  610

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
                 + +L YG+   RC+  NV+V N GIDW    N+YW++ V R ES+K+IL G +EF
Sbjct  611  -----DGILHYGEGLGRCRFHNVQVSNQGIDWKCSTNVYWQNKVSRHESLKIILKGCSEF  665

Query  541  EAMDVILQGNHVFEVPDGYKMKITP-GNSGFEVQLNAIENRSMDSGTWFWNYKIM-GTHI  368
            +A DV+++G+HVFEVPDG+KM++ P G +GF   L  +   S    +W W Y +     +
Sbjct  666  DASDVVIKGSHVFEVPDGHKMRVRPSGPTGFSCTLERLPESSR---SWAWKYAMRENGEV  722

Query  367  QLELV  353
            +LE+V
Sbjct  723  ELEMV  727



>ref|XP_002975099.1| hypothetical protein SELMODRAFT_150184 [Selaginella moellendorffii]
 gb|EFJ23884.1| hypothetical protein SELMODRAFT_150184 [Selaginella moellendorffii]
Length=745

 Score =   177 bits (450),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 126/187 (67%), Gaps = 10/187 (5%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            + LLHPA+GPLW + RQK +GGSI +GSE+Q+E++E  W +V + GSL++ AEN+MG+  
Sbjct  554  IALLHPAIGPLWNIFRQKIYGGSIRKGSEVQLEISELSWTNVDVSGSLVVEAENIMGTVK  613

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
                 + +L YG+   RC+  NV+V N GIDW    N+YW++ V R ES+K+IL G +EF
Sbjct  614  -----DGILHYGEGLGRCRFHNVQVSNQGIDWKCSTNVYWQNKVSRHESLKIILKGCSEF  668

Query  541  EAMDVILQGNHVFEVPDGYKMKI-TPGNSGFEVQLNAIENRSMDSGTWFWNYKIM-GTHI  368
            +A DV+++G+HVFEVPDG+KM++   G +GF   L  +   S    +W W Y +     +
Sbjct  669  DASDVVIKGSHVFEVPDGHKMRVRRSGPTGFSCTLERLPESSR---SWAWKYAMRENGEV  725

Query  367  QLELVES  347
            +LE+VE+
Sbjct  726  ELEMVEN  732



>gb|EPS73539.1| hypothetical protein M569_01218, partial [Genlisea aurea]
Length=109

 Score =   164 bits (416),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = -2

Query  715  ENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEA  536
            E GE ++QYG+R +RC+L+NV VLNDGIDWNS DN+YWKHDV RFE ++V+L+GNAEFEA
Sbjct  1    EAGEPIIQYGRRSARCRLENVTVLNDGIDWNSGDNVYWKHDVKRFECLQVVLNGNAEFEA  60

Query  535  MDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNY  389
            +DV + GNHVF VP G+ MKIT G SG +++LN I N S+D+GTWFWNY
Sbjct  61   IDVTIHGNHVFNVPGGHTMKITSGVSGLDIELNPIPNESIDTGTWFWNY  109



>ref|XP_002949328.1| hypothetical protein VOLCADRAFT_59132 [Volvox carteri f. nagariensis]
 gb|EFJ49821.1| hypothetical protein VOLCADRAFT_59132, partial [Volvox carteri 
f. nagariensis]
Length=723

 Score =   158 bits (400),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 109/180 (61%), Gaps = 7/180 (4%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            + L HPALGPLW+VI QK  GGS++ GSEL +EVAE   + + LDGSL +   +  G   
Sbjct  502  IFLFHPALGPLWDVISQKIVGGSMAHGSELVLEVAEARLQQLHLDGSLEVRGADSGGGMS  561

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
                   +L+Y +RC R +L NV+V+N GIDW + DN+YWKH V R ES K++L G +EF
Sbjct  562  PAPGSAGLLRYSRRCGRVQLVNVRVVNAGIDWEAPDNVYWKHQVSRRESCKIVLLGQSEF  621

Query  541  EAMDVILQGNHVFEVPDGYKMKITP---GNSGFEVQLNAI-ENRSMDSG---TWFWNYKI  383
            EA DV + G H F VPDG+++ +T    G  G   QL  +    S+  G   +W W Y +
Sbjct  622  EAHDVTISGAHTFVVPDGFRLTVTAAGDGVGGLRTQLAPLHPAASLMPGYEPSWDWIYSM  681



>emb|CCB89762.1| putative uncharacterized protein [Simkania negevensis Z]
Length=730

 Score =   150 bits (378),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 106/173 (61%), Gaps = 9/173 (5%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            L+  HPALGP + +IRQK  GG I  GSELQ+E+A+   + + LDGSL+I A+N+MG   
Sbjct  557  LMSYHPALGPFYSIIRQKIQGGEIRYGSELQLEIADLEMKSLFLDGSLLIFADNLMG---  613

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
             +++    L Y  R  +C LKNV++ N GIDWN+ D+L+WKH++ R  S+ + L G++ F
Sbjct  614  -HKDSHGQLVYSNRTGQCSLKNVRIENGGIDWNAEDHLFWKHEIKRRASLTIHLQGHSRF  672

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKI  383
            EA +V  QG+ + EVPDG  + +T  N          E R +     FW Y+I
Sbjct  673  EAENVTFQGDQMIEVPDGVHLIVTEQNGKLHY-----ERRLLSEDESFWTYQI  720



>ref|WP_041419450.1| hypothetical protein, partial [Simkania negevensis]
Length=613

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 105/171 (61%), Gaps = 9/171 (5%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            L+  HPALGP + +IRQK  GG I  GSELQ+E+A+   + + LDGSL+I A+N+MG   
Sbjct  452  LMSYHPALGPFYSIIRQKIQGGEIRYGSELQLEIADLEMKSLFLDGSLLIFADNLMGHK-  510

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
             + +G+ V  Y  R  +C LKNV++ N GIDWN+ D+L+WKH++ R  S+ + L G++ F
Sbjct  511  -DSHGQLV--YSNRTGQCSLKNVRIENGGIDWNAEDHLFWKHEIKRRASLTIHLQGHSRF  567

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNY  389
            EA +V  QG+ + EVPDG  + +T  N          E R +     FW Y
Sbjct  568  EAENVTFQGDQMIEVPDGVHLIVTEQNGKLHY-----ERRLLSEDESFWTY  613



>ref|XP_011402066.1| hypothetical protein F751_6536 [Auxenochlorella protothecoides]
 gb|KFM29017.1| hypothetical protein F751_6536 [Auxenochlorella protothecoides]
Length=547

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/196 (38%), Positives = 111/196 (57%), Gaps = 16/196 (8%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAEN------  740
            + L HPALGPLW V+ QK  GG ++  +ELQ+EVAE   + + L+GSL++LA++      
Sbjct  346  IFLYHPALGPLWSVVAQKLRGGRLAPRAELQLEVAEADVQGLDLEGSLLVLADDPCDGEA  405

Query  739  -VMGSTMLNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVI  563
             V G+   N +    L +  RC R +L+++ V N G+D+    N+YW+H V R  + +V 
Sbjct  406  EVGGACAENPDRHPRLTFSSRCGRLRLRDLAVRNAGVDYADPSNVYWRHAVARHAACRVH  465

Query  562  LHGNAEFEAMDVILQGNHVFEVPDGYKMKITPGNS--GFEVQLNAIENRSMDSGTWFWNY  389
            LHG+AE +A  V L G+  F VPDG+++ + P  S  G+   L  I   S     W W Y
Sbjct  466  LHGHAELDAAGVTLVGDLDFHVPDGHRLTLRPDASPRGWSAVLEPIAAPS-----WNWRY  520

Query  388  KIM--GTHIQLELVES  347
             +   GT + L L E+
Sbjct  521  ALGEDGTGVVLSLEEA  536



>ref|WP_006340614.1| hypothetical protein [Parachlamydia acanthamoebae]
 gb|EFB42236.1| hypothetical protein pah_c014o185 [Parachlamydia acanthamoebae 
str. Hall's coccus]
Length=754

 Score =   134 bits (338),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 104/171 (61%), Gaps = 10/171 (6%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            + L HPALGPL  +I QK   G ++  SEL +E+AE     V+L GSL I A+  +G   
Sbjct  579  IALFHPALGPLHSIIAQKISQGKMAHQSELILEIAEILLHHVELKGSLKIYADRALGYL-  637

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
               N E ++ YG++  +C+LKNVK+ N GID+ S+ N++WK D+H  ES+++ +HGN EF
Sbjct  638  ---NKEDIIHYGEQSGKCRLKNVKIRNKGIDF-SQKNMFWKQDIHHLESMQIKIHGNGEF  693

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNY  389
             A +V  +GN   EVP G++M+ +  ++    +   IE  S     W+W+Y
Sbjct  694  IAENVTFEGNIQIEVPHGHQMRASQKDNQIVYETTQIEKPS-----WYWSY  739



>ref|XP_007515057.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15297.1| predicted protein [Bathycoccus prasinos]
Length=895

 Score =   134 bits (338),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 103/185 (56%), Gaps = 10/185 (5%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            +  +HPA+GPLW++I QK  GGSI+  SE+++E+AE  W +V++DGSL+I   NV G   
Sbjct  717  IFAIHPAMGPLWDIIAQKLRGGSIARKSEVKLEIAELNWENVRVDGSLLITCTNVTGEGT  776

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +++           C R ++ +V VLN GIDW +  N+YW     R ES +++LHGNAE 
Sbjct  777  MSD---------IDCGRARIVDVDVLNAGIDWENEGNVYWSATYSRDESAEIVLHGNAEI  827

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIMGT-HIQ  365
            +     L GN  +EVP+G ++ I   N          E+      +W W Y   G   IQ
Sbjct  828  DIEGCALHGNCAYEVPNGKRLVIRSVNGDAGCLSETYEDIVPGVPSWRWKYAFGGKDDIQ  887

Query  364  LELVE  350
             +LV+
Sbjct  888  SDLVQ  892



>ref|XP_003057529.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH59174.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=745

 Score =   132 bits (332),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/194 (37%), Positives = 109/194 (56%), Gaps = 15/194 (8%)
 Frame = -2

Query  889  HPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNEN  710
            +PA+GPLW+V  QK  GG++ E +E+++E+AE  W+DV +DGSL+I A+   G   ++++
Sbjct  481  NPAIGPLWDVTSQKIRGGALRERAEVRLEIAEIEWKDVDVDGSLLITADAPFGEEKVDDD  540

Query  709  -----GETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAE  545
                 G+        C RC+L+ V V N G+DW++ D+  W   + R ES  V L GNAE
Sbjct  541  AGAARGKPTSFDDDACGRCRLRGVAVRNAGVDWSAPDDEAWSATLTRSESCVVRLRGNAE  600

Query  544  FEAMDVILQGNHVFEVPDGYKMKITPGNS--GFEVQLNAIENRSMD------SGTWFWNY  389
            F+A DV L G+ +++VP G+++ + P     G E  L A+     D        TW W Y
Sbjct  601  FDARDVTLSGDVMYDVPAGWRLSLRPDTDERGGE-SLGAVREEWTDLSAAGGGPTWRWAY  659

Query  388  KIM-GTHIQLELVE  350
             +  G  + L L E
Sbjct  660  DVSDGGRVGLRLEE  673



>ref|WP_013924194.1| hypothetical protein [Parachlamydia acanthamoebae]
 emb|CCB85144.1| putative uncharacterized protein [Parachlamydia acanthamoebae 
UV-7]
Length=754

 Score =   132 bits (332),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 102/171 (60%), Gaps = 10/171 (6%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            + L HPALGPL  +I QK   G ++  SEL +E+AE     V+L GSL I A+  +G   
Sbjct  579  IALFHPALGPLHSIIAQKISQGKMAHQSELILEIAEILLHHVELQGSLKIYADRALGYL-  637

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
               N E ++ YG++  +C+LKNVK+ N GID+ S+ N++WK D+H  ES+++ +HGN EF
Sbjct  638  ---NKEDIIHYGEQSGKCRLKNVKIRNKGIDF-SQKNMFWKQDIHHLESMQIKIHGNGEF  693

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNY  389
             A +V  +GN   EVP G++M+    ++         E   +   +W+W+Y
Sbjct  694  IAENVTFEGNIQIEVPHGHQMRAYQKDNQI-----VYETTQIKKPSWYWSY  739



>gb|KIA76347.1| hypothetical protein DB43_AK00070 [Parachlamydia acanthamoebae]
Length=758

 Score =   132 bits (331),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 102/171 (60%), Gaps = 10/171 (6%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            + L HPALGPL  +I QK   G ++  SEL +E+AE     V+L GSL I A+  +G   
Sbjct  583  IALFHPALGPLHSIIAQKISQGKMAHQSELILEIAEILLHHVELQGSLKIYADRALGYL-  641

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
               N E ++ YG++  +C+LKNVK+ N GID+ S+ N++WK D+H  ES+++ +HGN EF
Sbjct  642  ---NKEDIIHYGEQSGKCRLKNVKIRNKGIDF-SQKNMFWKQDIHHLESMQIKIHGNGEF  697

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNY  389
             A +V  +GN   EVP G++M+    ++         E   +   +W+W+Y
Sbjct  698  IAENVTFEGNIQIEVPHGHQMRAYQKDNQI-----VYETTQIKKPSWYWSY  743



>ref|XP_003082504.1| unnamed protein product, partial [Ostreococcus tauri]
Length=664

 Score =   131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 99/167 (59%), Gaps = 10/167 (6%)
 Frame = -2

Query  886  PALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENG  707
            P++GPLW+V+ QK  GG I +GSE+++E+AE  WRDV + GSL + A + +G      +G
Sbjct  491  PSIGPLWDVVDQKIQGGVIEKGSEVRLEIAEIEWRDVSVRGSLFVEAASPLGPA---RDG  547

Query  706  ETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDV  527
                  G  C RC+L+NV+V NDGID N   N+YW + + R E   + L G+ E +A+DV
Sbjct  548  TVYFDEGA-CGRCRLRNVRVSNDGIDRNENSNVYWSNFIARTERCSIFLEGSGELDALDV  606

Query  526  ILQGNHVFEVPDGYKMKITP-GNSGFEVQLNAIENRSMDSGTWFWNY  389
             L G+  + VPDG ++ + P G  G +   + I      S +W W+Y
Sbjct  607  TLAGDVRYVVPDGKRLTLRPDGAGGVQETWDDIV-----SPSWRWSY  648



>emb|CEG00018.1| UTP--glucose-1-phosphate uridylyltransferase, partial [Ostreococcus 
tauri]
Length=773

 Score =   131 bits (330),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 99/167 (59%), Gaps = 10/167 (6%)
 Frame = -2

Query  886  PALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENG  707
            P++GPLW+V+ QK  GG I +GSE+++E+AE  WRDV + GSL + A + +G      +G
Sbjct  600  PSIGPLWDVVDQKIQGGVIEKGSEVRLEIAEIEWRDVSVRGSLFVEAASPLGPA---RDG  656

Query  706  ETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDV  527
                  G  C RC+L+NV+V NDGID N   N+YW + + R E   + L G+ E +A+DV
Sbjct  657  TVYFDEGA-CGRCRLRNVRVSNDGIDRNENSNVYWSNFIARTERCSIFLEGSGELDALDV  715

Query  526  ILQGNHVFEVPDGYKMKITP-GNSGFEVQLNAIENRSMDSGTWFWNY  389
             L G+  + VPDG ++ + P G  G +   + I      S +W W+Y
Sbjct  716  TLAGDVRYVVPDGKRLTLRPDGAGGVQETWDDIV-----SPSWRWSY  757



>ref|XP_001420890.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO99183.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=739

 Score =   130 bits (328),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 100/167 (60%), Gaps = 10/167 (6%)
 Frame = -2

Query  886  PALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNENG  707
            P++GPLW+V+ QK  GG I +GSE+++E+AE  WRDV + GSL + + +  G+T    + 
Sbjct  566  PSIGPLWDVVEQKIQGGEIKKGSEVRLEIAEIEWRDVSVQGSLFVESSSPFGTT----SA  621

Query  706  ETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDV  527
            E+V      C RC+L NV V N GIDW+   N+YW + + R E   +++ GN EF+A DV
Sbjct  622  ESVCFDESACGRCRLNNVVVSNAGIDWSEASNVYWSNFITRRERCSIVVEGNGEFDAKDV  681

Query  526  ILQGNHVFEVPDGYKMKITP-GNSGFEVQLNAIENRSMDSGTWFWNY  389
             L+G+  + VP G ++ + P G  G +   + I   SM S  W W Y
Sbjct  682  ALEGDVRYVVPTGKRLMLRPDGAGGVQETWSDI---SMPS--WRWKY  723



>ref|XP_002502005.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63263.1| predicted protein [Micromonas sp. RCC299]
Length=486

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/186 (33%), Positives = 106/186 (57%), Gaps = 4/186 (2%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            +   +PA+GPLW+V  QK   GSI E SE+++E+AE  W DV + GSL++ A++ +G+T 
Sbjct  235  IFCANPAIGPLWQVTEQKIARGSIGERSEVRLEIAEIEWADVHVTGSLLVEADSPLGATR  294

Query  721  LNENGETVLQYGK-RCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAE  545
               +G   L + +  C RC+L++VK+ N G+DW++     W   + R E  ++ + G+ E
Sbjct  295  QTPSGAPTLVFDENECGRCRLRDVKITNAGVDWHADGTTIWSAQLTRTECCEIRVEGDGE  354

Query  544  FEAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSG--TWFWNYK-IMGT  374
            F+A  V ++G+  + VP G+++++ P        +    N +   G  TW W Y+   G 
Sbjct  355  FDAKGVTIKGDARYVVPAGWRLQLRPDRDDPGTIVERWTNLAAAGGGPTWNWAYEGGAGG  414

Query  373  HIQLEL  356
             ++L L
Sbjct  415  DVRLTL  420



>gb|KIC73590.1| hypothetical protein DB44_BC00180 [Candidatus Protochlamydia 
amoebophila]
Length=731

 Score =   122 bits (305),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 103/175 (59%), Gaps = 14/175 (8%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            L L HPALGPL+ +I+QK   G +S+GSELQIE+AE   + + L+GSLI+ +   +G   
Sbjct  553  LFLFHPALGPLYSIIQQKISFGRLSKGSELQIELAEVDLKQIDLEGSLILESSTPLGQ--  610

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
             NE G  +L YGK   RC L +V + N GID+ +    +WK+D+ R E +KV+L   AEF
Sbjct  611  YNEQG--ILHYGKE-PRCSLHHVTIKNRGIDFQNTQQ-FWKNDLIRHECMKVVLKEGAEF  666

Query  541  EAMDVILQGNHVFEVPDGYK--MKITPGNSGFEVQLNAIENRSMDSGTWFWNYKI  383
             A  + + GN  FEVP  ++  +K T GN+  E      E   +   TW W Y+I
Sbjct  667  YAEHLTIVGNQCFEVPAHHRLTLKSTSGNNWIE------ELTPIQQPTWTWLYQI  715



>emb|CAF23048.1| hypothetical protein pc0324 [Candidatus Protochlamydia amoebophila 
UWE25]
Length=731

 Score =   122 bits (305),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 103/175 (59%), Gaps = 14/175 (8%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            L L HPALGPL+ +I+QK   G +S+GSELQIE+AE   + + L+GSLI+ +   +G   
Sbjct  553  LFLFHPALGPLYSIIQQKISFGRLSKGSELQIELAEVDLKQIDLEGSLILESSTPLGQ--  610

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
             NE G  +L YGK   RC L +V + N GID+ +    +WK+D+ R E +KV+L   AEF
Sbjct  611  YNEQG--ILHYGKE-PRCSLHHVTIRNRGIDFQNTQQ-FWKNDLVRHECMKVVLKEGAEF  666

Query  541  EAMDVILQGNHVFEVPDGYK--MKITPGNSGFEVQLNAIENRSMDSGTWFWNYKI  383
             A  + + GN  FEVP  ++  +K T GN+  E      E   +   TW W Y+I
Sbjct  667  YAEHLTIVGNQCFEVPAHHRLTLKSTSGNNWIE------ELTPIQQPTWTWLYQI  715



>ref|WP_044045343.1| hypothetical protein, partial [Candidatus Protochlamydia amoebophila]
Length=738

 Score =   122 bits (305),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 103/175 (59%), Gaps = 14/175 (8%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            L L HPALGPL+ +I+QK   G +S+GSELQIE+AE   + + L+GSLI+ +   +G   
Sbjct  560  LFLFHPALGPLYSIIQQKISFGRLSKGSELQIELAEVDLKQIDLEGSLILESSTPLGQ--  617

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
             NE G  +L YGK   RC L +V + N GID+ +    +WK+D+ R E +KV+L   AEF
Sbjct  618  YNEQG--ILHYGKE-PRCSLHHVTIRNRGIDFQNTQQ-FWKNDLVRHECMKVVLKEGAEF  673

Query  541  EAMDVILQGNHVFEVPDGYK--MKITPGNSGFEVQLNAIENRSMDSGTWFWNYKI  383
             A  + + GN  FEVP  ++  +K T GN+  E      E   +   TW W Y+I
Sbjct  674  YAEHLTIVGNQCFEVPAHHRLTLKSTSGNNWIE------ELTPIQQPTWTWLYQI  722



>ref|WP_039356565.1| hypothetical protein, partial [Candidatus Protochlamydia amoebophila]
Length=729

 Score =   121 bits (304),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 103/175 (59%), Gaps = 14/175 (8%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            L L HPALGPL+ +I+QK   G +S+GSELQIE+AE   + + L+GSLI+ +   +G   
Sbjct  551  LFLFHPALGPLYSIIQQKISFGRLSKGSELQIELAEVDLKQIDLEGSLILESSTPLGQ--  608

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
             NE G  +L YGK   RC L +V + N GID+ +    +WK+D+ R E +KV+L   AEF
Sbjct  609  YNEQG--ILHYGKE-PRCSLHHVTIKNRGIDFQNTQQ-FWKNDLIRHECMKVVLKEGAEF  664

Query  541  EAMDVILQGNHVFEVPDGYK--MKITPGNSGFEVQLNAIENRSMDSGTWFWNYKI  383
             A  + + GN  FEVP  ++  +K T GN+  E      E   +   TW W Y+I
Sbjct  665  YAEHLTIVGNQCFEVPAHHRLTLKSTSGNNWIE------ELTPIQQPTWTWLYQI  713



>ref|WP_042282241.1| hypothetical protein, partial [Candidatus Protochlamydia sp. 
R18]
Length=734

 Score =   121 bits (303),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 103/175 (59%), Gaps = 14/175 (8%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            L L HPALGPL+ +I+QK   G +S+GSELQ+E+AE   + + L+GSLI+ +   +G   
Sbjct  556  LFLFHPALGPLYSIIQQKISFGRLSKGSELQVELAEVDLKQIDLEGSLILESSTPLGQ--  613

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
             NE G  +L YGK   RC L +V + N GID+ +    +WK+D+ R E +KV+L   AEF
Sbjct  614  YNEQG--ILHYGKE-PRCSLHHVTIRNRGIDFQNTQQ-FWKNDLVRHECMKVVLKEGAEF  669

Query  541  EAMDVILQGNHVFEVPDGYK--MKITPGNSGFEVQLNAIENRSMDSGTWFWNYKI  383
             A  + + GN  FEVP  ++  +K T GN+  E      E   +   TW W Y+I
Sbjct  670  YAEHLTIVGNQCFEVPAHHRLTLKSTSGNNWIE------ELTPIQQPTWTWLYQI  718



>ref|WP_042103582.1| hypothetical protein, partial [Parachlamydiaceae bacterium HS-T3]
Length=702

 Score =   119 bits (297),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 104/172 (60%), Gaps = 11/172 (6%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            +I  HP LGPL+ VI QK   G ++ GSELQ+E+ E Y   ++L+GS++I A + +G   
Sbjct  529  IIFYHPGLGPLYSVIEQKIQHGWLAFGSELQLEITELYIHQLRLEGSMMIKASHPLGHHE  588

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
             N      L Y  R  +C LKN++V N GID++++ N +WK++++R E +++ L  +AEF
Sbjct  589  KNR-----LIYSDRMGKCYLKNIEVKNKGIDFSAK-NKFWKNEIYRKEVLEIFLEEDAEF  642

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYK  386
             A ++I QG+H   VP G++M       G E+     E  S+ + +W W+Y+
Sbjct  643  YAENIIFQGSHQISVPKGHRM--VARMEGSEI---IYELASISAPSWHWHYE  689



>gb|KIC75402.1| hypothetical protein DB42_AC00080 [Neochlamydia sp. EPS4]
Length=736

 Score =   116 bits (291),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 90/138 (65%), Gaps = 5/138 (4%)
 Frame = -2

Query  892  LHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNE  713
             HPALGPL+ VI QK HGGS+S  SE+ +E++E   + V + GSL+I AEN++G    ++
Sbjct  563  FHPALGPLYSVIAQKIHGGSLSLNSEMVLEISELILQKVNIKGSLLIYAENIVG----HK  618

Query  712  NGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAM  533
            N + ++ Y ++  RC LKNV V+N GI+     + YWK  + R ES+K+ L G +EF A 
Sbjct  619  NAQGIITYSEKVGRCVLKNVYVVNRGIN-KKLSSSYWKKQIIREESLKITLKGCSEFIAE  677

Query  532  DVILQGNHVFEVPDGYKM  479
            +V L+G+   EV DG ++
Sbjct  678  NVTLEGDLEIEVADGERL  695



>ref|WP_044881648.1| hypothetical protein, partial [Neochlamydia sp. EPS4]
Length=719

 Score =   116 bits (291),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 90/138 (65%), Gaps = 5/138 (4%)
 Frame = -2

Query  892  LHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNE  713
             HPALGPL+ VI QK HGGS+S  SE+ +E++E   + V + GSL+I AEN++G    ++
Sbjct  546  FHPALGPLYSVIAQKIHGGSLSLNSEMVLEISELILQKVNIKGSLLIYAENIVG----HK  601

Query  712  NGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAM  533
            N + ++ Y ++  RC LKNV V+N GI+     + YWK  + R ES+K+ L G +EF A 
Sbjct  602  NAQGIITYSEKVGRCVLKNVYVVNRGIN-KKLSSSYWKKQIIREESLKITLKGCSEFIAE  660

Query  532  DVILQGNHVFEVPDGYKM  479
            +V L+G+   EV DG ++
Sbjct  661  NVTLEGDLEIEVADGERL  678



>gb|KIC72534.1| hypothetical protein DB41_KJ00090 [Neochlamydia sp. TUME1]
Length=736

 Score =   116 bits (291),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 90/138 (65%), Gaps = 5/138 (4%)
 Frame = -2

Query  892  LHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNE  713
             HPALGPL+ VI QK HGGS+S  SE+ +E++E   + V + GSL+I AEN++G    ++
Sbjct  563  FHPALGPLYSVIAQKIHGGSLSLNSEMVLEISELILQKVNIKGSLLIYAENIVG----HK  618

Query  712  NGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAM  533
            N + ++ Y ++  RC LKNV V+N GI+     + YWK  + R ES+K+ L G +EF A 
Sbjct  619  NAQGIITYSEKVGRCVLKNVYVVNRGIN-KKLSSSYWKKQIIREESLKITLKGCSEFIAE  677

Query  532  DVILQGNHVFEVPDGYKM  479
            +V L+G+   EV DG ++
Sbjct  678  NVTLEGDLEIEVADGERL  695



>ref|WP_039386373.1| hypothetical protein [Neochlamydia sp. TUME1]
Length=752

 Score =   116 bits (291),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 90/138 (65%), Gaps = 5/138 (4%)
 Frame = -2

Query  892  LHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNE  713
             HPALGPL+ VI QK HGGS+S  SE+ +E++E   + V + GSL+I AEN++G    ++
Sbjct  579  FHPALGPLYSVIAQKIHGGSLSLNSEMVLEISELILQKVNIKGSLLIYAENIVG----HK  634

Query  712  NGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAM  533
            N + ++ Y ++  RC LKNV V+N GI+     + YWK  + R ES+K+ L G +EF A 
Sbjct  635  NAQGIITYSEKVGRCVLKNVYVVNRGIN-KKLSSSYWKKQIIREESLKITLKGCSEFIAE  693

Query  532  DVILQGNHVFEVPDGYKM  479
            +V L+G+   EV DG ++
Sbjct  694  NVTLEGDLEIEVADGERL  711



>ref|WP_042240571.1| hypothetical protein, partial [Neochlamydia sp. S13]
Length=719

 Score =   116 bits (290),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 90/138 (65%), Gaps = 5/138 (4%)
 Frame = -2

Query  892  LHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNE  713
             HPALGPL+ VI QK HGGS+S  SE+ +E++E   + V + GSL+I AEN++G    ++
Sbjct  546  FHPALGPLYSVIAQKIHGGSLSLNSEMVLEISELILQKVNIKGSLLIYAENIVG----HK  601

Query  712  NGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAM  533
            N + ++ Y ++  RC LKNV V+N GI+     + YWK  + R ES+K+ L G +EF A 
Sbjct  602  NAQGIITYSEKVGRCVLKNVYVVNRGIN-KKLSSSYWKKQIIREESLKITLKGCSEFIAE  660

Query  532  DVILQGNHVFEVPDGYKM  479
            +V L+G+   EV DG ++
Sbjct  661  NVTLEGDLEIEVADGERL  678



>emb|CDZ79581.1| hypothetical protein BN1013_00075 [Chlamydia sp. 'Rubis']
Length=713

 Score =   114 bits (286),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 95/171 (56%), Gaps = 18/171 (11%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            L+ L P+LGPL  ++ QK  GGSI E SEL +E+AE    ++ LDGSL+ILA        
Sbjct  546  LVNLIPSLGPLNAIVGQKIRGGSIQEKSELHLEIAEIEIENLTLDGSLVILA--------  597

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
                 +   +   R  RC LKNVK+ N G++W + + + WK ++ R ES KVIL G +EF
Sbjct  598  ----SKQTAKLSNRTGRCLLKNVKIKNKGVNWEASEPI-WKGNIERLESFKVILEGFSEF  652

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNY  389
            EA ++   GN    VPDGY+   T  +      L +I+   ++S  W W Y
Sbjct  653  EAENIEFIGNFEIIVPDGYRYCATLKDG-----LISIDKIKINSPKWEWKY  698



>gb|AAY31019.1| low photochemical bleaching 1 protein [Chlamydomonas reinhardtii]
Length=1061

 Score =   114 bits (286),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 52/108 (48%), Positives = 71/108 (66%), Gaps = 2/108 (2%)
 Frame = -2

Query  748  AENVMGSTMLNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVK  569
            A    GS  ++  G  +L+YG+RC R ++ NV+V N GIDW S DN+YWKH V R ES K
Sbjct  876  ASAAAGSPSVSAAGGGILRYGRRCGRVQMVNVRVRNAGIDWASPDNVYWKHQVRRHESCK  935

Query  568  VILHGNAEFEAMDVILQGNHVFEVPDGYKMKIT--PGNSGFEVQLNAI  431
            V+L G +EFEA DV L G+H F VPDG+++ +T  P  +G E +L  +
Sbjct  936  VVLLGQSEFEAHDVTLTGSHTFVVPDGHRLSVTAAPDGAGIEAKLTPL  983


 Score = 73.6 bits (179),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMG  731
            + L HPALGPLW+VI QK  GGS+++GSEL +E AE    DV + GSL + AENVMG
Sbjct  746  IFLFHPALGPLWDVISQKLVGGSLAQGSELVLECAEARLVDVDITGSLQVYAENVMG  802



>gb|AAY31018.1| low photochemical bleaching 1 protein [Chlamydomonas reinhardtii]
Length=1064

 Score =   114 bits (286),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 52/108 (48%), Positives = 71/108 (66%), Gaps = 2/108 (2%)
 Frame = -2

Query  748  AENVMGSTMLNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVK  569
            A    GS  ++  G  +L+YG+RC R ++ NV+V N GIDW S DN+YWKH V R ES K
Sbjct  879  ASAAAGSPSVSAAGGGILRYGRRCGRVQMVNVRVRNAGIDWASPDNVYWKHQVRRHESCK  938

Query  568  VILHGNAEFEAMDVILQGNHVFEVPDGYKMKIT--PGNSGFEVQLNAI  431
            V+L G +EFEA DV L G+H F VPDG+++ +T  P  +G E +L  +
Sbjct  939  VVLLGQSEFEAHDVTLTGSHTFVVPDGHRLSVTAAPDGAGIEAKLTPL  986


 Score = 73.2 bits (178),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 34/57 (60%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMG  731
            + L HPALGPLW+VI QK  GGS+++GSEL +E AE    DV + GSL + AENVMG
Sbjct  751  IFLFHPALGPLWDVISQKLVGGSLAQGSELVLECAEARLVDVDIAGSLQVYAENVMG  807



>ref|WP_032125914.1| hypothetical protein, partial [Chlamydia sp. 'Diamant']
Length=725

 Score =   113 bits (282),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 103/172 (60%), Gaps = 12/172 (7%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            + L HPALGPL+ V++QK   G  ++ SELQIE+AE     + LDGSL+I + + +GS  
Sbjct  550  IFLFHPALGPLYSVVQQKIRHGRFADRSELQIELAEVNIDHLDLDGSLLIESPSPLGS--  607

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
            +NEN   +L+YG   SRC L++V + N GID+    + +WK+ + R E V++ L   AEF
Sbjct  608  INEND--LLEYGLE-SRCHLQHVTIRNKGIDYRLPQH-FWKNKLQRNECVRIHLKEGAEF  663

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSG-FEVQLNAIENRSMDSGTWFWNY  389
             A  + L GN  FEVP  +++ +   + G +  +L  IEN S     W W+Y
Sbjct  664  HAEHITLTGNCYFEVPAYHRLTLKAASDGTWAEELTKIENPS-----WSWHY  710



>gb|EKE08140.1| hypothetical protein ACD_17C00324G0001 [uncultured bacterium]
Length=158

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 88/143 (62%), Gaps = 5/143 (3%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            L L HPALGPL+ +I++K  GG    G+ +  E+A+ Y ++++++G L I AE  +G   
Sbjct  20   LFLYHPALGPLYSIIQRKIQGGHFHLGASVLFELADLYAKNLEVNGCLEIYAEKPIG---  76

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
             + + +  L + K    C L+NV + N G+DW S  + YWK ++   ESVK++L G ++F
Sbjct  77   -HYSSKGDLHFSKEAGSCILENVTIENTGVDWKS-SSPYWKMNLKTRESVKIVLKGKSKF  134

Query  541  EAMDVILQGNHVFEVPDGYKMKI  473
             A ++ LQG+H F + DG  +KI
Sbjct  135  IARNLHLQGSHTFIIEDGQTIKI  157



>gb|KJB74377.1| hypothetical protein B456_011G291300 [Gossypium raimondii]
Length=757

 Score =   109 bits (273),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            LI LHPALGP+WEV RQKF GGSIS+GSELQ+EVAEF WR++QLDGS+II+AEN+MGST 
Sbjct  685  LIFLHPALGPVWEVTRQKFSGGSISKGSELQVEVAEFLWRNIQLDGSMIIVAENIMGSTR  744

Query  721  LNENGETVLQY  689
            +++ G   + Y
Sbjct  745  IDDKGVEDVSY  755



>emb|CDR34196.1| Conserved hypothetical protein [Criblamydia sequanensis CRIB-18]
Length=706

 Score =   107 bits (266),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 104/174 (60%), Gaps = 13/174 (7%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            + L HP LGPL+++I QK   G I + SEL +E++E + RD+ L+GSL++ A++  G   
Sbjct  536  IFLYHPGLGPLYDIICQKIQKGKIYKKSELILEISEIFIRDLTLEGSLVVDAKSPFG---  592

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
              +  E+  ++ ++ +R +L+NV V+N G+   S    Y   +  R ESVK+IL+G +EF
Sbjct  593  --KRAES--RFSEKAARVRLENVSVINKGLKLESPIG-YPAGNFKREESVKIILNGFSEF  647

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIM  380
            +A +V+ +G+ V E+P+GY  K+T    G +++        +D  +W + Y  +
Sbjct  648  QAKNVVFKGDQVIEIPEGY--KVTAFEEGGKIKF---LKEKIDRPSWSYCYHFL  696



>ref|WP_041017774.1| hypothetical protein, partial [Criblamydia sequanensis]
Length=708

 Score =   107 bits (266),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 104/174 (60%), Gaps = 13/174 (7%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            + L HP LGPL+++I QK   G I + SEL +E++E + RD+ L+GSL++ A++  G   
Sbjct  538  IFLYHPGLGPLYDIICQKIQKGKIYKKSELILEISEIFIRDLTLEGSLVVDAKSPFG---  594

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEF  542
              +  E+  ++ ++ +R +L+NV V+N G+   S    Y   +  R ESVK+IL+G +EF
Sbjct  595  --KRAES--RFSEKAARVRLENVSVINKGLKLESPIG-YPAGNFKREESVKIILNGFSEF  649

Query  541  EAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNYKIM  380
            +A +V+ +G+ V E+P+GY  K+T    G +++        +D  +W + Y  +
Sbjct  650  QAKNVVFKGDQVIEIPEGY--KVTAFEEGGKIKF---LKEKIDRPSWSYCYHFL  698



>ref|XP_005850851.1| hypothetical protein CHLNCDRAFT_140453 [Chlorella variabilis]
 gb|EFN58749.1| hypothetical protein CHLNCDRAFT_140453 [Chlorella variabilis]
Length=414

 Score =   101 bits (251),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 79/135 (59%), Gaps = 19/135 (14%)
 Frame = -2

Query  706  ETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNA-------  548
            E  L Y +RC R +L NV+V N G+DW    N++W+H + R ES +++LHG +       
Sbjct  268  EPRLVYSERCGRLRLHNVRVENAGVDWEHPGNVWWRHSLARTESCQILLHGASGDRGRVG  327

Query  547  -------EFEAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLNAIENRSMDSGTWFWNY  389
                   EFEA DV L GN VFEVPDG++M +T G  G E++    E R ++  +W W Y
Sbjct  328  RQLTAAGEFEARDVTLAGNLVFEVPDGHRMLVTAGPDG-ELRR---EVRPLERPSWRWRY  383

Query  388  KIMGT-HIQLELVES  347
            ++     +QL+L+ES
Sbjct  384  RLGAEGQVQLDLLES  398


 Score = 69.3 bits (168),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            + L HPALGPLW+V+ QK  GGS++  +ELQ+EVAE   RDV + GSL ++A+ V+G + 
Sbjct  118  VFLAHPALGPLWQVVGQKLRGGSLAPRAELQLEVAEACLRDVHVCGSLRVMADAVLGHSE  177

Query  721  LN  716
            + 
Sbjct  178  MR  179



>ref|XP_005651201.1| nucleotide-diphospho-sugar transferase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26657.1| nucleotide-diphospho-sugar transferase [Coccomyxa subellipsoidea 
C-169]
Length=943

 Score =   102 bits (253),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 65/106 (61%), Gaps = 4/106 (4%)
 Frame = -2

Query  697  LQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAMDVILQ  518
            L +  RC R +L  V V N GIDW S DN YW+H V R E+ +++LHG +EFEA  V+L+
Sbjct  805  LVFSDRCGRVRLTGVVVRNKGIDWGSPDNCYWQHKVARKEAARIVLHGQSEFEASHVVLE  864

Query  517  GNHVFEVPDGYKMKITPGNS-GFEVQLNAIENRSMDSGTWFWNYKI  383
            G+  FEVPDGYKM ++   + G    L  +  R     +W W+Y++
Sbjct  865  GDQTFEVPDGYKMVVSAAPAGGLRRALFPLHKR---RPSWQWDYQM  907


 Score = 67.8 bits (164),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGS  728
            + L HPALGPLW+VI QK  GG++  GSEL +EVA+    DV ++GSL++ A+ V GS
Sbjct  660  IFLYHPALGPLWDVIAQKVRGGALKHGSELVLEVADAALLDVHVEGSLLVHADCVTGS  717



>gb|EKE21602.1| hypothetical protein ACD_7C00172G0003, partial [uncultured bacterium]
Length=343

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 80/145 (55%), Gaps = 11/145 (8%)
 Frame = -2

Query  892  LHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTMLNE  713
            ++P +GPL+ +I QK  GG   +GSE+Q+E+AE    ++ L GSLII        T L +
Sbjct  201  MNPMIGPLYSIICQKIKGGEFFQGSEMQLEIAEVLIENLSLKGSLII-------ETPLIK  253

Query  712  NGETVLQYGKRCSRCKLKNVKVLNDGIDWNSRDNLYWKHDVHRFESVKVILHGNAEFEAM  533
            N +  +      S C L NVK+ N GID N + N+YW++ + R +  K+IL  N++F A 
Sbjct  254  NSKKDIY---NTSSCVLTNVKIKNSGIDANYK-NIYWQNKIKRNQFFKIILEENSQFYAA  309

Query  532  DVILQGNHVFEVPDGYKMKITPGNS  458
            +V         VP  +KM I   N+
Sbjct  310  NVEFINTQEIIVPANHKMFILRQNN  334



>gb|ADI37750.1| conserved hypothetical protein [Waddlia chondrophila WSU 86-1044]
 emb|CCB90767.1| putative uncharacterized protein [Waddlia chondrophila 2032/99]
Length=696

 Score = 79.7 bits (195),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 81/156 (52%), Gaps = 24/156 (15%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            + L  P+LGP + +I +K  GG IS+ SE+ I++A+    +++L+GSL I  E+      
Sbjct  538  IFLYTPSLGPNYALIAKKIRGGEISDDSEMHIQLADVEIDNLRLEGSLSIRGES------  591

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGID-WNSRDNLYWKHDVHRFESVKVILHGNAE  545
                       G+  + C+LKNV V N GID   +RD  YWK+D  R E +++   G  E
Sbjct  592  -----------GR--AFCRLKNVAVKNRGIDRQKTRD--YWKNDPVRHELLEIFFEGKGE  636

Query  544  FEAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLN  437
            F A  V+  G     +PDG  + +T    G E+ L 
Sbjct  637  FIAEQVVFHGQQRIVIPDG--VCVTASEEGSEITLK  670



>ref|WP_041941704.1| hypothetical protein, partial [Waddlia chondrophila]
Length=641

 Score = 79.3 bits (194),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 81/156 (52%), Gaps = 24/156 (15%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQLDGSLIILAENVMGSTM  722
            + L  P+LGP + +I +K  GG IS+ SE+ I++A+    +++L+GSL I  E+      
Sbjct  483  IFLYTPSLGPNYALIAKKIRGGEISDDSEMHIQLADVEIDNLRLEGSLSIRGES------  536

Query  721  LNENGETVLQYGKRCSRCKLKNVKVLNDGID-WNSRDNLYWKHDVHRFESVKVILHGNAE  545
                       G+  + C+LKNV V N GID   +RD  YWK+D  R E +++   G  E
Sbjct  537  -----------GR--AFCRLKNVAVKNRGIDRQKTRD--YWKNDPVRHELLEIFFEGKGE  581

Query  544  FEAMDVILQGNHVFEVPDGYKMKITPGNSGFEVQLN  437
            F A  V+  G     +PDG  + +T    G E+ L 
Sbjct  582  FIAEQVVFHGQQRIVIPDG--VCVTASEEGSEITLK  615



>ref|XP_011084882.1| PREDICTED: uncharacterized protein LOC105167026 isoform X3 [Sesamum 
indicum]
Length=725

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -2

Query  901  LILLHPALGPLWEVIRQKFHGGSISEGSELQIEVAEFYWRDVQ  773
            LILLHPALGPLWEV RQKF  GSI+ GSELQIEVAEF WR+VQ
Sbjct  683  LILLHPALGPLWEVTRQKFRCGSIAMGSELQIEVAEFLWRNVQ  725



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2063602007762