BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig14082

Length=895
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009613825.1|  PREDICTED: zinc finger BED domain-containing...    409   1e-133   Nicotiana tomentosiformis
ref|XP_009761601.1|  PREDICTED: zinc finger BED domain-containing...    404   4e-131   Nicotiana sylvestris
ref|XP_009791008.1|  PREDICTED: zinc finger BED domain-containing...    401   6e-131   Nicotiana sylvestris
ref|XP_009621122.1|  PREDICTED: zinc finger BED domain-containing...    401   6e-131   Nicotiana tomentosiformis
ref|XP_010312124.1|  PREDICTED: zinc finger BED domain-containing...    390   4e-126   Solanum lycopersicum
ref|XP_010313787.1|  PREDICTED: zinc finger BED domain-containing...    389   2e-124   
ref|XP_010313784.1|  PREDICTED: zinc finger BED domain-containing...    389   2e-124   
ref|XP_010313785.1|  PREDICTED: zinc finger BED domain-containing...    389   2e-124   
ref|XP_010313781.1|  PREDICTED: zinc finger BED domain-containing...    389   4e-124   Solanum lycopersicum
ref|XP_011078385.1|  PREDICTED: zinc finger BED domain-containing...    382   9e-124   Sesamum indicum [beniseed]
emb|CDP10447.1|  unnamed protein product                                368   3e-121   Coffea canephora [robusta coffee]
ref|XP_012081198.1|  PREDICTED: zinc finger BED domain-containing...    340   4e-108   Jatropha curcas
ref|XP_011457833.1|  PREDICTED: zinc finger BED domain-containing...    334   2e-103   Fragaria vesca subsp. vesca
ref|XP_011457831.1|  PREDICTED: zinc finger BED domain-containing...    334   3e-103   Fragaria vesca subsp. vesca
gb|KHN15060.1|  Putative AC transposase                                 337   5e-103   Glycine soja [wild soybean]
ref|XP_007155048.1|  hypothetical protein PHAVU_003G168600g             335   5e-102   Phaseolus vulgaris [French bean]
gb|KJB64715.1|  hypothetical protein B456_010G061500                    325   6e-102   Gossypium raimondii
gb|KJB23615.1|  hypothetical protein B456_004G107300                    324   8e-102   Gossypium raimondii
ref|XP_010656463.1|  PREDICTED: zinc finger BED domain-containing...    324   1e-101   Vitis vinifera
ref|XP_010047980.1|  PREDICTED: zinc finger BED domain-containing...    323   2e-101   Eucalyptus grandis [rose gum]
gb|KHN03605.1|  Putative AC transposase                                 332   3e-101   Glycine soja [wild soybean]
gb|KJB64716.1|  hypothetical protein B456_010G061600                    322   6e-101   Gossypium raimondii
ref|XP_007013535.1|  BED zinc finger,hAT family dimerization doma...    320   3e-100   
ref|XP_007013534.1|  BED zinc finger,hAT family dimerization doma...    320   1e-99    
gb|KDO73493.1|  hypothetical protein CISIN_1g002915mg                   323   1e-99    Citrus sinensis [apfelsine]
emb|CBI28241.3|  unnamed protein product                                322   2e-99    Vitis vinifera
ref|XP_004493926.1|  PREDICTED: uncharacterized protein LOC101507...    328   2e-99    
gb|EPS67926.1|  hypothetical protein M569_06846                         317   6e-99    Genlisea aurea
ref|XP_011655423.1|  PREDICTED: zinc finger BED domain-containing...    317   8e-99    Cucumis sativus [cucumbers]
ref|XP_006453082.1|  hypothetical protein CICLE_v10007308mg             324   1e-98    Citrus clementina [clementine]
ref|XP_011655416.1|  PREDICTED: zinc finger BED domain-containing...    317   2e-98    Cucumis sativus [cucumbers]
ref|XP_011655412.1|  PREDICTED: zinc finger BED domain-containing...    317   5e-98    Cucumis sativus [cucumbers]
ref|XP_007138404.1|  hypothetical protein PHAVU_009G205900g             318   9e-98    Phaseolus vulgaris [French bean]
gb|EYU34976.1|  hypothetical protein MIMGU_mgv1a002172mg                314   2e-97    Erythranthe guttata [common monkey flower]
ref|XP_010687925.1|  PREDICTED: zinc finger BED domain-containing...    319   6e-97    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010687924.1|  PREDICTED: zinc finger BED domain-containing...    319   9e-97    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010250193.1|  PREDICTED: zinc finger BED domain-containing...    310   1e-96    Nelumbo nucifera [Indian lotus]
ref|XP_012081197.1|  PREDICTED: zinc finger BED domain-containing...    310   2e-96    Jatropha curcas
gb|KGN65126.1|  hypothetical protein Csa_1G229510                       312   2e-96    Cucumis sativus [cucumbers]
ref|XP_008242815.1|  PREDICTED: putative AC transposase isoform X2      310   7e-96    Prunus mume [ume]
ref|XP_008242814.1|  PREDICTED: putative AC transposase isoform X1      310   1e-95    Prunus mume [ume]
ref|XP_007203781.1|  hypothetical protein PRUPE_ppa001983mg             309   1e-95    Prunus persica
ref|XP_007203782.1|  hypothetical protein PRUPE_ppa001983mg             310   1e-95    Prunus persica
ref|XP_008457064.1|  PREDICTED: putative AC transposase                 307   2e-95    Cucumis melo [Oriental melon]
ref|XP_011648699.1|  PREDICTED: zinc finger BED domain-containing...    307   3e-95    Cucumis sativus [cucumbers]
ref|XP_009363984.1|  PREDICTED: zinc finger BED domain-containing...    308   6e-94    Pyrus x bretschneideri [bai li]
ref|XP_009363983.1|  PREDICTED: zinc finger BED domain-containing...    308   6e-94    
ref|XP_011017829.1|  PREDICTED: zinc finger BED domain-containing...    301   3e-93    Populus euphratica
ref|XP_002325202.1|  hypothetical protein POPTR_0018s12690g             300   9e-93    Populus trichocarpa [western balsam poplar]
ref|XP_010241568.1|  PREDICTED: zinc finger BED domain-containing...    300   1e-92    Nelumbo nucifera [Indian lotus]
ref|XP_010535860.1|  PREDICTED: zinc finger BED domain-containing...    287   5e-88    Tarenaya hassleriana [spider flower]
ref|XP_006385302.1|  hypothetical protein POPTR_0003s02610g             281   1e-85    
emb|CAN68819.1|  hypothetical protein VITISV_023069                     265   5e-85    Vitis vinifera
ref|XP_010541714.1|  PREDICTED: zinc finger BED domain-containing...    278   2e-84    Tarenaya hassleriana [spider flower]
ref|XP_010541713.1|  PREDICTED: zinc finger BED domain-containing...    278   2e-84    Tarenaya hassleriana [spider flower]
emb|CBI36351.3|  unnamed protein product                                267   3e-84    Vitis vinifera
ref|NP_001241846.1|  uncharacterized protein LOC100857052               264   9e-83    
gb|ABA18109.1|  hAT-like transposase                                    274   1e-82    Arabidopsis arenosa
ref|XP_002875576.1|  hypothetical protein ARALYDRAFT_323059             273   1e-82    Arabidopsis lyrata subsp. lyrata
ref|XP_006279357.1|  hypothetical protein CARUB_v10008021mg             273   2e-82    Capsella rubella
ref|XP_010514702.1|  PREDICTED: zinc finger BED domain-containing...    273   2e-82    Camelina sativa [gold-of-pleasure]
ref|XP_006419173.1|  hypothetical protein EUTSA_v10002435mg             273   3e-82    Eutrema salsugineum [saltwater cress]
ref|XP_010496529.1|  PREDICTED: zinc finger BED domain-containing...    272   3e-82    Camelina sativa [gold-of-pleasure]
gb|AAS16893.2|  putative hAT family dimerisation domain containin...    262   5e-82    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010236763.1|  PREDICTED: zinc finger BED domain-containing...    258   3e-81    
ref|XP_010425789.1|  PREDICTED: zinc finger BED domain-containing...    270   3e-81    Camelina sativa [gold-of-pleasure]
ref|XP_008776870.1|  PREDICTED: zinc finger BED domain-containing...    270   4e-81    Phoenix dactylifera
ref|NP_189803.1|  BED zinc finger and hAT dimerization domain-con...    270   5e-81    Arabidopsis thaliana [mouse-ear cress]
gb|AAW28145.1|  hAT-like transposase                                    270   5e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010097200.1|  Putative AC transposase                            270   7e-81    Morus notabilis
dbj|BAK01733.1|  predicted protein                                      269   2e-80    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010063482.1|  PREDICTED: zinc finger BED domain-containing...    270   3e-80    Eucalyptus grandis [rose gum]
ref|NP_001056444.1|  Os05g0583100                                       262   3e-80    
ref|XP_009390780.1|  PREDICTED: zinc finger BED domain-containing...    268   3e-80    Musa acuminata subsp. malaccensis [pisang utan]
gb|ACN26356.1|  unknown                                                 263   5e-80    Zea mays [maize]
ref|XP_010654811.1|  PREDICTED: zinc finger BED domain-containing...    266   1e-79    Vitis vinifera
emb|CDO98171.1|  unnamed protein product                                266   1e-79    Coffea canephora [robusta coffee]
ref|XP_009139828.1|  PREDICTED: zinc finger BED domain-containing...    265   1e-79    Brassica rapa
gb|ABA18094.1|  hAT-like transposase                                    266   1e-79    Olimarabidopsis pumila
ref|XP_010230409.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    256   2e-79    
ref|XP_009415017.1|  PREDICTED: zinc finger BED domain-containing...    264   6e-79    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX74476.1|  BnaA04g09130D                                          265   6e-79    
ref|XP_009757867.1|  PREDICTED: zinc finger BED domain-containing...    263   1e-78    Nicotiana sylvestris
ref|XP_008643588.1|  PREDICTED: LOC100281046 isoform X1                 265   1e-78    Zea mays [maize]
ref|NP_001147437.1|  LOC100281046                                       265   1e-78    Zea mays [maize]
ref|XP_009757855.1|  PREDICTED: zinc finger BED domain-containing...    264   1e-78    Nicotiana sylvestris
emb|CDY37871.1|  BnaC04g31350D                                          262   2e-78    Brassica napus [oilseed rape]
ref|NP_001174288.1|  Os05g0239150                                       264   2e-78    
ref|NP_001051173.1|  Os03g0733400                                       264   2e-78    
ref|XP_011081954.1|  PREDICTED: zinc finger BED domain-containing...    262   2e-78    Sesamum indicum [beniseed]
ref|XP_009594303.1|  PREDICTED: zinc finger BED domain-containing...    262   3e-78    Nicotiana tomentosiformis
ref|XP_011081945.1|  PREDICTED: zinc finger BED domain-containing...    262   5e-78    Sesamum indicum [beniseed]
ref|XP_011014817.1|  PREDICTED: zinc finger BED domain-containing...    265   5e-78    Populus euphratica
gb|EEE64835.1|  hypothetical protein OsJ_19692                          262   8e-78    Oryza sativa Japonica Group [Japonica rice]
gb|EEC79762.1|  hypothetical protein OsI_21153                          262   8e-78    Oryza sativa Indica Group [Indian rice]
ref|XP_008675089.1|  PREDICTED: transposon protein isoform X1           263   1e-77    Zea mays [maize]
ref|NP_001147988.1|  transposon protein                                 263   1e-77    
emb|CAN81954.1|  hypothetical protein VITISV_014020                     265   3e-77    Vitis vinifera
ref|XP_009379900.1|  PREDICTED: zinc finger BED domain-containing...    259   3e-77    
ref|XP_010906913.1|  PREDICTED: zinc finger BED domain-containing...    259   4e-77    Elaeis guineensis
ref|XP_009379895.1|  PREDICTED: zinc finger BED domain-containing...    259   6e-77    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002463929.1|  hypothetical protein SORBIDRAFT_01g009090          261   6e-77    Sorghum bicolor [broomcorn]
ref|XP_009379897.1|  PREDICTED: zinc finger BED domain-containing...    259   6e-77    Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO48633.1|  hypothetical protein CISIN_1g005485mg                   259   8e-77    Citrus sinensis [apfelsine]
ref|XP_006384324.1|  hypothetical protein POPTR_0004s12760g             261   2e-76    Populus trichocarpa [western balsam poplar]
ref|XP_010906914.1|  PREDICTED: zinc finger BED domain-containing...    258   2e-76    Elaeis guineensis
ref|XP_006384329.1|  hypothetical protein POPTR_0004s12810g             260   3e-76    Populus trichocarpa [western balsam poplar]
gb|EPS65666.1|  hypothetical protein M569_09109                         257   3e-76    Genlisea aurea
ref|XP_006427320.1|  hypothetical protein CICLE_v10025036mg             257   6e-76    Citrus clementina [clementine]
ref|XP_009392578.1|  PREDICTED: zinc finger BED domain-containing...    256   6e-76    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008790202.1|  PREDICTED: zinc finger BED domain-containing...    255   2e-75    Phoenix dactylifera
ref|XP_002325201.2|  hypothetical protein POPTR_0018s12680g             254   5e-75    
ref|XP_007215012.1|  hypothetical protein PRUPE_ppa002495mg             253   6e-75    Prunus persica
ref|NP_001151544.1|  transposon protein                                 253   4e-74    Zea mays [maize]
ref|XP_008643805.1|  PREDICTED: transposon protein isoform X1           253   4e-74    Zea mays [maize]
ref|XP_010230399.1|  PREDICTED: zinc finger BED domain-containing...    253   7e-74    Brachypodium distachyon [annual false brome]
ref|NP_001136571.1|  uncharacterized protein LOC100216693               246   9e-74    
dbj|BAK03580.1|  predicted protein                                      241   1e-73    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010691104.1|  PREDICTED: zinc finger BED domain-containing...    248   1e-72    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009336302.1|  PREDICTED: zinc finger BED domain-containing...    246   3e-72    Pyrus x bretschneideri [bai li]
ref|XP_011017830.1|  PREDICTED: zinc finger BED domain-containing...    246   8e-72    Populus euphratica
emb|CDY60307.1|  BnaUnng00680D                                          243   6e-71    Brassica napus [oilseed rape]
emb|CDY48867.1|  BnaA06g03150D                                          241   2e-70    Brassica napus [oilseed rape]
ref|XP_009147901.1|  PREDICTED: zinc finger BED domain-containing...    241   2e-70    Brassica rapa
dbj|BAJ88673.1|  predicted protein                                      241   1e-69    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ96825.1|  predicted protein                                      241   2e-69    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN22430.1|  Putative AC transposase                                 235   6e-69    Glycine soja [wild soybean]
ref|XP_011652997.1|  PREDICTED: zinc finger BED domain-containing...    237   1e-68    Cucumis sativus [cucumbers]
ref|XP_011457838.1|  PREDICTED: zinc finger BED domain-containing...    233   1e-66    Fragaria vesca subsp. vesca
gb|KHN44191.1|  Putative AC transposase                                 229   8e-66    Glycine soja [wild soybean]
ref|XP_011467072.1|  PREDICTED: zinc finger BED domain-containing...    229   9e-66    Fragaria vesca subsp. vesca
ref|XP_002442948.1|  hypothetical protein SORBIDRAFT_08g005330          229   2e-65    Sorghum bicolor [broomcorn]
ref|XP_010520572.1|  PREDICTED: zinc finger BED domain-containing...    222   2e-63    Tarenaya hassleriana [spider flower]
emb|CDX89026.1|  BnaA04g01600D                                          218   5e-62    
gb|EEC79764.1|  hypothetical protein OsI_21155                          207   6e-62    Oryza sativa Indica Group [Indian rice]
ref|NP_001056445.1|  Os05g0583200                                       220   6e-62    
ref|XP_007150768.1|  hypothetical protein PHAVU_005G179200g             218   1e-61    Phaseolus vulgaris [French bean]
gb|EEE64837.1|  hypothetical protein OsJ_19694                          219   3e-61    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011625892.1|  PREDICTED: zinc finger BED domain-containing...    214   2e-60    Amborella trichopoda
gb|ERN12810.1|  hypothetical protein AMTR_s00180p00017340               216   4e-60    Amborella trichopoda
emb|CDY00623.1|  BnaC04g23020D                                          217   1e-59    
gb|KHN01319.1|  Putative AC transposase                                 211   2e-59    Glycine soja [wild soybean]
gb|EAY97185.1|  hypothetical protein OsI_19106                          202   6e-58    Oryza sativa Indica Group [Indian rice]
gb|EAY91763.1|  hypothetical protein OsI_13406                          202   9e-58    Oryza sativa Indica Group [Indian rice]
gb|EYU24629.1|  hypothetical protein MIMGU_mgv1a023531mg                206   5e-57    Erythranthe guttata [common monkey flower]
ref|XP_011628141.1|  PREDICTED: zinc finger BED domain-containing...    199   7e-55    Amborella trichopoda
gb|ERN18855.1|  hypothetical protein AMTR_s00067p00136180               199   1e-54    Amborella trichopoda
gb|KHN03603.1|  Putative AC transposase                                 180   1e-52    Glycine soja [wild soybean]
ref|XP_007135765.1|  hypothetical protein PHAVU_010G156900g             189   4e-51    Phaseolus vulgaris [French bean]
sp|Q0JMB2.3|RSLE4_ORYSJ  RecName: Full=Zinc finger BED domain-con...    189   6e-51    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001043202.2|  Os01g0518400                                       189   7e-51    
ref|XP_010649234.1|  PREDICTED: zinc finger BED domain-containing...    177   4e-50    
gb|EPS64824.1|  hypothetical protein M569_09955                         186   6e-50    Genlisea aurea
emb|CAN60218.1|  hypothetical protein VITISV_006612                     184   3e-49    Vitis vinifera
ref|XP_010644074.1|  PREDICTED: zinc finger BED domain-containing...    184   3e-49    Vitis vinifera
ref|XP_009800989.1|  PREDICTED: zinc finger BED domain-containing...    183   4e-49    Nicotiana sylvestris
emb|CDY39631.1|  BnaC05g11600D                                          184   4e-49    Brassica napus [oilseed rape]
ref|XP_011468523.1|  PREDICTED: zinc finger BED domain-containing...    176   6e-49    Fragaria vesca subsp. vesca
ref|XP_009624222.1|  PREDICTED: zinc finger BED domain-containing...    182   1e-48    Nicotiana tomentosiformis
ref|XP_010273438.1|  PREDICTED: zinc finger BED domain-containing...    182   2e-48    Nelumbo nucifera [Indian lotus]
ref|XP_010656944.1|  PREDICTED: zinc finger BED domain-containing...    181   3e-48    
ref|XP_010656943.1|  PREDICTED: zinc finger BED domain-containing...    181   3e-48    Vitis vinifera
ref|XP_010327097.1|  PREDICTED: zinc finger BED domain-containing...    181   4e-48    Solanum lycopersicum
ref|XP_010656941.1|  PREDICTED: zinc finger BED domain-containing...    181   4e-48    Vitis vinifera
gb|EEC70768.1|  hypothetical protein OsI_02196                          176   6e-48    Oryza sativa Indica Group [Indian rice]
emb|CDP06055.1|  unnamed protein product                                180   9e-48    Coffea canephora [robusta coffee]
ref|XP_012076092.1|  PREDICTED: zinc finger BED domain-containing...    178   3e-47    Jatropha curcas
gb|KHN26291.1|  Putative AC transposase                                 178   3e-47    Glycine soja [wild soybean]
ref|XP_011460363.1|  PREDICTED: zinc finger BED domain-containing...    169   3e-47    Fragaria vesca subsp. vesca
ref|XP_011465798.1|  PREDICTED: zinc finger BED domain-containing...    175   4e-47    Fragaria vesca subsp. vesca
emb|CDP18725.1|  unnamed protein product                                177   9e-47    Coffea canephora [robusta coffee]
ref|XP_010272686.1|  PREDICTED: zinc finger BED domain-containing...    176   2e-46    Nelumbo nucifera [Indian lotus]
gb|KHN23048.1|  Putative AC transposase                                 175   3e-46    Glycine soja [wild soybean]
gb|EPS60750.1|  hypothetical protein M569_14050                         174   6e-46    Genlisea aurea
ref|XP_011045538.1|  PREDICTED: zinc finger BED domain-containing...    174   1e-45    Populus euphratica
emb|CAN68697.1|  hypothetical protein VITISV_042570                     176   1e-45    Vitis vinifera
emb|CAN80126.1|  hypothetical protein VITISV_013417                     176   1e-45    Vitis vinifera
ref|XP_009610280.1|  PREDICTED: zinc finger BED domain-containing...    172   4e-45    Nicotiana tomentosiformis
ref|XP_006370067.1|  hypothetical protein POPTR_0001s39240g             172   6e-45    
ref|XP_007213601.1|  hypothetical protein PRUPE_ppa002416mg             172   6e-45    Prunus persica
ref|XP_011076819.1|  PREDICTED: zinc finger BED domain-containing...    171   1e-44    Sesamum indicum [beniseed]
ref|XP_009376729.1|  PREDICTED: zinc finger BED domain-containing...    170   2e-44    Pyrus x bretschneideri [bai li]
ref|XP_010675272.1|  PREDICTED: zinc finger BED domain-containing...    170   2e-44    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006377715.1|  hypothetical protein POPTR_0011s10500g             170   2e-44    Populus trichocarpa [western balsam poplar]
ref|XP_010327109.1|  PREDICTED: zinc finger BED domain-containing...    170   2e-44    Solanum lycopersicum
ref|XP_011082939.1|  PREDICTED: zinc finger BED domain-containing...    169   4e-44    Sesamum indicum [beniseed]
ref|XP_009783770.1|  PREDICTED: zinc finger BED domain-containing...    169   4e-44    Nicotiana sylvestris
ref|XP_011098171.1|  PREDICTED: zinc finger BED domain-containing...    169   5e-44    Sesamum indicum [beniseed]
ref|XP_011044575.1|  PREDICTED: zinc finger BED domain-containing...    169   6e-44    Populus euphratica
ref|XP_011654029.1|  PREDICTED: zinc finger BED domain-containing...    167   2e-43    Cucumis sativus [cucumbers]
gb|KJB27004.1|  hypothetical protein B456_004G271300                    167   2e-43    Gossypium raimondii
ref|XP_009596751.1|  PREDICTED: zinc finger BED domain-containing...    159   2e-43    Nicotiana tomentosiformis
ref|XP_009601856.1|  PREDICTED: zinc finger BED domain-containing...    158   4e-43    Nicotiana tomentosiformis
ref|XP_010256082.1|  PREDICTED: zinc finger BED domain-containing...    167   4e-43    Nelumbo nucifera [Indian lotus]
ref|XP_010256080.1|  PREDICTED: zinc finger BED domain-containing...    166   4e-43    Nelumbo nucifera [Indian lotus]
ref|XP_007021998.1|  BED zinc finger,hAT family dimerization doma...    166   5e-43    
ref|XP_007022001.1|  BED zinc finger,hAT family dimerization doma...    166   5e-43    
ref|XP_011460829.1|  PREDICTED: zinc finger BED domain-containing...    166   5e-43    Fragaria vesca subsp. vesca
gb|KGN55034.1|  hypothetical protein Csa_4G624400                       167   8e-43    Cucumis sativus [cucumbers]
ref|XP_010060762.1|  PREDICTED: zinc finger BED domain-containing...    165   1e-42    Eucalyptus grandis [rose gum]
ref|XP_011471014.1|  PREDICTED: zinc finger BED domain-containing...    165   1e-42    Fragaria vesca subsp. vesca
ref|XP_009764968.1|  PREDICTED: zinc finger BED domain-containing...    161   2e-42    Nicotiana sylvestris
ref|XP_010655772.1|  PREDICTED: zinc finger BED domain-containing...    156   3e-42    Vitis vinifera
emb|CDY20085.1|  BnaA01g29170D                                          164   4e-42    Brassica napus [oilseed rape]
ref|XP_007133312.1|  hypothetical protein PHAVU_011G169000g             163   6e-42    Phaseolus vulgaris [French bean]
ref|XP_010551474.1|  PREDICTED: zinc finger BED domain-containing...    163   6e-42    Tarenaya hassleriana [spider flower]
gb|KJB45835.1|  hypothetical protein B456_007G331900                    163   8e-42    Gossypium raimondii
gb|KHG07030.1|  Putative AC transposase                                 163   8e-42    Gossypium arboreum [tree cotton]
ref|XP_009116606.1|  PREDICTED: zinc finger BED domain-containing...    162   2e-41    
ref|XP_006407043.1|  hypothetical protein EUTSA_v10020233mg             162   2e-41    
ref|XP_010253168.1|  PREDICTED: zinc finger BED domain-containing...    160   5e-41    Nelumbo nucifera [Indian lotus]
ref|XP_010253170.1|  PREDICTED: zinc finger BED domain-containing...    160   5e-41    Nelumbo nucifera [Indian lotus]
gb|EYU28909.1|  hypothetical protein MIMGU_mgv1a002591mg                160   5e-41    Erythranthe guttata [common monkey flower]
ref|XP_007216990.1|  hypothetical protein PRUPE_ppa002590mg             159   1e-40    Prunus persica
ref|XP_011044854.1|  PREDICTED: zinc finger BED domain-containing...    161   1e-40    Populus euphratica
ref|XP_011044853.1|  PREDICTED: zinc finger BED domain-containing...    161   1e-40    Populus euphratica
ref|XP_008784137.1|  PREDICTED: zinc finger BED domain-containing...    152   1e-40    
ref|XP_006369306.1|  hypothetical protein POPTR_0001s20900g             162   1e-40    
ref|XP_006297141.1|  hypothetical protein CARUB_v10013145mg             159   1e-40    Capsella rubella
ref|XP_011044850.1|  PREDICTED: zinc finger BED domain-containing...    161   1e-40    Populus euphratica
ref|XP_006369308.1|  hypothetical protein POPTR_0001s20900g             161   2e-40    
ref|XP_012073147.1|  PREDICTED: zinc finger BED domain-containing...    161   2e-40    Jatropha curcas
dbj|BAB02646.1|  Ac transposase-like protein                            158   3e-40    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011007706.1|  PREDICTED: zinc finger BED domain-containing...    159   7e-40    Populus euphratica
ref|XP_011007708.1|  PREDICTED: zinc finger BED domain-containing...    159   7e-40    Populus euphratica
ref|XP_011007704.1|  PREDICTED: zinc finger BED domain-containing...    159   8e-40    Populus euphratica
ref|XP_011007707.1|  PREDICTED: zinc finger BED domain-containing...    159   8e-40    Populus euphratica
ref|XP_011007705.1|  PREDICTED: zinc finger BED domain-containing...    159   8e-40    Populus euphratica
ref|XP_011007700.1|  PREDICTED: zinc finger BED domain-containing...    159   9e-40    Populus euphratica
ref|XP_010465389.1|  PREDICTED: zinc finger BED domain-containing...    157   1e-39    Camelina sativa [gold-of-pleasure]
ref|XP_008343867.1|  PREDICTED: uncharacterized protein LOC103406660    154   2e-39    
ref|XP_010684309.1|  PREDICTED: zinc finger BED domain-containing...    154   2e-39    
ref|XP_010035892.1|  PREDICTED: zinc finger BED domain-containing...    155   3e-39    Eucalyptus grandis [rose gum]
ref|XP_010535019.1|  PREDICTED: zinc finger BED domain-containing...    155   3e-39    Tarenaya hassleriana [spider flower]
gb|KJB75465.1|  hypothetical protein B456_012G042700                    155   3e-39    Gossypium raimondii
gb|KHN18108.1|  Putative AC transposase                                 154   3e-39    Glycine soja [wild soybean]
ref|XP_009631898.1|  PREDICTED: zinc finger BED domain-containing...    154   3e-39    
ref|XP_010487284.1|  PREDICTED: zinc finger BED domain-containing...    154   7e-39    Camelina sativa [gold-of-pleasure]
gb|KHM99619.1|  Putative AC transposase                                 154   7e-39    Glycine soja [wild soybean]
ref|XP_007146367.1|  hypothetical protein PHAVU_006G034500g             154   8e-39    Phaseolus vulgaris [French bean]
ref|XP_009356659.1|  PREDICTED: zinc finger BED domain-containing...    154   9e-39    Pyrus x bretschneideri [bai li]
ref|XP_009374222.1|  PREDICTED: zinc finger BED domain-containing...    149   9e-39    
ref|XP_010502162.1|  PREDICTED: zinc finger BED domain-containing...    154   1e-38    
ref|XP_009374223.1|  PREDICTED: zinc finger BED domain-containing...    149   1e-38    
ref|XP_010502139.1|  PREDICTED: zinc finger BED domain-containing...    154   1e-38    Camelina sativa [gold-of-pleasure]
ref|XP_010502134.1|  PREDICTED: zinc finger BED domain-containing...    154   1e-38    
ref|XP_010502154.1|  PREDICTED: zinc finger BED domain-containing...    154   1e-38    
ref|XP_007048823.1|  BED zinc finger,hAT family dimerization domain     153   1e-38    
gb|AAG52564.1|AC010675_12  unknown protein; 6859-4829                   152   4e-38    Arabidopsis thaliana [mouse-ear cress]
emb|CAN83599.1|  hypothetical protein VITISV_015691                     151   5e-38    Vitis vinifera
ref|XP_009105674.1|  PREDICTED: zinc finger BED domain-containing...    151   8e-38    Brassica rapa
ref|XP_012066534.1|  PREDICTED: zinc finger BED domain-containing...    150   1e-37    
emb|CDY38777.1|  BnaA07g28490D                                          150   1e-37    Brassica napus [oilseed rape]
ref|XP_009759412.1|  PREDICTED: zinc finger BED domain-containing...    147   1e-37    Nicotiana sylvestris
gb|KDP42662.1|  hypothetical protein JCGZ_00166                         151   1e-37    Jatropha curcas
gb|KCW80149.1|  hypothetical protein EUGRSUZ_C01493                     150   1e-37    Eucalyptus grandis [rose gum]
ref|XP_012066533.1|  PREDICTED: zinc finger BED domain-containing...    150   1e-37    Jatropha curcas
gb|KJB66355.1|  hypothetical protein B456_010G137500                    151   2e-37    Gossypium raimondii
ref|XP_011657561.1|  PREDICTED: zinc finger BED domain-containing...    150   2e-37    Cucumis sativus [cucumbers]
ref|XP_011657560.1|  PREDICTED: zinc finger BED domain-containing...    150   2e-37    Cucumis sativus [cucumbers]
ref|XP_011470501.1|  PREDICTED: zinc finger BED domain-containing...    149   2e-37    Fragaria vesca subsp. vesca
ref|XP_007023276.1|  BED zinc finger,hAT family dimerization domain     151   2e-37    
gb|KCW80278.1|  hypothetical protein EUGRSUZ_C01635                     150   2e-37    Eucalyptus grandis [rose gum]
emb|CAE04247.3|  OSJNBa0089N06.8                                        151   3e-37    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001053960.1|  Os04g0628400                                       151   3e-37    
ref|XP_007213385.1|  hypothetical protein PRUPE_ppa026473mg             150   4e-37    
ref|XP_009797845.1|  PREDICTED: zinc finger BED domain-containing...    146   4e-37    Nicotiana sylvestris
ref|XP_011082213.1|  PREDICTED: zinc finger BED domain-containing...    143   5e-37    
ref|XP_009118128.1|  PREDICTED: zinc finger BED domain-containing...    148   6e-37    Brassica rapa
ref|XP_009377735.1|  PREDICTED: zinc finger BED domain-containing...    149   6e-37    Pyrus x bretschneideri [bai li]
ref|XP_009610782.1|  PREDICTED: zinc finger BED domain-containing...    142   7e-37    
ref|XP_010056247.1|  PREDICTED: zinc finger BED domain-containing...    144   9e-37    
ref|XP_007022002.1|  BED zinc finger,hAT family dimerization doma...    148   1e-36    
ref|XP_008779300.1|  PREDICTED: zinc finger BED domain-containing...    142   1e-36    
gb|KHN27849.1|  Putative AC transposase                                 149   1e-36    Glycine soja [wild soybean]
ref|XP_010512061.1|  PREDICTED: zinc finger BED domain-containing...    148   1e-36    Camelina sativa [gold-of-pleasure]
ref|XP_010512060.1|  PREDICTED: zinc finger BED domain-containing...    148   2e-36    Camelina sativa [gold-of-pleasure]
ref|NP_001130386.1|  uncharacterized protein LOC100191482               147   2e-36    
emb|CDY11633.1|  BnaC06g31060D                                          147   2e-36    Brassica napus [oilseed rape]
gb|KHG11798.1|  Putative AC transposase                                 147   2e-36    
ref|XP_010474243.1|  PREDICTED: zinc finger BED domain-containing...    148   3e-36    
ref|NP_001175414.1|  Os08g0180400                                       147   5e-36    
ref|XP_008238080.1|  PREDICTED: uncharacterized protein LOC103336760    145   5e-36    
ref|XP_008779743.1|  PREDICTED: zinc finger BED domain-containing...    146   6e-36    
ref|XP_002443959.1|  hypothetical protein SORBIDRAFT_07g005050          145   6e-36    
ref|XP_009590929.1|  PREDICTED: zinc finger BED domain-containing...    141   7e-36    
emb|CDX81706.1|  BnaC08g38950D                                          144   9e-36    
ref|XP_010415663.1|  PREDICTED: zinc finger BED domain-containing...    145   1e-35    
ref|XP_010415664.1|  PREDICTED: zinc finger BED domain-containing...    145   1e-35    
gb|EMS55659.1|  Putative AC transposase                                 146   2e-35    
gb|KCW72874.1|  hypothetical protein EUGRSUZ_E01324                     144   2e-35    
ref|XP_007221311.1|  hypothetical protein PRUPE_ppa025777mg             144   4e-35    
ref|XP_008776470.1|  PREDICTED: zinc finger BED domain-containing...    142   4e-35    
emb|CAJ32532.1|  transposase related protein w-gary1                    145   4e-35    
ref|XP_008798027.1|  PREDICTED: zinc finger BED domain-containing...    144   4e-35    
gb|EEC83056.1|  hypothetical protein OsI_28162                          140   1e-34    
gb|EPS71279.1|  hypothetical protein M569_03484                         141   1e-34    
emb|CAJ32531.1|  transposase-related protein b-gary                     144   1e-34    
emb|CAJ32533.1|  transposase-related protein w-gary2                    143   1e-34    
emb|CDX83987.1|  BnaC08g16580D                                          143   2e-34    
ref|XP_006390942.1|  hypothetical protein EUTSA_v10018229mg             142   2e-34    
ref|XP_009418454.1|  PREDICTED: zinc finger BED domain-containing...    142   2e-34    
ref|XP_009600169.1|  PREDICTED: zinc finger BED domain-containing...    135   2e-34    
ref|NP_001060325.2|  Os07g0624100                                       142   3e-34    
ref|XP_007020914.1|  BED zinc finger,hAT family dimerization doma...    141   3e-34    
ref|XP_002455637.1|  hypothetical protein SORBIDRAFT_03g015311          140   3e-34    
dbj|BAK01372.1|  predicted protein                                      142   4e-34    
ref|XP_010234331.1|  PREDICTED: zinc finger BED domain-containing...    142   4e-34    
ref|XP_010236819.1|  PREDICTED: zinc finger BED domain-containing...    138   4e-34    
ref|XP_010686979.1|  PREDICTED: zinc finger BED domain-containing...    141   4e-34    
ref|XP_007036331.1|  BED zinc finger,hAT family dimerization domain     140   5e-34    
ref|XP_010274137.1|  PREDICTED: zinc finger BED domain-containing...    140   6e-34    
ref|XP_007022882.1|  BED zinc finger,hAT family dimerization doma...    140   9e-34    
ref|XP_010240467.1|  PREDICTED: zinc finger BED domain-containing...    141   9e-34    
ref|XP_009762657.1|  PREDICTED: zinc finger BED domain-containing...    139   1e-33    
ref|XP_009110492.1|  PREDICTED: zinc finger BED domain-containing...    140   1e-33    
ref|NP_001169279.1|  uncharacterized protein LOC100383142               140   1e-33    
ref|XP_010521534.1|  PREDICTED: zinc finger BED domain-containing...    141   1e-33    
gb|ABA98760.1|  hAT family dimerisation domain containing protein       139   2e-33    
ref|XP_007227649.1|  hypothetical protein PRUPE_ppa016870mg             139   2e-33    
gb|KJB27753.1|  hypothetical protein B456_005G007800                    139   3e-33    
ref|XP_007199330.1|  hypothetical protein PRUPE_ppa023755mg             137   4e-33    
ref|XP_010686703.1|  PREDICTED: zinc finger BED domain-containing...    138   5e-33    
ref|XP_008792782.1|  PREDICTED: zinc finger BED domain-containing...    138   5e-33    
ref|XP_008792783.1|  PREDICTED: zinc finger BED domain-containing...    138   5e-33    
ref|XP_007221262.1|  hypothetical protein PRUPE_ppa020713mg             137   8e-33    
ref|XP_007219605.1|  hypothetical protein PRUPE_ppa023156mg             137   1e-32    
ref|XP_007227103.1|  hypothetical protein PRUPE_ppa025706mg             136   1e-32    
gb|AAP53984.1|  hAT family dimerisation domain containing protein       137   1e-32    
ref|XP_007224101.1|  hypothetical protein PRUPE_ppa015615mg             136   1e-32    
ref|XP_010923373.1|  PREDICTED: zinc finger BED domain-containing...    137   2e-32    
ref|XP_002448572.1|  hypothetical protein SORBIDRAFT_06g029390          137   2e-32    
ref|XP_007033377.1|  BED zinc finger,hAT family dimerization doma...    137   2e-32    
ref|XP_009775322.1|  PREDICTED: zinc finger BED domain-containing...    134   2e-32    
ref|XP_007033376.1|  BED zinc finger,hAT family dimerization doma...    137   2e-32    
ref|XP_007033378.1|  BED zinc finger,hAT family dimerization doma...    136   2e-32    
ref|NP_001172874.1|  Os02g0237700                                       136   2e-32    
ref|XP_010924127.1|  PREDICTED: zinc finger BED domain-containing...    136   2e-32    
ref|NP_001054384.1|  Os05g0102300                                       135   2e-32    
ref|XP_011085903.1|  PREDICTED: zinc finger BED domain-containing...    130   2e-32    
ref|XP_010923384.1|  PREDICTED: zinc finger BED domain-containing...    136   3e-32    
ref|XP_007200126.1|  hypothetical protein PRUPE_ppa018034mg             135   3e-32    
ref|XP_009372066.1|  PREDICTED: zinc finger BED domain-containing...    135   3e-32    
ref|XP_009769521.1|  PREDICTED: zinc finger BED domain-containing...    134   4e-32    
gb|KJB36104.1|  hypothetical protein B456_006G141300                    134   5e-32    
gb|AAD55482.1|AC009322_22  Hypothetical protein                         137   5e-32    
ref|XP_009394499.1|  PREDICTED: zinc finger BED domain-containing...    135   6e-32    
ref|XP_009791292.1|  PREDICTED: zinc finger BED domain-containing...    127   1e-31    
ref|XP_010430022.1|  PREDICTED: probable serine/threonine-protein...    132   1e-31    
ref|XP_010229759.1|  PREDICTED: zinc finger BED domain-containing...    132   2e-31    
ref|XP_011469694.1|  PREDICTED: zinc finger BED domain-containing...    133   2e-31    
ref|NP_001052461.2|  Os04g0321400                                       130   3e-31    
ref|XP_009372067.1|  PREDICTED: zinc finger BED domain-containing...    130   3e-31    
gb|KHN10510.1|  Putative AC transposase                                 129   4e-31    
ref|XP_010666012.1|  PREDICTED: zinc finger BED domain-containing...    132   4e-31    
ref|XP_007219124.1|  hypothetical protein PRUPE_ppa015847mg             131   4e-31    
gb|KJB33209.1|  hypothetical protein B456_006G000800                    132   4e-31    
ref|XP_006658274.1|  PREDICTED: uncharacterized protein LOC102709665    131   6e-31    
gb|KJB23882.1|  hypothetical protein B456_004G119900                    132   6e-31    
emb|CAA25635.1|  unnamed protein product                                126   7e-31    
gb|KJB09837.1|  hypothetical protein B456_001G170000                    131   1e-30    
ref|XP_008791217.1|  PREDICTED: zinc finger BED domain-containing...    131   1e-30    
gb|KJB42529.1|  hypothetical protein B456_007G156600                    130   2e-30    
gb|KCW85965.1|  hypothetical protein EUGRSUZ_B02668                     129   2e-30    
ref|XP_006380778.1|  hypothetical protein POPTR_0007s13470g             129   2e-30    
ref|XP_011462907.1|  PREDICTED: zinc finger BED domain-containing...    127   3e-30    
emb|CDP10690.1|  unnamed protein product                                122   3e-30    
ref|XP_010265968.1|  PREDICTED: zinc finger BED domain-containing...    128   3e-30    
gb|KJB50760.1|  hypothetical protein B456_008G186400                    129   4e-30    
ref|XP_010417758.1|  PREDICTED: zinc finger BED domain-containing...    131   4e-30    
ref|XP_010417759.1|  PREDICTED: zinc finger BED domain-containing...    131   4e-30    
ref|XP_006300389.1|  hypothetical protein CARUB_v10019720mg             131   4e-30    
ref|XP_006409564.1|  hypothetical protein EUTSA_v10022530mg             131   5e-30    
ref|XP_011069601.1|  PREDICTED: zinc finger BED domain-containing...    127   5e-30    
gb|ACN33643.1|  unknown                                                 130   5e-30    
ref|XP_006383274.1|  hypothetical protein POPTR_0005s13270g             126   5e-30    
ref|XP_007201530.1|  hypothetical protein PRUPE_ppa016152mg             129   5e-30    
ref|XP_010472998.1|  PREDICTED: zinc finger BED domain-containing...    131   6e-30    
ref|XP_010472999.1|  PREDICTED: zinc finger BED domain-containing...    131   6e-30    
ref|XP_006384497.1|  hypothetical protein POPTR_0004s15890g             128   6e-30    
ref|XP_007028994.1|  Ac-like transposase THELMA13                       126   9e-30    
gb|ACF86826.1|  unknown                                                 120   9e-30    
ref|XP_010907377.1|  PREDICTED: zinc finger BED domain-containing...    124   1e-29    
ref|XP_010232197.1|  PREDICTED: zinc finger BED domain-containing...    129   1e-29    
gb|KJB73059.1|  hypothetical protein B456_011G212800                    128   1e-29    
prf||2021344A  activator-like transposable element                      129   2e-29 
ref|NP_001151767.1|  LOC100285402                                       128   2e-29    
ref|XP_009357245.1|  PREDICTED: zinc finger BED domain-containing...    125   2e-29    
ref|XP_010237819.1|  PREDICTED: zinc finger BED domain-containing...    127   2e-29    
emb|CAN69441.1|  hypothetical protein VITISV_016471                     124   2e-29    
ref|XP_009624860.1|  PREDICTED: zinc finger BED domain-containing...    122   3e-29    
ref|XP_009138908.1|  PREDICTED: zinc finger BED domain-containing...    128   3e-29    
ref|XP_002444199.1|  hypothetical protein SORBIDRAFT_07g014880          125   4e-29    
ref|XP_010678441.1|  PREDICTED: zinc finger BED domain-containing...    127   4e-29    
ref|XP_008655155.1|  PREDICTED: uncharacterized protein LOC100381...    126   4e-29    
ref|XP_008812492.1|  PREDICTED: zinc finger BED domain-containing...    120   5e-29    
ref|XP_010480984.1|  PREDICTED: zinc finger BED domain-containing...    125   5e-29    
ref|XP_009767846.1|  PREDICTED: zinc finger BED domain-containing...    127   5e-29    
ref|XP_002451486.1|  hypothetical protein SORBIDRAFT_04g002725          126   5e-29    
ref|XP_011462905.1|  PREDICTED: zinc finger BED domain-containing...    125   6e-29    
gb|ABF94985.1|  hAT family dimerisation domain containing protein       127   7e-29    
ref|XP_009781000.1|  PREDICTED: zinc finger BED domain-containing...    122   7e-29    
ref|XP_011462901.1|  PREDICTED: zinc finger BED domain-containing...    125   8e-29    
ref|XP_006384292.1|  hypothetical protein POPTR_0004s11480g             125   8e-29    
ref|XP_010470025.1|  PREDICTED: zinc finger BED domain-containing...    121   8e-29    
emb|CDP00328.1|  unnamed protein product                                126   8e-29    
gb|KJB39155.1|  hypothetical protein B456_007G001000                    125   8e-29    
ref|NP_001057110.1|  Os06g0209900                                       127   9e-29    
ref|XP_003591965.1|  Elongation factor 1-alpha                          127   9e-29    
ref|XP_009626553.1|  PREDICTED: zinc finger BED domain-containing...    125   1e-28    
ref|XP_011046058.1|  PREDICTED: zinc finger BED domain-containing...    126   2e-28    
sp|P08770.2|TRA1_MAIZE  RecName: Full=Putative AC transposase; Al...    126   2e-28    
emb|CAN63250.1|  hypothetical protein VITISV_017354                     126   2e-28    
gb|KHN15000.1|  Putative AC transposase                                 120   2e-28    
ref|XP_007226302.1|  hypothetical protein PRUPE_ppa020565mg             124   2e-28    
emb|CAN66417.1|  hypothetical protein VITISV_044134                     125   2e-28    
ref|XP_009596761.1|  PREDICTED: zinc finger BED domain-containing...    121   2e-28    
ref|XP_011046060.1|  PREDICTED: zinc finger BED domain-containing...    125   2e-28    
ref|XP_007224708.1|  hypothetical protein PRUPE_ppa025218mg             123   2e-28    
ref|XP_007214254.1|  hypothetical protein PRUPE_ppa024136mg             125   2e-28    
gb|EEE68201.1|  hypothetical protein OsJ_26362                          125   2e-28    
ref|NP_001061196.1|  Os08g0198000                                       125   3e-28    
ref|XP_010692516.1|  PREDICTED: zinc finger BED domain-containing...    120   3e-28    
ref|XP_010694028.1|  PREDICTED: zinc finger BED domain-containing...    123   3e-28    
sp|P03010.1|TRAC9_MAIZE  RecName: Full=Putative AC9 transposase         125   3e-28    
ref|XP_011080812.1|  PREDICTED: zinc finger BED domain-containing...    124   3e-28    
gb|EAZ05927.1|  hypothetical protein OsI_28164                          125   3e-28    
ref|XP_009618720.1|  PREDICTED: zinc finger BED domain-containing...    122   3e-28    
ref|XP_009757222.1|  PREDICTED: zinc finger BED domain-containing...    119   4e-28    
gb|KJB29513.1|  hypothetical protein B456_005G104500                    124   4e-28    
ref|XP_007225531.1|  hypothetical protein PRUPE_ppa025795mg             124   5e-28    
ref|XP_010468189.1|  PREDICTED: zinc finger BED domain-containing...    122   5e-28    
ref|XP_008786935.1|  PREDICTED: uncharacterized protein LOC103705098    122   6e-28    
gb|KJB30382.1|  hypothetical protein B456_005G140200                    122   7e-28    
gb|EAZ41821.1|  hypothetical protein OsJ_26360                          123   8e-28    
emb|CDY71977.1|  BnaCnng75370D                                          118   9e-28    
ref|XP_010247653.1|  PREDICTED: zinc finger BED domain-containing...    119   9e-28    
gb|AAM18172.1|AC092172_32  Putative activator-like transposable e...    123   1e-27    
gb|AEF33496.1|  putative transposase                                    122   1e-27    
ref|XP_009757221.1|  PREDICTED: zinc finger BED domain-containing...    118   1e-27    
ref|XP_008778371.1|  PREDICTED: zinc finger BED domain-containing...    117   1e-27    
ref|XP_009770558.1|  PREDICTED: zinc finger BED domain-containing...    118   1e-27    
ref|NP_001042787.2|  Os01g0290300                                       123   2e-27    
ref|XP_006369187.1|  hypothetical protein POPTR_0001s18450g             122   2e-27    
ref|XP_010679702.1|  PREDICTED: zinc finger BED domain-containing...    120   2e-27    
ref|XP_010689919.1|  PREDICTED: zinc finger BED domain-containing...    117   2e-27    
ref|XP_010484853.1|  PREDICTED: zinc finger BED domain-containing...    119   2e-27    
ref|XP_010268748.1|  PREDICTED: zinc finger BED domain-containing...    119   3e-27    
ref|XP_009768907.1|  PREDICTED: zinc finger BED domain-containing...    120   3e-27    
gb|KJB76715.1|  hypothetical protein B456_012G102500                    121   3e-27    
ref|XP_010684088.1|  PREDICTED: zinc finger BED domain-containing...    121   3e-27    
ref|XP_007033852.1|  Uncharacterized protein TCM_019956                 123   4e-27    
ref|XP_011070561.1|  PREDICTED: uncharacterized protein LOC105156187    121   4e-27    
ref|XP_010548831.1|  PREDICTED: zinc finger BED domain-containing...    122   5e-27    
ref|XP_007032573.1|  BED zinc finger,hAT family dimerization domain     114   6e-27    
gb|EEC82309.1|  hypothetical protein OsI_26572                          119   7e-27    
ref|XP_010939049.1|  PREDICTED: zinc finger BED domain-containing...    117   7e-27    
ref|XP_008680982.1|  PREDICTED: uncharacterized protein LOC100191...    120   9e-27    
ref|NP_001130635.1|  uncharacterized protein LOC100191735               120   9e-27    
ref|XP_002456204.1|  hypothetical protein SORBIDRAFT_03g032090          120   1e-26    
gb|KJB27884.1|  hypothetical protein B456_005G014600                    121   1e-26    
ref|XP_010265497.1|  PREDICTED: zinc finger BED domain-containing...    117   1e-26    
ref|XP_007199162.1|  hypothetical protein PRUPE_ppa019737mg             119   1e-26    
ref|XP_007200197.1|  hypothetical protein PRUPE_ppa016010mg             120   1e-26    
ref|XP_010431052.1|  PREDICTED: zinc finger BED domain-containing...    117   2e-26    
ref|XP_007217385.1|  hypothetical protein PRUPE_ppa025773mg             119   2e-26    
ref|XP_009604434.1|  PREDICTED: zinc finger BED domain-containing...    117   2e-26    
ref|XP_011462906.1|  PREDICTED: zinc finger BED domain-containing...    118   2e-26    
gb|ABA98519.1|  hAT family dimerisation domain containing protein       116   2e-26    
ref|XP_009591036.1|  PREDICTED: zinc finger BED domain-containing...    114   2e-26    
ref|NP_001043974.1|  Os01g0698300                                       119   2e-26    
ref|XP_006370155.1|  hypothetical protein POPTR_0001s40220g             119   3e-26    
emb|CDP22169.1|  unnamed protein product                                117   3e-26    
gb|AAD43146.1|AC007504_1  Hypothetical Protein                          114   3e-26    
gb|KJB80009.1|  hypothetical protein B456_013G077200                    118   3e-26    
ref|XP_008804919.1|  PREDICTED: zinc finger BED domain-containing...    111   3e-26    
ref|XP_009604433.1|  PREDICTED: zinc finger BED domain-containing...    117   3e-26    
ref|NP_001062550.1|  Os09g0101200                                       117   3e-26    
gb|EEC71336.1|  hypothetical protein OsI_03395                          118   4e-26    
ref|XP_010497099.1|  PREDICTED: zinc finger BED domain-containing...    119   5e-26    
ref|XP_010527739.1|  PREDICTED: zinc finger BED domain-containing...    117   5e-26    
ref|XP_008780286.1|  PREDICTED: zinc finger BED domain-containing...    112   6e-26    
ref|XP_011471032.1|  PREDICTED: zinc finger BED domain-containing...    112   6e-26    
gb|AAD39658.1|AC007591_23  Similar to gi|22113 Ac transposase (OR...    118   6e-26    
ref|XP_006375745.1|  hypothetical protein POPTR_0013s01720g             117   7e-26    
ref|XP_009757583.1|  PREDICTED: zinc finger BED domain-containing...    112   8e-26    
emb|CAH66110.1|  OSIGBa0115D20.3                                        117   9e-26    
ref|XP_009804558.1|  PREDICTED: zinc finger BED domain-containing...    112   9e-26    
ref|XP_006384349.1|  hypothetical protein POPTR_0004s13680g             116   9e-26    
ref|XP_008779859.1|  PREDICTED: zinc finger BED domain-containing...    110   1e-25    
ref|NP_001061202.1|  Os08g0198900                                       117   1e-25    
emb|CAN79118.1|  hypothetical protein VITISV_005773                     118   1e-25    
gb|AAG13541.1|AC023240_14  putative Tam3-transposase                    116   1e-25    
ref|XP_007018954.1|  T6D22.19-like protein                              115   1e-25    
ref|XP_010675028.1|  PREDICTED: zinc finger BED domain-containing...    117   1e-25    
ref|XP_009780212.1|  PREDICTED: zinc finger BED domain-containing...    117   1e-25    
ref|XP_009605438.1|  PREDICTED: zinc finger BED domain-containing...    112   1e-25    
ref|XP_010527738.1|  PREDICTED: zinc finger BED domain-containing...    117   1e-25    
ref|XP_009766998.1|  PREDICTED: zinc finger BED domain-containing...    115   1e-25    
emb|CDP15137.1|  unnamed protein product                                112   1e-25    



>ref|XP_009613825.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nicotiana tomentosiformis]
Length=785

 Score =   409 bits (1052),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 192/239 (80%), Positives = 218/239 (91%), Gaps = 2/239 (1%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE ARAA S+DP +  LTK+MQEKFDKYWK+CCL+L+IAV++DPRFKMKLVEFSF+K
Sbjct  547  KIQLELARAAASEDPSISSLTKTMQEKFDKYWKTCCLMLAIAVVMDPRFKMKLVEFSFTK  606

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQEL--STNELG  541
            IYGE+A+TYV+IV+EGIHELF +YVALPLPLTPTY EEANGGA+  ++AQ+L  S+N  G
Sbjct  607  IYGEEAATYVKIVEEGIHELFLEYVALPLPLTPTYAEEANGGAIKQENAQDLGASSNGAG  666

Query  540  LTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILT  361
            LTDFDA+IMET+SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDIL+
Sbjct  667  LTDFDAYIMETTSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILS  726

Query  360  VPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEVPI  184
            VPVST PADSVF TV KEMD+YRCSLRPETVEAL+CAKDW QN  V ++ APIKMEVPI
Sbjct  727  VPVSTVPADSVFCTVGKEMDQYRCSLRPETVEALICAKDWLQNASVDTLHAPIKMEVPI  785



>ref|XP_009761601.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nicotiana sylvestris]
 ref|XP_009761602.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nicotiana sylvestris]
Length=798

 Score =   404 bits (1037),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 190/239 (79%), Positives = 216/239 (90%), Gaps = 2/239 (1%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE ARAA S+DP +  LTK+MQEKFDKYWKSCCL+L+I+V++DPRFKMKLVEFSF+K
Sbjct  560  KIQLELARAAASEDPSISSLTKTMQEKFDKYWKSCCLMLAISVVMDPRFKMKLVEFSFTK  619

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQEL--STNELG  541
            IYGE+A+TYV+IV+EGIHELF +YVALPLPLTPTY EEANGG +  ++AQ+L  S+N  G
Sbjct  620  IYGEEAATYVKIVEEGIHELFLEYVALPLPLTPTYAEEANGGDIKQENAQDLGASSNGAG  679

Query  540  LTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILT  361
            LTDFDA+IMET+SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDIL+
Sbjct  680  LTDFDAYIMETTSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILS  739

Query  360  VPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEVPI  184
            VPVST  ADSVF TV KEMD+YRCSLRPETVEAL+CAKDW QN  V ++ APIKMEVPI
Sbjct  740  VPVSTVTADSVFCTVGKEMDQYRCSLRPETVEALICAKDWLQNASVDTLHAPIKMEVPI  798



>ref|XP_009791008.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nicotiana sylvestris]
Length=742

 Score =   401 bits (1031),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 189/239 (79%), Positives = 216/239 (90%), Gaps = 2/239 (1%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE ARAA S+DP +  LTK+MQEKFDKYWK+CCL+L+IAV++DPRFKMKLVEFSF+K
Sbjct  504  KIQLELARAAASEDPSISSLTKTMQEKFDKYWKTCCLMLAIAVVMDPRFKMKLVEFSFTK  563

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQEL--STNELG  541
            IYGE+A+TYV+IV+EGIHELF +YVALPLPLTPTY E+ANGGA+  ++AQ +  S+N  G
Sbjct  564  IYGEEAATYVKIVEEGIHELFLEYVALPLPLTPTYAEDANGGAMKQENAQGVGASSNGAG  623

Query  540  LTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILT  361
            LTDFDA+IMET+SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLS MARDIL+
Sbjct  624  LTDFDAYIMETTSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSIMARDILS  683

Query  360  VPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEVPI  184
            VPVST  ADSVFSTV KEMDRYRCSLRPETVEAL+CAKDW QN  V ++ AP+KMEVPI
Sbjct  684  VPVSTITADSVFSTVSKEMDRYRCSLRPETVEALICAKDWLQNASVNTLHAPLKMEVPI  742



>ref|XP_009621122.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nicotiana tomentosiformis]
Length=743

 Score =   401 bits (1031),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 189/239 (79%), Positives = 215/239 (90%), Gaps = 2/239 (1%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE ARAA S+DP +  LTK+MQEKFDKYWK+CCL+L+IAV++DPRFKMKLVEFSF+K
Sbjct  505  KIQLELARAAASEDPSISSLTKTMQEKFDKYWKTCCLMLAIAVVMDPRFKMKLVEFSFTK  564

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQEL--STNELG  541
            IYGE+A+TYV+IV+EGIHELF +YVALPLPLTPTY EEANGGA+  ++A  +  S+N  G
Sbjct  565  IYGEEAATYVKIVEEGIHELFLEYVALPLPLTPTYAEEANGGAMKQENAHGVGASSNGPG  624

Query  540  LTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILT  361
            LTDFDA+IMET+SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDIL+
Sbjct  625  LTDFDAYIMETTSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILS  684

Query  360  VPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEVPI  184
            VPVS+  ADSVFSTV KEMDRYRCSLRPETVEAL+CAKDW QN    ++ APIKMEVPI
Sbjct  685  VPVSSVTADSVFSTVSKEMDRYRCSLRPETVEALICAKDWLQNASENTLHAPIKMEVPI  743



>ref|XP_010312124.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Solanum lycopersicum]
Length=772

 Score =   390 bits (1001),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 185/239 (77%), Positives = 205/239 (86%), Gaps = 2/239 (1%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE ARAA S+DPF   LTK MQE FD YWKSCCL+L+IAV++DPRFKMKLVEFSFSK
Sbjct  534  KIQLELARAAASEDPFTSRLTKMMQEMFDNYWKSCCLMLAIAVVMDPRFKMKLVEFSFSK  593

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQEL--STNELG  541
            IYGE+A+ YV+ V+EGIHELF +YVALPLPLTPTY+EE NG  +  +D Q L  S N LG
Sbjct  594  IYGEEAAAYVKTVEEGIHELFNEYVALPLPLTPTYVEEVNGSGMRQEDGQGLDASCNGLG  653

Query  540  LTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILT  361
            LTDFD +IMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNR+KYPTLSKMARDIL+
Sbjct  654  LTDFDVYIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRIKYPTLSKMARDILS  713

Query  360  VPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEVPI  184
            VPVST  ADS+FSTV KEMD YRCSLRPETVEAL+CAKDW QN  + +   PIKMEVPI
Sbjct  714  VPVSTVTADSIFSTVSKEMDHYRCSLRPETVEALICAKDWLQNASLDTSPIPIKMEVPI  772



>ref|XP_010313787.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X5 [Solanum lycopersicum]
Length=907

 Score =   389 bits (999),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 183/237 (77%), Positives = 208/237 (88%), Gaps = 6/237 (3%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE ARAA S+DP + GLTK+MQE+FDKYWKSCCLIL+IAV++DPRFKMKLVEFSF+K
Sbjct  677  KIQLELARAAASEDPSISGLTKTMQEEFDKYWKSCCLILAIAVVMDPRFKMKLVEFSFTK  736

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            IYGE+A+T+V+ V+EGIHELF +YVALPLPLTP Y EE + GA+  ++         GLT
Sbjct  737  IYGEEAATFVKFVEEGIHELFLEYVALPLPLTPAYAEEVDDGALKQENGGG------GLT  790

Query  534  DFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            DFDA+IMET+SQQSRSELDQYL+ESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDIL+VP
Sbjct  791  DFDAYIMETTSQQSRSELDQYLDESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILSVP  850

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEVPI  184
            VST  ADSVFSTV KEMDRYRCSLRPETVEAL+CAKDW QN  V ++ APIKMEVPI
Sbjct  851  VSTVTADSVFSTVGKEMDRYRCSLRPETVEALICAKDWLQNASVNTLHAPIKMEVPI  907



>ref|XP_010313784.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X2 [Solanum lycopersicum]
Length=921

 Score =   389 bits (1000),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 183/237 (77%), Positives = 208/237 (88%), Gaps = 6/237 (3%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE ARAA S+DP + GLTK+MQE+FDKYWKSCCLIL+IAV++DPRFKMKLVEFSF+K
Sbjct  691  KIQLELARAAASEDPSISGLTKTMQEEFDKYWKSCCLILAIAVVMDPRFKMKLVEFSFTK  750

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            IYGE+A+T+V+ V+EGIHELF +YVALPLPLTP Y EE + GA+  ++         GLT
Sbjct  751  IYGEEAATFVKFVEEGIHELFLEYVALPLPLTPAYAEEVDDGALKQENGGG------GLT  804

Query  534  DFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            DFDA+IMET+SQQSRSELDQYL+ESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDIL+VP
Sbjct  805  DFDAYIMETTSQQSRSELDQYLDESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILSVP  864

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEVPI  184
            VST  ADSVFSTV KEMDRYRCSLRPETVEAL+CAKDW QN  V ++ APIKMEVPI
Sbjct  865  VSTVTADSVFSTVGKEMDRYRCSLRPETVEALICAKDWLQNASVNTLHAPIKMEVPI  921



>ref|XP_010313785.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X3 [Solanum lycopersicum]
 ref|XP_010313786.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X4 [Solanum lycopersicum]
Length=921

 Score =   389 bits (1000),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 183/237 (77%), Positives = 208/237 (88%), Gaps = 6/237 (3%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE ARAA S+DP + GLTK+MQE+FDKYWKSCCLIL+IAV++DPRFKMKLVEFSF+K
Sbjct  691  KIQLELARAAASEDPSISGLTKTMQEEFDKYWKSCCLILAIAVVMDPRFKMKLVEFSFTK  750

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            IYGE+A+T+V+ V+EGIHELF +YVALPLPLTP Y EE + GA+  ++         GLT
Sbjct  751  IYGEEAATFVKFVEEGIHELFLEYVALPLPLTPAYAEEVDDGALKQENGGG------GLT  804

Query  534  DFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            DFDA+IMET+SQQSRSELDQYL+ESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDIL+VP
Sbjct  805  DFDAYIMETTSQQSRSELDQYLDESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILSVP  864

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEVPI  184
            VST  ADSVFSTV KEMDRYRCSLRPETVEAL+CAKDW QN  V ++ APIKMEVPI
Sbjct  865  VSTVTADSVFSTVGKEMDRYRCSLRPETVEALICAKDWLQNASVNTLHAPIKMEVPI  921



>ref|XP_010313781.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Solanum lycopersicum]
 ref|XP_010313782.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Solanum lycopersicum]
 ref|XP_010313783.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Solanum lycopersicum]
Length=935

 Score =   389 bits (999),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 183/237 (77%), Positives = 208/237 (88%), Gaps = 6/237 (3%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE ARAA S+DP + GLTK+MQE+FDKYWKSCCLIL+IAV++DPRFKMKLVEFSF+K
Sbjct  705  KIQLELARAAASEDPSISGLTKTMQEEFDKYWKSCCLILAIAVVMDPRFKMKLVEFSFTK  764

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            IYGE+A+T+V+ V+EGIHELF +YVALPLPLTP Y EE + GA+  ++         GLT
Sbjct  765  IYGEEAATFVKFVEEGIHELFLEYVALPLPLTPAYAEEVDDGALKQENGGG------GLT  818

Query  534  DFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            DFDA+IMET+SQQSRSELDQYL+ESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDIL+VP
Sbjct  819  DFDAYIMETTSQQSRSELDQYLDESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILSVP  878

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEVPI  184
            VST  ADSVFSTV KEMDRYRCSLRPETVEAL+CAKDW QN  V ++ APIKMEVPI
Sbjct  879  VSTVTADSVFSTVGKEMDRYRCSLRPETVEALICAKDWLQNASVNTLHAPIKMEVPI  935



>ref|XP_011078385.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Sesamum indicum]
 ref|XP_011078386.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Sesamum indicum]
Length=700

 Score =   382 bits (980),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 178/239 (74%), Positives = 207/239 (87%), Gaps = 2/239 (1%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE ARAA S+DPFV  LTK MQEKFDKYWKSCC IL+IAV++DPRFKMKLVEFSFSK
Sbjct  462  KIQLELARAAASEDPFVSSLTKFMQEKFDKYWKSCCFILAIAVVMDPRFKMKLVEFSFSK  521

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQEL--STNELG  541
            IYGE+A++YV++VD+GIHELF +YVALPLPLTP Y EEANG ++  +D Q +  S+N LG
Sbjct  522  IYGEEAASYVKVVDDGIHELFLEYVALPLPLTPAYAEEANGASIKPEDPQGMGISSNGLG  581

Query  540  LTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILT  361
            LTDFD +IMET+SQ ++SELDQYLEESLLPRVHEFDV+GWWKLNR+KYPTLSKMARDIL+
Sbjct  582  LTDFDVYIMETTSQLAKSELDQYLEESLLPRVHEFDVIGWWKLNRIKYPTLSKMARDILS  641

Query  360  VPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEVPI  184
            +PV T PA SVF TV KEMD YRCSLRPETVEAL+CAKDW Q+E V++    +KME PI
Sbjct  642  IPVCTVPATSVFDTVRKEMDSYRCSLRPETVEALICAKDWLQSENVETALPVVKMEAPI  700



>emb|CDP10447.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   368 bits (945),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 184/242 (76%), Positives = 206/242 (85%), Gaps = 5/242 (2%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE  RAA S+DPF+  LTKSMQEKFD+YWKSCC IL+IAV++DPRFKMKLVEFSFSK
Sbjct  244  KIQLELGRAAGSEDPFISRLTKSMQEKFDRYWKSCCFILAIAVVMDPRFKMKLVEFSFSK  303

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPT--YIEEANGGAVNTQDAQE---LSTN  550
            IY E+A+TYV+IVDEGIHELF +YVALPLPL  T  Y+EEAN G V  +D Q    L++N
Sbjct  304  IYNEEAATYVKIVDEGIHELFVEYVALPLPLPLTPTYVEEANNGTVKAEDPQGGNLLASN  363

Query  549  ELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARD  370
             LGLTDFD +IMET+SQQS+SELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARD
Sbjct  364  GLGLTDFDVYIMETTSQQSKSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARD  423

Query  369  ILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEV  190
            IL++PVST P  SVF TV KEMDRYRCSLRPETVEAL+CAKDW Q   V +   P+KMEV
Sbjct  424  ILSIPVSTVPVGSVFDTVGKEMDRYRCSLRPETVEALICAKDWIQGVSVDTSIVPVKMEV  483

Query  189  PI  184
            PI
Sbjct  484  PI  485



>ref|XP_012081198.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Jatropha curcas]
Length=663

 Score =   340 bits (872),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 161/234 (69%), Positives = 192/234 (82%), Gaps = 0/234 (0%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQ + AR+  S+DPFV  +TK+MQEK  KYWK C L+L+IAV++DPRFKMKLVEFSFSK
Sbjct  429  KIQTDLARSVASEDPFVSTVTKAMQEKMSKYWKDCSLVLAIAVVMDPRFKMKLVEFSFSK  488

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            +YGEDA  Y++IVD+GIHELF +YVALPLPLTPTY EE N      +D Q    +++GLT
Sbjct  489  LYGEDAPAYIKIVDDGIHELFLEYVALPLPLTPTYAEEGNNENSMKEDHQGSLLSDIGLT  548

Query  534  DFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            DFD +IM+T+SQQ +SELDQYLEESLLPRVHEFDV+ WWKLN++KYPTLSKMARDILT+P
Sbjct  549  DFDVYIMDTTSQQMKSELDQYLEESLLPRVHEFDVLSWWKLNKLKYPTLSKMARDILTIP  608

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKME  193
            VS+A  DSVF TV KE+D+YRCSLRPETVEALVCAKDW Q    +   A +KME
Sbjct  609  VSSAALDSVFDTVTKEVDQYRCSLRPETVEALVCAKDWLQYASPEISNAVVKME  662



>ref|XP_011457833.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=917

 Score =   334 bits (856),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 184/221 (83%), Gaps = 1/221 (0%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            +IQ + ARA  ++DPFV  L K MQE+ +KYWK CCL L+ AV++DPRFKMKLVEFSF+K
Sbjct  682  RIQSDLARAITTEDPFVSNLAKKMQERIEKYWKKCCLALATAVVMDPRFKMKLVEFSFNK  741

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEAN-GGAVNTQDAQELSTNELGL  538
            +YGE+A T+++IVD+GIHELF +Y+ LPLPLTP Y EE N GG   T+D+Q  +T + GL
Sbjct  742  VYGEEAPTFIKIVDDGIHELFHEYLTLPLPLTPAYAEEGNAGGNTRTEDSQGGTTADNGL  801

Query  537  TDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
            TDFD +IMET+SQQ +SELDQYLEE+LLPRVHEFDV+GWWKLN+MKYPTLSKMARDIL++
Sbjct  802  TDFDVYIMETTSQQMKSELDQYLEEALLPRVHEFDVLGWWKLNKMKYPTLSKMARDILSI  861

Query  357  PVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            PVST  +DSVF     EMD+YR SLRPET+EA++CAKDW Q
Sbjct  862  PVSTVSSDSVFDNTANEMDQYRSSLRPETLEAVICAKDWMQ  902



>ref|XP_011457831.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=949

 Score =   334 bits (857),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 184/221 (83%), Gaps = 1/221 (0%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            +IQ + ARA  ++DPFV  L K MQE+ +KYWK CCL L+ AV++DPRFKMKLVEFSF+K
Sbjct  714  RIQSDLARAITTEDPFVSNLAKKMQERIEKYWKKCCLALATAVVMDPRFKMKLVEFSFNK  773

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEAN-GGAVNTQDAQELSTNELGL  538
            +YGE+A T+++IVD+GIHELF +Y+ LPLPLTP Y EE N GG   T+D+Q  +T + GL
Sbjct  774  VYGEEAPTFIKIVDDGIHELFHEYLTLPLPLTPAYAEEGNAGGNTRTEDSQGGTTADNGL  833

Query  537  TDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
            TDFD +IMET+SQQ +SELDQYLEE+LLPRVHEFDV+GWWKLN+MKYPTLSKMARDIL++
Sbjct  834  TDFDVYIMETTSQQMKSELDQYLEEALLPRVHEFDVLGWWKLNKMKYPTLSKMARDILSI  893

Query  357  PVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            PVST  +DSVF     EMD+YR SLRPET+EA++CAKDW Q
Sbjct  894  PVSTVSSDSVFDNTANEMDQYRSSLRPETLEAVICAKDWMQ  934



>gb|KHN15060.1| Putative AC transposase [Glycine soja]
Length=1154

 Score =   337 bits (865),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 159/236 (67%), Positives = 189/236 (80%), Gaps = 2/236 (1%)
 Frame = -2

Query  894   KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
             K+QL+ +RA VS+DPF+  LTK MQ+K DKYWK C L+L+IAV++DPRFKMKLVEFSF+K
Sbjct  918   KLQLDLSRAVVSEDPFISNLTKPMQQKIDKYWKDCSLVLAIAVVMDPRFKMKLVEFSFTK  977

Query  714   IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELST--NELG  541
             IYGEDA  YV+IVD+GIHELF +YVALPLPLTP Y EE N G+          T   + G
Sbjct  978   IYGEDAHEYVKIVDDGIHELFHEYVALPLPLTPAYAEEGNAGSHPRAGESPGGTLMPDNG  1037

Query  540   LTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILT  361
             LTDFD +IMETSS Q +SELDQYLEESLLPRV +FDV+GWWKLN++KYPTLSKMARDIL+
Sbjct  1038  LTDFDVYIMETSSHQMKSELDQYLEESLLPRVPDFDVLGWWKLNKLKYPTLSKMARDILS  1097

Query  360   VPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKME  193
             VPVS+ P +SVF T  KEMD+YR SLRPETVEA+VCAKDW Q    ++  A +KME
Sbjct  1098  VPVSSVPPESVFDTKVKEMDQYRSSLRPETVEAIVCAKDWMQYGAAEASNAIVKME  1153



>ref|XP_007155048.1| hypothetical protein PHAVU_003G168600g [Phaseolus vulgaris]
 gb|ESW27042.1| hypothetical protein PHAVU_003G168600g [Phaseolus vulgaris]
Length=1252

 Score =   335 bits (860),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 160/237 (68%), Positives = 193/237 (81%), Gaps = 6/237 (3%)
 Frame = -2

Query  894   KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
             K+QL+ +RA V++DPF+  LTK MQ+K DKYWK C L+L+IAV++DPRFKMKLVEFSF+K
Sbjct  1018  KLQLDLSRAVVNEDPFISNLTKPMQQKIDKYWKDCSLVLAIAVVMDPRFKMKLVEFSFTK  1077

Query  714   IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQE---LSTNEL  544
             IYGEDA  YV+IVD+GIHELF +YV LPLPLTP Y E+A G  V T+ +     LS N  
Sbjct  1078  IYGEDAHVYVKIVDDGIHELFHEYVTLPLPLTPAYAEDA-GSHVKTEGSPGGTLLSDN--  1134

Query  543   GLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDIL  364
             GLTDFD +IMETSS Q++SELDQYLEESLLPRV +FDV+GWWKLN++KYPTLSKMARDIL
Sbjct  1135  GLTDFDVYIMETSSHQTKSELDQYLEESLLPRVPDFDVLGWWKLNKIKYPTLSKMARDIL  1194

Query  363   TVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKME  193
             +VPVS+ P +SVF T  KEMD+YR SLRPETVEA+VCAKDW Q    ++  A +KME
Sbjct  1195  SVPVSSVPPESVFDTKVKEMDQYRSSLRPETVEAIVCAKDWMQYGAAEASHALVKME  1251



>gb|KJB64715.1| hypothetical protein B456_010G061500 [Gossypium raimondii]
Length=678

 Score =   325 bits (832),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 153/237 (65%), Positives = 184/237 (78%), Gaps = 4/237 (2%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KI ++  R+  S+DPF+  L KSMQEK DKYWK C L+L++AV++DPRFKMKLVEFSF+K
Sbjct  442  KIHVDLGRSVTSEDPFISNLAKSMQEKIDKYWKDCSLVLAMAVVMDPRFKMKLVEFSFTK  501

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANG---GAVNTQDAQELSTNEL  544
            IYGEDA TY++ VD+GIHELF +YVALPLPLTPTY+EE NG   G  N      L ++  
Sbjct  502  IYGEDAPTYIKTVDDGIHELFLEYVALPLPLTPTYVEEVNGANNGKTNESHQGNLLSDH-  560

Query  543  GLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDIL  364
            GL DFD +IMET+SQQ +SELDQYLEESLLPRV EFDV+GWWKLN+MKYPTLSKMARDIL
Sbjct  561  GLADFDVYIMETNSQQMKSELDQYLEESLLPRVQEFDVLGWWKLNKMKYPTLSKMARDIL  620

Query  363  TVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKME  193
            ++PVS A  +S+F    K++D YR SLRPETVEAL+CAKDW          A +KME
Sbjct  621  SIPVSAAATESIFDITDKQLDEYRSSLRPETVEALICAKDWLHYGSSDVSNALVKME  677



>gb|KJB23615.1| hypothetical protein B456_004G107300 [Gossypium raimondii]
 gb|KJB23616.1| hypothetical protein B456_004G107300 [Gossypium raimondii]
Length=673

 Score =   324 bits (830),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 154/233 (66%), Positives = 183/233 (79%), Gaps = 8/233 (3%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KI  +  R+  ++DPF+  + KSM EK DKYWK C LIL+IAV++DPRFKMKLVEFSF+K
Sbjct  438  KIHADLGRSITNEDPFISNIAKSMLEKIDKYWKDCSLILAIAVVMDPRFKMKLVEFSFTK  497

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELST--NELG  541
            I+GEDA TY++IVD+GIHELF +YVALPLPLTPTY EE N G     D  +     ++ G
Sbjct  498  IFGEDAPTYIKIVDDGIHELFLEYVALPLPLTPTYTEEGNAGNNGKTDESQQGNLLSDQG  557

Query  540  LTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILT  361
            LTDFD +IMETSSQQ +SELDQYLEESLLPRV EFDV+GWWKLN+MKYPTLSKMARDIL+
Sbjct  558  LTDFDVYIMETSSQQMKSELDQYLEESLLPRVQEFDVLGWWKLNKMKYPTLSKMARDILS  617

Query  360  VPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW------QQNELVK  220
            +PVS A  DSVF  + K++D YR SLRPETVEAL+CAKDW      + N LVK
Sbjct  618  IPVSAAAPDSVFDIIIKQLDEYRSSLRPETVEALICAKDWLHYGSEESNALVK  670



>ref|XP_010656463.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Vitis vinifera]
 ref|XP_010656464.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Vitis vinifera]
 ref|XP_010656465.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Vitis vinifera]
 ref|XP_010656466.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Vitis vinifera]
 ref|XP_010656467.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Vitis vinifera]
 ref|XP_010656468.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Vitis vinifera]
Length=675

 Score =   324 bits (830),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/224 (68%), Positives = 187/224 (83%), Gaps = 6/224 (3%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQ E ARAA  +DPF+  L K MQEK DKYWK C L+L+IAV +DPRFKMKLVEFSF K
Sbjct  437  KIQTELARAATCEDPFISNLAKPMQEKVDKYWKDCGLVLAIAVAMDPRFKMKLVEFSFPK  496

Query  714  IYGEDAS-TYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQE---LSTNE  547
            IYG++A+ T +R+VDEG+HELF +YVALPLPLTPTY++E N G++  +D  +   LS+N 
Sbjct  497  IYGDEAAPTCIRVVDEGLHELFLEYVALPLPLTPTYVDEGNAGSMKGEDHSQGGLLSSN-  555

Query  546  LGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  367
             GL+DFD +I+ETSSQQ +SELDQYLEES+LPRVHEFD++GWWKLN++KYPTLSKMARDI
Sbjct  556  -GLSDFDVYILETSSQQMKSELDQYLEESVLPRVHEFDLLGWWKLNKLKYPTLSKMARDI  614

Query  366  LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            L++PVS+   +S++ TV KEMD YR SLRPETVEAL+CAKDW Q
Sbjct  615  LSIPVSSVAVESIYDTVGKEMDEYRNSLRPETVEALICAKDWLQ  658



>ref|XP_010047980.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Eucalyptus grandis]
 ref|XP_010047981.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Eucalyptus grandis]
 ref|XP_010047982.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Eucalyptus grandis]
 ref|XP_010047983.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Eucalyptus grandis]
 gb|KCW80053.1| hypothetical protein EUGRSUZ_C01383 [Eucalyptus grandis]
Length=658

 Score =   323 bits (827),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/237 (65%), Positives = 187/237 (79%), Gaps = 3/237 (1%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQ + ARA  S+DPF+  LTK M EK DKYWK C L+L++AV++DPRFKMKLVEFSF+K
Sbjct  423  KIQADLARAVTSEDPFIADLTKPMLEKIDKYWKDCSLVLAMAVVMDPRFKMKLVEFSFTK  482

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQ--ELSTNELG  541
            ++GEDA  YV+IVDEGIHELF +YV+LPLPLTPTY EE   G    +  Q   L T+  G
Sbjct  483  VFGEDAPNYVKIVDEGIHELFLEYVSLPLPLTPTYAEEGQNGNKMEESPQGGHLLTDH-G  541

Query  540  LTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILT  361
            LTDFD +IMETS QQ +SELDQYL+E+LLPRV EFDV+GWWKLN++KYPTLSKMARDIL+
Sbjct  542  LTDFDMYIMETSGQQMKSELDQYLDETLLPRVQEFDVLGWWKLNKLKYPTLSKMARDILS  601

Query  360  VPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEV  190
            +PVST   DSVF T  KEMD+YRCSLRP+TVEAL+C KDW Q    +   A +K+E+
Sbjct  602  IPVSTVLPDSVFDTAPKEMDKYRCSLRPDTVEALLCTKDWLQYGSSQISNALVKVEM  658



>gb|KHN03605.1| Putative AC transposase [Glycine soja]
Length=1180

 Score =   332 bits (852),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 156/236 (66%), Positives = 188/236 (80%), Gaps = 2/236 (1%)
 Frame = -2

Query  894   KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
             K+QL+ +RA V++DPF+  LTK MQ+K DKYWK C ++L+IAV++DPRFKMKLVEFSF+K
Sbjct  944   KLQLDLSRAIVNEDPFISNLTKPMQQKIDKYWKDCSVVLAIAVVMDPRFKMKLVEFSFTK  1003

Query  714   IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELST--NELG  541
             IYGEDA  YV+IVD+GIHELF +YV LPLPLTP Y EE N G           T  ++ G
Sbjct  1004  IYGEDAHEYVKIVDDGIHELFHEYVTLPLPLTPAYAEEGNPGNHPKTGGSPGGTLMSDNG  1063

Query  540   LTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILT  361
             LTDFD +IMETS+ Q +SELDQYLEESLLPRV +FDV+GWWKLN++KYPTLSKMARDIL+
Sbjct  1064  LTDFDVYIMETSNHQMKSELDQYLEESLLPRVPDFDVLGWWKLNKLKYPTLSKMARDILS  1123

Query  360   VPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKME  193
             VPVS+ P +SVF T  KEMD+YR SLRPETVEALVCAKDW Q    ++  A +KME
Sbjct  1124  VPVSSLPPESVFDTKVKEMDQYRSSLRPETVEALVCAKDWMQYGAAEASNAIVKME  1179



>gb|KJB64716.1| hypothetical protein B456_010G061600 [Gossypium raimondii]
Length=678

 Score =   322 bits (825),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 152/237 (64%), Positives = 183/237 (77%), Gaps = 4/237 (2%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KI ++  R+  S+DPF+  L KSMQEK DKYWK C L+L++AV++DPRFKMKLVEFSF+K
Sbjct  442  KIHVDLGRSVTSEDPFISNLAKSMQEKIDKYWKDCSLVLAMAVVMDPRFKMKLVEFSFTK  501

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANG---GAVNTQDAQELSTNEL  544
            IYGEDA TY++ VD+GIHELF +YVALPLPLTPTY EE NG   G  N      L ++  
Sbjct  502  IYGEDAPTYIKTVDDGIHELFLEYVALPLPLTPTYAEEVNGANNGKTNESHQGNLLSDH-  560

Query  543  GLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDIL  364
            GL DFD +IMET+SQQ +SELDQYLEESLLPRV EFDV+GWWKLN+MKYPTLSKMARDIL
Sbjct  561  GLADFDVYIMETNSQQMKSELDQYLEESLLPRVQEFDVLGWWKLNKMKYPTLSKMARDIL  620

Query  363  TVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKME  193
            ++PVS A  +S+F    K++D YR SLRPETVEAL+CAKDW          A ++ME
Sbjct  621  SIPVSAAATESIFDITDKQLDEYRSSLRPETVEALICAKDWLHYGSSDVSNALVRME  677



>ref|XP_007013535.1| BED zinc finger,hAT family dimerization domain isoform 2 [Theobroma 
cacao]
 ref|XP_007013536.1| BED zinc finger,hAT family dimerization domain isoform 2 [Theobroma 
cacao]
 ref|XP_007013537.1| BED zinc finger,hAT family dimerization domain isoform 2 [Theobroma 
cacao]
 gb|EOY31154.1| BED zinc finger,hAT family dimerization domain isoform 2 [Theobroma 
cacao]
 gb|EOY31155.1| BED zinc finger,hAT family dimerization domain isoform 2 [Theobroma 
cacao]
 gb|EOY31156.1| BED zinc finger,hAT family dimerization domain isoform 2 [Theobroma 
cacao]
Length=673

 Score =   320 bits (820),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/237 (65%), Positives = 184/237 (78%), Gaps = 4/237 (2%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KI  +  R+   +DPF+  L KSM EK DKYWK C L+L+IAV++DPRFKMKLVEFSF+K
Sbjct  437  KIHADLGRSITGEDPFISNLAKSMLEKIDKYWKDCSLVLAIAVVMDPRFKMKLVEFSFTK  496

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNEL---  544
            IYG+DA TY++IVD+GIHELF +YVALPLPLTPTY EE N G  N +       N L   
Sbjct  497  IYGDDAPTYIKIVDDGIHELFLEYVALPLPLTPTYAEEGNAGN-NGKPEDSHQGNLLSDH  555

Query  543  GLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDIL  364
            GLTDFD +IMET+SQQ +SELDQYLEESLLPRV EFDV+GWWKLN++KYPTLSKMARDIL
Sbjct  556  GLTDFDVYIMETTSQQMKSELDQYLEESLLPRVQEFDVLGWWKLNKLKYPTLSKMARDIL  615

Query  363  TVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKME  193
            ++PVS A  +SVF  V K++D+YR SLRPETVEAL+CAKDW      +   A +KME
Sbjct  616  SIPVSAAAPESVFDIVDKQLDQYRSSLRPETVEALICAKDWLHYGSTEVSNALVKME  672



>ref|XP_007013534.1| BED zinc finger,hAT family dimerization domain isoform 1 [Theobroma 
cacao]
 gb|EOY31153.1| BED zinc finger,hAT family dimerization domain isoform 1 [Theobroma 
cacao]
Length=711

 Score =   320 bits (819),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/237 (65%), Positives = 184/237 (78%), Gaps = 4/237 (2%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KI  +  R+   +DPF+  L KSM EK DKYWK C L+L+IAV++DPRFKMKLVEFSF+K
Sbjct  475  KIHADLGRSITGEDPFISNLAKSMLEKIDKYWKDCSLVLAIAVVMDPRFKMKLVEFSFTK  534

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNEL---  544
            IYG+DA TY++IVD+GIHELF +YVALPLPLTPTY EE N G  N +       N L   
Sbjct  535  IYGDDAPTYIKIVDDGIHELFLEYVALPLPLTPTYAEEGNAGN-NGKPEDSHQGNLLSDH  593

Query  543  GLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDIL  364
            GLTDFD +IMET+SQQ +SELDQYLEESLLPRV EFDV+GWWKLN++KYPTLSKMARDIL
Sbjct  594  GLTDFDVYIMETTSQQMKSELDQYLEESLLPRVQEFDVLGWWKLNKLKYPTLSKMARDIL  653

Query  363  TVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKME  193
            ++PVS A  +SVF  V K++D+YR SLRPETVEAL+CAKDW      +   A +KME
Sbjct  654  SIPVSAAAPESVFDIVDKQLDQYRSSLRPETVEALICAKDWLHYGSTEVSNALVKME  710



>gb|KDO73493.1| hypothetical protein CISIN_1g002915mg [Citrus sinensis]
 gb|KDO73494.1| hypothetical protein CISIN_1g002915mg [Citrus sinensis]
Length=866

 Score =   323 bits (827),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/237 (64%), Positives = 189/237 (80%), Gaps = 3/237 (1%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KI  +  R+  ++DPFV  ++K M EK DKYW+ CCL+L+IAV++DPRFKMKLVEFSF+K
Sbjct  631  KILSDLTRSVTNEDPFVSSISKGMLEKIDKYWRDCCLVLAIAVVMDPRFKMKLVEFSFTK  690

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELST--NELG  541
            IYG+DA TY++IVD+GIHELF +YV+LPLPLTPTY EE N G     D  +  T  ++ G
Sbjct  691  IYGDDAPTYIKIVDDGIHELFLEYVSLPLPLTPTY-EEGNAGNNMKSDESQGGTLLSDNG  749

Query  540  LTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILT  361
            LTDFD FIMET++QQ +SELDQYL+ESLLPR H+FD++GWWKLN+MKYPTLSKMARDIL+
Sbjct  750  LTDFDMFIMETTNQQMKSELDQYLDESLLPRAHDFDLLGWWKLNKMKYPTLSKMARDILS  809

Query  360  VPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEV  190
            VPV +   DSVF TV KE+DRYR SLRPETVEAL+CAKDW Q    +   A +K+E+
Sbjct  810  VPVCSVGQDSVFDTVSKELDRYRSSLRPETVEALICAKDWFQYGSSEGSNALVKLEI  866



>emb|CBI28241.3| unnamed protein product [Vitis vinifera]
Length=839

 Score =   322 bits (825),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/224 (68%), Positives = 187/224 (83%), Gaps = 6/224 (3%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQ E ARAA  +DPF+  L K MQEK DKYWK C L+L+IAV +DPRFKMKLVEFSF K
Sbjct  516  KIQTELARAATCEDPFISNLAKPMQEKVDKYWKDCGLVLAIAVAMDPRFKMKLVEFSFPK  575

Query  714  IYGEDAS-TYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQE---LSTNE  547
            IYG++A+ T +R+VDEG+HELF +YVALPLPLTPTY++E N G++  +D  +   LS+N 
Sbjct  576  IYGDEAAPTCIRVVDEGLHELFLEYVALPLPLTPTYVDEGNAGSMKGEDHSQGGLLSSN-  634

Query  546  LGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  367
             GL+DFD +I+ETSSQQ +SELDQYLEES+LPRVHEFD++GWWKLN++KYPTLSKMARDI
Sbjct  635  -GLSDFDVYILETSSQQMKSELDQYLEESVLPRVHEFDLLGWWKLNKLKYPTLSKMARDI  693

Query  366  LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            L++PVS+   +S++ TV KEMD YR SLRPETVEAL+CAKDW Q
Sbjct  694  LSIPVSSVAVESIYDTVGKEMDEYRNSLRPETVEALICAKDWLQ  737



>ref|XP_004493926.1| PREDICTED: uncharacterized protein LOC101507795 isoform X1 [Cicer 
arietinum]
 ref|XP_004493927.1| PREDICTED: uncharacterized protein LOC101507795 isoform X2 [Cicer 
arietinum]
Length=1274

 Score =   328 bits (842),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 153/236 (65%), Positives = 184/236 (78%), Gaps = 2/236 (1%)
 Frame = -2

Query  894   KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
             K+ L+ ARAA ++D F+  LTK MQEK DKYW+ C L L IAV++DPRFKMKLVEFSF+K
Sbjct  1038  KLHLDLARAATNEDHFISNLTKPMQEKIDKYWRECSLTLVIAVVMDPRFKMKLVEFSFTK  1097

Query  714   IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELST--NELG  541
             IY EDA  YV+IVD+GIHELF +Y  LPLPLTP Y +E N G+    +     T  ++ G
Sbjct  1098  IYSEDAHVYVKIVDDGIHELFHEYATLPLPLTPAYADEGNAGSNAKMEGSPGGTLLSDNG  1157

Query  540   LTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILT  361
             L DFD +IMETSS Q++SELDQYLEESLLPRV +FDV+GWWKLN++KYPTLSKMARDIL+
Sbjct  1158  LADFDVYIMETSSHQTKSELDQYLEESLLPRVPDFDVLGWWKLNKLKYPTLSKMARDILS  1217

Query  360   VPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKME  193
             +PV T P DS+F    KEMD+YR SLRPETVEALVCAKDW Q    +S+TA +KME
Sbjct  1218  IPVCTVPPDSIFDKKGKEMDQYRSSLRPETVEALVCAKDWMQYTAPESLTALVKME  1273



>gb|EPS67926.1| hypothetical protein M569_06846, partial [Genlisea aurea]
Length=696

 Score =   317 bits (813),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 155/251 (62%), Positives = 187/251 (75%), Gaps = 17/251 (7%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KI  E +R++ S+DPF+G L KSMQEKF++YWK C  +L+  VI+DPRFKMKLVEFSFSK
Sbjct  446  KILFELSRSSASEDPFIGDLAKSMQEKFNRYWKGCSFVLAAGVIMDPRFKMKLVEFSFSK  505

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNT-------------Q  574
            IYG++A++YV++VD+GIHELFQ+YV LPLPLTP Y EE NG  + T             +
Sbjct  506  IYGDEAASYVKVVDDGIHELFQEYVTLPLPLTPAYAEEQNGAPIKTTAAVAAEAEPEGSK  565

Query  573  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  394
             +   + N  GL DFDA+I+ET+SQ  +SELD+YLEESLLPRV +FDVVGWWK+NRM YP
Sbjct  566  SSSNSNNNASGLMDFDAYIIETTSQLEKSELDRYLEESLLPRVQDFDVVGWWKINRMNYP  625

Query  393  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSI  214
            TLSKMARDIL+ PV T   DSVF T  KEMD YRCSLRPETVEALVCAKDW   E   S 
Sbjct  626  TLSKMARDILSSPVCTVCPDSVFDTTGKEMDGYRCSLRPETVEALVCAKDWLTAEKRDSA  685

Query  213  TA----PIKME  193
            +A     +KME
Sbjct  686  SATASPTVKME  696



>ref|XP_011655423.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X3 [Cucumis sativus]
Length=714

 Score =   317 bits (813),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 189/235 (80%), Gaps = 1/235 (0%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            +I  E ARA  ++DPF+  L+K M EKFDKYWK C ++L+ AV++DPRFKMKLVEFSF+K
Sbjct  479  RIHSELARAITNEDPFISSLSKMMLEKFDKYWKDCSIVLAAAVVMDPRFKMKLVEFSFTK  538

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEAN-GGAVNTQDAQELSTNELGL  538
            +YGE+A  Y+++VD+GIHELF +YVALPLPLTPTY E+ +  G +  +D+Q    ++ G 
Sbjct  539  VYGEEAPAYIKVVDDGIHELFDEYVALPLPLTPTYAEDGSVDGNMKGEDSQGNLLSDNGF  598

Query  537  TDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
            TDFD +IMET+SQQ +SELD+YLE+SLLPRV +FD++GWWKLN+ KYPTLSKMARDIL++
Sbjct  599  TDFDVYIMETTSQQMKSELDRYLEDSLLPRVQDFDLLGWWKLNKFKYPTLSKMARDILSI  658

Query  357  PVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKME  193
            PVST P DSVF T  K+MD+YR SLRPETVEA++C+KDW Q  L +   A ++ME
Sbjct  659  PVSTLPPDSVFITRRKKMDQYRSSLRPETVEAMICSKDWMQCGLSEVSNALVRME  713



>ref|XP_006453082.1| hypothetical protein CICLE_v10007308mg [Citrus clementina]
 gb|ESR66322.1| hypothetical protein CICLE_v10007308mg [Citrus clementina]
Length=1064

 Score =   324 bits (830),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/237 (64%), Positives = 189/237 (80%), Gaps = 3/237 (1%)
 Frame = -2

Query  894   KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
             KI  +  R+  ++DPFV  ++K M EK DKYW+ CCL+L+IAV++DPRFKMKLVEFSF+K
Sbjct  829   KILSDLTRSVTNEDPFVSSISKGMLEKIDKYWRDCCLVLAIAVVMDPRFKMKLVEFSFTK  888

Query  714   IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELST--NELG  541
             IYG+DA TY++IVD+GIHELF +YV+LPLPLTPTY EE N G     D  +  T  ++ G
Sbjct  889   IYGDDAPTYIKIVDDGIHELFLEYVSLPLPLTPTY-EEGNAGNNMKSDESQGGTLLSDNG  947

Query  540   LTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILT  361
             LTDFD FIMET++QQ +SELDQYL+ESLLPR H+FD++GWWKLN+MKYPTLSKMARDIL+
Sbjct  948   LTDFDMFIMETTNQQMKSELDQYLDESLLPRAHDFDLLGWWKLNKMKYPTLSKMARDILS  1007

Query  360   VPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEV  190
             VPV +   DSVF TV KE+DRYR SLRPETVEAL+CAKDW Q    +   A +K+E+
Sbjct  1008  VPVCSVGQDSVFDTVSKELDRYRSSLRPETVEALICAKDWFQYGSSEGSNALVKLEI  1064



>ref|XP_011655416.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X2 [Cucumis sativus]
Length=740

 Score =   317 bits (813),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 189/235 (80%), Gaps = 1/235 (0%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            +I  E ARA  ++DPF+  L+K M EKFDKYWK C ++L+ AV++DPRFKMKLVEFSF+K
Sbjct  505  RIHSELARAITNEDPFISSLSKMMLEKFDKYWKDCSIVLAAAVVMDPRFKMKLVEFSFTK  564

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEAN-GGAVNTQDAQELSTNELGL  538
            +YGE+A  Y+++VD+GIHELF +YVALPLPLTPTY E+ +  G +  +D+Q    ++ G 
Sbjct  565  VYGEEAPAYIKVVDDGIHELFDEYVALPLPLTPTYAEDGSVDGNMKGEDSQGNLLSDNGF  624

Query  537  TDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
            TDFD +IMET+SQQ +SELD+YLE+SLLPRV +FD++GWWKLN+ KYPTLSKMARDIL++
Sbjct  625  TDFDVYIMETTSQQMKSELDRYLEDSLLPRVQDFDLLGWWKLNKFKYPTLSKMARDILSI  684

Query  357  PVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKME  193
            PVST P DSVF T  K+MD+YR SLRPETVEA++C+KDW Q  L +   A ++ME
Sbjct  685  PVSTLPPDSVFITRRKKMDQYRSSLRPETVEAMICSKDWMQCGLSEVSNALVRME  739



>ref|XP_011655412.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Cucumis sativus]
Length=786

 Score =   317 bits (812),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 145/235 (62%), Positives = 189/235 (80%), Gaps = 1/235 (0%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            +I  E ARA  ++DPF+  L+K M EKFDKYWK C ++L+ AV++DPRFKMKLVEFSF+K
Sbjct  551  RIHSELARAITNEDPFISSLSKMMLEKFDKYWKDCSIVLAAAVVMDPRFKMKLVEFSFTK  610

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEAN-GGAVNTQDAQELSTNELGL  538
            +YGE+A  Y+++VD+GIHELF +YVALPLPLTPTY E+ +  G +  +D+Q    ++ G 
Sbjct  611  VYGEEAPAYIKVVDDGIHELFDEYVALPLPLTPTYAEDGSVDGNMKGEDSQGNLLSDNGF  670

Query  537  TDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
            TDFD +IMET+SQQ +SELD+YLE+SLLPRV +FD++GWWKLN+ KYPTLSKMARDIL++
Sbjct  671  TDFDVYIMETTSQQMKSELDRYLEDSLLPRVQDFDLLGWWKLNKFKYPTLSKMARDILSI  730

Query  357  PVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKME  193
            PVST P DSVF T  K+MD+YR SLRPETVEA++C+KDW Q  L +   A ++ME
Sbjct  731  PVSTLPPDSVFITRRKKMDQYRSSLRPETVEAMICSKDWMQCGLSEVSNALVRME  785



>ref|XP_007138404.1| hypothetical protein PHAVU_009G205900g [Phaseolus vulgaris]
 gb|ESW10398.1| hypothetical protein PHAVU_009G205900g [Phaseolus vulgaris]
Length=856

 Score =   318 bits (814),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 151/237 (64%), Positives = 186/237 (78%), Gaps = 6/237 (3%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+QL+ ARA  S+DPF+  L K M EK D YW+ C L+L++AV++DPRFKMKLVEFSF+K
Sbjct  620  KLQLDAARAVTSEDPFINSLNKIMHEKIDIYWRECSLVLALAVVLDPRFKMKLVEFSFTK  679

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVN----TQDAQELSTNE  547
            IYG+DA  Y++ V++GIHE+F +YVALPLPLTP Y E+   G  +    +Q    LS N 
Sbjct  680  IYGDDAHLYIKTVEDGIHEMFHEYVALPLPLTPAYTEDGCSGNRSKMEESQGDAMLSDN-  738

Query  546  LGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  367
             GLTDFDA+IMETSSQQ +SELDQYLEESLLPRV +FDV+GWWKLN++KYPTLSKMARDI
Sbjct  739  -GLTDFDAYIMETSSQQMKSELDQYLEESLLPRVPDFDVLGWWKLNKLKYPTLSKMARDI  797

Query  366  LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKM  196
            L+VPVST   DSVF +  KEMD+YR SLRPETVEA+VC+KDW Q    ++  A +KM
Sbjct  798  LSVPVSTVAPDSVFYSKTKEMDQYRSSLRPETVEAIVCSKDWMQYGTAEASNALVKM  854



>gb|EYU34976.1| hypothetical protein MIMGU_mgv1a002172mg [Erythranthe guttata]
Length=705

 Score =   314 bits (804),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/241 (62%), Positives = 196/241 (81%), Gaps = 5/241 (2%)
 Frame = -2

Query  894  KIQLEXARAAVS-DDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFS  718
            K+QL+ AR+A + ++ F+ G+TKSM E FDKYWKS C IL+IAV++DPRFKMKLV+F+F 
Sbjct  466  KVQLDLARSANNKENDFLSGMTKSMYENFDKYWKSTCYILAIAVVMDPRFKMKLVQFTFV  525

Query  717  KIYGED-ASTYVRIVDEGIHELFQDYVALPLPLT--PTYIEEANGGAVNTQDAQELSTNE  547
            KIYGE+ A+++++IVDEGIHELF +Y++ P+  T   +Y E+ NG +V  +D++ + +N 
Sbjct  526  KIYGEERAASFIKIVDEGIHELFHEYLSFPMHSTHDSSYGEDENGQSVKIEDSEGMDSNG  585

Query  546  LGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  367
             GL+DFDA+IMET+SQ S++ELDQYLEESLLPRVH+FDVVGWWKLNR+KYPTLSKMARD+
Sbjct  586  -GLSDFDAYIMETTSQLSKTELDQYLEESLLPRVHDFDVVGWWKLNRIKYPTLSKMARDV  644

Query  366  LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEVP  187
            L+VPV T P + VF TV +EMD YR SLR ETVEAL+CAKDW Q E ++     IKME+P
Sbjct  645  LSVPVCTVPGNMVFDTVRREMDSYRSSLRSETVEALICAKDWLQPEKLEGPAPVIKMEIP  704

Query  186  I  184
            I
Sbjct  705  I  705



>ref|XP_010687925.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=1053

 Score =   319 bits (818),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 150/237 (63%), Positives = 192/237 (81%), Gaps = 4/237 (2%)
 Frame = -2

Query  894   KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
             KIQLE ARAA SDD FV GL K +Q+KF KYWK+ CL+L++AV +DPRFKMKLVEFSF+K
Sbjct  819   KIQLELARAAASDDLFVAGLAKPLQDKFHKYWKNSCLVLAVAVAMDPRFKMKLVEFSFTK  878

Query  714   IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELST-NELGL  538
             I+ ++A  ++R+VD+GIHELF +Y+  PLPLTP  + + NGG V  +D++  +  N  GL
Sbjct  879   IFMDEAPHFIRVVDDGIHELFHEYMNHPLPLTP--VRDGNGGYVKGEDSEGGNLLNSNGL  936

Query  537   TDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
             +DFD +IMETSSQQ +SELDQYLEESLLPR+ +FDV+GWWKLN++KYPTLSKMARDIL++
Sbjct  937   SDFDMYIMETSSQQMKSELDQYLEESLLPRIQDFDVLGWWKLNKLKYPTLSKMARDILSM  996

Query  357   PVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAP-IKMEV  190
             P+ST  A+SVF T  KEMD YRCSLRPET+EAL+CAKDW Q +  K+ +   +KME+
Sbjct  997   PLSTVSAESVFDTSFKEMDSYRCSLRPETLEALICAKDWLQPDSTKASSKELVKMEL  1053



>ref|XP_010687924.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=1065

 Score =   319 bits (817),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 150/237 (63%), Positives = 192/237 (81%), Gaps = 4/237 (2%)
 Frame = -2

Query  894   KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
             KIQLE ARAA SDD FV GL K +Q+KF KYWK+ CL+L++AV +DPRFKMKLVEFSF+K
Sbjct  831   KIQLELARAAASDDLFVAGLAKPLQDKFHKYWKNSCLVLAVAVAMDPRFKMKLVEFSFTK  890

Query  714   IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELST-NELGL  538
             I+ ++A  ++R+VD+GIHELF +Y+  PLPLTP  + + NGG V  +D++  +  N  GL
Sbjct  891   IFMDEAPHFIRVVDDGIHELFHEYMNHPLPLTP--VRDGNGGYVKGEDSEGGNLLNSNGL  948

Query  537   TDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
             +DFD +IMETSSQQ +SELDQYLEESLLPR+ +FDV+GWWKLN++KYPTLSKMARDIL++
Sbjct  949   SDFDMYIMETSSQQMKSELDQYLEESLLPRIQDFDVLGWWKLNKLKYPTLSKMARDILSM  1008

Query  357   PVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAP-IKMEV  190
             P+ST  A+SVF T  KEMD YRCSLRPET+EAL+CAKDW Q +  K+ +   +KME+
Sbjct  1009  PLSTVSAESVFDTSFKEMDSYRCSLRPETLEALICAKDWLQPDSTKASSKELVKMEL  1065



>ref|XP_010250193.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nelumbo nucifera]
Length=667

 Score =   310 bits (794),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 158/246 (64%), Positives = 188/246 (76%), Gaps = 23/246 (9%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE   AA S DPFV  LTKSMQEKFD+YW+ C L+L+IAV++DPRFKMKLVEFSFSK
Sbjct  432  KIQLELTHAATSQDPFVSSLTKSMQEKFDRYWRDCNLVLAIAVVMDPRFKMKLVEFSFSK  491

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIE------EANGGAVNTQDAQELST  553
            IYG+DA  Y+R+VDEGIHELF +Y+A PLPLTPTY+E      E+ GG +       LS+
Sbjct  492  IYGDDAGEYIRVVDEGIHELFLEYMAQPLPLTPTYVERETPKTESPGGIL-------LSS  544

Query  552  NELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMA  376
             + GL DFD FI E +SSQ S+SELDQYLEESLLPR+ EFD++ WWKLN +KYPTLS+MA
Sbjct  545  GD-GLLDFDVFISEMSSSQNSKSELDQYLEESLLPRIQEFDILSWWKLNNLKYPTLSRMA  603

Query  375  RDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN-----ELVKSIT  211
            RDIL +PVS A ADSVF T  K +D YR SLRPET+EAL+CAKDW  +     EL K+I 
Sbjct  604  RDILAIPVSPASADSVFDTEIKRLDSYRSSLRPETIEALICAKDWLPHGTPSAELSKAI-  662

Query  210  APIKME  193
              +KME
Sbjct  663  --VKME  666



>ref|XP_012081197.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Jatropha curcas]
Length=662

 Score =   310 bits (794),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/234 (63%), Positives = 183/234 (78%), Gaps = 0/234 (0%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQ + ARAA SDDPF+  +TK+MQEK  +YWK C L+L+IAV++DPRFKMKLVEF+FSK
Sbjct  428  KIQTDLARAAASDDPFISIVTKAMQEKISRYWKDCSLVLAIAVVMDPRFKMKLVEFTFSK  487

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            I+GEDA TY++IVD+G+HELF +Y+A P  L  TY EE N      +D Q    ++ G T
Sbjct  488  IHGEDAPTYIKIVDDGLHELFHEYLASPSSLALTYTEEGNTENSMREDHQGTLLSDNGFT  547

Query  534  DFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            DFD +IMET++Q+  SELDQYLEESLLPRV EFDV+ WWKLN++KYPTLSK+ARDILT+P
Sbjct  548  DFDVYIMETTNQEMTSELDQYLEESLLPRVQEFDVLSWWKLNKLKYPTLSKLARDILTIP  607

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKME  193
            VS+A  DSVF T+ KE+D+YR SLRPETVEALVCAKDW Q    +     +KME
Sbjct  608  VSSAAPDSVFDTMTKELDQYRSSLRPETVEALVCAKDWLQYASAEISDDIVKME  661



>gb|KGN65126.1| hypothetical protein Csa_1G229510 [Cucumis sativus]
Length=751

 Score =   312 bits (799),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 182/221 (82%), Gaps = 1/221 (0%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            +I  E ARA  ++DPF+  L+K M EKFDKYWK C ++L+ AV++DPRFKMKLVEFSF+K
Sbjct  505  RIHSELARAITNEDPFISSLSKMMLEKFDKYWKDCSIVLAAAVVMDPRFKMKLVEFSFTK  564

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEAN-GGAVNTQDAQELSTNELGL  538
            +YGE+A  Y+++VD+GIHELF +YVALPLPLTPTY E+ +  G +  +D+Q    ++ G 
Sbjct  565  VYGEEAPAYIKVVDDGIHELFDEYVALPLPLTPTYAEDGSVDGNMKGEDSQGNLLSDNGF  624

Query  537  TDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
            TDFD +IMET+SQQ +SELD+YLE+SLLPRV +FD++GWWKLN+ KYPTLSKMARDIL++
Sbjct  625  TDFDVYIMETTSQQMKSELDRYLEDSLLPRVQDFDLLGWWKLNKFKYPTLSKMARDILSI  684

Query  357  PVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            PVST P DSVF T  K+MD+YR SLRPETVEA++C+KDW Q
Sbjct  685  PVSTLPPDSVFITRRKKMDQYRSSLRPETVEAMICSKDWMQ  725



>ref|XP_008242815.1| PREDICTED: putative AC transposase isoform X2 [Prunus mume]
Length=724

 Score =   310 bits (793),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 190/225 (84%), Gaps = 6/225 (3%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            +IQ E  R   S+DPF+  LTK MQ++ +KYWK+C L L+ AV++DPRFKMKLVEFSF+K
Sbjct  487  RIQTELVRTITSEDPFISSLTKVMQDRIEKYWKNCSLALATAVVMDPRFKMKLVEFSFNK  546

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGA-VNTQDAQE---LSTNE  547
            IYGE+A T+++IVD+GIHELF +Y+ LPLPLTPTY ++  GGA V T+D+Q    L+ N 
Sbjct  547  IYGEEAPTFIKIVDDGIHELFHEYLTLPLPLTPTYADDGTGGANVKTEDSQGGTLLTDN-  605

Query  546  LGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  367
             GLTDFD +IMET+SQQ +SELDQYL+ESLLPRVHEFDV+GWWKLN+MKYPTLSKMARDI
Sbjct  606  -GLTDFDMYIMETTSQQMKSELDQYLDESLLPRVHEFDVLGWWKLNKMKYPTLSKMARDI  664

Query  366  LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  232
            L++PVST P++SVF TV KEMD+YR SLRPETVEAL+CAKDW Q+
Sbjct  665  LSIPVSTVPSESVFDTVAKEMDQYRSSLRPETVEALICAKDWMQH  709



>ref|XP_008242814.1| PREDICTED: putative AC transposase isoform X1 [Prunus mume]
Length=733

 Score =   310 bits (793),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 190/225 (84%), Gaps = 6/225 (3%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            +IQ E  R   S+DPF+  LTK MQ++ +KYWK+C L L+ AV++DPRFKMKLVEFSF+K
Sbjct  496  RIQTELVRTITSEDPFISSLTKVMQDRIEKYWKNCSLALATAVVMDPRFKMKLVEFSFNK  555

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGA-VNTQDAQE---LSTNE  547
            IYGE+A T+++IVD+GIHELF +Y+ LPLPLTPTY ++  GGA V T+D+Q    L+ N 
Sbjct  556  IYGEEAPTFIKIVDDGIHELFHEYLTLPLPLTPTYADDGTGGANVKTEDSQGGTLLTDN-  614

Query  546  LGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  367
             GLTDFD +IMET+SQQ +SELDQYL+ESLLPRVHEFDV+GWWKLN+MKYPTLSKMARDI
Sbjct  615  -GLTDFDMYIMETTSQQMKSELDQYLDESLLPRVHEFDVLGWWKLNKMKYPTLSKMARDI  673

Query  366  LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  232
            L++PVST P++SVF TV KEMD+YR SLRPETVEAL+CAKDW Q+
Sbjct  674  LSIPVSTVPSESVFDTVAKEMDQYRSSLRPETVEALICAKDWMQH  718



>ref|XP_007203781.1| hypothetical protein PRUPE_ppa001983mg [Prunus persica]
 gb|EMJ04980.1| hypothetical protein PRUPE_ppa001983mg [Prunus persica]
Length=724

 Score =   309 bits (792),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 190/225 (84%), Gaps = 6/225 (3%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            +IQ E  R   S+DPF+  LTK MQE+ +KYWK+C L L+ AV++DPRFKMKLVEFSF+K
Sbjct  487  RIQTELVRTITSEDPFICSLTKVMQERIEKYWKNCSLALATAVVMDPRFKMKLVEFSFNK  546

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGA-VNTQDAQE---LSTNE  547
            IYGE+A T+++IVD+GIHELF +Y+ LPLPLTPTY ++  GGA V T+D+Q    L+ N 
Sbjct  547  IYGEEAPTFIKIVDDGIHELFHEYLTLPLPLTPTYADDGTGGANVKTEDSQGGTLLTDN-  605

Query  546  LGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  367
             GLTDFD +IMET+SQQ +SELDQYL+ESLLPRVHEFDV+GWWKLN+MKYPTLSKMARDI
Sbjct  606  -GLTDFDMYIMETTSQQMKSELDQYLDESLLPRVHEFDVLGWWKLNKMKYPTLSKMARDI  664

Query  366  LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  232
            L++PVST P++SVF T+ KEMD+YR SLRPETVEAL+CAKDW Q+
Sbjct  665  LSIPVSTVPSESVFDTIAKEMDQYRSSLRPETVEALICAKDWMQH  709



>ref|XP_007203782.1| hypothetical protein PRUPE_ppa001983mg [Prunus persica]
 gb|EMJ04981.1| hypothetical protein PRUPE_ppa001983mg [Prunus persica]
Length=733

 Score =   310 bits (793),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 190/225 (84%), Gaps = 6/225 (3%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            +IQ E  R   S+DPF+  LTK MQE+ +KYWK+C L L+ AV++DPRFKMKLVEFSF+K
Sbjct  496  RIQTELVRTITSEDPFICSLTKVMQERIEKYWKNCSLALATAVVMDPRFKMKLVEFSFNK  555

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGA-VNTQDAQE---LSTNE  547
            IYGE+A T+++IVD+GIHELF +Y+ LPLPLTPTY ++  GGA V T+D+Q    L+ N 
Sbjct  556  IYGEEAPTFIKIVDDGIHELFHEYLTLPLPLTPTYADDGTGGANVKTEDSQGGTLLTDN-  614

Query  546  LGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  367
             GLTDFD +IMET+SQQ +SELDQYL+ESLLPRVHEFDV+GWWKLN+MKYPTLSKMARDI
Sbjct  615  -GLTDFDMYIMETTSQQMKSELDQYLDESLLPRVHEFDVLGWWKLNKMKYPTLSKMARDI  673

Query  366  LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  232
            L++PVST P++SVF T+ KEMD+YR SLRPETVEAL+CAKDW Q+
Sbjct  674  LSIPVSTVPSESVFDTIAKEMDQYRSSLRPETVEALICAKDWMQH  718



>ref|XP_008457064.1| PREDICTED: putative AC transposase [Cucumis melo]
 ref|XP_008457073.1| PREDICTED: putative AC transposase [Cucumis melo]
Length=677

 Score =   307 bits (787),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/239 (62%), Positives = 182/239 (76%), Gaps = 6/239 (3%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            +I LE ARA  S+DPF   LT+ MQEK +KYWK C LIL+ AV++DPRFKMKLVEFSF+K
Sbjct  441  RIHLELARALTSEDPFTCSLTQMMQEKINKYWKDCGLILAAAVVMDPRFKMKLVEFSFNK  500

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEAN-GGAVNTQDAQE---LSTNE  547
            +YGE+A  Y++IVD+GIHELF +Y+ LPLPLTPTY +E N GG + ++  Q    LS N 
Sbjct  501  LYGEEAPAYIKIVDDGIHELFHEYITLPLPLTPTYADEGNAGGNIKSEGPQSGSLLSDN-  559

Query  546  LGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  367
             GLTDFD +IMETSSQQ +SELDQYL ESLLPRV +FD++GWWK N+MKYPTLS MARDI
Sbjct  560  -GLTDFDVYIMETSSQQMKSELDQYLAESLLPRVQDFDLLGWWKQNKMKYPTLSTMARDI  618

Query  366  LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEV  190
            L++PV T P +S+F    KEMD YR SLRP TVEA++C +DW Q    +   + +KME 
Sbjct  619  LSIPVCTLPPESIFDMEIKEMDPYRSSLRPATVEAIICTRDWIQCGFAEVSDSLVKMEC  677



>ref|XP_011648699.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Cucumis sativus]
 ref|XP_011648701.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Cucumis sativus]
 gb|KGN60709.1| hypothetical protein Csa_2G008020 [Cucumis sativus]
Length=677

 Score =   307 bits (786),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 147/239 (62%), Positives = 179/239 (75%), Gaps = 6/239 (3%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            +I LE ARA  S+DPF   LT+ MQEK +KYWK C LIL+ AV++DPRFKMKLVEFSF+K
Sbjct  441  RIHLELARALTSEDPFTCSLTQMMQEKINKYWKDCGLILAAAVVMDPRFKMKLVEFSFNK  500

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAV----NTQDAQELSTNE  547
            +YGE+A  Y++IVD+GIHELF +YV LPLPLTPTY +E N G+       Q    LS N 
Sbjct  501  LYGEEAPAYIKIVDDGIHELFHEYVTLPLPLTPTYADEGNAGSNIKSEGPQSGSLLSDN-  559

Query  546  LGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  367
             GLTDFD +IMETSSQQ +SELDQYL ESLLPRV +FD++GWWK N+MKYPTLS MARDI
Sbjct  560  -GLTDFDVYIMETSSQQMKSELDQYLAESLLPRVQDFDLLGWWKQNKMKYPTLSTMARDI  618

Query  366  LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEV  190
            L++PV T P +S+F    KEMD YR SLRP TVEA++C +DW Q    +   + +KME 
Sbjct  619  LSIPVCTLPPESIFDMEIKEMDPYRSSLRPATVEAIICTRDWIQCGFAEVSDSLVKMEC  677



>ref|XP_009363984.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
isoform X2 [Pyrus x bretschneideri]
Length=852

 Score =   308 bits (788),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 152/237 (64%), Positives = 194/237 (82%), Gaps = 6/237 (3%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            +IQ +  +   S+DPF+  LTK+MQE+ +KYWK+C L L+ AV++DPRFKMKLVEFSF+K
Sbjct  618  RIQTDLTKTVASEDPFISSLTKTMQERIEKYWKNCSLALATAVVMDPRFKMKLVEFSFNK  677

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQ---ELSTNEL  544
            +YGE+A T++++VD+GIHELF +Y+ LPLPLTPTY +E N   + T+D+Q    L+ N  
Sbjct  678  VYGEEAPTHIKVVDDGIHELFHEYLTLPLPLTPTYADEGNN-YIKTEDSQGGANLTDN--  734

Query  543  GLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDIL  364
            GLTDFD +IMET+SQQ +SELDQYL+ESLLPRVH+FDV+GWWKLN+MKYPTLSKMARDIL
Sbjct  735  GLTDFDMYIMETTSQQMKSELDQYLDESLLPRVHDFDVLGWWKLNKMKYPTLSKMARDIL  794

Query  363  TVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKME  193
            ++PVST P+DSVF T  KEMD+YR SLRPETVEAL+CAKDW Q     + TA ++ME
Sbjct  795  SIPVSTVPSDSVFDTTVKEMDQYRTSLRPETVEALICAKDWLQYGSADASTALVRME  851



>ref|XP_009363983.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
isoform X1 [Pyrus x bretschneideri]
Length=864

 Score =   308 bits (788),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 152/237 (64%), Positives = 194/237 (82%), Gaps = 6/237 (3%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            +IQ +  +   S+DPF+  LTK+MQE+ +KYWK+C L L+ AV++DPRFKMKLVEFSF+K
Sbjct  630  RIQTDLTKTVASEDPFISSLTKTMQERIEKYWKNCSLALATAVVMDPRFKMKLVEFSFNK  689

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQ---ELSTNEL  544
            +YGE+A T++++VD+GIHELF +Y+ LPLPLTPTY +E N   + T+D+Q    L+ N  
Sbjct  690  VYGEEAPTHIKVVDDGIHELFHEYLTLPLPLTPTYADEGNN-YIKTEDSQGGANLTDN--  746

Query  543  GLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDIL  364
            GLTDFD +IMET+SQQ +SELDQYL+ESLLPRVH+FDV+GWWKLN+MKYPTLSKMARDIL
Sbjct  747  GLTDFDMYIMETTSQQMKSELDQYLDESLLPRVHDFDVLGWWKLNKMKYPTLSKMARDIL  806

Query  363  TVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKME  193
            ++PVST P+DSVF T  KEMD+YR SLRPETVEAL+CAKDW Q     + TA ++ME
Sbjct  807  SIPVSTVPSDSVFDTTVKEMDQYRTSLRPETVEALICAKDWLQYGSADASTALVRME  863



>ref|XP_011017829.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Populus euphratica]
Length=666

 Score =   301 bits (772),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 174/216 (81%), Gaps = 0/216 (0%)
 Frame = -2

Query  882  EXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGE  703
            E +RA  S+DPF+  L K M+EK DKY K C L L+IAV++DPRFKMKLV+F FSKI+G+
Sbjct  433  ELSRAVASEDPFISSLAKLMREKIDKYLKGCSLALAIAVVMDPRFKMKLVQFRFSKIFGD  492

Query  702  DASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDA  523
            +A  YV+IVD+G+HELF +YVALPLPLTPTY E+ N   + T+D Q    ++ GLTDFD 
Sbjct  493  EAPLYVKIVDDGLHELFLEYVALPLPLTPTYAEDGNFENMKTEDNQGTLLSDHGLTDFDM  552

Query  522  FIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTA  343
            +IMET+SQ +RSELDQYLEESLLPR+ E DV+ WWK+N++KYPTLSK+ARDILT+ VSTA
Sbjct  553  YIMETTSQNTRSELDQYLEESLLPRLQELDVLEWWKMNKLKYPTLSKLARDILTIQVSTA  612

Query  342  PADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
              DSVF T  KE+D YR SLRPETVEALVCAKDW Q
Sbjct  613  DPDSVFDTEIKELDSYRSSLRPETVEALVCAKDWLQ  648



>ref|XP_002325202.1| hypothetical protein POPTR_0018s12690g [Populus trichocarpa]
 gb|EEF03767.1| hypothetical protein POPTR_0018s12690g [Populus trichocarpa]
Length=666

 Score =   300 bits (769),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 174/216 (81%), Gaps = 0/216 (0%)
 Frame = -2

Query  882  EXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGE  703
            E +RA  S+DPF+  L K M+EK DKY K C L L+IAV++DPRFKMKLV+F FSKI+G+
Sbjct  433  ELSRAVASEDPFISSLAKLMREKIDKYLKDCSLALAIAVVMDPRFKMKLVQFRFSKIFGD  492

Query  702  DASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDA  523
            +A  YV+IVD+G+HELF +YVALPLPLTPTY E+ N   + T+D Q    ++ GLTDFD 
Sbjct  493  EAPLYVKIVDDGLHELFLEYVALPLPLTPTYAEDGNFENMKTEDNQGTLLSDHGLTDFDM  552

Query  522  FIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTA  343
            +IMET+SQ +RSELDQYLEESLLPR+ E D++ WWK+N++KYPTLSK+ARDILT+ VSTA
Sbjct  553  YIMETTSQNTRSELDQYLEESLLPRLQELDLLDWWKMNKLKYPTLSKLARDILTIQVSTA  612

Query  342  PADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
              DSVF T  KE+D YR SLRPETVEALVCAKDW Q
Sbjct  613  DPDSVFDTEIKELDSYRSSLRPETVEALVCAKDWLQ  648



>ref|XP_010241568.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nelumbo nucifera]
 ref|XP_010241570.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nelumbo nucifera]
 ref|XP_010241571.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nelumbo nucifera]
 ref|XP_010241572.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nelumbo nucifera]
 ref|XP_010241573.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nelumbo nucifera]
Length=675

 Score =   300 bits (769),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/222 (66%), Positives = 176/222 (79%), Gaps = 5/222 (2%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KI LE   AA+S DPFV  LT+ MQEKFDKYWK C L+L++AV++DPRFKMKLVEFSFSK
Sbjct  437  KIHLELTHAAMSQDPFVCNLTRPMQEKFDKYWKDCNLVLALAVVMDPRFKMKLVEFSFSK  496

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ---DAQELSTNEL  544
            IYG+DA  YV+IVDEGIH+LF +YV+ PLPLTPTY+E        T+       LS  + 
Sbjct  497  IYGDDAGEYVKIVDEGIHDLFLEYVSQPLPLTPTYVERETPLTPKTEVSPGGTLLSAGD-  555

Query  543  GLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  367
            GL DFD +I E +SSQQ++SELDQYLEESLLPR+ EFD++GWWKLN +KYPTLS+MARDI
Sbjct  556  GLLDFDVYISEISSSQQTKSELDQYLEESLLPRIQEFDILGWWKLNNLKYPTLSRMARDI  615

Query  366  LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            L + VS A ADSVF+T  K++D YR SLRPET+EAL+CAKDW
Sbjct  616  LVITVSPATADSVFNTELKKLDPYRSSLRPETIEALICAKDW  657



>ref|XP_010535860.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Tarenaya hassleriana]
Length=641

 Score =   287 bits (735),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 136/226 (60%), Positives = 172/226 (76%), Gaps = 12/226 (5%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K Q + +RA V +DP++GG+ K+M+EK DKYW+ C L+L++AVI+DPRFKMKLVEFSFSK
Sbjct  426  KTQSDLSRAIVGEDPYIGGMAKTMKEKIDKYWRDCSLVLAMAVIMDPRFKMKLVEFSFSK  485

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            I+GEDA   ++ VD+GIHELF +YVALPLPLTP Y   A GG+    D          L 
Sbjct  486  IFGEDAGKNIKTVDDGIHELFNEYVALPLPLTPAY---AEGGSNPKPDR---------LL  533

Query  534  DFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            DFD +IMET+ Q  +SELDQYL+E+L+PRV EFDV+ WWK N++KYPTLSKMARDIL++P
Sbjct  534  DFDMYIMETTGQNLKSELDQYLDETLMPRVQEFDVLDWWKQNKLKYPTLSKMARDILSIP  593

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKS  217
            VS A   +VF    +EMD Y+ SLRPETVEAL+CAKDW Q+  VK+
Sbjct  594  VSAAAFGNVFEGEPREMDEYKTSLRPETVEALICAKDWLQSSDVKT  639



>ref|XP_006385302.1| hypothetical protein POPTR_0003s02610g [Populus trichocarpa]
 gb|ERP63099.1| hypothetical protein POPTR_0003s02610g [Populus trichocarpa]
Length=668

 Score =   281 bits (720),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 139/222 (63%), Positives = 170/222 (77%), Gaps = 2/222 (1%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE   AA+S DPFV  LTK ++EKFD+YWK C LIL+IAV++DPRFKMKL+EFSF K
Sbjct  438  KIQLELTNAAMSHDPFVRNLTKPLKEKFDQYWKDCFLILAIAVVMDPRFKMKLLEFSFPK  497

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            ++GEDA  +++ VD+GIHEL   Y+     L  T +EE     ++TQD   LS  + GL+
Sbjct  498  VFGEDAGMWIKSVDDGIHELLVGYLTPNFHLPATDVEEGLPQELHTQDLPMLSIGD-GLS  556

Query  534  DFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
            DFD +I E TS Q  +SELDQYLEESLLPRVHEFDV+GWWKLNR+KYPTLSKMA DIL++
Sbjct  557  DFDIYISEITSGQHFKSELDQYLEESLLPRVHEFDVLGWWKLNRLKYPTLSKMAVDILSI  616

Query  357  PVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  232
            PVST   DSVF T +K +D YR SLRP T+EAL+CAKDW Q+
Sbjct  617  PVSTVTPDSVFDTENKRIDSYRSSLRPVTLEALICAKDWLQH  658



>emb|CAN68819.1| hypothetical protein VITISV_023069 [Vitis vinifera]
Length=195

 Score =   265 bits (678),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 155/180 (86%), Gaps = 6/180 (3%)
 Frame = -2

Query  762  VDPRFKMKLVEFSFSKIYGEDAS-TYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGA  586
            +DPRFKMKLVEFSF KIYG++A+ T +R+VDEG+HELF +YVALPLPLTPTY++E N G+
Sbjct  1    MDPRFKMKLVEFSFPKIYGDEAAPTCIRVVDEGLHELFLEYVALPLPLTPTYVDEGNAGS  60

Query  585  VNTQDAQE---LSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWK  415
            +  +D  +   LS+N  GL+DFD +I+ETSSQQ +SELDQYLEES+LPRVHEFD++GWWK
Sbjct  61   MKGEDHSQGGLLSSN--GLSDFDVYILETSSQQMKSELDQYLEESVLPRVHEFDLLGWWK  118

Query  414  LNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            LN++KYPTLSKMARDIL++PVS+   +S++ TV KEMD YR SLRPETVEAL+CAKDW Q
Sbjct  119  LNKLKYPTLSKMARDILSIPVSSVAVESIYDTVGKEMDEYRNSLRPETVEALICAKDWLQ  178



>ref|XP_010541714.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X2 [Tarenaya hassleriana]
Length=648

 Score =   278 bits (712),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/229 (58%), Positives = 168/229 (73%), Gaps = 11/229 (5%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K Q + +R    +DP++GGL K+M+EK DKYW+ C L+L++AV++DPRFKMKLVEFSFSK
Sbjct  426  KTQADLSRVIAGEDPYMGGLAKTMKEKIDKYWRDCSLVLAMAVVMDPRFKMKLVEFSFSK  485

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            I+GEDA   ++ VD+GIHELF +Y+ALPLPLTPTY E   G                 L 
Sbjct  486  IFGEDAPKNIKTVDDGIHELFNEYIALPLPLTPTYAEGGGGDPKPDG-----------LI  534

Query  534  DFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            DFD +IMET+ Q  +SELDQYL+E+LLPRV EFDV+ WWK N++KYPTLSKMARDIL++P
Sbjct  535  DFDMYIMETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQNKLKYPTLSKMARDILSIP  594

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITA  208
            VS A    VF    +EMD Y+ SLRPETVEAL+CAK+W Q+E   + +A
Sbjct  595  VSAAALGYVFDMEPREMDDYKTSLRPETVEALICAKEWIQSEAFAAQSA  643



>ref|XP_010541713.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Tarenaya hassleriana]
Length=665

 Score =   278 bits (712),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/229 (58%), Positives = 168/229 (73%), Gaps = 11/229 (5%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K Q + +R    +DP++GGL K+M+EK DKYW+ C L+L++AV++DPRFKMKLVEFSFSK
Sbjct  443  KTQADLSRVIAGEDPYMGGLAKTMKEKIDKYWRDCSLVLAMAVVMDPRFKMKLVEFSFSK  502

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            I+GEDA   ++ VD+GIHELF +Y+ALPLPLTPTY E   G                 L 
Sbjct  503  IFGEDAPKNIKTVDDGIHELFNEYIALPLPLTPTYAEGGGGDPKPDG-----------LI  551

Query  534  DFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            DFD +IMET+ Q  +SELDQYL+E+LLPRV EFDV+ WWK N++KYPTLSKMARDIL++P
Sbjct  552  DFDMYIMETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQNKLKYPTLSKMARDILSIP  611

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITA  208
            VS A    VF    +EMD Y+ SLRPETVEAL+CAK+W Q+E   + +A
Sbjct  612  VSAAALGYVFDMEPREMDDYKTSLRPETVEALICAKEWIQSEAFAAQSA  660



>emb|CBI36351.3| unnamed protein product [Vitis vinifera]
Length=295

 Score =   267 bits (682),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 137/256 (54%), Positives = 177/256 (69%), Gaps = 24/256 (9%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+QLE   AA SDDPF+  LTK +Q+KFD+YWK   L+L+IAV++DPRFKMKLVEFSFSK
Sbjct  41   KVQLELTEAAKSDDPFISNLTKPLQDKFDRYWKDTSLVLAIAVVMDPRFKMKLVEFSFSK  100

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALP--LPLTPTYIEEANGGAVNTQ-----------  574
            IYG +A  +++IVDEGI ELF DYV  P  L + P Y+EE  G  V +Q           
Sbjct  101  IYGAEAEMWIKIVDEGIRELFVDYVTQPPLLSIQPAYVEE--GTEVISQTYMEEGTEVIP  158

Query  573  -----DAQELSTNELGLTDFDAFIMETSSQQS-RSELDQYLEESLLPRVHEFDVVGWWKL  412
                 D   L ++   L+DFD +I E S  Q  RSELDQYL+ESL+PR  +FDV+ WWKL
Sbjct  159  KTEMTDGGPLLSDSDRLSDFDVYISEISGGQDMRSELDQYLDESLMPRSQDFDVLAWWKL  218

Query  411  NRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  232
            N++KYPTLS+MA DIL++P++T   D+VF TV +++D YR SLRP T+EAL+CAKDW QN
Sbjct  219  NKLKYPTLSRMASDILSIPITTVGPDNVFDTVGRKIDSYRSSLRPLTLEALICAKDWLQN  278

Query  231  ELVK---SITAPIKME  193
               +   S+   +KME
Sbjct  279  GATEPDMSVPPIVKME  294



>ref|NP_001241846.1| uncharacterized protein LOC100857052 [Zea mays]
 gb|ACR37953.1| unknown [Zea mays]
Length=313

 Score =   264 bits (674),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 165/228 (72%), Gaps = 9/228 (4%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+QLE A     +DP    + K M E+FDKYWK C L+L+IAV++DPRFKMKLVEFS+SK
Sbjct  68   KLQLELANGTGHEDPTFSSIAKDMHERFDKYWKDCSLVLAIAVVMDPRFKMKLVEFSYSK  127

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIE--EANGGAVNTQDAQ--ELSTNE  547
            IYG  A+ YV++VD+ +HEL+++YVA PLPLTP Y++  E N G  N   +Q    ST +
Sbjct  128  IYGAGAAKYVKVVDDAVHELYKEYVAQPLPLTPAYVDQGEGNNGPANANSSQGAPASTGD  187

Query  546  LGLTDFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARD  370
             GL DFD ++ E  SSQ S+SEL+QYL+ESL PR+ EFD++ WWKLN +K+PTLSKMARD
Sbjct  188  -GLLDFDMYLSEIQSSQPSKSELEQYLDESLTPRIQEFDILNWWKLNTVKFPTLSKMARD  246

Query  369  ILTVPVS-TAPADSVF--STVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            IL +PVS  +   S+F   T    +D YR SLRPE VEALVCAKDW Q
Sbjct  247  ILAIPVSMVSSGSSIFCAGTGSHMLDDYRSSLRPEIVEALVCAKDWLQ  294



>gb|ABA18109.1| hAT-like transposase [Arabidopsis arenosa]
Length=654

 Score =   274 bits (700),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 164/218 (75%), Gaps = 16/218 (7%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K Q + +RA   +DP+V G+ K+M+EK DKYW+ C L+L++AV++DPRFKMKLVEFSFSK
Sbjct  431  KTQSDLSRAIAGEDPYVAGIAKTMKEKVDKYWRDCSLVLAMAVVMDPRFKMKLVEFSFSK  490

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            I+GEDA   ++ VD+GIHELF +Y+ALP PL PT    + GG  +            GL+
Sbjct  491  IFGEDAGKNIKTVDDGIHELFSEYMALPSPLKPT----SEGGKAD------------GLS  534

Query  534  DFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            DFD +IMET+ Q  +SELDQYL+E+LLPRV EFDV+ WWK N++KYPTLSKMARDIL++P
Sbjct  535  DFDTYIMETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQNKLKYPTLSKMARDILSIP  594

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            VS A  D VF    +EMD Y+ SLRPETVEAL+CA++W
Sbjct  595  VSAAAFDYVFDMEPREMDEYKTSLRPETVEALICAREW  632



>ref|XP_002875576.1| hypothetical protein ARALYDRAFT_323059 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51835.1| hypothetical protein ARALYDRAFT_323059 [Arabidopsis lyrata subsp. 
lyrata]
Length=654

 Score =   273 bits (699),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 164/218 (75%), Gaps = 16/218 (7%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K Q + +RA   +DP+V G+ K+M+EK DKYW+ C L+L++AV++DPRFKMKLVEFSFSK
Sbjct  431  KTQSDLSRAIAGEDPYVAGIAKTMKEKVDKYWRDCSLVLAMAVVMDPRFKMKLVEFSFSK  490

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            I+GEDA   ++ VD+GIHELF +Y+ALP PL PT    + GG  +            GL+
Sbjct  491  IFGEDAGKNIKTVDDGIHELFSEYMALPSPLKPT----SEGGKAD------------GLS  534

Query  534  DFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            DFD +IMET+ Q  +SELDQYL+E+LLPRV EFDV+ WWK N++KYPTLSKMARDIL++P
Sbjct  535  DFDTYIMETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQNKLKYPTLSKMARDILSIP  594

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            VS A  D VF    +EMD Y+ SLRPETVEAL+CA++W
Sbjct  595  VSAAAFDYVFDMEPREMDEYKTSLRPETVEALICAREW  632



>ref|XP_006279357.1| hypothetical protein CARUB_v10008021mg [Capsella rubella]
 gb|ABA18106.1| hAT-like transposase [Capsella rubella]
 gb|EOA12255.1| hypothetical protein CARUB_v10008021mg [Capsella rubella]
Length=665

 Score =   273 bits (699),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 164/218 (75%), Gaps = 19/218 (9%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K Q + +RA   +DP+V G+ K+M+EK DKYW+ C L+L++AV++DPRFKMKLVEFSFSK
Sbjct  446  KTQSDLSRAIAGEDPYVAGIAKTMKEKVDKYWRDCSLVLAMAVVMDPRFKMKLVEFSFSK  505

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            I+GEDA+  ++ VD+GIHELF +Y+ALP PL PT   EA+G                 L+
Sbjct  506  IFGEDATKNIKTVDDGIHELFSEYMALPAPLKPT--SEADG-----------------LS  546

Query  534  DFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            DFD +IMET+ Q  +SELDQYL+E+LLPRV EFDV+ WWK N++KYPTLSKMARDIL++P
Sbjct  547  DFDTYIMETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQNKLKYPTLSKMARDILSIP  606

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            VS A  D VF    +EMD Y+ SLRPETVEAL+CAK+W
Sbjct  607  VSAAAFDYVFDMEPREMDEYKTSLRPETVEALICAKEW  644



>ref|XP_010514702.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Camelina sativa]
Length=655

 Score =   273 bits (698),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 164/218 (75%), Gaps = 16/218 (7%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K Q + +RA   +DPFV  + K+M+EK DKYW+ C L+L++AV++DPRFKMKLVEFSFSK
Sbjct  432  KTQSDLSRAIAGEDPFVATIAKTMKEKVDKYWRDCSLVLAMAVVMDPRFKMKLVEFSFSK  491

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            I+GEDA   ++ VD+GIHELF +Y+ALP PL PT    + GG V+            GL+
Sbjct  492  IFGEDAGKNIKTVDDGIHELFSEYMALPAPLKPT----SEGGKVD------------GLS  535

Query  534  DFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            DFD +IMET+ Q  +SELDQYL+E+LLPRV EFDV+ WWK N++KYPTLSKMARDIL++P
Sbjct  536  DFDTYIMETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQNKLKYPTLSKMARDILSIP  595

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            VS A  D VF    +EMD Y+ SLRPETVEAL+CA++W
Sbjct  596  VSAAAFDYVFDMEPREMDEYKTSLRPETVEALICAREW  633



>ref|XP_006419173.1| hypothetical protein EUTSA_v10002435mg [Eutrema salsugineum]
 gb|ESQ37609.1| hypothetical protein EUTSA_v10002435mg [Eutrema salsugineum]
Length=657

 Score =   273 bits (697),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 164/218 (75%), Gaps = 16/218 (7%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K Q + +RA   +DP+V G+ K+M+EK DKYW+ C L+L++AV++DPRFKMKLVEFSFSK
Sbjct  433  KTQSDLSRAIAGEDPYVAGIAKTMKEKVDKYWRDCSLVLAMAVVMDPRFKMKLVEFSFSK  492

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            I+GEDA   ++ VD+GIHELF +Y+ LP PL PT    + GG  +            GL+
Sbjct  493  IFGEDAGKNIKTVDDGIHELFSEYMTLPSPLKPT----SEGGKTD------------GLS  536

Query  534  DFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            DFD +IMET+ Q  +SELDQYL+E+LLPRV EFDV+ WWK N++KYPTLSKMARDIL++P
Sbjct  537  DFDTYIMETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQNKLKYPTLSKMARDILSIP  596

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            VS A  D+VF    +EMD Y+ SLRPETVEAL+CA++W
Sbjct  597  VSAAAFDNVFDMEPREMDEYKTSLRPETVEALICAREW  634



>ref|XP_010496529.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Camelina sativa]
Length=655

 Score =   272 bits (696),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 164/218 (75%), Gaps = 16/218 (7%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K Q + +RA   +DP+V  + K+M+EK DKYW+ C L+L++AV++DPRFKMKLVEFSFSK
Sbjct  432  KTQSDLSRAIAGEDPYVASIAKTMKEKVDKYWRDCSLVLAMAVVMDPRFKMKLVEFSFSK  491

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            I+GEDA   ++ VD+GIHELF +Y+ALP PL PT    + GG V+            GL+
Sbjct  492  IFGEDAGKNIKTVDDGIHELFSEYMALPAPLKPT----SQGGKVD------------GLS  535

Query  534  DFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            DFD +IMET+ Q  +SELDQYL+E+LLPRV EFDV+ WWK N++KYPTLSKMARDIL++P
Sbjct  536  DFDTYIMETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQNKLKYPTLSKMARDILSIP  595

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            VS A  D VF    +EMD Y+ SLRPETVEAL+CA++W
Sbjct  596  VSAAAFDYVFDMEPREMDEYKMSLRPETVEALICAREW  633



>gb|AAS16893.2| putative hAT family dimerisation domain containing protein [Oryza 
sativa Japonica Group]
Length=313

 Score =   262 bits (669),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 167/230 (73%), Gaps = 13/230 (6%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+QLE + A   +DP    + K M E+FDKYWK C L+L+IAV++DPRFKMKLVEFS+SK
Sbjct  68   KLQLELSNATGHEDPVFSSIAKDMHERFDKYWKDCNLVLAIAVVMDPRFKMKLVEFSYSK  127

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNEL---  544
            IYG +A+ YV++VD+ +HEL+++YVA PLPLTP Y+E+  G   N   A E ST      
Sbjct  128  IYGVEAAKYVKVVDDAVHELYKEYVAQPLPLTPAYVEQGEG---NNAPASENSTQTTAPS  184

Query  543  ---GLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMA  376
               GL DFD ++ E  +SQ ++SEL+QYL+ESL PR+ EFD++ WWKLN +K+PTLSKMA
Sbjct  185  TGDGLVDFDMYLSEIATSQPTKSELEQYLDESLTPRIQEFDILNWWKLNTLKFPTLSKMA  244

Query  375  RDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            RDIL +P+S  +  +S+FS  T  + +D YR SLRPE VEAL CAKDW Q
Sbjct  245  RDILAIPMSMVSSGNSIFSAGTGTRMLDDYRSSLRPEIVEALFCAKDWLQ  294



>ref|XP_010236763.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Brachypodium distachyon]
Length=262

 Score =   258 bits (659),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 169/230 (73%), Gaps = 11/230 (5%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+QLE + A   +DP    + K M E+FDKYWK C L+L+IAV++DPRFKMKLVEFS+SK
Sbjct  17   KLQLELSNAIAHEDPVFSSIAKEMHERFDKYWKDCNLVLAIAVVMDPRFKMKLVEFSYSK  76

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIE--EANGGAVNTQDAQEL---STN  550
            IYG +A+ YV++VD+ IHEL+++YVA PLPLTP Y+E  EAN     +Q+   +   ST 
Sbjct  77   IYGMEAAKYVKVVDDAIHELYKEYVAQPLPLTPAYVEQGEANKNVHASQNNNTVTPPSTG  136

Query  549  ELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMAR  373
            + GL DFD ++ E + SQ S+SEL+QYLEE+L PR+ +F++V WWKLN +K+PTLSKMAR
Sbjct  137  D-GLLDFDIYLSEIAVSQPSKSELEQYLEEALTPRIQDFEIVDWWKLNTLKFPTLSKMAR  195

Query  372  DILTVPVS-TAPADSVFS---TVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            DIL +P+S  +   S+FS   T  + +D YR SLRPETVEAL C KDW Q
Sbjct  196  DILAIPMSMVSRGSSIFSAATTGSRMLDDYRSSLRPETVEALFCTKDWLQ  245



>ref|XP_010425789.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER 
[Camelina sativa]
Length=654

 Score =   270 bits (689),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 163/218 (75%), Gaps = 16/218 (7%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K Q + +RA   +DP+V  + K+M+EK DKYW+ C L+L++AV++DPRFKMKLVEFSFSK
Sbjct  431  KTQSDLSRAIAGEDPYVASIAKTMKEKVDKYWRDCSLVLAMAVVMDPRFKMKLVEFSFSK  490

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            I+GEDA   ++ VD+GIHELF +Y+ALP PL PT    + GG V+            GL+
Sbjct  491  IFGEDAGKNIKTVDDGIHELFSEYMALPAPLKPT----SEGGKVD------------GLS  534

Query  534  DFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            DFD +IMET+ Q  +SELDQYL+E+LLPRV EFDV+ WWK N++KYPTLSKMARDIL++ 
Sbjct  535  DFDTYIMETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQNKLKYPTLSKMARDILSIS  594

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            VS A  D VF    +EMD Y+ SLRPETVEAL+CA++W
Sbjct  595  VSAAAFDYVFDMEPREMDEYKTSLRPETVEALICAREW  632



>ref|XP_008776870.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Phoenix dactylifera]
 ref|XP_008776871.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Phoenix dactylifera]
 ref|XP_008776872.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Phoenix dactylifera]
 ref|XP_008776873.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Phoenix dactylifera]
Length=679

 Score =   270 bits (690),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 136/230 (59%), Positives = 170/230 (74%), Gaps = 11/230 (5%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE A A +++D  V  + K M EKFDKYWK C L+L+IAV++DPRFKMKLVEFSFSK
Sbjct  433  KIQLELATATMNEDVLVSSIAKEMHEKFDKYWKDCSLVLAIAVVMDPRFKMKLVEFSFSK  492

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIE--EANGGAVNTQD----AQELST  553
            IYG DA+ YV++VD+ IHEL+ +YVA PLPLTP Y E  EA    +N  D    A   ST
Sbjct  493  IYGADAARYVKVVDDSIHELYLEYVAQPLPLTPAYEEQGEATTNNINGNDSCRPATPAST  552

Query  552  NELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMA  376
             + GL DFD ++ E + +Q ++SELDQYLEESL+PR+ EFD++ WWKLN +KYPTLSKMA
Sbjct  553  GD-GLLDFDLYLSEMAVNQPTKSELDQYLEESLVPRIQEFDILNWWKLNNLKYPTLSKMA  611

Query  375  RDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            RDIL +P+S  +   S+F+  T  + +D YR SLRPETVEAL CAKDW Q
Sbjct  612  RDILAIPMSMVSTGSSIFASGTGSRVLDEYRSSLRPETVEALFCAKDWLQ  661



>ref|NP_189803.1| BED zinc finger and hAT dimerization domain-containing protein 
[Arabidopsis thaliana]
 sp|Q9M2N5.1|DSLE_ARATH RecName: Full=Zinc finger BED domain-containing protein DAYSLEEPER; 
AltName: Full=Transposase-like protein DAYSLEEPER [Arabidopsis 
thaliana]
 emb|CAB68118.1| putative transposase [Arabidopsis thaliana]
 gb|AAO24589.1| At3g42170 [Arabidopsis thaliana]
 dbj|BAE99632.1| putative transposase [Arabidopsis thaliana]
 gb|AEE77728.1| BED zinc finger and hAT dimerization domain-containing protein 
[Arabidopsis thaliana]
Length=696

 Score =   270 bits (691),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 162/218 (74%), Gaps = 16/218 (7%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K Q + +RA   +DPFV G+ K+MQEK DKYW+ C L+L++AV++DPRFKMKLVEFSFSK
Sbjct  472  KTQSDLSRAIAGEDPFVTGIAKTMQEKVDKYWRDCSLVLAMAVVMDPRFKMKLVEFSFSK  531

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            I+GEDA   ++ VD+GIHELF +Y+ALP P   T    + GG  +            GL+
Sbjct  532  IFGEDAGKNIKTVDDGIHELFTEYMALPSPQNTT----SEGGKAD------------GLS  575

Query  534  DFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            DFD +IMET+ Q  +SELDQYL+E+LLPRV EFDV+ WWK N++KYPTLSKMARDIL++P
Sbjct  576  DFDTYIMETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQNKLKYPTLSKMARDILSIP  635

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            VS A  D VF    +EMD Y+ SLRPETVEAL+CA++W
Sbjct  636  VSAAAFDYVFDMEPREMDEYKTSLRPETVEALICAREW  673



>gb|AAW28145.1| hAT-like transposase [Arabidopsis thaliana]
Length=696

 Score =   270 bits (691),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 162/218 (74%), Gaps = 16/218 (7%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K Q + +RA   +DPFV G+ K+MQEK DKYW+ C L+L++AV++DPRFKMKLVEFSFSK
Sbjct  472  KTQSDLSRAIAGEDPFVTGIAKTMQEKVDKYWRDCSLVLAMAVVMDPRFKMKLVEFSFSK  531

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            I+GEDA   ++ VD+GIHELF +Y+ALP P   T    + GG  +            GL+
Sbjct  532  IFGEDAGKNIKTVDDGIHELFTEYMALPSPQNTT----SEGGKAD------------GLS  575

Query  534  DFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            DFD +IMET+ Q  +SELDQYL+E+LLPRV EFDV+ WWK N++KYPTLSKMARDIL++P
Sbjct  576  DFDTYIMETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQNKLKYPTLSKMARDILSIP  635

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            VS A  D VF    +EMD Y+ SLRPETVEAL+CA++W
Sbjct  636  VSAAAFDYVFDMEPREMDEYKTSLRPETVEALICAREW  673



>ref|XP_010097200.1| Putative AC transposase [Morus notabilis]
 gb|EXB67267.1| Putative AC transposase [Morus notabilis]
Length=682

 Score =   270 bits (689),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 131/231 (57%), Positives = 172/231 (74%), Gaps = 11/231 (5%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQ++   AA+S+DPF+  L + + E+FDKYW +CCL+L+IAV++DPRFKMKLVEF+FSK
Sbjct  431  KIQMDLMEAAMSEDPFISYLIRPLHERFDKYWSNCCLVLAIAVVMDPRFKMKLVEFTFSK  490

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQE---------  562
            IYGE+A T+VRIVD+GIHELF DY+   L L    ++  N   ++++  QE         
Sbjct  491  IYGENAETWVRIVDDGIHELFIDYMTQMLALPEPSMDNGNEHMIDSETHQEDVHDYEGPF  550

Query  561  LSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLS  385
            +ST + GL+DF+ ++ E TSSQQ +SELDQYLEE LLPRV EFD++ WW  NR KYPTLS
Sbjct  551  ISTGD-GLSDFEIYLSEITSSQQMKSELDQYLEEPLLPRVQEFDIMSWWNQNRSKYPTLS  609

Query  384  KMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  232
            +MA DIL++PVST   DSVF T  K +D+YR SL P T+EAL+CAKDW Q+
Sbjct  610  RMASDILSIPVSTVAPDSVFDTNLKVVDKYRSSLHPVTLEALICAKDWLQH  660



>dbj|BAK01733.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=727

 Score =   269 bits (688),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/244 (57%), Positives = 178/244 (73%), Gaps = 19/244 (8%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+QLE A A+  +DP    + K M EKFDKYWK C L+L++AV++DPRFKMKLVEFS+SK
Sbjct  484  KLQLELANASAHEDPIFSSVAKDMYEKFDKYWKDCNLVLAVAVVMDPRFKMKLVEFSYSK  543

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEE-------ANGGAVNTQDAQELS  556
            IYG +A+ YV++V++ +H+LF+DYVA PLPLTP Y+E+       ANG   NTQ A + S
Sbjct  544  IYGVEAAKYVKVVNDSVHDLFKDYVAQPLPLTPAYVEQGKTDNVTANGN--NTQ-ATQPS  600

Query  555  TNELGLTDFDAFIMETSSQQ-SRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKM  379
            T + GL DFD ++ E ++ Q S+SEL+QYL+ESL PR+ EFD++ WWKLN +KYPTLSKM
Sbjct  601  TGD-GLQDFDIYLSEIATTQPSKSELEQYLDESLTPRIQEFDILNWWKLNTLKYPTLSKM  659

Query  378  ARDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITA  208
            ARDIL++PVS      S+FS  T    +D YR SLRPE VEALVCAKDW    L  S TA
Sbjct  660  ARDILSIPVSMVTGGSSIFSAGTGGHMLDDYRSSLRPEIVEALVCAKDW----LPYSTTA  715

Query  207  PIKM  196
            P+ +
Sbjct  716  PVAL  719



>ref|XP_010063482.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Eucalyptus grandis]
 gb|KCW70722.1| hypothetical protein EUGRSUZ_F03885 [Eucalyptus grandis]
Length=789

 Score =   270 bits (690),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 135/253 (53%), Positives = 176/253 (70%), Gaps = 18/253 (7%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+QL+   AA S DPFV  L + +QEKFDKYW+ CCLIL++AV++DPRFKMKLVEFSFS+
Sbjct  537  KLQLDLTHAATSQDPFVSNLIRPLQEKFDKYWRGCCLILAVAVVMDPRFKMKLVEFSFSR  596

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQE------LST  553
            I+GEDA T++ +VDEGI ELF DY +  LPL    +E      + ++   E      +S 
Sbjct  597  IFGEDAETWIGLVDEGIRELFLDYFSPILPLPEAPMENGTESIIKSELPNEGMPQEGVSH  656

Query  552  NEL-----------GLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  409
             EL           GL+DFD +I E TS QQ++SELDQYLEESLLPRV +FD++GWWKLN
Sbjct  657  EELPHDGTVISFGDGLSDFDVYISEITSGQQTKSELDQYLEESLLPRVQDFDLLGWWKLN  716

Query  408  RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
             +KYP LSKMA D+L++P+S     +VF T  K++D YR SLRP T+EALVCAK+W Q+ 
Sbjct  717  NLKYPILSKMAADVLSIPISIVDPGAVFDTQSKKIDGYRSSLRPVTLEALVCAKNWLQSG  776

Query  228  LVKSITAPIKMEV  190
              ++  A +K EV
Sbjct  777  SSETSNAFVKAEV  789



>ref|NP_001056444.1| Os05g0583100 [Oryza sativa Japonica Group]
 dbj|BAF18358.1| Os05g0583100, partial [Oryza sativa Japonica Group]
Length=473

 Score =   262 bits (670),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 167/230 (73%), Gaps = 13/230 (6%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+QLE + A   +DP    + K M E+FDKYWK C L+L+IAV++DPRFKMKLVEFS+SK
Sbjct  228  KLQLELSNATGHEDPVFSSIAKDMHERFDKYWKDCNLVLAIAVVMDPRFKMKLVEFSYSK  287

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNEL---  544
            IYG +A+ YV++VD+ +HEL+++YVA PLPLTP Y+E+  G   N   A E ST      
Sbjct  288  IYGVEAAKYVKVVDDAVHELYKEYVAQPLPLTPAYVEQGEG---NNAPASENSTQTTAPS  344

Query  543  ---GLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMA  376
               GL DFD ++ E  +SQ ++SEL+QYL+ESL PR+ EFD++ WWKLN +K+PTLSKMA
Sbjct  345  TGDGLVDFDMYLSEIATSQPTKSELEQYLDESLTPRIQEFDILNWWKLNTLKFPTLSKMA  404

Query  375  RDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            RDIL +P+S  +  +S+FS  T  + +D YR SLRPE VEAL CAKDW Q
Sbjct  405  RDILAIPMSMVSSGNSIFSAGTGTRMLDDYRSSLRPEIVEALFCAKDWLQ  454



>ref|XP_009390780.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Musa acuminata subsp. malaccensis]
 ref|XP_009390781.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Musa acuminata subsp. malaccensis]
 ref|XP_009390782.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Musa acuminata subsp. malaccensis]
Length=673

 Score =   268 bits (684),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 131/227 (58%), Positives = 166/227 (73%), Gaps = 7/227 (3%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE   A +S D  V  + K M EKFDKYWK C L+L++AV++DPRFKMKLVEFSFSK
Sbjct  429  KIQLELTNATLSQDLMVSSIAKEMHEKFDKYWKDCSLVLALAVVMDPRFKMKLVEFSFSK  488

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELST-NEL--  544
            IYGED++ YV++V++ IHEL+ +YVA PLPLTP YI++     VN  D    +T N +  
Sbjct  489  IYGEDSARYVKVVNDSIHELYIEYVAQPLPLTPAYIDQGEANHVNGNDNNPHTTPNPMGD  548

Query  543  GLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  367
            GL DFD ++ ET+ +Q ++SELDQYLEESL+PR+  FD++ WWKLN +KYP LSKMA+DI
Sbjct  549  GLLDFDIYLSETAVNQATKSELDQYLEESLVPRIQGFDILNWWKLNNLKYPILSKMAKDI  608

Query  366  LTVPVS-TAPADSVF--STVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            L +PVS      S+F   T  + +D YR SLRPETVEAL CAKDW Q
Sbjct  609  LGIPVSIVGTGCSIFGSGTGSRVLDEYRSSLRPETVEALFCAKDWLQ  655



>gb|ACN26356.1| unknown [Zea mays]
Length=510

 Score =   263 bits (671),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 124/224 (55%), Positives = 165/224 (74%), Gaps = 4/224 (2%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE A     ++P    + K M E+FDKYWK C L+L+IAV++DPRFKMKLVEFS+SK
Sbjct  268  KIQLELANGTEHENPIFSSIAKDMHERFDKYWKDCSLVLAIAVVMDPRFKMKLVEFSYSK  327

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            IYG +A  YV++V++ +HEL+++YVA PLPLTP Y+E  N  A  + +    S+   GL 
Sbjct  328  IYGAEAMKYVKVVNDSLHELYKEYVAQPLPLTPAYVEANNVAANASVNQGNPSSTGDGLL  387

Query  534  DFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
            DFD ++ E  S+Q ++ +L+QYLEESL PR+ EFD++ WWKLN +K+PTLSKMARDIL +
Sbjct  388  DFDMYLSEIQSTQPAKCDLEQYLEESLTPRIQEFDILNWWKLNTLKFPTLSKMARDILAI  447

Query  357  PVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            P+S  +   S+FS  T ++ +D YR SLRPETVEALVCAKDW Q
Sbjct  448  PMSMVSSGSSIFSAGTGNRMLDDYRSSLRPETVEALVCAKDWLQ  491



>ref|XP_010654811.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Vitis vinifera]
Length=689

 Score =   266 bits (681),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/256 (54%), Positives = 177/256 (69%), Gaps = 24/256 (9%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+QLE   AA SDDPF+  LTK +Q+KFD+YWK   L+L+IAV++DPRFKMKLVEFSFSK
Sbjct  435  KVQLELTEAAKSDDPFISNLTKPLQDKFDRYWKDTSLVLAIAVVMDPRFKMKLVEFSFSK  494

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALP--LPLTPTYIEEANGGAVNTQ-----------  574
            IYG +A  +++IVDEGI ELF DYV  P  L + P Y+EE  G  V +Q           
Sbjct  495  IYGAEAEMWIKIVDEGIRELFVDYVTQPPLLSIQPAYVEE--GTEVISQTYMEEGTEVIP  552

Query  573  -----DAQELSTNELGLTDFDAFIMETSSQQS-RSELDQYLEESLLPRVHEFDVVGWWKL  412
                 D   L ++   L+DFD +I E S  Q  RSELDQYL+ESL+PR  +FDV+ WWKL
Sbjct  553  KTEMTDGGPLLSDSDRLSDFDVYISEISGGQDMRSELDQYLDESLMPRSQDFDVLAWWKL  612

Query  411  NRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  232
            N++KYPTLS+MA DIL++P++T   D+VF TV +++D YR SLRP T+EAL+CAKDW QN
Sbjct  613  NKLKYPTLSRMASDILSIPITTVGPDNVFDTVGRKIDSYRSSLRPLTLEALICAKDWLQN  672

Query  231  ELVK---SITAPIKME  193
               +   S+   +KME
Sbjct  673  GATEPDMSVPPIVKME  688



>emb|CDO98171.1| unnamed protein product [Coffea canephora]
Length=674

 Score =   266 bits (680),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/225 (56%), Positives = 172/225 (76%), Gaps = 4/225 (2%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE   AA S D F   LTK ++++FD+YWK C L+L++AV++DPRFKMKLVEFSFS+
Sbjct  434  KIQLELMHAARSPDLFTRNLTKPLKDRFDRYWKDCNLVLAVAVVMDPRFKMKLVEFSFSR  493

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQE--LSTNELG  541
            IY  +A T++++VDEG+HEL+ DYV   LP  PT+++EA+   +  + +Q+  L ++  G
Sbjct  494  IYENEAETWIKLVDEGLHELYLDYVLESLP-PPTFLDEASESIIKAEISQDDCLLSSADG  552

Query  540  LTDFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDIL  364
            L+DFD +I E  SS Q +SELDQYLEESLLPRV +FD +GWWKLNR+KYPTLS+MA D+L
Sbjct  553  LSDFDIYISEIMSSNQMKSELDQYLEESLLPRVQDFDALGWWKLNRLKYPTLSRMASDVL  612

Query  363  TVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
            ++PVST   DSVF T  ++MD +R +L P T+EALVC+KDW + E
Sbjct  613  SIPVSTVAPDSVFDTAERKMDSFRSTLSPTTLEALVCSKDWLKYE  657



>ref|XP_009139828.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Brassica rapa]
Length=647

 Score =   265 bits (678),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 161/218 (74%), Gaps = 19/218 (9%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K Q + +RA   +DP+V G+ K+M+EK DKYW+ C L+L++AV++DPRFKMKLVEFSFSK
Sbjct  429  KTQSDLSRAIAGEDPYVAGIAKTMKEKVDKYWRECSLVLAMAVVMDPRFKMKLVEFSFSK  488

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            I+GEDA   ++ VD+GIHELF +Y+ALP PL P    EA+G                 L+
Sbjct  489  IFGEDAGKNIKTVDDGIHELFNEYMALPAPLKPA--SEADG-----------------LS  529

Query  534  DFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            DFD +I+ET+ Q  +SELDQYL+E+LLPRV EFDV+ WWK N++KYPTL KMARDIL++P
Sbjct  530  DFDNYILETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQNKLKYPTLCKMARDILSIP  589

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            VS A  D VF    +EMD Y+ SLRPETVEAL+CA++W
Sbjct  590  VSAAAFDYVFDMEPREMDEYKTSLRPETVEALICAREW  627



>gb|ABA18094.1| hAT-like transposase [Olimarabidopsis pumila]
Length=672

 Score =   266 bits (679),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 167/238 (70%), Gaps = 17/238 (7%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K Q + +RA   +DP+  G+ K+M+EK DKYW+ C L+L++AV++DPRFKMKLVEFSFSK
Sbjct  446  KAQSDLSRAIAGEDPYAAGIAKTMKEKVDKYWRDCSLVLAMAVVMDPRFKMKLVEFSFSK  505

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            I+GEDA   ++ VD+ IHELF +Y+ALP P  PT    + GG  +            GL+
Sbjct  506  IFGEDAGKNIKTVDDSIHELFSEYMALPEPTKPT----SEGGKAD------------GLS  549

Query  534  DFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            DFD +IMET+ Q  +SELDQYLEE+L PRV EFDV+ WWK N++KYPTL KMARDIL++P
Sbjct  550  DFDTYIMETTGQNLKSELDQYLEETLFPRVQEFDVLDWWKQNKLKYPTLLKMARDILSIP  609

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW-QQNELVKSITAPIKMEVPI  184
            VS A  D VF    +EMD Y+ SLRPETVEAL+CA+ W  +N+ + S  A  +M   I
Sbjct  610  VSAAAFDYVFDMEPREMDEYKTSLRPETVEALICARVWLLENDAIASSAATQQMSSAI  667



>ref|XP_010230409.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger BED domain-containing 
protein RICESLEEPER 2-like [Brachypodium distachyon]
Length=323

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/229 (55%), Positives = 165/229 (72%), Gaps = 10/229 (4%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+QLE A +   +DP   G+ K M E+FDKYWK C L+L++AV++DPRFKMKLVEFS+SK
Sbjct  79   KLQLELANSIGHEDPVFSGIAKDMHERFDKYWKDCNLVLAVAVVMDPRFKMKLVEFSYSK  138

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQD-----AQELSTN  550
            IYG +A+ YV++V++ +HEL++DYVA PLPLTP Y+E+         +     A + ST 
Sbjct  139  IYGIEAAKYVKVVNDSVHELYKDYVAQPLPLTPAYVEQGETTNNAAANGNNPRATQPSTG  198

Query  549  ELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMAR  373
            + GL DFD ++ E  +SQ S+SEL+QYL+ESL PR+ EFD++ WWKLN +K+PTLSKMAR
Sbjct  199  D-GLLDFDMYLSEIATSQPSKSELEQYLDESLTPRIQEFDILNWWKLNTLKFPTLSKMAR  257

Query  372  DILTVPVSTAP-ADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            DIL +P+S      S+FS  T    +D YR SLRPE VEALVC KDW Q
Sbjct  258  DILAIPMSMVTIGSSIFSAGTGSHMLDDYRSSLRPEIVEALVCTKDWLQ  306



>ref|XP_009415017.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Musa acuminata subsp. malaccensis]
 ref|XP_009415018.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Musa acuminata subsp. malaccensis]
Length=669

 Score =   264 bits (675),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 130/242 (54%), Positives = 174/242 (72%), Gaps = 9/242 (4%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+ +E   A +S+D  V G+   M EKFDKYWK C LIL++AV++DPRFK+KLVEFSFSK
Sbjct  430  KLLVELNSATLSEDTMVSGIANEMHEKFDKYWKDCSLILALAVVMDPRFKIKLVEFSFSK  489

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            +YG D++ YV++VD+ IHEL+ +YVA PLPLTP Y+++     +N  D+   + +  GL 
Sbjct  490  VYGADSARYVKLVDDSIHELYLEYVAQPLPLTPAYVDQGEANHINGNDSNVPTVD--GLQ  547

Query  534  DFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
            DFD ++ E S +Q S+ E+DQYLEESL+PR+ +FD++ WWKLN +KYPTLSKMARDIL +
Sbjct  548  DFDMYLSELSVNQPSKPEIDQYLEESLVPRIQDFDILNWWKLNYLKYPTLSKMARDILAI  607

Query  357  PVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKS---ITAPIKM  196
            PVS  +   S+FS  T  + +D YR SLRPETVEAL CAKDW Q     +    TA +KM
Sbjct  608  PVSMVSTGCSIFSSGTGSRVLDEYRSSLRPETVEALFCAKDWLQYLPTMAEPPSTAIVKM  667

Query  195  EV  190
            E+
Sbjct  668  EI  669



>emb|CDX74476.1| BnaA04g09130D [Brassica napus]
Length=732

 Score =   265 bits (678),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 161/218 (74%), Gaps = 19/218 (9%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K Q + +RA   +DP+V G+ K+M+EK DKYW+ C L+L++AV++DPRFKMKLVEFSFSK
Sbjct  514  KTQSDLSRAIAGEDPYVAGIAKTMKEKVDKYWRECSLVLAMAVVMDPRFKMKLVEFSFSK  573

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            I+GEDA   ++ VD+GIHELF +Y+ALP PL P    EA+G                 L+
Sbjct  574  IFGEDAGKNIKTVDDGIHELFNEYMALPAPLKPA--SEADG-----------------LS  614

Query  534  DFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            DFD +I+ET+ Q  +SELDQYL+E+LLPRV EFDV+ WWK N++KYPTL KMARDIL++P
Sbjct  615  DFDNYILETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQNKLKYPTLCKMARDILSIP  674

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            VS A  D VF    +EMD Y+ SLRPETVEAL+CA++W
Sbjct  675  VSAAAFDYVFDMEPREMDEYKTSLRPETVEALICAREW  712



>ref|XP_009757867.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X2 [Nicotiana sylvestris]
Length=675

 Score =   263 bits (673),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 167/226 (74%), Gaps = 4/226 (2%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQL+  +AA S D FV  LTK +QEKFDKYW  C L+L++AV++DPRFKMK+VEF+F+K
Sbjct  433  KIQLDLMQAAHSQDHFVSNLTKPLQEKFDKYWTDCNLVLAVAVVMDPRFKMKIVEFTFNK  492

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTP-TYIEEANGGAVNTQDAQE--LSTNEL  544
            IYGE+A T+++IVDEG+HELF DY+   LP  P  +++EAN   + ++  QE     N  
Sbjct  493  IYGEEAETWIKIVDEGVHELFCDYIVQSLPPPPPNFVDEANENIIKSEFCQEDNFLPNGD  552

Query  543  GLTDFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  367
               DFD ++ +  ++QQ ++ELDQYLEESL+PR  +FDV+GWW++NR KYPTLSKMA DI
Sbjct  553  TFADFDVYLHDIMNNQQMKTELDQYLEESLMPRSQDFDVLGWWRINRSKYPTLSKMASDI  612

Query  366  LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
            L++PV T   DSVF T  + +D +R SLRP T+EAL CAKDW Q E
Sbjct  613  LSIPVCTVTLDSVFDTTPRNLDSHRSSLRPITLEALSCAKDWLQYE  658



>ref|XP_008643588.1| PREDICTED: LOC100281046 isoform X1 [Zea mays]
 ref|XP_008643589.1| PREDICTED: LOC100281046 isoform X1 [Zea mays]
 ref|XP_008643590.1| PREDICTED: LOC100281046 isoform X1 [Zea mays]
Length=719

 Score =   265 bits (676),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 165/228 (72%), Gaps = 9/228 (4%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+QLE A     +DP    + K M E+FDKYWK C L+L+IAV++DPRFKMKLVEFS+SK
Sbjct  474  KLQLELANGTGHEDPTFSSIAKDMHERFDKYWKDCSLVLAIAVVMDPRFKMKLVEFSYSK  533

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIE--EANGGAVNTQDAQE--LSTNE  547
            IYG  A+ YV++VD+ +HEL+++YVA PLPLTP Y++  E N G  N   +Q    ST +
Sbjct  534  IYGAGAAKYVKVVDDAVHELYKEYVAQPLPLTPAYVDQGEGNNGPANANSSQGAPASTGD  593

Query  546  LGLTDFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARD  370
             GL DFD ++ E  SSQ S+SEL+QYL+ESL PR+ EFD++ WWKLN +K+PTLSKMARD
Sbjct  594  -GLLDFDMYLSEIQSSQPSKSELEQYLDESLTPRIQEFDILNWWKLNTVKFPTLSKMARD  652

Query  369  ILTVPVS-TAPADSVF--STVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            IL +PVS  +   S+F   T    +D YR SLRPE VEALVCAKDW Q
Sbjct  653  ILAIPVSMVSSGSSIFCAGTGSHMLDDYRSSLRPEIVEALVCAKDWLQ  700



>ref|NP_001147437.1| LOC100281046 [Zea mays]
 gb|ACG27513.1| transposon protein [Zea mays]
Length=719

 Score =   265 bits (676),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 165/228 (72%), Gaps = 9/228 (4%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+QLE A     +DP    + K M E+FDKYWK C L+L+IAV++DPRFKMKLVEFS+SK
Sbjct  474  KLQLELANGTGHEDPTFSSIAKDMHERFDKYWKDCSLVLAIAVVMDPRFKMKLVEFSYSK  533

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIE--EANGGAVNTQDAQE--LSTNE  547
            IYG  A+ YV++VD+ +HEL+++YVA PLPLTP Y++  E N G  N   +Q    ST +
Sbjct  534  IYGAGAAKYVKVVDDAVHELYKEYVAQPLPLTPAYVDQGEGNNGPANANSSQGAPASTGD  593

Query  546  LGLTDFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARD  370
             GL DFD ++ E  SSQ S+SEL+QYL+ESL PR+ EFD++ WWKLN +K+PTLSKMARD
Sbjct  594  -GLLDFDMYLSEIQSSQPSKSELEQYLDESLTPRIQEFDILNWWKLNTVKFPTLSKMARD  652

Query  369  ILTVPVS-TAPADSVF--STVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            IL +PVS  +   S+F   T    +D YR SLRPE VEALVCAKDW Q
Sbjct  653  ILAIPVSMVSSGSSIFCAGTGSHMLDDYRSSLRPEIVEALVCAKDWLQ  700



>ref|XP_009757855.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009757861.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Nicotiana sylvestris]
Length=697

 Score =   264 bits (674),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 167/226 (74%), Gaps = 4/226 (2%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQL+  +AA S D FV  LTK +QEKFDKYW  C L+L++AV++DPRFKMK+VEF+F+K
Sbjct  455  KIQLDLMQAAHSQDHFVSNLTKPLQEKFDKYWTDCNLVLAVAVVMDPRFKMKIVEFTFNK  514

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTP-TYIEEANGGAVNTQDAQE--LSTNEL  544
            IYGE+A T+++IVDEG+HELF DY+   LP  P  +++EAN   + ++  QE     N  
Sbjct  515  IYGEEAETWIKIVDEGVHELFCDYIVQSLPPPPPNFVDEANENIIKSEFCQEDNFLPNGD  574

Query  543  GLTDFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  367
               DFD ++ +  ++QQ ++ELDQYLEESL+PR  +FDV+GWW++NR KYPTLSKMA DI
Sbjct  575  TFADFDVYLHDIMNNQQMKTELDQYLEESLMPRSQDFDVLGWWRINRSKYPTLSKMASDI  634

Query  366  LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
            L++PV T   DSVF T  + +D +R SLRP T+EAL CAKDW Q E
Sbjct  635  LSIPVCTVTLDSVFDTTPRNLDSHRSSLRPITLEALSCAKDWLQYE  680



>emb|CDY37871.1| BnaC04g31350D [Brassica napus]
Length=647

 Score =   262 bits (670),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 160/218 (73%), Gaps = 19/218 (9%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K Q + +RA   +DP+V GL K+M+EK DKYW+ C L+L++AV++DPRFKMKLVEFSFSK
Sbjct  429  KTQSDLSRAIAGEDPYVAGLAKTMKEKVDKYWRECSLVLAMAVVMDPRFKMKLVEFSFSK  488

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            I+GEDA   ++ VD+GIHELF +Y+ALP PL P    EA+G                 L+
Sbjct  489  IFGEDAGKNIKTVDDGIHELFNEYMALPEPLKPA--SEADG-----------------LS  529

Query  534  DFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            DFD +I+ET+ Q  +SELDQYL+E+LLPRV EFDV+ WWK N++KYPTL KMARDIL++ 
Sbjct  530  DFDNYILETTGQNLKSELDQYLDETLLPRVQEFDVLDWWKQNKLKYPTLCKMARDILSIS  589

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            VS A  D VF    +EMD Y+ SLRPETVEAL+CA++W
Sbjct  590  VSAAAFDYVFDMEPREMDEYKTSLRPETVEALICAREW  627



>ref|NP_001174288.1| Os05g0239150 [Oryza sativa Japonica Group]
 sp|B9FJG3.1|RSLE1_ORYSJ RecName: Full=Zinc finger BED domain-containing protein RICESLEEPER 
1; AltName: Full=Transposase-like protein RICESLEEPER 
1 [Oryza sativa Japonica Group]
 gb|EEE62941.1| hypothetical protein OsJ_17746 [Oryza sativa Japonica Group]
 dbj|BAH93016.1| Os05g0239150 [Oryza sativa Japonica Group]
Length=722

 Score =   264 bits (674),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/228 (56%), Positives = 167/228 (73%), Gaps = 9/228 (4%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+QLE + A   +DP    + K M E+FDKYWK C L+L+IAV++DPRFKMKLVEFS+SK
Sbjct  477  KLQLELSNATGREDPVFSSIAKDMHERFDKYWKDCNLVLAIAVVMDPRFKMKLVEFSYSK  536

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAV----NTQDAQELSTNE  547
            IYG +A+ YV++VD+ +HEL+ +YVA PLPLTP Y+E+  G       N+  A   ST +
Sbjct  537  IYGVEAAKYVKVVDDAVHELYNEYVAQPLPLTPAYVEQGGGNNAPASENSTQATAPSTGD  596

Query  546  LGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARD  370
             GL DFD ++ E  +SQ ++SEL+QYL+ESL PR+ EFD++ WWKLN +KYPTLSKMARD
Sbjct  597  -GLVDFDMYLSEIATSQPTKSELEQYLDESLTPRIQEFDILNWWKLNTLKYPTLSKMARD  655

Query  369  ILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            IL +P+S  +  +S+FS  T  + +D YR S RPE VEALVCAKDW Q
Sbjct  656  ILAIPMSMVSSGNSIFSAGTGTRMLDDYRSSSRPEIVEALVCAKDWLQ  703



>ref|NP_001051173.1| Os03g0733400 [Oryza sativa Japonica Group]
 sp|Q6AVI0.1|RSLE2_ORYSJ RecName: Full=Zinc finger BED domain-containing protein RICESLEEPER 
2; AltName: Full=Transposase-like protein RICESLEEPER 
2 [Oryza sativa Japonica Group]
 gb|AAT77879.1| putative hAT family dimerisation domain containing protein [Oryza 
sativa Japonica Group]
 gb|AAT78789.1| putative transposases [Oryza sativa Japonica Group]
 gb|ABF98716.1| hAT family dimerisation domain containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13087.1| Os03g0733400 [Oryza sativa Japonica Group]
 gb|EAZ28483.1| hypothetical protein OsJ_12466 [Oryza sativa Japonica Group]
 dbj|BAH00332.1| unnamed protein product [Oryza sativa Japonica Group]
Length=722

 Score =   264 bits (674),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/228 (55%), Positives = 169/228 (74%), Gaps = 9/228 (4%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+QLE + A   +DP    + K M E+FDKYWK C L+L+IAV++DPRFKMKLVEFS+SK
Sbjct  477  KLQLELSNATGHEDPVFSSIAKDMHERFDKYWKDCNLVLAIAVVMDPRFKMKLVEFSYSK  536

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAV----NTQDAQELSTNE  547
            IYG +A+ YV++VD+ +HEL+++YVA PLPLTP Y+E+ +G       N   A   ST +
Sbjct  537  IYGVEAAKYVKVVDDAVHELYKEYVAQPLPLTPAYVEQGDGNNAPASENGTQATAPSTGD  596

Query  546  LGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARD  370
             GL DFD ++ E  +SQ ++SEL+QYL+ESL PR+ EFD++ WWKLN +K+PTLS+MARD
Sbjct  597  -GLVDFDMYLSEIATSQPTKSELEQYLDESLTPRIQEFDILNWWKLNTLKFPTLSRMARD  655

Query  369  ILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            IL +P+S  +  +S+FS  T  + +D YR SLRPE VEALVCAKDW Q
Sbjct  656  ILAIPMSMVSSGNSIFSAGTGTRMLDDYRSSLRPEIVEALVCAKDWLQ  703



>ref|XP_011081954.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X2 [Sesamum indicum]
Length=651

 Score =   262 bits (670),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 165/224 (74%), Gaps = 3/224 (1%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KI LE    A S D FV  LTK + EKF KYW  C L+L++AV++DPRFKM+LVEFSFS+
Sbjct  408  KIHLELMHGANSQDFFVSCLTKPLMEKFTKYWDDCNLVLAVAVVMDPRFKMRLVEFSFSR  467

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQE-LSTNELGL  538
            IYGED  T++ IVDEG+HEL+ +Y+   LP  PT+IE  N   V T+  +E L +N  G 
Sbjct  468  IYGEDVETWINIVDEGLHELYLEYLVQSLP-APTFIEGENDTLVKTEPQEEGLLSNTDGF  526

Query  537  TDFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILT  361
            +DFD +I +  S+Q  +SELDQYLEE LLPRV +FDV+GWWK+NR KYPTLSK+A D+L+
Sbjct  527  SDFDIYISDIMSAQHMKSELDQYLEEPLLPRVQDFDVLGWWKMNRSKYPTLSKLASDVLS  586

Query  360  VPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
            +P+ST  A+SVF    K++D YR SLRP  ++ALVC+KDW Q+E
Sbjct  587  IPLSTISAESVFDMREKKIDSYRSSLRPSILQALVCSKDWLQHE  630



>ref|XP_009594303.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nicotiana tomentosiformis]
 ref|XP_009594304.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nicotiana tomentosiformis]
 ref|XP_009594305.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Nicotiana tomentosiformis]
Length=675

 Score =   262 bits (670),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 167/226 (74%), Gaps = 4/226 (2%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQL+   AA S D FV  LTK +QEKFDKYW  C L+L++AV++DPRFKMK+VEF+F+K
Sbjct  433  KIQLDLMLAAHSQDHFVSNLTKPLQEKFDKYWNDCNLVLAVAVVMDPRFKMKIVEFTFNK  492

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTP-TYIEEANGGAVNTQDAQELS--TNEL  544
            IYGE+A T+++IVDEG+HE+F DY+   LP  P  +++EAN   + ++  QE S   N  
Sbjct  493  IYGEEAETWIKIVDEGVHEVFCDYIVQSLPPPPPNFVDEANENIIKSEFCQEDSFLPNGD  552

Query  543  GLTDFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  367
               DFD ++ +  ++QQ ++ELDQYLEESL+PR  +FDV+GWW++NR KYPTLSKMA DI
Sbjct  553  TFADFDVYLHDIMNNQQMKTELDQYLEESLMPRSQDFDVLGWWRINRSKYPTLSKMASDI  612

Query  366  LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
            L++PV T   DSVF T  + +D +R SLRP T+EAL CAKDW Q E
Sbjct  613  LSIPVCTVTPDSVFDTTPRNLDSHRSSLRPITLEALSCAKDWLQYE  658



>ref|XP_011081945.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Sesamum indicum]
Length=679

 Score =   262 bits (669),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 165/224 (74%), Gaps = 3/224 (1%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KI LE    A S D FV  LTK + EKF KYW  C L+L++AV++DPRFKM+LVEFSFS+
Sbjct  436  KIHLELMHGANSQDFFVSCLTKPLMEKFTKYWDDCNLVLAVAVVMDPRFKMRLVEFSFSR  495

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQE-LSTNELGL  538
            IYGED  T++ IVDEG+HEL+ +Y+   LP  PT+IE  N   V T+  +E L +N  G 
Sbjct  496  IYGEDVETWINIVDEGLHELYLEYLVQSLP-APTFIEGENDTLVKTEPQEEGLLSNTDGF  554

Query  537  TDFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILT  361
            +DFD +I +  S+Q  +SELDQYLEE LLPRV +FDV+GWWK+NR KYPTLSK+A D+L+
Sbjct  555  SDFDIYISDIMSAQHMKSELDQYLEEPLLPRVQDFDVLGWWKMNRSKYPTLSKLASDVLS  614

Query  360  VPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
            +P+ST  A+SVF    K++D YR SLRP  ++ALVC+KDW Q+E
Sbjct  615  IPLSTISAESVFDMREKKIDSYRSSLRPSILQALVCSKDWLQHE  658



>ref|XP_011014817.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Populus euphratica]
Length=813

 Score =   265 bits (676),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 134/222 (60%), Positives = 168/222 (76%), Gaps = 7/222 (3%)
 Frame = -2

Query  855  DPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVRIV  676
            DPFV  L + MQEK DKY K C L L+IAV++DPRF+MKL+EFSF K YG++AS Y++IV
Sbjct  594  DPFVISLAEIMQEKIDKYLKECILALAIAVVLDPRFRMKLIEFSFVKFYGKEASKYIKIV  653

Query  675  DEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMETSSQQ  496
            ++ +HELF +Y ALPLPLTP + E+ N   + T+   E+S NEL  TDFDA++ ET+SQ 
Sbjct  654  NDALHELFLEYAALPLPLTPAHAEDGNFENMKTE---EISYNEL--TDFDAYV-ETTSQN  707

Query  495  SRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTV  316
             +SEL+QYLEESLLPR  E DV+ WW+ NR++YP LSKMARDILT+ VSTA  DSVF T 
Sbjct  708  MKSELEQYLEESLLPRFQEMDVLKWWEENRLQYPVLSKMARDILTMQVSTADPDSVFDTE  767

Query  315  HKEMDRYRCSLRPETVEALVCAKDWQQNELVKSIT-APIKME  193
             KE+D YR SLRPETVEALVCAKDW Q      ++ A +K+E
Sbjct  768  IKELDEYRSSLRPETVEALVCAKDWLQYRFATEVSNALVKVE  809



>gb|EEE64835.1| hypothetical protein OsJ_19692 [Oryza sativa Japonica Group]
Length=722

 Score =   262 bits (670),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 167/230 (73%), Gaps = 13/230 (6%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+QLE + A   +DP    + K M E+FDKYWK C L+L+IAV++DPRFKMKLVEFS+SK
Sbjct  477  KLQLELSNATGHEDPVFSSIAKDMHERFDKYWKDCNLVLAIAVVMDPRFKMKLVEFSYSK  536

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNEL---  544
            IYG +A+ YV++VD+ +HEL+++YVA PLPLTP Y+E+  G   N   A E ST      
Sbjct  537  IYGVEAAKYVKVVDDAVHELYKEYVAQPLPLTPAYVEQGEG---NNAPASENSTQTTAPS  593

Query  543  ---GLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMA  376
               GL DFD ++ E  +SQ ++SEL+QYL+ESL PR+ EFD++ WWKLN +K+PTLSKMA
Sbjct  594  TGDGLVDFDMYLSEIATSQPTKSELEQYLDESLTPRIQEFDILNWWKLNTLKFPTLSKMA  653

Query  375  RDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            RDIL +P+S  +  +S+FS  T  + +D YR SLRPE VEAL CAKDW Q
Sbjct  654  RDILAIPMSMVSSGNSIFSAGTGTRMLDDYRSSLRPEIVEALFCAKDWLQ  703



>gb|EEC79762.1| hypothetical protein OsI_21153 [Oryza sativa Indica Group]
Length=722

 Score =   262 bits (670),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 167/230 (73%), Gaps = 13/230 (6%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+QLE + A   +DP    + K M E+FDKYWK C L+L+IAV++DPRFKMKLVEFS+SK
Sbjct  477  KLQLELSNATGHEDPVFSSIAKDMHERFDKYWKDCNLVLAIAVVMDPRFKMKLVEFSYSK  536

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNEL---  544
            IYG +A+ YV++VD+ +HEL+++YVA PLPLTP Y+E+  G   N   A E ST      
Sbjct  537  IYGVEAAKYVKVVDDAVHELYKEYVAQPLPLTPAYVEQGEG---NNAPASENSTQTTAPS  593

Query  543  ---GLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMA  376
               GL DFD ++ E  +SQ ++SEL+QYL+ESL PR+ EFD++ WWKLN +K+PTLSKMA
Sbjct  594  TGDGLVDFDMYLSEIATSQPTKSELEQYLDESLTPRIQEFDILNWWKLNTLKFPTLSKMA  653

Query  375  RDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            RDIL +P+S  +  +S+FS  T  + +D YR SLRPE VEAL CAKDW Q
Sbjct  654  RDILAIPMSMVSSGNSIFSAGTGTRMLDDYRSSLRPEIVEALFCAKDWLQ  703



>ref|XP_008675089.1| PREDICTED: transposon protein isoform X1 [Zea mays]
 ref|XP_008675096.1| PREDICTED: transposon protein isoform X1 [Zea mays]
Length=768

 Score =   263 bits (671),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/224 (55%), Positives = 165/224 (74%), Gaps = 4/224 (2%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE A     ++P    + K M E+FDKYWK C L+L+IAV++DPRFKMKLVEFS+SK
Sbjct  526  KIQLELANGTEHENPIFSSIAKDMHERFDKYWKDCSLVLAIAVVMDPRFKMKLVEFSYSK  585

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            IYG +A  YV++V++ +HEL+++YVA PLPLTP Y+E  N  A  + +    S+   GL 
Sbjct  586  IYGAEAMKYVKVVNDSLHELYKEYVAQPLPLTPAYVEANNVAANASVNQGNPSSTGDGLL  645

Query  534  DFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
            DFD ++ E  S+Q ++ +L+QYLEESL PR+ EFD++ WWKLN +K+PTLSKMARDIL +
Sbjct  646  DFDMYLSEIQSTQPAKCDLEQYLEESLTPRIQEFDILNWWKLNTLKFPTLSKMARDILAI  705

Query  357  PVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            P+S  +   S+FS  T ++ +D YR SLRPETVEALVCAKDW Q
Sbjct  706  PMSMVSSGSSIFSAGTGNRMLDDYRSSLRPETVEALVCAKDWLQ  749



>ref|NP_001147988.1| transposon protein [Zea mays]
 gb|ACG29330.1| transposon protein [Zea mays]
Length=768

 Score =   263 bits (671),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/224 (55%), Positives = 165/224 (74%), Gaps = 4/224 (2%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE A     ++P    + K M E+FDKYWK C L+L+IAV++DPRFKMKLVEFS+SK
Sbjct  526  KIQLELANGTEHENPIFSSIAKDMHERFDKYWKDCSLVLAIAVVMDPRFKMKLVEFSYSK  585

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            IYG +A  YV++V++ +HEL+++YVA PLPLTP Y+E  N  A  + +    S+   GL 
Sbjct  586  IYGAEAMKYVKVVNDSLHELYKEYVAQPLPLTPAYVEANNVAANASVNQGNPSSTGDGLL  645

Query  534  DFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
            DFD ++ E  S+Q ++ +L+QYLEESL PR+ EFD++ WWKLN +K+PTLSKMARDIL +
Sbjct  646  DFDMYLSEIQSTQPAKCDLEQYLEESLTPRIQEFDILNWWKLNTLKFPTLSKMARDILAI  705

Query  357  PVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            P+S  +   S+FS  T ++ +D YR SLRPETVEALVCAKDW Q
Sbjct  706  PMSMVSSGSSIFSAGTGNRMLDDYRSSLRPETVEALVCAKDWLQ  749



>emb|CAN81954.1| hypothetical protein VITISV_014020 [Vitis vinifera]
Length=1045

 Score =   265 bits (678),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 137/256 (54%), Positives = 177/256 (69%), Gaps = 24/256 (9%)
 Frame = -2

Query  894   KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
             K+QLE   AA SDDPF+  LTK +Q+KFD+YWK   L+L+IAV++DPRFKMKLVEFSFSK
Sbjct  791   KVQLELTEAAKSDDPFISNLTKPLQDKFDRYWKDTSLVLAIAVVMDPRFKMKLVEFSFSK  850

Query  714   IYGEDASTYVRIVDEGIHELFQDYVALP--LPLTPTYIEEANGGAVNTQ-----------  574
             IYG +A  +++IVDEGI ELF DYV  P  L + P Y+EE  G  V +Q           
Sbjct  851   IYGAEAEMWIKIVDEGIRELFVDYVTQPPLLSIQPAYVEE--GTEVISQTYMEEGTEVIP  908

Query  573   -----DAQELSTNELGLTDFDAFIMETSSQQS-RSELDQYLEESLLPRVHEFDVVGWWKL  412
                  D   L ++   L+DFD +I E S  Q  RSELDQYL+ESL+PR  +FDV+ WWKL
Sbjct  909   KTEMTDGGPLLSDSDRLSDFDVYISEISGGQDMRSELDQYLDESLMPRSQDFDVLAWWKL  968

Query  411   NRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  232
             N++KYPTLS+MA DIL++P++T   D+VF TV +++D YR SLRP T+EAL+CAKDW QN
Sbjct  969   NKLKYPTLSRMASDILSIPITTVGPDNVFDTVGRKIDSYRSSLRPVTLEALICAKDWLQN  1028

Query  231   ELVK---SITAPIKME  193
                +   S+   +KME
Sbjct  1029  GATEPDMSVPPIVKME  1044



>ref|XP_009379900.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X3 [Musa acuminata subsp. malaccensis]
Length=648

 Score =   259 bits (662),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 164/228 (72%), Gaps = 9/228 (4%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+QLE A   +S+D  V  + K M EKFDKYWK C L+L+I+V++DPRFKMKLVEFSF+K
Sbjct  404  KVQLELANGTLSEDTMVSSIAKEMHEKFDKYWKDCSLVLAISVVMDPRFKMKLVEFSFAK  463

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQD----AQELSTNE  547
            IYGED++ ++++V++ IHEL+ +YV+ PL L P Y++E     +N  D    A   ST +
Sbjct  464  IYGEDSARFIKVVNDSIHELYLEYVSQPLQLMPAYVDEGEANHMNGNDNNPPATPNSTGD  523

Query  546  LGLTDFDAFIMETSSQQS-RSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARD  370
             GL DFD ++ E +  QS +SELDQYLEESL+PR+  FD++ WWKLN +KYPTLSKMARD
Sbjct  524  -GLLDFDVYLSEMAVNQSTKSELDQYLEESLVPRIQGFDILNWWKLNNLKYPTLSKMARD  582

Query  369  ILTVPVS-TAPADSVF--STVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            +L +PVS      S+F   T  + +D YR SLRPETVEAL CAKDW Q
Sbjct  583  VLAIPVSMVGTGCSIFGSGTGSRVLDDYRSSLRPETVEALFCAKDWLQ  630



>ref|XP_010906913.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Elaeis guineensis]
Length=687

 Score =   259 bits (663),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 127/237 (54%), Positives = 165/237 (70%), Gaps = 17/237 (7%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE   A +++D  V    K M EKFDKYWK C L+L+IAV++DPRFK+KLVEFSFSK
Sbjct  433  KIQLELTNATLNEDVLVSSFAKEMHEKFDKYWKDCSLVLAIAVVMDPRFKLKLVEFSFSK  492

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQE---------  562
            IYGE+A  Y+++V++ IHEL+ +YVA PLPLTP Y E+    A N    +          
Sbjct  493  IYGEEAVRYIKVVNDSIHELYLEYVAQPLPLTPAYEEQGEATANNINGNENGSGSGNDND  552

Query  561  ----LSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  397
                L TN  GL DFD ++ E + +Q ++SEL+QYLEESL+PR+ EFD++ WWKLN +KY
Sbjct  553  RPATLVTNGDGLLDFDLYLSEMAVNQPTKSELEQYLEESLVPRIQEFDILNWWKLNNLKY  612

Query  396  PTLSKMARDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            PTLSKMARD+L +P+S  +   S+F+  T  + +D Y  SLRPETVEAL CAKDW Q
Sbjct  613  PTLSKMARDVLAIPMSMVSTGSSIFASGTGSRVLDDYHSSLRPETVEALFCAKDWLQ  669



>ref|XP_009379895.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009379896.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=685

 Score =   259 bits (662),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 164/228 (72%), Gaps = 9/228 (4%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+QLE A   +S+D  V  + K M EKFDKYWK C L+L+I+V++DPRFKMKLVEFSF+K
Sbjct  441  KVQLELANGTLSEDTMVSSIAKEMHEKFDKYWKDCSLVLAISVVMDPRFKMKLVEFSFAK  500

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQD----AQELSTNE  547
            IYGED++ ++++V++ IHEL+ +YV+ PL L P Y++E     +N  D    A   ST +
Sbjct  501  IYGEDSARFIKVVNDSIHELYLEYVSQPLQLMPAYVDEGEANHMNGNDNNPPATPNSTGD  560

Query  546  LGLTDFDAFIMETSSQQS-RSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARD  370
             GL DFD ++ E +  QS +SELDQYLEESL+PR+  FD++ WWKLN +KYPTLSKMARD
Sbjct  561  -GLLDFDVYLSEMAVNQSTKSELDQYLEESLVPRIQGFDILNWWKLNNLKYPTLSKMARD  619

Query  369  ILTVPVS-TAPADSVF--STVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            +L +PVS      S+F   T  + +D YR SLRPETVEAL CAKDW Q
Sbjct  620  VLAIPVSMVGTGCSIFGSGTGSRVLDDYRSSLRPETVEALFCAKDWLQ  667



>ref|XP_002463929.1| hypothetical protein SORBIDRAFT_01g009090 [Sorghum bicolor]
 gb|EER90927.1| hypothetical protein SORBIDRAFT_01g009090 [Sorghum bicolor]
Length=770

 Score =   261 bits (666),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 128/234 (55%), Positives = 166/234 (71%), Gaps = 4/234 (2%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE A       PF   + K M E+FDKYWK C L+L+IAV++DPRFKMKLVEFS+SK
Sbjct  528  KIQLELANGTEHGSPFFSSVAKDMHERFDKYWKDCSLVLAIAVVMDPRFKMKLVEFSYSK  587

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            IYG +A+ YV++V++ +HEL+++YVA PLPLTP Y+E  N  A    +     +   GL 
Sbjct  588  IYGAEATKYVKVVNDSLHELYKEYVAQPLPLTPAYVEANNVAANTNVNQGNPPSTSDGLL  647

Query  534  DFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
            DFD ++ E  SSQ ++ EL+QYLEESL PR+ EFD++ WWKLN +K+PTLSKMARDIL +
Sbjct  648  DFDMYLSEIQSSQPAKCELEQYLEESLTPRIQEFDILNWWKLNTLKFPTLSKMARDILAI  707

Query  357  PVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAP  205
            P+S  +   S+FS  T ++ +D YR SLRPETVEALVCAKDW Q     +  AP
Sbjct  708  PMSMVSSGSSIFSAGTGNRMLDDYRSSLRPETVEALVCAKDWLQYSPPAATEAP  761



>ref|XP_009379897.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009379898.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_009379899.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X2 [Musa acuminata subsp. malaccensis]
Length=678

 Score =   259 bits (661),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 125/228 (55%), Positives = 164/228 (72%), Gaps = 9/228 (4%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+QLE A   +S+D  V  + K M EKFDKYWK C L+L+I+V++DPRFKMKLVEFSF+K
Sbjct  434  KVQLELANGTLSEDTMVSSIAKEMHEKFDKYWKDCSLVLAISVVMDPRFKMKLVEFSFAK  493

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQD----AQELSTNE  547
            IYGED++ ++++V++ IHEL+ +YV+ PL L P Y++E     +N  D    A   ST +
Sbjct  494  IYGEDSARFIKVVNDSIHELYLEYVSQPLQLMPAYVDEGEANHMNGNDNNPPATPNSTGD  553

Query  546  LGLTDFDAFIMETSSQQS-RSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARD  370
             GL DFD ++ E +  QS +SELDQYLEESL+PR+  FD++ WWKLN +KYPTLSKMARD
Sbjct  554  -GLLDFDVYLSEMAVNQSTKSELDQYLEESLVPRIQGFDILNWWKLNNLKYPTLSKMARD  612

Query  369  ILTVPVS-TAPADSVF--STVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            +L +PVS      S+F   T  + +D YR SLRPETVEAL CAKDW Q
Sbjct  613  VLAIPVSMVGTGCSIFGSGTGSRVLDDYRSSLRPETVEALFCAKDWLQ  660



>gb|KDO48633.1| hypothetical protein CISIN_1g005485mg [Citrus sinensis]
 gb|KDO48634.1| hypothetical protein CISIN_1g005485mg [Citrus sinensis]
 gb|KDO48635.1| hypothetical protein CISIN_1g005485mg [Citrus sinensis]
Length=694

 Score =   259 bits (661),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 127/243 (52%), Positives = 172/243 (71%), Gaps = 24/243 (10%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQ E  +AA+S++PF   LTK ++E+FD+YWK C L+L+IAV++DPRFKMKL+EFSFS+
Sbjct  444  KIQAELTQAAMSEEPFTSYLTKPLKERFDEYWKDCFLVLAIAVVIDPRFKMKLIEFSFSR  503

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEA---------------NGGAV-  583
            IYGEDA  +++ VD+G+HELF +Y+   L L  T+++E                + G + 
Sbjct  504  IYGEDAGMWIKAVDDGLHELFHEYLVQMLALPDTFMDEGLEVIPKSEASREETLHAGNIE  563

Query  582  ------NTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVG  424
                  ++QD   +S  + GL+DF+ +I E TS Q  RSELDQYLEE LLPR  +FD++ 
Sbjct  564  EGTPQEHSQDLSLISIGD-GLSDFEVYISEDTSGQPMRSELDQYLEEFLLPRTQDFDILD  622

Query  423  WWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKD  244
            WW+LN+ KYPTLS+MA DIL++P ST P DSVF TV K++D YR SLRP T+EAL+CAKD
Sbjct  623  WWRLNQAKYPTLSRMASDILSIPFSTVPTDSVFDTVSKKIDSYRSSLRPVTLEALICAKD  682

Query  243  WQQ  235
            W Q
Sbjct  683  WLQ  685



>ref|XP_006384324.1| hypothetical protein POPTR_0004s12760g [Populus trichocarpa]
 gb|ERP62121.1| hypothetical protein POPTR_0004s12760g [Populus trichocarpa]
Length=842

 Score =   261 bits (666),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/207 (62%), Positives = 159/207 (77%), Gaps = 6/207 (3%)
 Frame = -2

Query  855  DPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVRIV  676
            DPFV  L + MQEK DKY K C L L+IAV++DPRF+MKL+EFSF K YG++AS Y++IV
Sbjct  623  DPFVISLAEIMQEKIDKYLKECILSLAIAVVLDPRFRMKLIEFSFVKFYGKEASKYIKIV  682

Query  675  DEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMETSSQQ  496
            D+ +HELF +Y ALP PLTP + E+ N   + T+   E+S NEL  TDFDA++ ET+SQ 
Sbjct  683  DDALHELFLEYAALPFPLTPAHAEDGNFENMKTE---EISYNEL--TDFDAYV-ETTSQN  736

Query  495  SRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTV  316
             +SEL+QYLEESLLPR  E DV+ WW+ N+++YP LS MARDILT+ VSTA  DSVF T 
Sbjct  737  KKSELEQYLEESLLPRFQEMDVLKWWEENKLQYPVLSTMARDILTMQVSTADPDSVFDTE  796

Query  315  HKEMDRYRCSLRPETVEALVCAKDWQQ  235
             KE+D YR SLRPETVEALVCAKDW Q
Sbjct  797  IKELDEYRSSLRPETVEALVCAKDWLQ  823



>ref|XP_010906914.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Elaeis guineensis]
Length=687

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/237 (53%), Positives = 166/237 (70%), Gaps = 17/237 (7%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE   A +++D  V    K M EKFDKYWK C L+L+IAV++DPRFK+KLVEFSFSK
Sbjct  433  KIQLELTNATLNEDVLVSSFAKEMHEKFDKYWKDCSLVLAIAVVMDPRFKLKLVEFSFSK  492

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEA-----------NGGAVNTQDA  568
            IYG DA  Y+ +V++ IHEL+ +YVA PLPLTP Y E+            NG  +   + 
Sbjct  493  IYGADAVRYINVVNDSIHELYLEYVAQPLPLTPAYEEQGEVTTSNINGNENGSGIGNDNN  552

Query  567  Q--ELSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKY  397
            +   L +N  GL DFD ++ E + +Q ++SEL+QYLEESL+PR+ EFD++ WWKLN +KY
Sbjct  553  RPTTLVSNGDGLQDFDLYLSEMAVNQPTKSELEQYLEESLVPRIQEFDILNWWKLNNLKY  612

Query  396  PTLSKMARDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            PTLSK+ARD+L +P+S  +   S+F+  T  + +D YR SLRPETVEAL CAKDW Q
Sbjct  613  PTLSKLARDVLAIPMSMVSTGSSIFASGTGSRVLDDYRSSLRPETVEALFCAKDWLQ  669



>ref|XP_006384329.1| hypothetical protein POPTR_0004s12810g [Populus trichocarpa]
 gb|ERP62126.1| hypothetical protein POPTR_0004s12810g [Populus trichocarpa]
Length=842

 Score =   260 bits (664),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 128/207 (62%), Positives = 159/207 (77%), Gaps = 6/207 (3%)
 Frame = -2

Query  855  DPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVRIV  676
            DPFV  L + MQEK DKY K C L L+IAV++DPRF+MKL+EFSF K YG++A  Y++IV
Sbjct  623  DPFVISLAEIMQEKIDKYLKDCILALAIAVVLDPRFRMKLIEFSFVKFYGKEAGKYIKIV  682

Query  675  DEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMETSSQQ  496
            D+ +HELF +Y ALPLPLTP + E+ N   + T+   E+S NEL  TDFDA++ ET+SQ 
Sbjct  683  DDALHELFLEYAALPLPLTPAHAEDGNFENMKTE---EISYNEL--TDFDAYV-ETTSQN  736

Query  495  SRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTV  316
             +SEL+QYLEESLLPR  E DV+ WW+ N+++YP LSKMARDILT+ VSTA  DS+F T 
Sbjct  737  MKSELEQYLEESLLPRFQEMDVLKWWEENKLQYPVLSKMARDILTMQVSTADPDSIFDTE  796

Query  315  HKEMDRYRCSLRPETVEALVCAKDWQQ  235
             KE+D YR SLRPE VEALVCAKDW Q
Sbjct  797  IKELDEYRSSLRPEAVEALVCAKDWLQ  823



>gb|EPS65666.1| hypothetical protein M569_09109, partial [Genlisea aurea]
Length=690

 Score =   257 bits (657),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 133/229 (58%), Positives = 165/229 (72%), Gaps = 17/229 (7%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDK-YWKSCCLILSIAVIVDPRFKMKLVEFSFS  718
            KI  E +R + S+DPF   L K M+ KFD  YWK C  +L++AV+VDPRFKMKLVEFSFS
Sbjct  466  KILFELSRCSASEDPFASDLAKFMRGKFDDWYWKGCSFVLAVAVVVDPRFKMKLVEFSFS  525

Query  717  KIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYI----------EEANGGAVNTQDA  568
            KIYG++A++ V++VD+GIHELF++YV LP P  P             +EA+G    + + 
Sbjct  526  KIYGDEAASQVKVVDDGIHELFREYVTLPSPPPPPPPLAHPAHAAEDDEADGARAASSNG  585

Query  567  QELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTL  388
                 +ELG  DFDA+IMET++Q  +SELD+YLEESLLPRV +FDV  WWK NRM YPTL
Sbjct  586  ----GSELG--DFDAYIMETTNQMEKSELDRYLEESLLPRVQDFDVTRWWKANRMNYPTL  639

Query  387  SKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            S+MARDIL++PV T P  +VF    KEMD YRCSLRPETVEAL CAKDW
Sbjct  640  SRMARDILSIPVCTVPPWAVFDATGKEMDGYRCSLRPETVEALECAKDW  688



>ref|XP_006427320.1| hypothetical protein CICLE_v10025036mg [Citrus clementina]
 ref|XP_006427321.1| hypothetical protein CICLE_v10025036mg [Citrus clementina]
 gb|ESR40560.1| hypothetical protein CICLE_v10025036mg [Citrus clementina]
 gb|ESR40561.1| hypothetical protein CICLE_v10025036mg [Citrus clementina]
Length=699

 Score =   257 bits (656),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 127/248 (51%), Positives = 172/248 (69%), Gaps = 29/248 (12%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQ E  +AA+S++PF   LTK ++E+FD+YWK C L+L+IAV++DPRFKMKL+EFSFS+
Sbjct  444  KIQAELMQAAMSEEPFTSYLTKPLKERFDEYWKDCFLVLAIAVVIDPRFKMKLIEFSFSR  503

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEA---------------NGGAV-  583
            IYGEDA  +++ VD+G+HELF +Y+   L L  T+++E                + G + 
Sbjct  504  IYGEDAGMWIKAVDDGLHELFHEYLVQMLALPDTFMDEGLEVIPKSEASREETLHAGNIE  563

Query  582  -----------NTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHE  439
                       ++QD   +S  + GL+DF+ +I E TS Q  RSELDQYLEE LLPR  +
Sbjct  564  EGTPQEGHPQEHSQDLSLISIGD-GLSDFEVYISEDTSGQPMRSELDQYLEEFLLPRTQD  622

Query  438  FDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEAL  259
            FD++ WW+LN+ KYPTLS+MA DIL++P ST P DSVF TV K++D YR SLRP T+EAL
Sbjct  623  FDILDWWRLNQAKYPTLSRMASDILSIPFSTVPTDSVFDTVSKKIDSYRSSLRPVTLEAL  682

Query  258  VCAKDWQQ  235
            +CAKDW Q
Sbjct  683  ICAKDWLQ  690



>ref|XP_009392578.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Musa acuminata subsp. malaccensis]
Length=671

 Score =   256 bits (655),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 161/227 (71%), Gaps = 7/227 (3%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K Q E   A +S+D  V  + K M EKFDKYWK C L+L++AV++DPRFKMKLVEFSFSK
Sbjct  427  KTQAELTNATLSEDTMVSSIAKEMHEKFDKYWKDCSLVLALAVVMDPRFKMKLVEFSFSK  486

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTN---EL  544
            IYG D++ YV++VD+ +HEL+ +YV  PLP T  Y+++      N  D    +T+     
Sbjct  487  IYGADSARYVKLVDDSVHELYLEYVEQPLPQTLAYVDQGEANHANGDDKNVPTTSMPAAD  546

Query  543  GLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  367
            GL DFD ++ E + +Q S+SE+DQYLEESL+PR+ EFD++ WWKLN +KYPTLSKMARDI
Sbjct  547  GLQDFDMYLSELAVNQSSKSEIDQYLEESLMPRIQEFDILNWWKLNYLKYPTLSKMARDI  606

Query  366  LTVPVSTAPAD-SVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            L +PVS      S+FS  T  + +D YR SLRPETVEAL CAKDW Q
Sbjct  607  LAIPVSMVDTGCSIFSSGTGSRVLDEYRSSLRPETVEALFCAKDWLQ  653



>ref|XP_008790202.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Phoenix dactylifera]
 ref|XP_008790203.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Phoenix dactylifera]
Length=682

 Score =   255 bits (651),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/233 (54%), Positives = 163/233 (70%), Gaps = 13/233 (6%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE   A +++D  V    K M EKFDKYWK C L+L+IAV++DPRFK+KLVEFSFSK
Sbjct  432  KIQLELTNATLNEDVLVSSFAKEMHEKFDKYWKDCSLVLAIAVVMDPRFKLKLVEFSFSK  491

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQ---------E  562
            IYG DA  Y ++V++ IHEL+ +YVA PLPLTP Y E+      N    +          
Sbjct  492  IYGADAGRYAKVVNDSIHELYLEYVAQPLPLTPAYEEQGEATGNNINGNENGNDNNRPAN  551

Query  561  LSTNELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLS  385
            L +N  GL DFD ++ E + +Q ++SEL+QYLEESL+PR+ EFD++ WWKLN +KYPTLS
Sbjct  552  LVSNGDGLLDFDLYLSEMAVNQPTKSELEQYLEESLVPRIQEFDILNWWKLNNLKYPTLS  611

Query  384  KMARDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            KMARD+L +P+S  +   S+F+  T  + +D Y+ SLRPETVEAL CAKDW Q
Sbjct  612  KMARDVLAIPMSMVSTGSSIFASGTGSRVLDEYKSSLRPETVEALFCAKDWLQ  664



>ref|XP_002325201.2| hypothetical protein POPTR_0018s12680g [Populus trichocarpa]
 gb|EEF03766.2| hypothetical protein POPTR_0018s12680g [Populus trichocarpa]
Length=716

 Score =   254 bits (650),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 155/205 (76%), Gaps = 5/205 (2%)
 Frame = -2

Query  855  DPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVRIV  676
            DPFV  L + MQEK DKY K C L L+I V++DPRFKMKL+EFSF + YGE+A  YVRI+
Sbjct  494  DPFVISLAEIMQEKMDKYLKECILALAIVVVMDPRFKMKLIEFSFLRFYGEEAGKYVRII  553

Query  675  DEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMETSSQQ  496
            D G+H+LF +YV LPLPLT  Y E+  G   N    +E+S N  GLTD D ++ ET+SQ 
Sbjct  554  DGGLHKLFLEYVRLPLPLTSAYAED--GNFENNTKTEEISDN--GLTDCDVYV-ETTSQN  608

Query  495  SRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTV  316
            ++SEL+QYLEESLLPR  E DV+ WW+ N++KYPTLSKMARDILT+ VSTA  D+VF T 
Sbjct  609  TKSELEQYLEESLLPRHQEMDVLKWWEENKLKYPTLSKMARDILTMQVSTAEPDTVFDTE  668

Query  315  HKEMDRYRCSLRPETVEALVCAKDW  241
             KE+D Y  SLRPETVEALVCAKDW
Sbjct  669  IKELDSYWSSLRPETVEALVCAKDW  693



>ref|XP_007215012.1| hypothetical protein PRUPE_ppa002495mg [Prunus persica]
 gb|EMJ16211.1| hypothetical protein PRUPE_ppa002495mg [Prunus persica]
Length=666

 Score =   253 bits (647),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 123/225 (55%), Positives = 165/225 (73%), Gaps = 7/225 (3%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            +IQ+E   AA+S DPFV  L + + EKFDKYW++CCL+L++AVI+DPR+KMK+VE  F++
Sbjct  430  RIQMELMHAAMSVDPFVSYLMRPLYEKFDKYWENCCLVLAVAVIMDPRYKMKIVELEFNR  489

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELS------T  553
            IYGE+A T++RIVD+GIHELF DY+   L L  T ++E N   + T+  +E S      +
Sbjct  490  IYGENAETWIRIVDDGIHELFLDYMMQMLTLPETPMDEGNDSIIKTEAPEEASQEGSLLS  549

Query  552  NELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMA  376
            +  GL DF+ +I + T  QQ +SELDQYLEE+   RV +FDV+ WW+LNRMKYPTLS+MA
Sbjct  550  SVDGLQDFELYISDITGGQQMKSELDQYLEEAFTDRVEDFDVLVWWRLNRMKYPTLSRMA  609

Query  375  RDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
             DIL++ VST  +DSVF T  K MD Y+ SL P T+EAL+CAKDW
Sbjct  610  SDILSISVSTVASDSVFDTEIKRMDSYQTSLGPATLEALICAKDW  654



>ref|NP_001151544.1| transposon protein [Zea mays]
 gb|ACG43259.1| transposon protein [Zea mays]
Length=764

 Score =   253 bits (646),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/224 (55%), Positives = 160/224 (71%), Gaps = 4/224 (2%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE A       PF   + K M E+FDKYWK C L+L+IAV++DPRFKMKLVEFS+SK
Sbjct  522  KIQLELANGTEHGSPFFSCIAKDMHERFDKYWKDCSLVLAIAVVMDPRFKMKLVEFSYSK  581

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            IYG +A+ YV++V++ +HEL+++YVA  LPL P Y+E  N  A    +         GL 
Sbjct  582  IYGAEAAKYVKVVNDSLHELYKEYVAQTLPLAPAYVEANNVAANTNVNQGNPPPTSDGLL  641

Query  534  DFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
            DFD ++ E  SSQ ++ EL+QYLEESL PR+ EFD++ WWKLN +K+PTLSKMARDIL +
Sbjct  642  DFDMYLSEIQSSQPAKCELEQYLEESLTPRIQEFDILNWWKLNTLKFPTLSKMARDILAI  701

Query  357  PVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            P+S  +   S+FS  T ++ +D YR SLRPETVEALVCAKDW Q
Sbjct  702  PMSMVSSGSSIFSAGTGNRMLDDYRSSLRPETVEALVCAKDWLQ  745



>ref|XP_008643805.1| PREDICTED: transposon protein isoform X1 [Zea mays]
Length=764

 Score =   253 bits (646),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/224 (55%), Positives = 160/224 (71%), Gaps = 4/224 (2%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE A       PF   + K M E+FDKYWK C L+L+IAV++DPRFKMKLVEFS+SK
Sbjct  522  KIQLELANGTEHGSPFFSCIAKDMHERFDKYWKDCSLVLAIAVVMDPRFKMKLVEFSYSK  581

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            IYG +A+ YV++V++ +HEL+++YVA  LPL P Y+E  N  A    +         GL 
Sbjct  582  IYGAEAAKYVKVVNDSLHELYKEYVAQTLPLAPAYVEANNVAANTNVNQGNPPPTSDGLL  641

Query  534  DFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
            DFD ++ E  SSQ ++ EL+QYLEESL PR+ EFD++ WWKLN +K+PTLSKMARDIL +
Sbjct  642  DFDMYLSEIQSSQPAKCELEQYLEESLTPRIQEFDILNWWKLNTLKFPTLSKMARDILAI  701

Query  357  PVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            P+S  +   S+FS  T ++ +D YR SLRPETVEALVCAKDW Q
Sbjct  702  PMSMVSSGSSIFSAGTGNRMLDDYRSSLRPETVEALVCAKDWLQ  745



>ref|XP_010230399.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Brachypodium distachyon]
 ref|XP_010230403.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Brachypodium distachyon]
 ref|XP_010230404.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Brachypodium distachyon]
Length=769

 Score =   253 bits (645),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 123/230 (53%), Positives = 165/230 (72%), Gaps = 11/230 (5%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+QLE + A   +DP    + K M E+FDKYWK C L+L+IAV++DPRFKMKLVEFS+SK
Sbjct  523  KLQLELSNAIAHEDPVFSSIAKEMHERFDKYWKDCNLVLAIAVVMDPRFKMKLVEFSYSK  582

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNEL---  544
            IYG +A+ YV++VD+ IHE++++YVA PL LTP Y+E+      N   +Q  +T  L   
Sbjct  583  IYGMEAAKYVKVVDDAIHEIYKEYVAQPLTLTPAYVEQGEANK-NVHASQNNNTVTLPSA  641

Query  543  --GLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMAR  373
              GL DFD ++ E + SQ S+SEL+QYLEE+L PR+ +F+++ WWKLN +K+PTLSKMAR
Sbjct  642  GDGLLDFDKYLSEIAVSQPSKSELEQYLEEALTPRIQDFEILDWWKLNTLKFPTLSKMAR  701

Query  372  DILTVPVS-TAPADSVFS---TVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            DIL +P+S  +   S+FS   T  + +D YR SLRPETVEAL C KDW Q
Sbjct  702  DILAIPMSMVSRGSSIFSAATTGSRMLDDYRSSLRPETVEALFCTKDWLQ  751



>ref|NP_001136571.1| uncharacterized protein LOC100216693 [Zea mays]
 gb|ACF82192.1| unknown [Zea mays]
Length=503

 Score =   246 bits (629),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 120/229 (52%), Positives = 163/229 (71%), Gaps = 10/229 (4%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+QLE A     +DP    + K M E+FDKYWK C L+L++AV++DPRFKMKLVEFS++K
Sbjct  268  KLQLELANGTGHEDPTFRSIAKDMHERFDKYWKDCSLVLAVAVVMDPRFKMKLVEFSYTK  327

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEAN-----GGAVNTQDAQELSTN  550
            IYG +A+ +V++V++ +HEL+++YVA PLPLTP Y+E+           N+      S  
Sbjct  328  IYGAEAAKHVKVVNDAVHELYEEYVAHPLPLTPAYVEQGEGGNNGAANANSSQGSPASAG  387

Query  549  ELGLTDFDAFIMET-SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMAR  373
            + GL DFD ++ E  SSQ S+ EL+QYL+ESL PR  EFD++ WWKLNR+K+PTLS+MA 
Sbjct  388  D-GLLDFDMYLSEIQSSQPSKPELEQYLDESLTPRTQEFDILNWWKLNRVKFPTLSRMAC  446

Query  372  DILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            DIL +P+S  +   S+F+  T  + +D YR SLRPETVEALVCAKDW Q
Sbjct  447  DILAIPMSMVSSGSSIFTAGTGSRMLDDYRSSLRPETVEALVCAKDWLQ  495



>dbj|BAK03580.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=326

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/222 (53%), Positives = 160/222 (72%), Gaps = 8/222 (4%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+QLE A AA  +D  V    + M E FDKYWK C L+L++AV++DPRFKMKLVEFS+SK
Sbjct  93   KLQLELANAAAHEDLVVSSTARDMHESFDKYWKDCNLVLAVAVVMDPRFKMKLVEFSYSK  152

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            IYG +A+ YV++V++ +HEL+++Y+A PLP  P Y+ ++  G  NTQ       +  GL 
Sbjct  153  IYGVEAAKYVKVVNDSLHELYKEYLAQPLPARPVYVGQSASGNNNTQTTPPSIGD--GLL  210

Query  534  DFDAFIME-TSSQQSRSELDQYLEESLLPR-VHEFDVVGWWKLNRMKYPTLSKMARDILT  361
            DFD ++ E  ++Q S+SEL+QYLEE L PR + EFD++ WWKLN +++PTLSKMARD+L 
Sbjct  211  DFDMYLSEIATAQPSKSELEQYLEEPLTPRSIQEFDILSWWKLNTLRFPTLSKMARDVLA  270

Query  360  VPVSTAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDW  241
            +P++     S+FS  T  + +D YR SLRPE VEALVCAKDW
Sbjct  271  IPMTM--VSSIFSAETGIRTLDDYRSSLRPEIVEALVCAKDW  310



>ref|XP_010691104.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Beta vulgaris subsp. vulgaris]
Length=719

 Score =   248 bits (634),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/244 (50%), Positives = 173/244 (71%), Gaps = 10/244 (4%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQ++ A  +  +DP++    + + EKFD+YW+ C ++L++AV +DPR+K+KLVEFSFSK
Sbjct  474  KIQMQLAHGSFHEDPYISNFVRPLYEKFDRYWRDCSVVLAMAVAMDPRYKLKLVEFSFSK  533

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELST--NELG  541
            +YGE+A  ++R V +GIHEL+ +YVA  LPL   ++E+   G +  +  Q+ +T     G
Sbjct  534  VYGEEADMWLRAVYDGIHELYFEYVAQTLPLPSIHVEQRYEGFIKAEALQDEATLPPSDG  593

Query  540  LTDFDAFIMETSS-QQSRSELDQYLEESLLPR-VHEFDVVGWWKLNRMKYPTLSKMARDI  367
            L+DFD +I E SS  Q++SELDQYL+ESLLPR   +FD++ WWKLNR+KYPTLSKMA DI
Sbjct  594  LSDFDVYISEISSNHQTKSELDQYLDESLLPRGSQDFDILEWWKLNRIKYPTLSKMAADI  653

Query  366  LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW------QQNELVKSITAP  205
            L++P +T   DSVF TV K++D +R SL+P T+EALVCA DW      Q + L+   T  
Sbjct  654  LSIPFATVSRDSVFDTVGKKLDSHRSSLKPVTLEALVCANDWLQCGMRQSSPLLDISTMC  713

Query  204  IKME  193
            IKME
Sbjct  714  IKME  717



>ref|XP_009336302.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Pyrus x bretschneideri]
Length=679

 Score =   246 bits (629),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 128/230 (56%), Positives = 163/230 (71%), Gaps = 11/230 (5%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            +IQ     AA+SDDPFV  L + + EKFDKYW++CCL+L+IAVI+DPRFKMK VE +FS+
Sbjct  430  EIQKALMHAAMSDDPFVSYLIRPLYEKFDKYWENCCLVLAIAVIMDPRFKMKHVESTFSE  489

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNEL---  544
            IYGE+A T++RIVD GIH+LF +Y+   L L    IEE N G + T+   E+ + E+   
Sbjct  490  IYGENAETWIRIVDGGIHDLFLEYMMQMLTLPEIPIEEGNDGIMKTE-LPEIPSQEILLS  548

Query  543  ---GLTDFDAFIME-TSSQQSRSELDQYLEES---LLPRVHEFDVVGWWKLNRMKYPTLS  385
               GL DFD F+ + T  QQ +SELDQYLEE    L+  V +FDV+GWW+LNR KYPTLS
Sbjct  549  SADGLQDFDFFMPDITGGQQMKSELDQYLEEEEFLLVDGVEDFDVLGWWRLNRHKYPTLS  608

Query  384  KMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            +MA DIL++PVST   D+VF T  K MD YR SL   T+EAL+CAKDW Q
Sbjct  609  RMASDILSIPVSTVAPDAVFDTEIKRMDSYRTSLGTATLEALICAKDWIQ  658



>ref|XP_011017830.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Populus euphratica]
Length=716

 Score =   246 bits (628),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 152/205 (74%), Gaps = 5/205 (2%)
 Frame = -2

Query  855  DPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVRIV  676
            DPFV  L K MQEK DKY K C L L+I V++DPRFKMKL+EFSF + YGE+A  +V+I+
Sbjct  494  DPFVISLAKIMQEKMDKYLKECILALAIVVVMDPRFKMKLIEFSFLRFYGEEAGKHVKII  553

Query  675  DEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMETSSQQ  496
            D G+HELF +YV LP PL   Y E+  G   N    +E+S N  GL D D ++ +T+SQ 
Sbjct  554  DGGLHELFLEYVRLPHPLNSAYAED--GNFENNTKTEEISDN--GLADCDVYV-KTTSQD  608

Query  495  SRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTV  316
            ++SEL+QYLE+SL PR  E DV+ WW+ N++KYPTLSKMARDILT+ VSTA  ++VF T 
Sbjct  609  TKSELEQYLEDSLSPRHQEMDVLKWWEENKLKYPTLSKMARDILTIQVSTAEPNTVFDTE  668

Query  315  HKEMDRYRCSLRPETVEALVCAKDW  241
             KE+D YR SLRPETVEALVCAKDW
Sbjct  669  IKELDSYRSSLRPETVEALVCAKDW  693



>emb|CDY60307.1| BnaUnng00680D [Brassica napus]
Length=663

 Score =   243 bits (619),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 155/219 (71%), Gaps = 21/219 (10%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K   + +R+   DDP+V G+ K+M+EK DKYW+ C L+L++AV++DPRFKMKLVEFSFSK
Sbjct  442  KTHSDLSRSIAGDDPYVAGIAKTMKEKADKYWRECSLVLAMAVVMDPRFKMKLVEFSFSK  501

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            I+GEDA   +  VD+GIHELF +YVAL  P+                     + +E  L+
Sbjct  502  IFGEDAGKNINTVDDGIHELFSEYVALSAPVK--------------------AASEDELS  541

Query  534  DFDAFIM-ETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
            +FD +I+ ET+ +  +SELDQYLEE+LLPRV EFDV+ WWK N++K+PTLSKMARDIL +
Sbjct  542  EFDKYIIKETAGKNLKSELDQYLEETLLPRVQEFDVLEWWKQNKLKFPTLSKMARDILAI  601

Query  357  PVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            PVS A  D VF    +EMD Y+ SLRPETVEAL+ A++W
Sbjct  602  PVSAAAFDYVFDVEPREMDEYKTSLRPETVEALISAREW  640



>emb|CDY48867.1| BnaA06g03150D [Brassica napus]
Length=659

 Score =   241 bits (616),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 154/219 (70%), Gaps = 21/219 (10%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K Q + +R+   +DP+V G+ K+M+EK DKYW+   L+L++AV++DPRFKMKLVEFSFSK
Sbjct  438  KTQSDLSRSIAGEDPYVAGIAKTMKEKADKYWRESSLVLAMAVVMDPRFKMKLVEFSFSK  497

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            I+GEDA   +  VD+GIHELF +YVAL   + P   +E                    L+
Sbjct  498  IFGEDAGKNINTVDDGIHELFSEYVALSALVKPASEDE--------------------LS  537

Query  534  DFDAFIM-ETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
            +FD FI+ E + +  +SELDQYLEE+LLPRV EFDV+ WWK N++K+PTLSKMARDIL +
Sbjct  538  EFDKFIIKERAGKNLKSELDQYLEETLLPRVQEFDVLEWWKQNKLKFPTLSKMARDILAI  597

Query  357  PVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            PVS A  D VF    +EMD Y+ SLRPETVEAL+CA++W
Sbjct  598  PVSAAAFDYVFHVEPREMDEYKTSLRPETVEALICAREW  636



>ref|XP_009147901.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Brassica rapa]
Length=659

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 153/219 (70%), Gaps = 21/219 (10%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K Q + +R+   +DP+V G+ K+M+EK DKYW+   L+L++AV++DPRFKMKLVEFSFSK
Sbjct  438  KTQSDLSRSIAGEDPYVAGIAKTMKEKADKYWRESSLVLAMAVVMDPRFKMKLVEFSFSK  497

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            I+GEDA   +  VD+GIHELF +YVAL   + P   +E                    L+
Sbjct  498  IFGEDAGKNINTVDDGIHELFSEYVALSALVKPASEDE--------------------LS  537

Query  534  DFDAF-IMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
            +FD F I E + +  +SELDQYLEE+LLPRV EFDV+ WWK N++K+PTLSKMARDIL +
Sbjct  538  EFDKFMIKERAGKNLKSELDQYLEETLLPRVQEFDVLEWWKQNKLKFPTLSKMARDILAI  597

Query  357  PVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            PVS A  D VF    +EMD Y+ SLRPETVEAL+CAK+W
Sbjct  598  PVSAAAFDYVFDVEPREMDEYKTSLRPETVEALICAKEW  636



>dbj|BAJ88673.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=759

 Score =   241 bits (615),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/222 (53%), Positives = 160/222 (72%), Gaps = 8/222 (4%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+QLE A AA  +D  V    + M E FDKYWK C L+L++AV++DPRFKMKLVEFS+SK
Sbjct  526  KLQLELANAAAHEDLVVSSTARDMHESFDKYWKDCNLVLAVAVVMDPRFKMKLVEFSYSK  585

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            IYG +A+ YV++V++ +HEL+++Y+A PLP  P Y+ ++  G  NTQ       +  GL 
Sbjct  586  IYGVEAAKYVKVVNDSLHELYKEYLAQPLPARPVYVGQSASGNNNTQTTPPSIGD--GLL  643

Query  534  DFDAFIMETSSQQ-SRSELDQYLEESLLPR-VHEFDVVGWWKLNRMKYPTLSKMARDILT  361
            DFD ++ E ++ Q S+SEL+QYLEE L PR + EFD++ WWKLN +++PTLSKMARD+L 
Sbjct  644  DFDMYLSEIATAQPSKSELEQYLEEPLTPRSIQEFDILSWWKLNTLRFPTLSKMARDVLA  703

Query  360  VPVSTAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDW  241
            +P++     S+FS  T  + +D YR SLRPE VEALVCAKDW
Sbjct  704  IPMTM--VSSIFSAETGIRTLDDYRSSLRPEIVEALVCAKDW  743



>dbj|BAJ96825.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score =   241 bits (614),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/222 (53%), Positives = 160/222 (72%), Gaps = 8/222 (4%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+QLE A AA  +D  V    + M E FDKYWK C L+L++AV++DPRFKMKLVEFS+SK
Sbjct  542  KLQLELANAAAHEDLVVSSTARDMHESFDKYWKDCNLVLAVAVVMDPRFKMKLVEFSYSK  601

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            IYG +A+ YV++V++ +HEL+++Y+A PLP  P Y+ ++  G  NTQ       +  GL 
Sbjct  602  IYGVEAAKYVKVVNDSLHELYKEYLAQPLPARPVYVGQSASGNNNTQTTPPSIGD--GLL  659

Query  534  DFDAFIMETSSQQ-SRSELDQYLEESLLPR-VHEFDVVGWWKLNRMKYPTLSKMARDILT  361
            DFD ++ E ++ Q S+SEL+QYLEE L PR + EFD++ WWKLN +++PTLSKMARD+L 
Sbjct  660  DFDMYLSEIATAQPSKSELEQYLEEPLTPRSIQEFDILSWWKLNTLRFPTLSKMARDVLA  719

Query  360  VPVSTAPADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDW  241
            +P++     S+FS  T  + +D YR SLRPE VEALVCAKDW
Sbjct  720  IPMTM--VSSIFSAETGIRTLDDYRSSLRPEIVEALVCAKDW  759



>gb|KHN22430.1| Putative AC transposase [Glycine soja]
Length=543

 Score =   235 bits (599),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 162/226 (72%), Gaps = 6/226 (3%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+Q+E   AA+S DPF   L   +QEKFD+YW+  C +L++AV++DPR+KMKLVE +F+K
Sbjct  301  KLQVELTCAALSQDPFCSHLITPLQEKFDQYWRESCFVLAVAVVMDPRYKMKLVESTFAK  360

Query  714  IYGEDASTYVRIVDEGIHELFQDY-VALPLPLTPTYIEEANGGAVNTQDAQE----LSTN  550
            I+GE+A  ++RIV++G+HELF +Y +   LP T T  +E N   + T+  QE    L   
Sbjct  361  IFGENADQWIRIVEDGLHELFLEYNIIQVLPFTATNDDEGNEAMIKTEPFQEFDGSLFAA  420

Query  549  ELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMAR  373
            + GL+DF+ +I + T +QQ ++ELD+YLEE L PRV EFD++ WW++N +KYPTLS++A 
Sbjct  421  DDGLSDFEFYISDFTCNQQFKTELDEYLEEPLEPRVQEFDILSWWRINGLKYPTLSRLAS  480

Query  372  DILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            DIL +P+ST  AD+VF T  ++MD YR SL   T+EAL+C KDW Q
Sbjct  481  DILCMPISTLSADAVFDTEIRKMDSYRSSLDSLTLEALICTKDWLQ  526



>ref|XP_011652997.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Cucumis sativus]
 gb|KGN52935.1| hypothetical protein Csa_4G006420 [Cucumis sativus]
Length=692

 Score =   237 bits (605),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/227 (52%), Positives = 158/227 (70%), Gaps = 7/227 (3%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQ E   A++S DP V  LTK +++KFDKYW  CCL+L++AV++DPRFK+KLVEF FSK
Sbjct  445  KIQTELTNASMSQDPLVRDLTKPLKDKFDKYWNECCLVLALAVVMDPRFKLKLVEFIFSK  504

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNEL---  544
            I+ ++A  ++RIVD G+H+LF  +    L L+ T+ E+ N G   T+   E    E+   
Sbjct  505  IFVQNAEEWIRIVDYGLHDLFLQFTMETLTLSETFGEDGNIGISITELQDEEHQGEIFLT  564

Query  543  ---GLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMA  376
               GL+DFD +I E S  QQ++SELD+YLEE L P+  EFDV+ WW+LN+ +YPTL+KMA
Sbjct  565  TGDGLSDFDVYISEISEGQQTKSELDRYLEEELSPKSQEFDVLSWWRLNKYRYPTLAKMA  624

Query  375  RDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
             DIL++PVST   DSVF T  + MD YR SL   T+EAL+C +DW Q
Sbjct  625  CDILSMPVSTVTRDSVFDTEIRRMDSYRRSLPSATLEALICTRDWLQ  671



>ref|XP_011457838.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Fragaria vesca subsp. vesca]
Length=735

 Score =   233 bits (593),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 150/221 (68%), Gaps = 29/221 (13%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            +IQ E ++   ++DPFV  L ++M EK + YWK+C L L++AV++DPR+KMK VEF+F K
Sbjct  539  RIQEELSKLITNEDPFVSNLARTMLEKINTYWKNCSLTLAVAVVMDPRYKMKYVEFTFKK  598

Query  714  IYG-EDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGL  538
            IY  E+A T +++VD+ IHELFQ+Y  +PLPL P Y EE                     
Sbjct  599  IYNEEEAQTCIKMVDDRIHELFQEYSTMPLPLAPNYAEE---------------------  637

Query  537  TDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
              FD +IM    +  +++LDQYL E  + RVHEFDV+ WWKLN+M YPTLS+MARD+L+ 
Sbjct  638  --FDVYIM----KNLKTQLDQYLAEPPI-RVHEFDVLAWWKLNQMMYPTLSQMARDMLSF  690

Query  357  PVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            PVST P DSVF T  KEMD+YR SL+ ETVEAL+C KDW Q
Sbjct  691  PVSTVPCDSVFDTNAKEMDQYRSSLQAETVEALICTKDWMQ  731



>gb|KHN44191.1| Putative AC transposase [Glycine soja]
Length=656

 Score =   229 bits (583),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 110/226 (49%), Positives = 160/226 (71%), Gaps = 6/226 (3%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+Q+E   AA+S DPF   L   +QEKFD+YW+  CL+L++AV +DPR+KMK+VE +F+K
Sbjct  414  KLQVELTCAALSQDPFCSRLIMPLQEKFDQYWRESCLVLAVAVAMDPRYKMKIVESTFAK  473

Query  714  IYGEDASTYVRIVDEGIHELFQDY-VALPLPLTPTYIEEANGGAVNTQDAQELSTNELG-  541
            I+GE+A  ++RIV++G+ ELF +Y +   LP   T  +E N   + T+ +QE   +  G 
Sbjct  474  IFGENADQWIRIVEDGLQELFLEYNIIQVLPFAATNDDEGNEAMIKTETSQEFDGSLFGA  533

Query  540  ---LTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMAR  373
               L+DF+ +I + T +QQ ++ELD+YLEE L PRV EFD++ WW++N +KYPTLS++A 
Sbjct  534  DDGLSDFEFYISDFTCNQQFKTELDEYLEEPLEPRVQEFDILSWWRINGLKYPTLSRLAS  593

Query  372  DILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            DIL +P+ST  AD+VF T  ++MD YR SL   T+EAL+C KDW Q
Sbjct  594  DILCMPISTLSADAVFDTEIRKMDSYRTSLDSLTLEALICTKDWFQ  639



>ref|XP_011467072.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Fragaria vesca subsp. vesca]
Length=673

 Score =   229 bits (584),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 159/224 (71%), Gaps = 6/224 (3%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            +IQ+E  +AA+S+D  V  L   + EKFD+YW++CCL+L+IAVI+DPR+K + V+F+FSK
Sbjct  425  QIQVELMQAAMSEDSLVSSLISPLYEKFDRYWENCCLVLAIAVIMDPRYKKQFVDFTFSK  484

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNEL---  544
            IYG++A T+V++VD+G+HELF +Y+   L L  T +EE N   + +   +    +     
Sbjct  485  IYGDNAETWVKLVDDGLHELFMEYMMQMLSLPGTLMEEGNEDIIKSDPPEAAEASHEEAT  544

Query  543  -GLTDFDAFIME-TSSQQSRSELDQYLEESLL-PRVHEFDVVGWWKLNRMKYPTLSKMAR  373
             G+++FD ++ + T  QQ +SEL+QYLEE +L PR  +FD++GWWK    KYPTLSKMA 
Sbjct  545  DGISEFDIYLSDVTGGQQMKSELEQYLEEIILAPRGQDFDILGWWKEKSTKYPTLSKMAS  604

Query  372  DILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            D+L++PVST  ADSVF+T  K MD YR SL    +EAL+CAKDW
Sbjct  605  DVLSIPVSTVAADSVFNTEIKRMDSYRTSLGASNLEALICAKDW  648



>ref|XP_002442948.1| hypothetical protein SORBIDRAFT_08g005330 [Sorghum bicolor]
 gb|EES16786.1| hypothetical protein SORBIDRAFT_08g005330 [Sorghum bicolor]
Length=762

 Score =   229 bits (585),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/229 (52%), Positives = 161/229 (70%), Gaps = 10/229 (4%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            IQ E + A    D   G +TK M E FDKYW+ C ++L+IAV++DPRFKMK+VEFS+SKI
Sbjct  529  IQREISNATDDQDSISGTITKGMHEIFDKYWRDCNVVLAIAVVMDPRFKMKIVEFSYSKI  588

Query  711  YG-EDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAV----NTQDAQELSTNE  547
            YG    S YV++VD+ +HEL+++YV  PLP TP ++E+   GA+    N       ST  
Sbjct  589  YGLMKGSKYVKLVDDAVHELYKEYVRQPLPSTPAHVEQEVTGALPDNKNNIPTDPTSTGN  648

Query  546  LGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARD  370
            L L+ FD ++ E + SQ S+SELDQYLEE+L+PR+ EFD++ WWK+N ++YPTLS+MA+D
Sbjct  649  L-LSGFDTYLSEVALSQISKSELDQYLEEALVPRMLEFDILMWWKVNAVRYPTLSRMAQD  707

Query  369  ILTVPVST-APADSVFS--TVHKEMDRYRCSLRPETVEALVCAKDWQQN  232
            +L +PVST     SVF+  T  K +D Y+ SL PET+EAL CAKDW Q+
Sbjct  708  VLAIPVSTVGRGSSVFAAGTEAKMLDDYQSSLHPETLEALFCAKDWLQH  756



>ref|XP_010520572.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Tarenaya hassleriana]
Length=641

 Score =   222 bits (566),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 157/226 (69%), Gaps = 17/226 (8%)
 Frame = -2

Query  894  KIQLEXARA-AVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFS  718
            K   + +RA A  +DP +G L K+M  K +KY K   L+L++AV++DPR+KMKLVEFSFS
Sbjct  413  KTHSDLSRAIAREEDPCIGDLVKTMIVKIEKYLKDSSLVLAMAVVMDPRYKMKLVEFSFS  472

Query  717  KIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGL  538
            K++ EDA   ++ VD+ +HELF  Y+ALP PLT  Y E             E S N  GL
Sbjct  473  KLFREDARKNIKAVDDRLHELFNGYLALPQPLTLAYAE------------GESSLNPDGL  520

Query  537  TDFDAFIMETSSQQSRSELDQYLEESLLPR-VHEFDVVGWWKLNRMKYPTLSKMARDILT  361
             DFD +IMET  +  +SELD+YL+E+LLPR V EF+V+ WWK N+++YPTLS MARDIL+
Sbjct  521  ADFDVYIMETMGRNLKSELDRYLDETLLPRHVKEFNVLEWWKHNKLRYPTLSGMARDILS  580

Query  360  VPVSTAPAD--SVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
            +P+S A AD  +VF    +EMD Y+  LRPETVEAL+CAKDW Q++
Sbjct  581  IPMSAA-ADFGNVFDIESREMDAYKTLLRPETVEALICAKDWFQSQ  625



>emb|CDX89026.1| BnaA04g01600D [Brassica napus]
Length=628

 Score =   218 bits (556),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 110/218 (50%), Positives = 150/218 (69%), Gaps = 9/218 (4%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+QLE + AA+S++P V  L   ++EKFD+YW+ C L+L++AV++DPRFKMKL+EFSFSK
Sbjct  405  KLQLELSHAAMSEEPDVRKLATPLREKFDEYWRGCFLLLAVAVVMDPRFKMKLIEFSFSK  464

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
             YGEDA  ++R VD+ +HEL+ DY       +    E+    A++  ++QE +       
Sbjct  465  AYGEDAEKWIRSVDDAVHELYHDYAEQRD--SNLLNEKPRDHALDGHESQEAA-------  515

Query  534  DFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            + D   +  S +Q +SELDQYLEESL+PR  +F+V+GWW LNR KYPTLSKMA D+L++P
Sbjct  516  ETDQTQLVGSREQMKSELDQYLEESLIPRSPDFEVLGWWSLNRTKYPTLSKMAADVLSLP  575

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
              T   DSVF T  K+MD YR SL   T+EAL CAKDW
Sbjct  576  FCTVSPDSVFDTDVKKMDNYRSSLGHVTLEALFCAKDW  613



>gb|EEC79764.1| hypothetical protein OsI_21155 [Oryza sativa Indica Group]
Length=212

 Score =   207 bits (526),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 109/219 (50%), Positives = 146/219 (67%), Gaps = 16/219 (7%)
 Frame = -2

Query  825  MQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQD  646
            M E+FDKYWK C L+L+IAV++DPRFKMKLVEFS+SKI+  +A+ YV++VD+ IHEL+ +
Sbjct  1    MHERFDKYWKDCNLVLAIAVVMDPRFKMKLVEFSYSKIHSVEAAKYVKVVDDAIHELYSE  60

Query  645  YVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYL  469
            Y         T  E      V    A     N   L DFD ++ E  +SQ S SEL+QYL
Sbjct  61   YA--------TQGEANRDAHVTDNSAAVTPPNGDELLDFDIYLSEIATSQPSISELEQYL  112

Query  468  EESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVS-TAPADSVFS---TVHKEMD  301
            EE+L+PR+ +F+++ WWKLN +K+PTLSKMARD+L +P+S  +   S+FS   T  + +D
Sbjct  113  EEALMPRIQDFEILEWWKLNTIKFPTLSKMARDVLAIPMSMVSSGSSIFSATATGSQMLD  172

Query  300  RYRCSLRPETVEALVCAKDWQQNELVKS---ITAPIKME  193
             YR SLRPETVE+L CAKDW Q     +    TA +KME
Sbjct  173  DYRSSLRPETVESLFCAKDWLQYPPATTEAPSTALVKME  211



>ref|NP_001056445.1| Os05g0583200 [Oryza sativa Japonica Group]
 sp|Q75HY5.1|RSLE3_ORYSJ RecName: Full=Zinc finger BED domain-containing protein RICESLEEPER 
3; AltName: Full=Transposase-like protein RICESLEEPER 
3 [Oryza sativa Japonica Group]
 gb|AAS16892.1| unknow protein [Oryza sativa Japonica Group]
 dbj|BAF18359.1| Os05g0583200 [Oryza sativa Japonica Group]
 dbj|BAG95453.1| unnamed protein product [Oryza sativa Japonica Group]
Length=752

 Score =   220 bits (560),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 111/225 (49%), Positives = 152/225 (68%), Gaps = 13/225 (6%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+Q E + A   +DP      K M E+FDKYWK C L+L+IAV++DPRFKMKLVEFS+SK
Sbjct  518  KLQSELSNAIAHEDPIFRSTAKIMHERFDKYWKDCNLVLAIAVVMDPRFKMKLVEFSYSK  577

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            I+  +A+ YV++VD+ IHEL+ +Y          ++ + N  AV   +  E       L 
Sbjct  578  IHSVEAAKYVKVVDDAIHELYSEYATQGEANRDAHVTD-NSAAVTPPNGDE-------LL  629

Query  534  DFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
            DFD ++ E  +SQ S SEL+QYLEE+L+PR+ +F+++ WWKLN +K+PTLSKMARD+L +
Sbjct  630  DFDIYLSEIATSQPSISELEQYLEEALMPRIQDFEILEWWKLNTIKFPTLSKMARDVLAI  689

Query  357  PVS-TAPADSVFS---TVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            P+S  +   S+FS   T  + +D YR SLRPETVEAL CAKDW Q
Sbjct  690  PMSMVSSGSSIFSATATGSQMLDDYRSSLRPETVEALFCAKDWLQ  734



>ref|XP_007150768.1| hypothetical protein PHAVU_005G179200g [Phaseolus vulgaris]
 gb|ESW22762.1| hypothetical protein PHAVU_005G179200g [Phaseolus vulgaris]
Length=657

 Score =   218 bits (555),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/238 (47%), Positives = 160/238 (67%), Gaps = 9/238 (4%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+QL    A++S DPF   L   +Q+KFD+YW+  C IL++AV +DPR+KMK VE +F K
Sbjct  413  KLQLVLTCASLSHDPFCSRLIMPLQKKFDQYWRESCFILAVAVAMDPRYKMKFVESTFGK  472

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALP-LPLTPTYIEEANGGAVNTQDAQE------LS  556
            I+GE+A  ++R+V++G++ELF DY  +  LP T     E +   + T+   E      L 
Sbjct  473  IFGENAEYWIRVVEDGLNELFLDYNIIEVLPFTARSDNEGDETMIKTESFDEAGFDGSLF  532

Query  555  TNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKM  379
              + GL+D + +I + T +QQ +SELD+YLEE L  RV EFDV+ WW++NR+KYPTLS++
Sbjct  533  AADDGLSDIEFYISDLTCNQQFKSELDEYLEEPLESRVQEFDVLSWWRINRLKYPTLSRL  592

Query  378  ARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAP  205
            A DIL VPVST  AD+VF T  ++MD YR SL   T+EAL+C+KDW Q + +  IT P
Sbjct  593  ASDILCVPVSTLSADAVFDTQIRKMDNYRSSLDSLTLEALICSKDWFQYKSL-PITVP  649



>gb|EEE64837.1| hypothetical protein OsJ_19694 [Oryza sativa Japonica Group]
Length=879

 Score =   219 bits (558),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 116/242 (48%), Positives = 159/242 (66%), Gaps = 16/242 (7%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+Q E + A   +DP      K M E+FDKYWK C L+L+IAV++DPRFKMKLVEFS+SK
Sbjct  645  KLQSELSNAIAHEDPIFRSTAKIMHERFDKYWKDCNLVLAIAVVMDPRFKMKLVEFSYSK  704

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            I+  +A+ YV++VD+ IHEL+ +Y          ++ + N  AV   +  E       L 
Sbjct  705  IHSVEAAKYVKVVDDAIHELYSEYATQGEANRDAHVTD-NSAAVTPPNGDE-------LL  756

Query  534  DFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
            DFD ++ E  +SQ S SEL+QYLEE+L+PR+ +F+++ WWKLN +K+PTLSKMARD+L +
Sbjct  757  DFDIYLSEIATSQPSISELEQYLEEALMPRIQDFEILEWWKLNTIKFPTLSKMARDVLAI  816

Query  357  PVS-TAPADSVFS---TVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKS---ITAPIK  199
            P+S  +   S+FS   T  + +D YR SLRPETVEAL CAKDW Q     +    TA +K
Sbjct  817  PMSMVSSGSSIFSATATGSQMLDDYRSSLRPETVEALFCAKDWLQYPPATTEAPSTALVK  876

Query  198  ME  193
            ME
Sbjct  877  ME  878



>ref|XP_011625892.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Amborella trichopoda]
Length=655

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/231 (48%), Positives = 157/231 (68%), Gaps = 12/231 (5%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KI +       S D  +  + +++Q+KFDKYW+   L+L+IAV +DPRFKMK VEFSFSK
Sbjct  418  KIHMHLNHTVTSPDIVIIPVIRNLQDKFDKYWREYSLVLAIAVSMDPRFKMKFVEFSFSK  477

Query  714  IYGEDASTYVRIVDEGIHELFQDY---VALPLPLTPTYIEEANGGAVNTQDAQELSTNEL  544
            +YG +A  Y R+V E I +L+  Y   +  P+PL  TY    NG   ++ ++ +++    
Sbjct  478  VYGTNAFMYTRVVIEAIRDLYSQYARNIPGPVPLA-TY----NGDQSSSNNSFQIND---  529

Query  543  GLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  367
            GL DFD F+ E S SQQ++SELDQYLEE L PR  EFD++ WWK++  KYP LS+MARDI
Sbjct  530  GLQDFDQFLSELSGSQQTKSELDQYLEEPLFPRNQEFDILRWWKMSAPKYPVLSEMARDI  589

Query  366  LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSI  214
            L + V+T  ++S+F+T  K +D+Y+ SL PET+EAL+CA+DW  +EL  S+
Sbjct  590  LAIRVTTVDSESMFNTGGKVLDQYQSSLSPETIEALICARDWLHHELETSL  640



>gb|ERN12810.1| hypothetical protein AMTR_s00180p00017340 [Amborella trichopoda]
Length=841

 Score =   216 bits (549),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 111/237 (47%), Positives = 159/237 (67%), Gaps = 12/237 (5%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KI +       S D  +  + +++Q+KFDKYW+   L+L+IAV +DPRFKMK VEFSFSK
Sbjct  418  KIHMHLNHTVTSPDIVIIPVIRNLQDKFDKYWREYSLVLAIAVSMDPRFKMKFVEFSFSK  477

Query  714  IYGEDASTYVRIVDEGIHELFQDY---VALPLPLTPTYIEEANGGAVNTQDAQELSTNEL  544
            +YG +A  Y R+V E I +L+  Y   +  P+PL  TY    NG   ++ ++ +++    
Sbjct  478  VYGTNAFMYTRVVIEAIRDLYSQYARNIPGPVPLA-TY----NGDQSSSNNSFQIND---  529

Query  543  GLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  367
            GL DFD F+ E S SQQ++SELDQYLEE L PR  EFD++ WWK++  KYP LS+MARDI
Sbjct  530  GLQDFDQFLSELSGSQQTKSELDQYLEEPLFPRNQEFDILRWWKMSAPKYPVLSEMARDI  589

Query  366  LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKM  196
            L + V+T  ++S+F+T  K +D+Y+ SL PET+EAL+CA+DW  +EL  S+   + M
Sbjct  590  LAIRVTTVDSESMFNTGGKVLDQYQSSLSPETIEALICARDWLHHELETSLDTVLNM  646



>emb|CDY00623.1| BnaC04g23020D [Brassica napus]
Length=1270

 Score =   217 bits (552),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 148/224 (66%), Gaps = 21/224 (9%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+QLE +  A+S++P V  L   ++EKFD+YW+ C L+L++AV++DPRFKMKL+EFSFSK
Sbjct  502  KLQLELSHTAMSEEPDVRNLATPLREKFDEYWRGCFLLLAVAVVMDPRFKMKLIEFSFSK  561

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQ------DAQELST  553
             YGEDA  ++R VD+ +HEL+ DY            E+ +   +N +      D  E  +
Sbjct  562  AYGEDAEKWIRSVDDAVHELYHDYA-----------EQRDSNLLNEKPRDHALDGHE--S  608

Query  552  NELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMAR  373
             E   TD    +   S +Q +SELDQYLEESL+PR  +F+V+GWW LNR KYPTLSKMA 
Sbjct  609  QEAAQTDRTQLV--GSREQMKSELDQYLEESLIPRSPDFEVLGWWSLNRTKYPTLSKMAA  666

Query  372  DILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            D+L++P  T   DSVF T  K+MD YR SL   T+EAL CAKDW
Sbjct  667  DVLSLPFCTVSPDSVFDTDVKKMDNYRSSLGHVTLEALFCAKDW  710



>gb|KHN01319.1| Putative AC transposase, partial [Glycine soja]
Length=647

 Score =   211 bits (538),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/230 (47%), Positives = 155/230 (67%), Gaps = 19/230 (8%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+Q+E   AA S DPF+  L   + + FD+YW+  CL+L+IAV +DPR KMKLVEF+F+K
Sbjct  425  KVQVELTHAAFSQDPFLSSLFLPLHKNFDQYWRESCLVLAIAVAMDPRHKMKLVEFTFAK  484

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANG---------GAVNTQ---D  571
            I+GE+A  +++IV++G+ ELF +Y ++ + LT T  +E +          G+++     D
Sbjct  485  IFGENAEEWIKIVEDGLRELFIEY-SMQMFLTTTNGDEGDDIMIKKTFLEGSIDCSLFVD  543

Query  570  AQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPT  391
              E S  E  ++DF      T + Q +SELD+YLEE LL RV EFD++ WW++N +KYPT
Sbjct  544  GDEFSDYEFYISDF------TGNPQFKSELDEYLEEPLLTRVEEFDILSWWRVNGLKYPT  597

Query  390  LSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            LS++A DIL++PVST  ADS+F    ++MD YR SL   T+EAL+CAKDW
Sbjct  598  LSRIASDILSLPVSTLSADSIFDMQIRKMDSYRSSLSSLTLEALICAKDW  647



>gb|EAY97185.1| hypothetical protein OsI_19106 [Oryza sativa Indica Group]
Length=409

 Score =   202 bits (515),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 103/194 (53%), Positives = 136/194 (70%), Gaps = 19/194 (10%)
 Frame = -2

Query  762  VDPRFK----------MKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPT  613
            + PRF+          MKLVEFS+SKIYG +A+ YV++VD+ +HEL+ +YVA PLPLTP 
Sbjct  198  LQPRFRVVDVETMEWEMKLVEFSYSKIYGVEAAKYVKVVDDAVHELYNEYVAQPLPLTPA  257

Query  612  YIEEANGGAV----NTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPR  448
            Y+E+  G       N+  A   ST + GL DFD ++ E  +SQ ++SEL+QYL+ESL PR
Sbjct  258  YVEQGGGNNAPASENSTQATAPSTGD-GLVDFDMYLSEIATSQPTKSELEQYLDESLTPR  316

Query  447  VHEFDVVGWWKLNRMKYPTLSKMARDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRP  277
            + EFD++ WWKLN +KYPTLSKMARDIL +P+S  +  +S+FS  T  + +D YR S RP
Sbjct  317  IQEFDILNWWKLNTLKYPTLSKMARDILAIPMSMVSSGNSIFSAGTGTRMLDDYRSSSRP  376

Query  276  ETVEALVCAKDWQQ  235
            E VEALVCAKDW Q
Sbjct  377  EIVEALVCAKDWLQ  390



>gb|EAY91763.1| hypothetical protein OsI_13406 [Oryza sativa Indica Group]
Length=409

 Score =   202 bits (514),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 138/194 (71%), Gaps = 19/194 (10%)
 Frame = -2

Query  762  VDPRFK----------MKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVALPLPLTPT  613
            + PRF+          MKLVEFS+SKIYG +A+ YV++VD+ +HEL+++YVA PLPLTP 
Sbjct  198  LQPRFRVVDVETMEGEMKLVEFSYSKIYGVEAAKYVKVVDDAVHELYKEYVAQPLPLTPA  257

Query  612  YIEEANGGAV----NTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPR  448
            Y+E+ +G       N   A   ST + GL DFD ++ E  +SQ ++SEL+QYL+ESL PR
Sbjct  258  YVEQGDGNNAPASENGTQATAPSTGD-GLVDFDMYLSEIATSQPTKSELEQYLDESLTPR  316

Query  447  VHEFDVVGWWKLNRMKYPTLSKMARDILTVPVS-TAPADSVFS--TVHKEMDRYRCSLRP  277
            + EFD++ WWKLN +K+PTLS+MARDIL +P+S  +  +S+FS  T  + +D YR SLRP
Sbjct  317  IQEFDILNWWKLNTLKFPTLSRMARDILAIPMSMVSSGNSIFSAGTGTRMLDDYRSSLRP  376

Query  276  ETVEALVCAKDWQQ  235
            E VEALVCAKDW Q
Sbjct  377  EIVEALVCAKDWLQ  390



>gb|EYU24629.1| hypothetical protein MIMGU_mgv1a023531mg [Erythranthe guttata]
Length=691

 Score =   206 bits (523),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/218 (47%), Positives = 146/218 (67%), Gaps = 12/218 (6%)
 Frame = -2

Query  870  AAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDAST  691
            AA S DPF   LTK ++EKF +YW+SC L++++A ++DPR KM  V F+ ++IYGEDA T
Sbjct  456  AATSSDPFRITLTKPLREKFMRYWESCNLVIAMAAVMDPRMKMDYVAFNSTRIYGEDAGT  515

Query  690  YVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGL-TDFDAFIM  514
            +V+IV++ +HELF  YV +   L P + EE    A++     E+   E  L +  D  I 
Sbjct  516  WVKIVNDSLHELFLQYV-MHSHLGPAFAEEE---AIDPLVKMEMPCQEDALLSSVDGLID  571

Query  513  ET-------SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
                         ++ E+DQYLEES+LPRV EFDV+GWW++N  +YPTLS+MA D+L++P
Sbjct  572  FDIDISDIMGESHTKLEIDQYLEESILPRVQEFDVLGWWRVNTYRYPTLSRMAFDVLSIP  631

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            +ST P +SVF T  +++D YR SLRP T++AL CAKDW
Sbjct  632  MSTTPTESVFDTRERKVDDYRSSLRPSTLDALFCAKDW  669



>ref|XP_011628141.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2 [Amborella trichopoda]
Length=631

 Score =   199 bits (506),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 99/232 (43%), Positives = 153/232 (66%), Gaps = 3/232 (1%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            ++ L     ++S +  +  +   M+EKFDKYWK   L+L+IAV++DPRFK+K VE+S+S+
Sbjct  399  QMHLRLVEWSMSLNKHISSMAIKMKEKFDKYWKISNLVLAIAVVIDPRFKLKFVEYSYSQ  458

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            IYG DA  ++R+V +G+++L  +Y +   PL     E +   + +T      +  +L   
Sbjct  459  IYGNDAEHHIRMVRQGVYDLCNEYESKE-PLASNS-ESSLAVSASTSSGGVDTHGKLWAM  516

Query  534  DFDAFIMETSSQQSR-SELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
            +F+ F+ E+SS Q+R SELD+YLEE + PR  +F++  WW+LN  ++PTLSKMARDIL +
Sbjct  517  EFEKFVRESSSNQARKSELDRYLEEPIFPRNLDFNIRNWWQLNAPRFPTLSKMARDILGI  576

Query  357  PVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPI  202
            PVST  +DS F    + +D+YR SL PET++AL+CA+DW  NEL    ++ I
Sbjct  577  PVSTVTSDSTFDIGGQVLDQYRSSLLPETIQALMCAQDWLWNELKGGKSSSI  628



>gb|ERN18855.1| hypothetical protein AMTR_s00067p00136180 [Amborella trichopoda]
Length=685

 Score =   199 bits (505),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/224 (44%), Positives = 150/224 (67%), Gaps = 3/224 (1%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            ++ L     ++S +  +  +   M+EKFDKYWK   L+L+IAV++DPRFK+K VE+S+S+
Sbjct  453  QMHLRLVEWSMSLNKHISSMAIKMKEKFDKYWKISNLVLAIAVVIDPRFKLKFVEYSYSQ  512

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            IYG DA  ++R+V +G+++L  +Y +   PL     E +   + +T      +  +L   
Sbjct  513  IYGNDAEHHIRMVRQGVYDLCNEYESKE-PLASNS-ESSLAVSASTSSGGVDTHGKLWAM  570

Query  534  DFDAFIMETSSQQSR-SELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
            +F+ F+ E+SS Q+R SELD+YLEE + PR  +F++  WW+LN  ++PTLSKMARDIL +
Sbjct  571  EFEKFVRESSSNQARKSELDRYLEEPIFPRNLDFNIRNWWQLNAPRFPTLSKMARDILGI  630

Query  357  PVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  226
            PVST  +DS F    + +D+YR SL PET++AL+CA+DW  NEL
Sbjct  631  PVSTVTSDSTFDIGGQVLDQYRSSLLPETIQALMCAQDWLWNEL  674



>gb|KHN03603.1| Putative AC transposase [Glycine soja]
Length=123

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = -2

Query  543  GLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDIL  364
            GLTDFD +IMETS+ Q +SELDQYLEESLLPRV +FDV+GWWKLN++KYPTLSKMARDIL
Sbjct  6    GLTDFDVYIMETSNHQMKSELDQYLEESLLPRVPDFDVLGWWKLNKLKYPTLSKMARDIL  65

Query  363  TVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKME  193
            +VPVS+ P +SVF T  KEMD+YR SLRPETVEALVCAKDW Q    ++  A +KME
Sbjct  66   SVPVSSLPPESVFDTKVKEMDQYRSSLRPETVEALVCAKDWMQYGAAEASNALVKME  122



>ref|XP_007135765.1| hypothetical protein PHAVU_010G156900g [Phaseolus vulgaris]
 gb|ESW07759.1| hypothetical protein PHAVU_010G156900g [Phaseolus vulgaris]
Length=658

 Score =   189 bits (480),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 106/234 (45%), Positives = 158/234 (68%), Gaps = 19/234 (8%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+Q+E  +AA   DPF+  L   + E FD+YW+  C+IL+IAV +DPR KMKLVEF+F+K
Sbjct  432  KVQVELTQAAFIQDPFIRSLIFPLHENFDQYWRESCIILAIAVAMDPRHKMKLVEFTFAK  491

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANG---------GAVNTQ---D  571
             +GE+A+ +++IV++G+ +LF +Y +  + LT T  ++ +          G+++     D
Sbjct  492  TFGENAAAWIKIVEDGLRDLFIEY-STQMFLTATNDDDGDDIMIKETYQEGSIDCSLFVD  550

Query  570  AQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPT  391
              ELS  E  ++DF      T + Q +SEL++YLEE LL R  EFD++ WW++N +KYPT
Sbjct  551  GDELSDYEFYISDF------TGNPQFKSELEEYLEEPLLSRAEEFDILSWWRVNGLKYPT  604

Query  390  LSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
            LS++A DIL++PVST  ADSVF T  +++D YR SL   T+EAL+CAKDW Q+E
Sbjct  605  LSRIASDILSLPVSTLSADSVFDTQIRKIDSYRSSLSSLTLEALICAKDWFQSE  658



>sp|Q0JMB2.3|RSLE4_ORYSJ RecName: Full=Zinc finger BED domain-containing protein RICESLEEPER 
4; AltName: Full=Transposase-like protein RICESLEEPER 
4 [Oryza sativa Japonica Group]
 gb|EAZ12126.1| hypothetical protein OsJ_02008 [Oryza sativa Japonica Group]
Length=684

 Score =   189 bits (479),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 109/235 (46%), Positives = 151/235 (64%), Gaps = 16/235 (7%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            +QLE        D  + G+   + EKFDKYWK C ++L+IAV +DPRFKMK+VEF++SKI
Sbjct  447  LQLELQNGMAHGDDVIRGIVIGIHEKFDKYWKDCNVVLAIAVAMDPRFKMKMVEFAYSKI  506

Query  711  YG-EDASTYVRIVDEGIHELFQDYVALP--LPLTPTYIEE--ANG------GAVNTQDAQ  565
            YG  DA+ YV++VD+ I +L+++Y A P  LPL+P Y+++  A+G      G      + 
Sbjct  507  YGPTDAAKYVKLVDDAILDLYKEYAAQPELLPLSPIYVDQVPADGLPFIETGGAPATASP  566

Query  564  ELSTNELGLTDFDAFIME--TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPT  391
              +    GL DFD ++ E  T  Q  + EL+ YLEE+L  R  +FDV+ WW+ N +KYPT
Sbjct  567  STAAAGAGLVDFDMYLSEVTTMGQPFKHELELYLEEALTQRTPDFDVLKWWQDNTLKYPT  626

Query  390  LSKMARDILTVPVST-APADSVF--STVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            LS+MARD+L +P+ST     SVF      + +D YR SLRPE VEAL+CAKDW Q
Sbjct  627  LSRMARDVLAIPMSTVGVGSSVFLPDNGSRSLDDYRSSLRPELVEALLCAKDWLQ  681



>ref|NP_001043202.2| Os01g0518400 [Oryza sativa Japonica Group]
 dbj|BAF05116.2| Os01g0518400, partial [Oryza sativa Japonica Group]
Length=688

 Score =   189 bits (479),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 109/235 (46%), Positives = 151/235 (64%), Gaps = 16/235 (7%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            +QLE        D  + G+   + EKFDKYWK C ++L+IAV +DPRFKMK+VEF++SKI
Sbjct  451  LQLELQNGMAHGDDVIRGIVIGIHEKFDKYWKDCNVVLAIAVAMDPRFKMKMVEFAYSKI  510

Query  711  YG-EDASTYVRIVDEGIHELFQDYVALP--LPLTPTYIEE--ANG------GAVNTQDAQ  565
            YG  DA+ YV++VD+ I +L+++Y A P  LPL+P Y+++  A+G      G      + 
Sbjct  511  YGPTDAAKYVKLVDDAILDLYKEYAAQPELLPLSPIYVDQVPADGLPFIETGGAPATASP  570

Query  564  ELSTNELGLTDFDAFIME--TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPT  391
              +    GL DFD ++ E  T  Q  + EL+ YLEE+L  R  +FDV+ WW+ N +KYPT
Sbjct  571  STAAAGAGLVDFDMYLSEVTTMGQPFKHELELYLEEALTQRTPDFDVLKWWQDNTLKYPT  630

Query  390  LSKMARDILTVPVST-APADSVF--STVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            LS+MARD+L +P+ST     SVF      + +D YR SLRPE VEAL+CAKDW Q
Sbjct  631  LSRMARDVLAIPMSTVGVGSSVFLPDNGSRSLDDYRSSLRPELVEALLCAKDWLQ  685



>ref|XP_010649234.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Vitis vinifera]
Length=219

 Score =   177 bits (448),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 136/206 (66%), Gaps = 6/206 (3%)
 Frame = -2

Query  837  LTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVRIVDEGIHE  658
            +T SM EKFDKYW  C ++++IAV++DPR+KMK++EF F  +YG +AS+ +  + +  ++
Sbjct  1    MTSSMLEKFDKYWSGCHIVMAIAVVLDPRYKMKILEFYFPIMYGSEASSEIGKIRQLCYD  60

Query  657  LFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELG-LTDFDAFIMETSSQ-QSRSE  484
            L   Y +     +    + ++ GA +  +  EL+ +E   L+ FD F+  TS +  ++SE
Sbjct  61   LLSKYQSK----SKMGQQTSSHGASSVSNLFELTYDEQDPLSKFDLFVHSTSEEGHAKSE  116

Query  483  LDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEM  304
            LD YLEE++LPR+ +FDV+ WWK N +KYPTL  + RDI  +PVST  ++S FST  + +
Sbjct  117  LDYYLEETVLPRILDFDVLSWWKTNGIKYPTLQMIVRDIYAIPVSTVASESAFSTGGRMV  176

Query  303  DRYRCSLRPETVEALVCAKDWQQNEL  226
             ++R  L P T+EAL+CA+ W  NE+
Sbjct  177  SKHRSRLHPNTLEALMCAQSWLGNEM  202



>gb|EPS64824.1| hypothetical protein M569_09955 [Genlisea aurea]
Length=692

 Score =   186 bits (472),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 99/231 (43%), Positives = 144/231 (62%), Gaps = 6/231 (3%)
 Frame = -2

Query  870  AAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDAST  691
            AA   D FV  L   +QE+F KYW  C  +L++AV +DPRFKMKLVEF+F +I+G+D+S 
Sbjct  451  AAAKTDRFVSNLNAVLQERFLKYWNDCNQVLAVAVTMDPRFKMKLVEFNFQRIFGDDSSL  510

Query  690  YVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNT-QDAQELSTNELGLTDFDAFIM  514
            +++ V EG+HEL  +YV   LPLT    E ++     T  D ++    E      D ++ 
Sbjct  511  WIKAVSEGLHELSVEYVVQSLPLTFIQKEGSDPPHPKTEDDGEDEEEEEEEFGGIDVYVS  570

Query  513  ETSSQQS--RSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAP  340
            +   + +    ELD YLE+ +LPR+ +FDV+GWWK    +YPTLSK+A D+L++PVST  
Sbjct  571  DIPVEHNFKTEELDHYLEDGVLPRIQDFDVLGWWKGKASRYPTLSKLAVDVLSIPVSTVF  630

Query  339  ADSVFST--VHKEMDRYRCSLRPETVEALVCAKDW-QQNELVKSITAPIKM  196
             +SVF T    +++D YR  L   TV+ALVCAKDW  QN+  ++   P ++
Sbjct  631  GESVFDTGRRRRQLDAYRSGLGASTVQALVCAKDWLLQNDGDRTSDVPYRI  681



>emb|CAN60218.1| hypothetical protein VITISV_006612 [Vitis vinifera]
Length=667

 Score =   184 bits (467),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/223 (42%), Positives = 133/223 (60%), Gaps = 7/223 (3%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I ++      S D F+  L   M+ KFDKYW  C L L++AVI+DPRFKMKLVE+ + +I
Sbjct  437  IHIQLIEWCKSPDDFISSLALKMKAKFDKYWSKCSLALAVAVILDPRFKMKLVEYYYPQI  496

Query  711  YGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTD  532
            YG DA+  ++ V +GI ELF  Y +    L        +     + D+++       L  
Sbjct  497  YGNDAADRIKDVSDGIKELFNVYCSTSASLHQGVALPGSSLPSTSNDSRD------RLKG  550

Query  531  FDAFIMETSSQQS-RSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            FD FI ETS  Q+  S+LD+YLEE + PR  +F ++ WWK+ + +YP LS M RD+L +P
Sbjct  551  FDKFIHETSQNQNIVSDLDKYLEEPVFPRNCDFHILNWWKVQKPRYPILSMMVRDVLGIP  610

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  226
            +ST   + VFST  + +D YR SL P+T +AL+C +DW Q  L
Sbjct  611  MSTVAPEVVFSTGARVLDHYRSSLNPDTRQALICTQDWLQTGL  653



>ref|XP_010644074.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Vitis vinifera]
 ref|XP_010644075.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Vitis vinifera]
 ref|XP_010644076.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Vitis vinifera]
 emb|CBI20108.3| unnamed protein product [Vitis vinifera]
Length=677

 Score =   184 bits (466),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/223 (42%), Positives = 133/223 (60%), Gaps = 7/223 (3%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I ++      S D F+  L   M+ KFDKYW  C L L++AVI+DPRFKMKLVE+ + +I
Sbjct  437  IHIQLIEWCKSPDDFISSLALKMKAKFDKYWSKCSLALAVAVILDPRFKMKLVEYYYPQI  496

Query  711  YGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTD  532
            YG DA+  ++ V +GI ELF  Y +    L        +     + D+++       L  
Sbjct  497  YGTDAADRIKDVSDGIKELFNVYCSTSASLHQGVALPGSSLPSTSNDSRD------RLKG  550

Query  531  FDAFIMETSSQQS-RSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            FD FI ETS  Q+  S+LD+YLEE + PR  +F ++ WWK+ + +YP LS M RD+L +P
Sbjct  551  FDKFIHETSQNQNIVSDLDKYLEEPVFPRNCDFHILNWWKVQKPRYPILSMMVRDVLGIP  610

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  226
            +ST   + VFST  + +D YR SL P+T +AL+C +DW Q  L
Sbjct  611  MSTVAPEVVFSTGARVLDHYRSSLNPDTRQALICTQDWLQTGL  653



>ref|XP_009800989.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nicotiana sylvestris]
Length=667

 Score =   183 bits (465),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 94/223 (42%), Positives = 142/223 (64%), Gaps = 12/223 (5%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I L+      + D FV  L   ++ +FD+YWK C L L+IA I+DPR+KMKLVE+ + +I
Sbjct  437  IHLQLIEWCQNSDDFVNSLALKLKSRFDEYWKKCSLALAIAAILDPRYKMKLVEYYYPQI  496

Query  711  YGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTD  532
            YG+ A   + IV + +  L+  + A+  PL P      NG A    +A ++  N   LT 
Sbjct  497  YGDSAPDCINIVSDCMKALYNGH-AIYSPLAP------NGQA----EASQVGGNNDRLTG  545

Query  531  FDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            +D FI ETS S   +S+LD+YLEE L PR  +F ++ WWK++  +YP LS MAR+IL +P
Sbjct  546  YDKFIYETSQSNNIKSDLDKYLEEPLFPRKADFSILNWWKVHTPRYPILSMMARNILGMP  605

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  226
            +S A  + VF+T +K +++YR SLR +T++AL+CA+DW ++E 
Sbjct  606  MSKASLEFVFNTGNKALEQYRSSLRSDTLQALMCAQDWMRDEF  648



>emb|CDY39631.1| BnaC05g11600D [Brassica napus]
Length=688

 Score =   184 bits (466),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 96/235 (41%), Positives = 144/235 (61%), Gaps = 20/235 (9%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K+QLE + AA+ DD        +++EKFD YW+ C L+L++AV++DPRFKMK ++ +F+ 
Sbjct  459  KLQLELSHAAMGDDVDARNTVNALREKFDLYWRGCFLVLAVAVVMDPRFKMKHIKDTFTN  518

Query  714  IYGEDASTYVRIVDEGIHELF---------QDYVALPLPLTPTY----IEEANGGAVNTQ  574
             YGEDA  +++ V + +H+LF          +YV + +   P +     ++AN G V + 
Sbjct  519  AYGEDAEDWIKSVSDAVHDLFLNYSGHNLLDEYVEIEVAEEPDFQQDMPQDANTGDVQSV  578

Query  573  DAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYP  394
            D    +   +G  D D   M+T       E+DQYL+++L+     FDV+GWWKLN + YP
Sbjct  579  DETRSTLVTIGDFDIDMSDMKT-------EMDQYLDDTLVLMSDSFDVLGWWKLNSINYP  631

Query  393  TLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
             LSK+A D+L+VP ST   DSVF T  K+MD Y+ SL   T+EAL+C KDW +N+
Sbjct  632  ILSKIAVDLLSVPFSTVSPDSVFDTEVKQMDSYKASLPRVTLEALLCTKDWLKNQ  686



>ref|XP_011468523.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Fragaria vesca subsp. vesca]
Length=310

 Score =   176 bits (447),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 91/229 (40%), Positives = 140/229 (61%), Gaps = 7/229 (3%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KI++  ++   S+  F+  +   M+EKFDKYW  C L+L++ V+ DPRFKM+L+E+ F K
Sbjct  80   KIKMHLSKGEKSEHEFLRLMAVPMKEKFDKYWDECSLVLAVGVVFDPRFKMQLIEYYFEK  139

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            ++G +A  Y+  V   + +LF +Y       +     E+N     + + + +++ +  L+
Sbjct  140  LHGSEAYEYIERVRTAMFDLFTEYE----DDSSQSEMESNLQFSGSCNDKTVASRDDELS  195

Query  534  DFDAFIMETSSQ---QSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDIL  364
             FDAF+ E SS    + +SEL+QYLEE L PR   F+V+ WWK+N  K PTL++MARDIL
Sbjct  196  GFDAFVREGSSHIVAKKKSELEQYLEEPLFPRAEPFNVLNWWKINSAKCPTLARMARDIL  255

Query  363  TVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKS  217
             VP +T  +++ FS   + +D  R S+ PETVEALV  KDW  +   KS
Sbjct  256  AVPATTVASEAAFSVGGRVIDESRASMLPETVEALVTTKDWLPSRKRKS  304



>ref|XP_009624222.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nicotiana tomentosiformis]
 ref|XP_009624230.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nicotiana tomentosiformis]
 ref|XP_009624235.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nicotiana tomentosiformis]
Length=670

 Score =   182 bits (462),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/225 (42%), Positives = 141/225 (63%), Gaps = 13/225 (6%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I L+      + D FV  L   ++ +FD+YWK C L L+IA I+DPR+KMKLVE+ + +I
Sbjct  437  IHLQLIEWCQNSDDFVNSLALKLKSRFDEYWKKCSLALAIAAILDPRYKMKLVEYYYPQI  496

Query  711  YGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEAN--GGAVNTQDAQELSTNELGL  538
            YG+ A   + IV + +  L+  + A+  PL P    EA+  GGA    D          L
Sbjct  497  YGDSAPDCINIVSDCMKALYNGH-AIYSPLAPNGQAEASQVGGAGANNDR---------L  546

Query  537  TDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILT  361
            T +D FI ETS S   +S+LD+YLEE L PR  +F ++ WWK++  +YP LS MAR+IL 
Sbjct  547  TGYDKFIYETSQSNNIKSDLDKYLEEPLFPRKADFSILNWWKVHTPRYPILSMMARNILG  606

Query  360  VPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  226
            +P+S A  + VF+T +K +++YR SLR +T++AL+CA+DW ++E 
Sbjct  607  MPMSKASLEFVFNTGNKALEQYRSSLRSDTLQALMCAQDWMRDEF  651



>ref|XP_010273438.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nelumbo nucifera]
 ref|XP_010273439.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nelumbo nucifera]
 ref|XP_010273440.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nelumbo nucifera]
 ref|XP_010273441.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nelumbo nucifera]
Length=678

 Score =   182 bits (461),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/241 (39%), Positives = 146/241 (61%), Gaps = 9/241 (4%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I L+      S D  +G +   M+ KFDKYW +C L L++AVI+DPRFKMKLVE+ + +I
Sbjct  423  IHLQLIEWCKSSDIVIGSMALKMKSKFDKYWSTCNLALAVAVILDPRFKMKLVEYYYPQI  482

Query  711  YGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAV-NTQDAQELSTNELG--  541
            YG  A   +++V + + EL+ +Y       T   +++  G  V N       S   +   
Sbjct  483  YGSSAPERIKVVSDSVKELYNEYAICS---TLASLDQGLGWEVRNNSGFSGTSVPNVSND  539

Query  540  -LTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  367
             L+ FD F+ ET+ SQ+S+S+LD+YLEE + PR  +F+++ WWK++  +YP LS MARD+
Sbjct  540  RLSGFDKFLNETTNSQRSKSDLDKYLEEPVFPRNVDFNILNWWKVHMPRYPILSMMARDV  599

Query  366  LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEVP  187
            L VP++T P  S F+   + +D YR SL P+T++AL+C +DW + E V+   +     +P
Sbjct  600  LGVPMATVPLGSTFNAGDRVLDPYRSSLNPDTLQALICTQDWLRTE-VQDCRSSSNHSIP  658

Query  186  I  184
            +
Sbjct  659  V  659



>ref|XP_010656944.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like isoform X3 [Vitis vinifera]
Length=685

 Score =   181 bits (459),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/238 (41%), Positives = 138/238 (58%), Gaps = 5/238 (2%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I L+      S D  +  L   M+ KFD+YWK C L L++A I+DPRFKMKLVE+ +SKI
Sbjct  438  IHLQLIDLCNSSDILISTLALKMKSKFDEYWKKCSLALAVAAILDPRFKMKLVEYYYSKI  497

Query  711  YGEDASTYVRIVDEGIHELFQDY-VALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            YG +A+ ++  +   I  LF ++ +  PL      +    GG+             LG  
Sbjct  498  YGSNATVHIDDISVSIKALFNEHAICSPLASLDQGLAWQVGGSGRLSAGNYSRDRLLG--  555

Query  534  DFDAFIMETSSQQS-RSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
             FD F+ ETS  QS +S+LD+YLEE L PR  +F ++ WWK++  KYP LS MAR++L +
Sbjct  556  -FDKFLHETSQSQSVKSDLDKYLEEPLFPRNVDFSILNWWKVHTPKYPILSMMARNVLGI  614

Query  357  PVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEVPI  184
            P+S    DS F+   + +D  R SL P TV+ALVCA+DW +NEL  S +      +P+
Sbjct  615  PMSKVALDSAFNMEGRVLDHDRSSLSPATVQALVCAQDWMRNELEDSKSFSSHSTLPL  672



>ref|XP_010656943.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like isoform X2 [Vitis vinifera]
Length=687

 Score =   181 bits (459),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/238 (41%), Positives = 138/238 (58%), Gaps = 5/238 (2%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I L+      S D  +  L   M+ KFD+YWK C L L++A I+DPRFKMKLVE+ +SKI
Sbjct  438  IHLQLIDLCNSSDILISTLALKMKSKFDEYWKKCSLALAVAAILDPRFKMKLVEYYYSKI  497

Query  711  YGEDASTYVRIVDEGIHELFQDY-VALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            YG +A+ ++  +   I  LF ++ +  PL      +    GG+             LG  
Sbjct  498  YGSNATVHIDDISVSIKALFNEHAICSPLASLDQGLAWQVGGSGRLSAGNYSRDRLLG--  555

Query  534  DFDAFIMETSSQQS-RSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
             FD F+ ETS  QS +S+LD+YLEE L PR  +F ++ WWK++  KYP LS MAR++L +
Sbjct  556  -FDKFLHETSQSQSVKSDLDKYLEEPLFPRNVDFSILNWWKVHTPKYPILSMMARNVLGI  614

Query  357  PVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEVPI  184
            P+S    DS F+   + +D  R SL P TV+ALVCA+DW +NEL  S +      +P+
Sbjct  615  PMSKVALDSAFNMEGRVLDHDRSSLSPATVQALVCAQDWMRNELEDSKSFSSHSTLPL  672



>ref|XP_010327097.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Solanum lycopersicum]
Length=669

 Score =   181 bits (458),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/223 (42%), Positives = 140/223 (63%), Gaps = 11/223 (5%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I L+      + D FV  L   ++ +FD+YWK C L L+IA I+DPRFKM+LV++ + +I
Sbjct  438  IHLQLIEWCQNSDDFVNSLALKLKSRFDEYWKKCSLALAIAAILDPRFKMQLVKYYYPQI  497

Query  711  YGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTD  532
            YG+ A   + IV + +  L+  + A+  PL P      NG A   + +Q    N   LT 
Sbjct  498  YGDSAPDCINIVSDCMKALYNGH-AIYSPLAP------NGQA---EASQVGGVNNDRLTG  547

Query  531  FDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            FD FI ETS S   +S+LD YLEE L PR  +F+++ WWK++  +YP LS MAR+IL +P
Sbjct  548  FDKFIYETSVSNNIKSDLDNYLEEKLFPRKDDFNILNWWKVHTPRYPILSMMARNILGMP  607

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  226
            +S A  + VF+T +K ++ YR SLR +T++AL+CA+DW ++E 
Sbjct  608  MSKASLEYVFNTGNKALEPYRSSLRSDTLQALMCAQDWMRDEF  650



>ref|XP_010656941.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like isoform X1 [Vitis vinifera]
 ref|XP_010656942.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like isoform X1 [Vitis vinifera]
Length=690

 Score =   181 bits (458),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 97/238 (41%), Positives = 138/238 (58%), Gaps = 5/238 (2%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I L+      S D  +  L   M+ KFD+YWK C L L++A I+DPRFKMKLVE+ +SKI
Sbjct  438  IHLQLIDLCNSSDILISTLALKMKSKFDEYWKKCSLALAVAAILDPRFKMKLVEYYYSKI  497

Query  711  YGEDASTYVRIVDEGIHELFQDY-VALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            YG +A+ ++  +   I  LF ++ +  PL      +    GG+             LG  
Sbjct  498  YGSNATVHIDDISVSIKALFNEHAICSPLASLDQGLAWQVGGSGRLSAGNYSRDRLLG--  555

Query  534  DFDAFIMETSSQQS-RSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
             FD F+ ETS  QS +S+LD+YLEE L PR  +F ++ WWK++  KYP LS MAR++L +
Sbjct  556  -FDKFLHETSQSQSVKSDLDKYLEEPLFPRNVDFSILNWWKVHTPKYPILSMMARNVLGI  614

Query  357  PVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEVPI  184
            P+S    DS F+   + +D  R SL P TV+ALVCA+DW +NEL  S +      +P+
Sbjct  615  PMSKVALDSAFNMEGRVLDHDRSSLSPATVQALVCAQDWMRNELEDSKSFSSHSTLPL  672



>gb|EEC70768.1| hypothetical protein OsI_02196 [Oryza sativa Indica Group]
Length=392

 Score =   176 bits (446),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 144/214 (67%), Gaps = 16/214 (7%)
 Frame = -2

Query  828  SMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYG-EDASTYVRIVDEGIHELF  652
            +++ +FDKYWK C ++L+IAV +DPRFKMK+VEF++SKIYG  DA+ YV++VD+ I +L+
Sbjct  176  TIETEFDKYWKDCNVVLAIAVAMDPRFKMKMVEFAYSKIYGPTDAAKYVKLVDDAILDLY  235

Query  651  QDYVALP--LPLTPTYIEE--ANG------GAVNTQDAQELSTNELGLTDFDAFIME--T  508
            ++Y A P  LPL+P Y+++  A+G      G      +   +    GL DFD ++ E  T
Sbjct  236  KEYAAQPELLPLSPIYVDQVPADGLPFIETGGAPATASPSTAAAGAGLVDFDMYLSEVTT  295

Query  507  SSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVST-APADS  331
              Q  + EL+ YLEE+L  R  +FDV+ WW+ N +KYPTLS+MARD+L +P+ST     S
Sbjct  296  MGQPFKHELELYLEEALTQRTPDFDVLKWWQDNTLKYPTLSRMARDVLAIPMSTVGVGSS  355

Query  330  VF--STVHKEMDRYRCSLRPETVEALVCAKDWQQ  235
            VF      + +D YR SLRPE VEAL+CAKDW Q
Sbjct  356  VFLPDNGSRSLDDYRSSLRPELVEALLCAKDWLQ  389



>emb|CDP06055.1| unnamed protein product [Coffea canephora]
Length=685

 Score =   180 bits (456),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 99/232 (43%), Positives = 137/232 (59%), Gaps = 27/232 (12%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I ++      S D F+  +   M+ KFDKYWK C L ++IA I+DPRFKMKLVE+ + +I
Sbjct  442  IHIQLIEWCKSPDDFLSSIAAKMKSKFDKYWKKCSLAVAIAAILDPRFKMKLVEYYYPQI  501

Query  711  YGEDASTYVRIVDEGIHELFQDYV----------ALPLPLTPTYIEEANGGAVNTQDAQE  562
            YG DA  +++ V  GI  LF +Y           ALP    P+ I   NG    T+D   
Sbjct  502  YGSDAVGHIKEVSNGIRGLFSEYAVSSSSVDQDSALPDGSLPSTI---NG----TRDR--  552

Query  561  LSTNELGLTDFDAFIMETSSQQSR-SELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLS  385
                   L  FD F+ ETS  QS  S+LD+YLEE + PR ++F+++ WWK++  +YP LS
Sbjct  553  -------LRGFDKFLHETSISQSMISDLDKYLEEPVFPRNNDFNILNWWKVHTPRYPILS  605

Query  384  KMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
             MARD+L +PV+T   D VFS   + +D +R SL P+T EALVC +DW + E
Sbjct  606  MMARDVLGLPVATLGRDLVFSNRGRVLDHHRSSLNPDTREALVCGQDWLRVE  657



>ref|XP_012076092.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Jatropha curcas]
 gb|KDP34464.1| hypothetical protein JCGZ_11935 [Jatropha curcas]
Length=672

 Score =   178 bits (452),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/212 (42%), Positives = 132/212 (62%), Gaps = 7/212 (3%)
 Frame = -2

Query  861  SDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVR  682
            S D F+  +   M+ KFDKYW  C L L++A I+DPRFKMKLVE+ +S+IYG  A   ++
Sbjct  450  SPDNFLSSIASKMKAKFDKYWNKCSLALAVAAILDPRFKMKLVEYYYSQIYGSTALDRIK  509

Query  681  IVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMETSS  502
             V +GI ELF  Y      +  T +++ +    N+  +    + +  L  FD F+ E S 
Sbjct  510  EVSDGIKELFNAY-----SICSTLVDQGSALPGNSLPSTSSDSRD-RLKGFDKFLHENSQ  563

Query  501  QQS-RSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVF  325
             QS  S+LD+YLEE + PR  +F+++ WWK++  +YP LS MARD+L  P+ST   +S F
Sbjct  564  SQSVASDLDKYLEEPVFPRNCDFNILNWWKVHTPRYPILSMMARDVLGTPMSTISPESAF  623

Query  324  STVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
            ST  + +D +R SL P+T +AL+CA+DW + E
Sbjct  624  STGGRVLDSHRSSLNPDTRQALICARDWLRGE  655



>gb|KHN26291.1| Putative AC transposase [Glycine soja]
Length=671

 Score =   178 bits (452),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/227 (41%), Positives = 134/227 (59%), Gaps = 8/227 (4%)
 Frame = -2

Query  861  SDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVR  682
            S D F+  +   M+ KFD+YW  C L L++A ++DPRFKMKLVE+ +S IYG  A   ++
Sbjct  449  SSDDFLSPMALKMKAKFDRYWSKCSLALAVAAVLDPRFKMKLVEYYYSLIYGSTALERIK  508

Query  681  IVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMETSS  502
             V +GI ELF  Y      +  T I++  G A+          +   L  FD F+ ETS 
Sbjct  509  EVSDGIKELFNAY-----SICSTMIDQ--GSALPGSSLPSTCGSRDRLKGFDRFLHETSQ  561

Query  501  QQSR-SELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVF  325
             QS  S+LD+YLEE + PR  +F+++ WWK++  +YP LS MARD+L  P+ST   +  F
Sbjct  562  SQSIISDLDKYLEEPIFPRNSDFNILNWWKVHMPRYPILSMMARDVLGTPMSTLAPELAF  621

Query  324  STVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEVPI  184
            ST  + +D  R SL P+T EAL+C +DW QNE      +PI   +P+
Sbjct  622  STGGRVLDSSRSSLNPDTREALICTQDWLQNESGNLNPSPIHSALPL  668



>ref|XP_011460363.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Fragaria vesca subsp. vesca]
Length=209

 Score =   169 bits (427),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 86/207 (42%), Positives = 128/207 (62%), Gaps = 7/207 (3%)
 Frame = -2

Query  825  MQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQD  646
            M+EKFDKYW  C L+L++ V+ DPRFKM+L+E+ F K++G +A  Y+  V   + +LF +
Sbjct  5    MKEKFDKYWDECSLVLAVGVVFDPRFKMQLIEYYFEKLHGSEAYEYIERVRTAMFDLFTE  64

Query  645  YVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMETSSQ---QSRSELDQ  475
            Y       +     E+N     + + + +++ +  L+ FDAF+ E SS    + +SEL+Q
Sbjct  65   YE----DDSSQSEMESNLEFSGSCNDKTVASRDDELSGFDAFVREGSSHIVAKKKSELEQ  120

Query  474  YLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRY  295
            YLEE L PR   F+V+ WWK+N  K PTL++MARDIL VP +T  +++ FS   + +D  
Sbjct  121  YLEEPLFPRAEPFNVLNWWKINGAKCPTLARMARDILAVPATTVASEAAFSVGGRVIDES  180

Query  294  RCSLRPETVEALVCAKDWQQNELVKSI  214
              S+ PETVEALV  KDW  +   KS 
Sbjct  181  HASMLPETVEALVTTKDWLPSRKRKSF  207



>ref|XP_011465798.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Fragaria vesca subsp. vesca]
Length=463

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 91/230 (40%), Positives = 140/230 (61%), Gaps = 7/230 (3%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KI++  ++   S+  F+  +   M+EKFDKYW  C L+L++ V+ DPRFKM+L+E+ F K
Sbjct  236  KIKMHLSKWEKSEHEFLRLMAVPMKEKFDKYWDECSLVLAVGVVFDPRFKMQLIEYYFEK  295

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            ++G +A  Y+  V   + +LF +Y       +     E+N     + + + +++ +  L+
Sbjct  296  LHGSEAYEYIERVRTAMFDLFTEYE----DDSSQSEMESNLEFSGSCNDKTVASRDDELS  351

Query  534  DFDAFIMETSSQ---QSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDIL  364
             FDAF+ E SS    + +SEL+QYLEE L PR   F+V+ WWK+N  K PTL++MARDIL
Sbjct  352  GFDAFVREGSSHIVAKKKSELEQYLEEPLFPRAEPFNVLNWWKINSAKCPTLARMARDIL  411

Query  363  TVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSI  214
             VP +T  +++ FS   + +D  R S+ PETVEALV  KDW  +   KS 
Sbjct  412  AVPATTVASEAAFSVGGRVIDESRASMLPETVEALVTTKDWLPSRKRKSF  461



>emb|CDP18725.1| unnamed protein product [Coffea canephora]
Length=676

 Score =   177 bits (448),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 92/226 (41%), Positives = 140/226 (62%), Gaps = 9/226 (4%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I L+      + D F+  L   M+++FD+YWK C L L+IA I+DPRFKMKLVE+ + +I
Sbjct  438  IHLQLIEWCQNSDDFISSLALKMKQRFDEYWKKCSLALAIAAILDPRFKMKLVEYYYPQI  497

Query  711  YGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGA---VNTQDAQELSTNELG  541
            YG  A   + IV   +  L+  + A+ LPLT     +  GGA   V T     ++ +   
Sbjct  498  YGNSAPDCIDIVSNCMKALYNGH-AVCLPLT----SQGQGGATCQVGTFGTGAINDSRSR  552

Query  540  LTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDIL  364
            LT FD F+ ETS SQ  +S+LD+YLEE L PR  +F ++ WWK++  +YP LS MAR+IL
Sbjct  553  LTGFDKFVNETSQSQNVKSDLDKYLEEPLFPRNVDFSILNWWKVHTPRYPILSTMARNIL  612

Query  363  TVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  226
             +P+S   ++++F+T  + +D+    LR ET++A++C +DW  +EL
Sbjct  613  GIPLSKVSSEALFNTGDRAIDQPWVPLRSETLQAVMCTQDWMSSEL  658



>ref|XP_010272686.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nelumbo nucifera]
Length=664

 Score =   176 bits (446),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/227 (40%), Positives = 139/227 (61%), Gaps = 8/227 (4%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I L+      S D  +  +   M+ KFDKYW +C L L++AVI+DPRFKMKLVE+ + +I
Sbjct  422  IHLQLIEWCKSSDVVISTMGLKMKSKFDKYWSTCNLALAVAVILDPRFKMKLVEYYYPQI  481

Query  711  YGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQEL----STNEL  544
            YG  AS  +++V + I EL+ +Y    +  T   +++  G  V   +        S N  
Sbjct  482  YGSSASERIKVVFDSIKELYNEY---SICSTLASLDQGLGWEVRGNNRFTGTCLPSVNND  538

Query  543  GLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  367
             L+ FD F+ ETS SQ+++S+LD+YLEE + PR  +F+++ WWK++  +YP LS MARD+
Sbjct  539  RLSGFDKFLNETSNSQRAKSDLDKYLEEPVFPRNLDFNILNWWKVHMPRYPILSMMARDV  598

Query  366  LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  226
            L +P++T P  S  S   + +D YR SL P+ ++AL+  +DW Q EL
Sbjct  599  LGIPMATVPLGSTISVGDRVLDPYRSSLNPDILQALISTQDWLQTEL  645



>gb|KHN23048.1| Putative AC transposase [Glycine soja]
Length=672

 Score =   175 bits (444),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/212 (43%), Positives = 133/212 (63%), Gaps = 7/212 (3%)
 Frame = -2

Query  861  SDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVR  682
            S D F+  +   M++KFD+YW  C L L++A ++DPRFKMKLVE+ FS IYG  A  +++
Sbjct  449  SSDNFLSSMALKMKDKFDRYWSKCSLPLAVAAVLDPRFKMKLVEYYFSLIYGSTALEHIK  508

Query  681  IVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMETSS  502
             V +GI ELF  Y      +  T I++ +    ++  +   S+ +  L  FD F+ ETS 
Sbjct  509  EVSDGIKELFNVY-----SICSTMIDQGSALPGSSLPSTSCSSRD-RLKGFDRFLHETSQ  562

Query  501  QQSR-SELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVF  325
             QS  S+LD+YLEE + PR  +F+++ WWK++  +YP LS MARD+L  P+ST   +  F
Sbjct  563  GQSMISDLDKYLEEPIFPRNSDFNILNWWKVHMPRYPILSMMARDVLGTPMSTMAPELAF  622

Query  324  STVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
            ST  + +D  R SL P+T EAL+C +DW QNE
Sbjct  623  STGGRVLDSSRSSLNPDTREALICTQDWLQNE  654



>gb|EPS60750.1| hypothetical protein M569_14050, partial [Genlisea aurea]
Length=647

 Score =   174 bits (442),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 88/223 (39%), Positives = 135/223 (61%), Gaps = 14/223 (6%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I L+        D F+  L   ++  FD+YWK C LI+++A I+DPR+KMKLVE+ + +I
Sbjct  437  IHLKLIEWCQKSDDFISSLALKLKSVFDEYWKKCSLIMAVAAILDPRYKMKLVEYYYPQI  496

Query  711  YGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTD  532
            YG+ A   + IV   +  L+  ++    PL     E  NGGA               LT 
Sbjct  497  YGDSAPECIEIVSNCMKSLYNGHIIYS-PLAAHASE--NGGAAAKDR----------LTG  543

Query  531  FDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            FD F+ ETS SQ ++S+L++YLE+ L PR ++ +++ WWK+N  +YP LS MAR+IL +P
Sbjct  544  FDRFLHETSVSQNTKSDLEKYLEDPLFPRNNDLNILSWWKVNEPRYPVLSMMARNILGIP  603

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  226
            +S   +D+VF T +K +D    +L+ ET++AL+C++DW  NEL
Sbjct  604  ISKVSSDAVFDTGNKPIDHCWATLKSETLQALMCSQDWLHNEL  646



>ref|XP_011045538.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Populus euphratica]
 ref|XP_011045539.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Populus euphratica]
 ref|XP_011045541.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Populus euphratica]
Length=673

 Score =   174 bits (441),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 128/211 (61%), Gaps = 9/211 (4%)
 Frame = -2

Query  855  DPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVRIV  676
            D F+  +   M+ KFDKYW  C L L++A I+DPRFKMKLVE+ +S+IYG  A   ++ V
Sbjct  453  DDFLSSMASKMKAKFDKYWSKCSLALAVAAILDPRFKMKLVEYYYSQIYGSTALDRIKEV  512

Query  675  DEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELG-LTDFDAFIMETSSQ  499
             +GI ELF  Y      +  T ++E  G A+        ST+    L  FD F+ E+S  
Sbjct  513  SDGIKELFNAY-----SICSTLVDE--GSALPGSSLPSTSTDSRDRLKGFDKFLHESSQG  565

Query  498  QSR-SELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFS  322
            QS  S+LD+YLEE + PR  +F+++ WWK++  +YP LS MARDIL  PVST   +  F 
Sbjct  566  QSAISDLDKYLEEPVFPRNCDFNILNWWKVHTPRYPILSMMARDILGTPVSTVSPELAFG  625

Query  321  TVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
               + +D YR SL P+T +AL+C +DW + E
Sbjct  626  VGGRVLDSYRSSLNPDTRQALICTRDWLRVE  656



>emb|CAN68697.1| hypothetical protein VITISV_042570 [Vitis vinifera]
Length=1068

 Score =   176 bits (447),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/215 (40%), Positives = 139/215 (65%), Gaps = 6/215 (3%)
 Frame = -2

Query  864  VSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYV  685
            +  +  V  +  SM EKFDKYW  C ++++IAV++DPR+KMK++EF F  +YG +AS+ +
Sbjct  486  ICSNEVVSTMASSMLEKFDKYWSGCHIVMAIAVVLDPRYKMKILEFYFPIMYGSEASSEI  545

Query  684  RIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELG-LTDFDAFIMET  508
              + +  ++L  +Y +     +    + ++ GA +  +  EL+ +E   L+ FD F+  T
Sbjct  546  GKIRQLCYDLLSEYQSK----SKMGQQTSSHGASSVSNLFELTYDEQDPLSKFDLFVHST  601

Query  507  SSQ-QSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADS  331
            S +  ++SELD YLEE++LPR+ +FDV+ WWK N +KYPTL  + RDI  +PVST  ++S
Sbjct  602  SEEGHAKSELDYYLEETVLPRISDFDVLSWWKTNGIKYPTLQMIVRDIYAIPVSTVASES  661

Query  330  VFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  226
             FST  + + ++R  L P T+EAL+CA+ W  NE+
Sbjct  662  AFSTGGRMVSKHRSRLHPNTLEALMCAQSWLGNEM  696



>emb|CAN80126.1| hypothetical protein VITISV_013417 [Vitis vinifera]
Length=1266

 Score =   176 bits (447),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/215 (40%), Positives = 139/215 (65%), Gaps = 6/215 (3%)
 Frame = -2

Query  864  VSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYV  685
            +  +  V  +  SM EKFDKYW  C ++++IAV++DPR+KMK++EF F  +YG +AS+ +
Sbjct  514  ICSNEVVSTMASSMLEKFDKYWSGCHIVMAIAVVLDPRYKMKILEFYFPIMYGSEASSEI  573

Query  684  RIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELG-LTDFDAFIMET  508
              + +  ++L  +Y +     +    + ++ GA +  +  EL+ +E   L+ FD F+  T
Sbjct  574  GKIRQLCYDLLSEYQSK----SKMGQQTSSHGASSVSNLFELTYDEQDPLSKFDLFVHST  629

Query  507  SSQ-QSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADS  331
            S +  ++SELD YLEE++LPR+ +FDV+ WWK N +KYPTL  + RDI  +PVST  ++S
Sbjct  630  SEEGHAKSELDYYLEETVLPRISDFDVLSWWKTNGIKYPTLQMIVRDIYAIPVSTVASES  689

Query  330  VFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  226
             FST  + + ++R  L P T+EAL+CA+ W  NE+
Sbjct  690  AFSTGGRMVSKHRSRLHPNTLEALMCAQSWLGNEM  724



>ref|XP_009610280.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nicotiana tomentosiformis]
 ref|XP_009610281.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nicotiana tomentosiformis]
 ref|XP_009610282.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nicotiana tomentosiformis]
Length=675

 Score =   172 bits (436),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 92/225 (41%), Positives = 130/225 (58%), Gaps = 7/225 (3%)
 Frame = -2

Query  855  DPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVRIV  676
            D F+  +   M+EKFDKYW  C L L+IA I+DPRFKMKLVE+ + +IYG DAS  ++ +
Sbjct  452  DNFLSDIALKMKEKFDKYWSKCSLTLAIAAILDPRFKMKLVEYYYPQIYGSDASNQIKEI  511

Query  675  DEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMETSSQQ  496
             + I EL  +Y      L P        G   +  +    T +  L  FD F+ ETS   
Sbjct  512  SDAIRELSNEYAMGSSSLDPD-----TAGTSGSLTSISSGTRD-RLRGFDKFLHETSQNH  565

Query  495  S-RSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFST  319
            +  S L++YLEE + PR ++F ++ WWK++  +YPTLS MARDIL VP ST   +  F+ 
Sbjct  566  NITSNLEKYLEEPVFPRNYDFSILNWWKVHTPRYPTLSMMARDILGVPASTLGPEVAFNN  625

Query  318  VHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEVPI  184
              K +D+ R SL P   EALVC +DW + E  ++ +  I   VP+
Sbjct  626  RGKVLDQDRSSLNPAAREALVCGQDWLRVETEETNSPHIYTAVPL  670



>ref|XP_006370067.1| hypothetical protein POPTR_0001s39240g [Populus trichocarpa]
 gb|ERP66636.1| hypothetical protein POPTR_0001s39240g [Populus trichocarpa]
Length=673

 Score =   172 bits (435),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 128/211 (61%), Gaps = 9/211 (4%)
 Frame = -2

Query  855  DPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVRIV  676
            D F+  +   M+ KFDKYW  C L L++A I+DPRFKMKLVE+ +S+IYG  A   ++ V
Sbjct  453  DDFLSSIASKMKAKFDKYWSKCSLALAVAAILDPRFKMKLVEYYYSQIYGSTALDRIKEV  512

Query  675  DEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELG-LTDFDAFIMETSSQ  499
             +GI ELF  Y      +  T +++  G A+        ST+    L  FD F+ E+S  
Sbjct  513  SDGIKELFNAY-----SICSTLVDQ--GSALPGSSLPSTSTDSRDRLKGFDKFLHESSQG  565

Query  498  QSR-SELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFS  322
            QS  S+LD+YLEE + PR  +F+++ WWK++  +YP LS MARDIL  P+ST   +  F 
Sbjct  566  QSSISDLDKYLEEPVFPRNCDFNILNWWKVHTPRYPILSMMARDILGTPMSTVSPELAFG  625

Query  321  TVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
               + +D YR SL P+T +AL+C +DW + E
Sbjct  626  VGGRVLDSYRSSLNPDTRQALICTRDWLRVE  656



>ref|XP_007213601.1| hypothetical protein PRUPE_ppa002416mg [Prunus persica]
 gb|EMJ14800.1| hypothetical protein PRUPE_ppa002416mg [Prunus persica]
Length=675

 Score =   172 bits (435),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 90/213 (42%), Positives = 131/213 (62%), Gaps = 7/213 (3%)
 Frame = -2

Query  861  SDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVR  682
            S D F+  +   M+ KFDKYW  C L L++A I+DPRFKMKLVE+ +S+IYG  A   ++
Sbjct  449  SPDDFLSCMALKMKAKFDKYWSKCSLALAVAAILDPRFKMKLVEYYYSQIYGSTALDRIK  508

Query  681  IVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMETS-  505
             V +GI ELF  Y      +  T +++ +    ++  +    T +  L  FD F+ ETS 
Sbjct  509  EVSDGIKELFDAY-----SICSTMVDQGSALPGSSLPSTSSDTRD-RLKGFDKFLYETSQ  562

Query  504  SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVF  325
            SQ   S+LD+YLEE + PR  +F+++ WWK++  +YP LS MARD+L  P+ST   +S F
Sbjct  563  SQNVISDLDKYLEEPVFPRNCDFNILNWWKVHTPRYPILSMMARDVLGTPMSTVAPESAF  622

Query  324  STVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  226
            S   + +D+ R SL P+  +ALVC +DW Q EL
Sbjct  623  SIGGRVLDQCRSSLNPDIRQALVCTQDWLQVEL  655



>ref|XP_011076819.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
 ref|XP_011076827.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
 ref|XP_011076835.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
Length=670

 Score =   171 bits (432),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/223 (39%), Positives = 138/223 (62%), Gaps = 10/223 (4%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I L+        D F+  L   ++ KFD+YWK C LI++IA I+DPRFKMKLVE+ + +I
Sbjct  437  IHLQLIEWCQKSDDFISSLALKLKSKFDEYWKKCSLIMAIAAILDPRFKMKLVEYYYPQI  496

Query  711  YGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTD  532
            YG+ A   + IV   +  L+  + A+  PL       A+G +  ++ +  +  + L  T 
Sbjct  497  YGDSAPDCIDIVSNCMRALYSGH-AIYSPLA------AHGQSSASESSGSIVKDRL--TG  547

Query  531  FDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            FD F+ ETS SQ ++S+LD+YLEE   PR  +F ++ WWK++  +YP LS MAR+IL +P
Sbjct  548  FDRFLHETSLSQNTKSDLDKYLEEPFFPRSVDFSILNWWKVHEPRYPVLSMMARNILGIP  607

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  226
            +S    +S+F T  + +D    SL+ +T++AL+C++DW +NEL
Sbjct  608  ISKVAQESLFDTGDRALDHCWSSLKSDTLQALMCSQDWMRNEL  650



>ref|XP_009376729.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Pyrus x bretschneideri]
Length=677

 Score =   170 bits (431),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/228 (41%), Positives = 133/228 (58%), Gaps = 9/228 (4%)
 Frame = -2

Query  861  SDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVR  682
            S D F+  +   M+ KFDKYW  C L L++A I+DPRFKMKLVE+ +S+IYG  A   ++
Sbjct  448  SPDEFLSSMALKMKAKFDKYWSKCSLALAVAAILDPRFKMKLVEYYYSQIYGSTALDRIK  507

Query  681  IVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELG-LTDFDAFIMETS  505
             V +G+ ELF  Y      +  T +++  G A+        ST+    L  FD F+ ETS
Sbjct  508  EVSDGLKELFDAY-----SICSTMVDQ--GSALPGSSLPSTSTDSRDRLKGFDKFLYETS  560

Query  504  -SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSV  328
             SQ   S+LD+YLEE + PR  +F+++ WWK++  +YP LS MARD+L  P+ST   +S 
Sbjct  561  QSQNMISDLDKYLEEPVFPRNCDFNILNWWKVHTPRYPILSMMARDVLGTPMSTVAPESA  620

Query  327  FSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEVPI  184
            F    + +D  R SL P+  EALVC +DW + EL  + T       PI
Sbjct  621  FDIGGRVLDECRSSLNPDIREALVCTQDWLRVELKDANTLSSHSARPI  668



>ref|XP_010675272.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010675273.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Beta vulgaris subsp. vulgaris]
Length=671

 Score =   170 bits (431),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/227 (38%), Positives = 137/227 (60%), Gaps = 9/227 (4%)
 Frame = -2

Query  861  SDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVR  682
            S D  +  +   M+ KFD YWK C L L+IA I+DPRFKMKLVE+ + +IYG  A   ++
Sbjct  448  SSDECIRSMALKMKAKFDIYWKKCSLSLAIAAILDPRFKMKLVEYYYPQIYGSSAEDNIK  507

Query  681  IVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMETS-  505
             V +GI ELF +Y    + ++  +   ++ G + +     L         FD F+ ETS 
Sbjct  508  EVSDGIRELFDEYSIGSVSVSVDHGVGSSNGGIGSDSRDRLK-------GFDKFLHETSQ  560

Query  504  SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVF  325
             + + S+L++YLEE + PR ++F++  WWK++  +YP LS MA+D+L VP+ST   +  F
Sbjct  561  GKNAVSDLEKYLEEPVFPRNYDFNIFTWWKVHTPRYPILSMMAQDVLGVPMSTVAPELAF  620

Query  324  STVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEVPI  184
             T  + +D+YR SL  +TV+AL+C +DW + E+ +S + P    VP+
Sbjct  621  RTGGRVLDQYRSSLSSDTVQALICTQDWLRTEVEES-SPPGHSAVPL  666



>ref|XP_006377715.1| hypothetical protein POPTR_0011s10500g [Populus trichocarpa]
 gb|ERP55512.1| hypothetical protein POPTR_0011s10500g [Populus trichocarpa]
Length=673

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/211 (42%), Positives = 127/211 (60%), Gaps = 9/211 (4%)
 Frame = -2

Query  855  DPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVRIV  676
            D F+  +   M+ KFD+YW  C L L++A I+DPRFKMKLVE+ +S+IYG  A   ++ V
Sbjct  453  DDFLSSMASKMKAKFDRYWSKCSLALAVAAILDPRFKMKLVEYYYSQIYGSTALDRIKEV  512

Query  675  DEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELG-LTDFDAFIMETSSQ  499
             +GI ELF  Y      +  T +++  G  +        ST+    L  FD F+ E+S  
Sbjct  513  SDGIKELFNAY-----SICSTLVDQ--GSTLPGSSLPSTSTDSRDRLKGFDKFLHESSQG  565

Query  498  QSR-SELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFS  322
            QS  S+LD+YLEE + PR  +F+++ WWK++  +YP LS MARDIL  P+ST   +  F 
Sbjct  566  QSAISDLDKYLEEPVFPRNCDFNILNWWKVHTPRYPILSMMARDILGTPMSTIAPELAFG  625

Query  321  TVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
               + +D YR SL P+T +AL+C +DW Q E
Sbjct  626  VGGRVLDSYRSSLNPDTRQALICTRDWLQVE  656



>ref|XP_010327109.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Solanum lycopersicum]
Length=676

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/225 (39%), Positives = 130/225 (58%), Gaps = 7/225 (3%)
 Frame = -2

Query  855  DPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVRIV  676
            D F+  +   M+EKFD+YW  C L L+IA I+DPRFKMKLVE+ + +IY  DA   ++ +
Sbjct  453  DNFLSDIALKMKEKFDRYWSKCSLTLAIAAILDPRFKMKLVEYYYPQIYDSDAPNQIKAI  512

Query  675  DEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMETSSQQ  496
             + I EL  +Y      L P        GA  +  +  + T +  L  FD F+ ETS   
Sbjct  513  SDAIRELSNEYAMGSSSLDPD-----TAGASGSLASTTIGTRD-RLRGFDKFLHETSHNH  566

Query  495  S-RSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFST  319
            +  S+LD+YLEE + PR ++F ++ WWK++  +YP LS MARDIL VP ST   +  F+ 
Sbjct  567  NMTSDLDKYLEEPVFPRNYDFSILNWWKVHTPRYPILSMMARDILGVPASTLGPELAFNN  626

Query  318  VHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEVPI  184
              + +D +R SL P+  EAL+C +DW + E  +  +  I   VP+
Sbjct  627  RGRVLDYHRSSLNPDAREALICGQDWLRMESEEYNSPHIYTAVPL  671



>ref|XP_011082939.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
 ref|XP_011082940.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
 ref|XP_011082941.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
Length=670

 Score =   169 bits (429),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/223 (39%), Positives = 137/223 (61%), Gaps = 10/223 (4%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I L+        D F+  L   ++ KFD+YWK C LI++IA I+DPRFKMKLVE+ + +I
Sbjct  437  IHLQLIEWCQKSDDFISSLALKLKSKFDEYWKKCSLIMAIAAILDPRFKMKLVEYYYPQI  496

Query  711  YGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTD  532
            YG+ A   + IV   +  L+  + A+  PL       A+G +  ++ +     + L  T 
Sbjct  497  YGDSAPDCIDIVSNCMRALYSGH-AIYSPLA------AHGQSSASESSGSTVKDRL--TG  547

Query  531  FDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            FD F+ ETS SQ ++S+LD+YLEE   PR  +F ++ WWK++  +YP LS MAR+IL +P
Sbjct  548  FDRFLHETSLSQNTKSDLDKYLEEPFFPRSVDFSILNWWKVHEPRYPVLSMMARNILGIP  607

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  226
            +S    +S+F T  + +D    SL+ +T++AL+C++DW +NEL
Sbjct  608  ISKVAQESLFDTGDRALDHCWSSLKSDTLQALMCSQDWMRNEL  650



>ref|XP_009783770.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Nicotiana sylvestris]
Length=675

 Score =   169 bits (428),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/225 (40%), Positives = 128/225 (57%), Gaps = 7/225 (3%)
 Frame = -2

Query  855  DPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVRIV  676
            D F+  +   M+EKFDKYW  C   L++A I+DPRFKMKLVE+ + +IYG DAS  ++ +
Sbjct  452  DNFLSDIALKMKEKFDKYWSKCSSTLAVAAILDPRFKMKLVEYYYPQIYGSDASNQIKEI  511

Query  675  DEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMETSSQQ  496
             + I EL  +Y      L P      +G   N       S     L  FD F+ ETS   
Sbjct  512  SDAIRELSNEYAMGSSSLDPD-TAGTSGSLTNIS-----SGTRDRLRGFDKFLHETSQNH  565

Query  495  S-RSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFST  319
            +  S+L++YLEE + PR ++F ++ WWK++  +YP LS MARDIL VP ST   +  F+ 
Sbjct  566  NITSDLEKYLEEPVFPRNYDFSILNWWKVHTPRYPILSMMARDILGVPASTLGPEVAFNN  625

Query  318  VHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEVPI  184
              K +D+ R SL P   EALVC +DW + E  ++ +  I   VP+
Sbjct  626  RGKVLDQDRSSLNPAAREALVCGQDWLRTETEETNSPHIYTAVPL  670



>ref|XP_011098171.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
 ref|XP_011098172.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
 ref|XP_011098173.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
 ref|XP_011098174.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Sesamum indicum]
Length=684

 Score =   169 bits (428),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 88/212 (42%), Positives = 130/212 (61%), Gaps = 7/212 (3%)
 Frame = -2

Query  861  SDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVR  682
            S D F+  +   M+ KFD YW  C ++L+IA I+DPRFKMKLVE+ F +IYG  A   ++
Sbjct  459  SPDEFLSSVALKMKLKFDVYWSKCSMVLAIAAILDPRFKMKLVEYYFQQIYGSAAPCRIK  518

Query  681  IVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMETSS  502
             V  G+ ELF +Y      +  +  +E +G   +   +   S+ +  L  FD F+ ETS 
Sbjct  519  EVSAGLRELFNEY-----SMASSSPDEDSGLPGSCLPSSSNSSRD-KLKGFDKFLFETSQ  572

Query  501  QQS-RSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVF  325
             QS  S+LD+YLEE + PR ++F ++ WWK++  +YP LS MARD+L +PVST   +  F
Sbjct  573  SQSMSSDLDKYLEEPVFPRNYDFSILNWWKVHTPRYPILSMMARDVLGIPVSTLGPEVAF  632

Query  324  STVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
            S   + +D+Y  SL P+T EAL+C +DW + E
Sbjct  633  SNGGRVLDQYHSSLSPDTREALLCGQDWLRME  664



>ref|XP_011044575.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Populus euphratica]
 ref|XP_011044576.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Populus euphratica]
Length=673

 Score =   169 bits (427),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 86/210 (41%), Positives = 128/210 (61%), Gaps = 7/210 (3%)
 Frame = -2

Query  855  DPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVRIV  676
            D F+  +   M+ KFD+YW  C L L++A I+DPRFKMKLVE+ +S+IYG  A   ++ V
Sbjct  453  DDFLSSMASKMKAKFDRYWSKCSLALAVAAILDPRFKMKLVEYYYSQIYGSTALDRIKEV  512

Query  675  DEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMETSSQQ  496
             +GI ELF  Y      +  T +++ +    ++  +    + +  L  FD F+ E+S  Q
Sbjct  513  SDGIKELFNAY-----SICSTLVDQGSTLPGSSLPSTSSDSRD-RLKGFDKFLHESSQGQ  566

Query  495  SR-SELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFST  319
            S  S+LD+YLEE + PR  +F+++ WWK++  +YP LS MARDIL  P+ST   D  F  
Sbjct  567  SAISDLDKYLEEPVFPRNCDFNILNWWKVHTPRYPILSMMARDILGTPMSTIAPDLAFGV  626

Query  318  VHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
              + +D YR SL P+T +AL+C +DW Q E
Sbjct  627  GGRVLDSYRSSLNPDTRQALICTRDWLQVE  656



>ref|XP_011654029.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Cucumis sativus]
 ref|XP_011654030.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Cucumis sativus]
Length=673

 Score =   167 bits (424),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/216 (39%), Positives = 130/216 (60%), Gaps = 13/216 (6%)
 Frame = -2

Query  861  SDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVR  682
            S D F+  L   ++ K+DKYW  C L L++A ++DPRFKMKLVE+ +S+IYG  A   ++
Sbjct  448  SSDSFLNSLASKIKAKYDKYWSKCSLALAVAAVLDPRFKMKLVEYYYSQIYGSMALDRIK  507

Query  681  IVDEGIHELFQDY-VALPLPLTPTYIEEAN--GGAVNTQDAQELSTNELGLTDFDAFIME  511
             V +GI EL+  Y +   + +  + +  +   G    ++D          L  FD F+ E
Sbjct  508  EVSDGIKELYDQYSICFSMVVQGSTLHGSGLPGTGNESRDR---------LKGFDKFLHE  558

Query  510  TSSQQS-RSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPAD  334
            TS  QS  S+LD+YLEE + PR  +F+++ WW ++  +YP LS MARD++  P+S+   +
Sbjct  559  TSQSQSVMSDLDKYLEEPVFPRNCDFNILNWWNVHTPRYPILSMMARDVIGTPMSSIVPE  618

Query  333  SVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  226
              F T  + +DRYR SL P+T +AL+CA+DW   EL
Sbjct  619  FAFCTTGRVLDRYRSSLSPDTRQALICAQDWLCIEL  654



>gb|KJB27004.1| hypothetical protein B456_004G271300 [Gossypium raimondii]
 gb|KJB27005.1| hypothetical protein B456_004G271300 [Gossypium raimondii]
Length=672

 Score =   167 bits (424),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 88/218 (40%), Positives = 127/218 (58%), Gaps = 27/218 (12%)
 Frame = -2

Query  861  SDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVR  682
            S D F+  L   M+ KFDKYW  C L L++A I+DPRFKMKLVE+ +S+IYG  A   ++
Sbjct  447  SPDNFLSSLAAKMKAKFDKYWSKCSLSLAVAAILDPRFKMKLVEYYYSQIYGSTALERIK  506

Query  681  IVDEGIHELFQDYV----------ALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTD  532
             V +G+ ELF  Y           ALPL   P+          ++ D ++       L  
Sbjct  507  EVSDGLKELFNTYSICSTLMDQGSALPLGSLPS----------SSNDGRD------RLKG  550

Query  531  FDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            FD F+ ETS SQ + S+L++YL+E + PR   F+++ WW+++  +YP LS MARD+L  P
Sbjct  551  FDKFLHETSQSQTAISDLEKYLDEPVFPRNCNFNILNWWRVHTPRYPILSMMARDVLGTP  610

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            +ST   +S F    + +D  RC L PET +AL+C +DW
Sbjct  611  MSTVSQESAFHAGGRVLDSCRCPLTPETQQALICTQDW  648



>ref|XP_009596751.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
3-like [Nicotiana tomentosiformis]
 ref|XP_009596752.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
3-like [Nicotiana tomentosiformis]
Length=226

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 124/212 (58%), Gaps = 11/212 (5%)
 Frame = -2

Query  816  KFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYVA  637
            KF KYW    +++ +A   D R+KM+LVEF    IYGE+AST ++ V    ++LFQDY +
Sbjct  7    KFKKYWDDVHILMGVAASFDLRYKMRLVEFFLPLIYGEEASTKIQEVRSNCYDLFQDYKS  66

Query  636  -LPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMETSSQ-QSRSELDQYLEE  463
             L  P         +  A ++ +    +  +  L+ FD F+  T +  + RSELD YLEE
Sbjct  67   KLSAP--------HDSLASSSSEVTSFTQGD-RLSSFDRFVASTGATVEKRSELDMYLEE  117

Query  462  SLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSL  283
             LLPR   FD + WWK N  K+PTL KMARD+L +PVST  ++S FST  + +  +R  L
Sbjct  118  DLLPRTPSFDNLSWWKTNGWKFPTLQKMARDLLAIPVSTVASESAFSTSGRLISPHRSRL  177

Query  282  RPETVEALVCAKDWQQNELVKSITAPIKMEVP  187
             P T+EAL+CA+ W  N+L+   +   K+  P
Sbjct  178  HPTTLEALMCARTWLWNDLIGLTSTIDKVSCP  209



>ref|XP_009601856.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana tomentosiformis]
Length=220

 Score =   158 bits (400),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 89/218 (41%), Positives = 127/218 (58%), Gaps = 16/218 (7%)
 Frame = -2

Query  837  LTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVRIVDEGIHE  658
            +T SM  KF KYW    ++L +A I DPR+KMK+V+F  ++IYGE AS       + I E
Sbjct  1    MTTSMLLKFKKYWDDIHILLGVATIFDPRYKMKVVKFYLAQIYGEKASL------DKIQE  54

Query  657  LFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMETSSQ-QSRSEL  481
            + ++Y +  L  T     +A+   V   D   LS+       FD F+  + +   +RSEL
Sbjct  55   VRKEYQSRAL--TSHESSQASNEVVGIVDGDRLSS-------FDQFVASSRANVDTRSEL  105

Query  480  DQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMD  301
            D YLEESLLPR   FD + WWK N +K+ TL KMARD+L +PVST  ++S FST  + + 
Sbjct  106  DVYLEESLLPRTPSFDSLSWWKTNGLKFSTLQKMARDLLAIPVSTVTSESAFSTSGRLIS  165

Query  300  RYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEVP  187
             +R  L P T+EAL+CA+ W  NE+    ++  K+  P
Sbjct  166  PHRSRLYPTTLEALMCARTWLWNEINGLTSSVDKVSCP  203



>ref|XP_010256082.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X2 [Nelumbo nucifera]
Length=679

 Score =   167 bits (422),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/227 (39%), Positives = 135/227 (59%), Gaps = 11/227 (5%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I L+      S  PF+  +   ++EKFDKYW+   L+L+IA+++DPRFKM++VE+ ++KI
Sbjct  425  INLKLQEWGRSGHPFLRSMAFKIKEKFDKYWEDNNLVLAIAIVLDPRFKMQIVEYYYNKI  484

Query  711  YGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEE--ANGGAVNTQ----DAQELSTN  550
            YG +A  Y+  V   I +L+ +Y      L P+  +   A  G+ N         E S N
Sbjct  485  YGFEADKYISRVRTAIFDLYMEYGGELRDLLPSQSQASLAESGSSNLSLRFGFEVEASDN  544

Query  549  ELGLTDFDAFIMETSSQQ----SRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSK  382
            E  L DFD + +++        ++SELD YLEE+L PR  +FD++G+WKL  +K P LS 
Sbjct  545  E-ELADFDKWCIDSGIASNIALTKSELDVYLEENLFPRSKDFDILGYWKLYHLKRPKLSA  603

Query  381  MARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            MARDIL +P +T  ++  F+T  + + +Y   LRPE +EAL+C + W
Sbjct  604  MARDILAIPATTIASEEAFNTSARAIHKYHTCLRPEVIEALMCGQSW  650



>ref|XP_010256080.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X1 [Nelumbo nucifera]
 ref|XP_010256081.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X1 [Nelumbo nucifera]
Length=680

 Score =   166 bits (421),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/227 (39%), Positives = 135/227 (59%), Gaps = 11/227 (5%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I L+      S  PF+  +   ++EKFDKYW+   L+L+IA+++DPRFKM++VE+ ++KI
Sbjct  425  INLKLQEWGRSGHPFLRSMAFKIKEKFDKYWEDNNLVLAIAIVLDPRFKMQIVEYYYNKI  484

Query  711  YGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEE--ANGGAVNTQ----DAQELSTN  550
            YG +A  Y+  V   I +L+ +Y      L P+  +   A  G+ N         E S N
Sbjct  485  YGFEADKYISRVRTAIFDLYMEYGGELRDLLPSQSQASLAESGSSNLSLRFGFEVEASDN  544

Query  549  ELGLTDFDAFIMETSSQQ----SRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSK  382
            E  L DFD + +++        ++SELD YLEE+L PR  +FD++G+WKL  +K P LS 
Sbjct  545  E-ELADFDKWCIDSGIASNIALTKSELDVYLEENLFPRSKDFDILGYWKLYHLKRPKLSA  603

Query  381  MARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            MARDIL +P +T  ++  F+T  + + +Y   LRPE +EAL+C + W
Sbjct  604  MARDILAIPATTIASEEAFNTSARAIHKYHTCLRPEVIEALMCGQSW  650



>ref|XP_007021998.1| BED zinc finger,hAT family dimerization domain isoform 1 [Theobroma 
cacao]
 ref|XP_007021999.1| BED zinc finger,hAT family dimerization domain isoform 1 [Theobroma 
cacao]
 ref|XP_007022000.1| BED zinc finger,hAT family dimerization domain isoform 1 [Theobroma 
cacao]
 gb|EOY13523.1| BED zinc finger,hAT family dimerization domain isoform 1 [Theobroma 
cacao]
 gb|EOY13524.1| BED zinc finger,hAT family dimerization domain isoform 1 [Theobroma 
cacao]
 gb|EOY13525.1| BED zinc finger,hAT family dimerization domain isoform 1 [Theobroma 
cacao]
Length=672

 Score =   166 bits (421),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 127/208 (61%), Gaps = 7/208 (3%)
 Frame = -2

Query  861  SDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVR  682
            S D F+  L   M+ KFDKYW  C L L++A I+DPRFKMKLVE+ +S+IYG  A   ++
Sbjct  447  SPDNFLSSLAAKMKAKFDKYWSKCSLALAVAAILDPRFKMKLVEYYYSQIYGSTALERIK  506

Query  681  IVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMETSS  502
             V +GI ELF  Y      +  T I+E      ++  +    + +  L  FD F+ ET+ 
Sbjct  507  EVSDGIKELFNAY-----SICSTLIDEGTALPGSSLPSSSNDSRD-RLKGFDKFLHETAQ  560

Query  501  QQSR-SELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVF  325
             QS  S+L++YLEE++ PR  +F+++ WW+++  +YP LS MARD+L  P+ST   +S F
Sbjct  561  SQSAISDLEKYLEEAVFPRNCDFNILNWWRVHTPRYPILSMMARDVLGTPMSTVAQESAF  620

Query  324  STVHKEMDRYRCSLRPETVEALVCAKDW  241
            +   + +D  R SL  +T +AL+C +DW
Sbjct  621  NAGGRVLDSCRSSLTADTRQALICTRDW  648



>ref|XP_007022001.1| BED zinc finger,hAT family dimerization domain isoform 4 [Theobroma 
cacao]
 ref|XP_007022003.1| BED zinc finger,hAT family dimerization domain isoform 4 [Theobroma 
cacao]
 gb|EOY13526.1| BED zinc finger,hAT family dimerization domain isoform 4 [Theobroma 
cacao]
 gb|EOY13528.1| BED zinc finger,hAT family dimerization domain isoform 4 [Theobroma 
cacao]
Length=689

 Score =   166 bits (420),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 127/208 (61%), Gaps = 7/208 (3%)
 Frame = -2

Query  861  SDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVR  682
            S D F+  L   M+ KFDKYW  C L L++A I+DPRFKMKLVE+ +S+IYG  A   ++
Sbjct  447  SPDNFLSSLAAKMKAKFDKYWSKCSLALAVAAILDPRFKMKLVEYYYSQIYGSTALERIK  506

Query  681  IVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMETSS  502
             V +GI ELF  Y      +  T I+E      ++  +    + +  L  FD F+ ET+ 
Sbjct  507  EVSDGIKELFNAY-----SICSTLIDEGTALPGSSLPSSSNDSRD-RLKGFDKFLHETAQ  560

Query  501  QQSR-SELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVF  325
             QS  S+L++YLEE++ PR  +F+++ WW+++  +YP LS MARD+L  P+ST   +S F
Sbjct  561  SQSAISDLEKYLEEAVFPRNCDFNILNWWRVHTPRYPILSMMARDVLGTPMSTVAQESAF  620

Query  324  STVHKEMDRYRCSLRPETVEALVCAKDW  241
            +   + +D  R SL  +T +AL+C +DW
Sbjct  621  NAGGRVLDSCRSSLTADTRQALICTRDW  648



>ref|XP_011460829.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Fragaria vesca subsp. vesca]
 ref|XP_011460830.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Fragaria vesca subsp. vesca]
Length=675

 Score =   166 bits (420),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 89/214 (42%), Positives = 131/214 (61%), Gaps = 9/214 (4%)
 Frame = -2

Query  861  SDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVR  682
            S D F+  +   M++KFDKYW  C L L++AVI+DPRFKMKLVE+ +S+IYG  +   ++
Sbjct  449  SPDDFLRSMALKMKDKFDKYWSKCSLALAVAVILDPRFKMKLVEYYYSQIYGSQSLEKIK  508

Query  681  IVDEGIHELFQDYVALPLPLTPTYIEEANGGAV-NTQDAQELSTNELGLTDFDAFIMETS  505
             V +GI ELF  Y      +  T +++  G A+  +      S     L  FD F+ ETS
Sbjct  509  DVSDGIKELFDAY-----SICSTMVDQ--GSALPGSSLPSTCSDPRDRLKGFDKFLYETS  561

Query  504  -SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSV  328
             SQ   S+L++YL+E   PR  +F+++ WWK++  +YP LS MARD+L  P+ST   +S 
Sbjct  562  QSQNVSSDLEKYLQEPNFPRNCDFNILNWWKVHTPRYPILSMMARDVLGTPMSTIARESA  621

Query  327  FSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  226
            FS   + +D+ R  L P+T EAL+C +DW Q E+
Sbjct  622  FSIDGRVLDKCRSLLNPDTREALICTQDWLQMEV  655



>gb|KGN55034.1| hypothetical protein Csa_4G624400 [Cucumis sativus]
Length=871

 Score =   167 bits (423),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 85/216 (39%), Positives = 130/216 (60%), Gaps = 13/216 (6%)
 Frame = -2

Query  861  SDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVR  682
            S D F+  L   ++ K+DKYW  C L L++A ++DPRFKMKLVE+ +S+IYG  A   ++
Sbjct  646  SSDSFLNSLASKIKAKYDKYWSKCSLALAVAAVLDPRFKMKLVEYYYSQIYGSMALDRIK  705

Query  681  IVDEGIHELFQDY-VALPLPLTPTYIEEAN--GGAVNTQDAQELSTNELGLTDFDAFIME  511
             V +GI EL+  Y +   + +  + +  +   G    ++D          L  FD F+ E
Sbjct  706  EVSDGIKELYDQYSICFSMVVQGSTLHGSGLPGTGNESRDR---------LKGFDKFLHE  756

Query  510  TSSQQS-RSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPAD  334
            TS  QS  S+LD+YLEE + PR  +F+++ WW ++  +YP LS MARD++  P+S+   +
Sbjct  757  TSQSQSVMSDLDKYLEEPVFPRNCDFNILNWWNVHTPRYPILSMMARDVIGTPMSSIVPE  816

Query  333  SVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  226
              F T  + +DRYR SL P+T +AL+CA+DW   EL
Sbjct  817  FAFCTTGRVLDRYRSSLSPDTRQALICAQDWLCIEL  852



>ref|XP_010060762.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Eucalyptus grandis]
Length=673

 Score =   165 bits (418),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/211 (39%), Positives = 131/211 (62%), Gaps = 9/211 (4%)
 Frame = -2

Query  855  DPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVRIV  676
            D F+  + + M+ KFDKYW  C L L+ AVI+DPRFK+KLVE+ +S+IYG  A   ++ +
Sbjct  451  DDFISKIVQKMKTKFDKYWNKCSLSLAAAVILDPRFKVKLVEYYYSQIYGSTALDRIKEI  510

Query  675  DEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELG-LTDFDAFIMETSSQ  499
             +GI +LF  Y      +  + +++  G A+       + ++    L  FD F+ ETS  
Sbjct  511  SDGIKQLFDAY-----SICSSLVDQ--GSALPGSSLPSMCSDSRDRLKGFDKFLHETSQN  563

Query  498  QSR-SELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFS  322
            QS  S+LD+YLEE + PR  +F+++ WWK++  +YP LS MARD+L  P+ST   +S F+
Sbjct  564  QSGVSDLDKYLEEPVFPRNCDFNILNWWKVHTPRYPILSMMARDVLGTPMSTGSPESTFT  623

Query  321  TVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
            +  + +D+ + SL P+  +AL+C +DW Q E
Sbjct  624  SGPRMLDQVQSSLDPDIHQALICTRDWLQME  654



>ref|XP_011471014.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Fragaria vesca subsp. vesca]
Length=656

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/212 (40%), Positives = 133/212 (63%), Gaps = 5/212 (2%)
 Frame = -2

Query  855  DPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVRIV  676
            D ++  L   M+ KF++YW+ C L L++A ++DPRFKMKLVEF++++I+G  A   +  V
Sbjct  446  DDYISSLAFKMRSKFEEYWQRCSLGLAVAAVLDPRFKMKLVEFNYAQIFGSVAPGRISNV  505

Query  675  DEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMETS-SQ  499
             + + EL+ ++      L      +  GG       ++       LT FD ++ ET+ S+
Sbjct  506  HDCVKELYDEHSISLASLDQGLAWQVGGGPRMPNSGRDSRDR---LTGFDTYLQETTQSE  562

Query  498  QSRSELDQYLEESLLPR-VHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFS  322
             S+S+LD+YLEE L PR    FDV+ WWK++  +YP LS MAR++L +P+S A  DS F+
Sbjct  563  GSKSDLDKYLEEPLFPRNAPGFDVLNWWKVHTPRYPILSMMARNVLGMPMSKASLDSAFN  622

Query  321  TVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  226
            T  + +DR   SL+P T++AL+CA+DW ++EL
Sbjct  623  TGGRVLDRDWSSLKPATIQALMCAQDWIRSEL  654



>ref|XP_009764968.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana sylvestris]
Length=388

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/236 (36%), Positives = 132/236 (56%), Gaps = 8/236 (3%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I+LE      S +P +  +  SM  KF KYW    +++ +A I DPRFKMKLVEF  ++I
Sbjct  146  IKLELEAWVKSLNPLISSMASSMLLKFKKYWDDMHILMGVATIFDPRFKMKLVEFYLAQI  205

Query  711  YGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTD  532
            YGE+    ++ V      LFQ+Y +  +    ++   ++       +   LS+       
Sbjct  206  YGEETLHKIQEVRNHCFNLFQEYTSRVVASHESFQASSSNEVAGVVEGDRLSS-------  258

Query  531  FDAFIMETSSQ-QSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            FD F+  +S+    RSEL+ YLEE +L R   FD + WWK N +K+PTL K+ARD+L +P
Sbjct  259  FDRFVASSSANVDPRSELESYLEEGVLSRTPSFDSLSWWKTNILKFPTLQKIARDLLAIP  318

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEVP  187
            +ST  ++S FST  + +  +R  L P T+EAL+ A+ W  NE+  S ++  ++  P
Sbjct  319  ISTVASESAFSTSGRLISPHRSRLHPTTLEALMYARTWLWNEINGSCSSIDRVSCP  374



>ref|XP_010655772.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Vitis vinifera]
Length=227

 Score =   156 bits (395),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/212 (39%), Positives = 125/212 (59%), Gaps = 20/212 (9%)
 Frame = -2

Query  837  LTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVRIVDEGIHE  658
            +  SM +KFDKYW  C ++++IA I DPR+K+K++EF F  +YG +AS  +  +    +E
Sbjct  1    MASSMLQKFDKYWSGCHIVMAIAAIFDPRYKIKILEFYFPLMYGSEASNEIEKIRGMCYE  60

Query  657  LFQDYVALPLPLTPTYIEEANGGAVNTQDAQ-------ELSTNELG-LTDFDAFIMETSS  502
            L  +Y +           ++N G   +           EL+ +E   L+ FD F+  T+ 
Sbjct  61   LLSEYQS-----------KSNLGQKTSSYGTSSGSTLLELNYDEQDPLSKFDLFVHSTTG  109

Query  501  Q-QSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVF  325
            +  ++SELD YLEES+LPR   FDV+ WWK N +KYPTL  + RDI  +PVS   ++S F
Sbjct  110  ESHTKSELDYYLEESILPRNSNFDVLSWWKTNGIKYPTLQMIVRDIYAIPVSIVASESAF  169

Query  324  STVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
            ST  + + ++R  L P+T+EAL+CA+ W   E
Sbjct  170  STGGRVVSKHRSRLHPDTLEALMCAQSWLWKE  201



>emb|CDY20085.1| BnaA01g29170D [Brassica napus]
Length=675

 Score =   164 bits (414),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 88/223 (39%), Positives = 128/223 (57%), Gaps = 8/223 (4%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I ++      S+D F+  L   M+ KFD+YW  C L+L+IA I+DPRFKMKLVE+ +SKI
Sbjct  444  IHIQLIEWCKSEDSFLSSLAAKMKSKFDEYWNKCSLVLAIAAILDPRFKMKLVEYYYSKI  503

Query  711  YGEDASTYVRIVDEGIHELFQDY-VALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            YG  A   ++ V  G+ EL   Y +   +    ++    +G      DA++       L 
Sbjct  504  YGSTALDRIKEVSNGVKELLDAYSICSAIGDDSSFSGGGSGLGRGGMDARD------RLK  557

Query  534  DFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
             FD F+ ETS +Q + S+LD+YL E + PR  EF+++ +WK++  +YP LS MARDIL  
Sbjct  558  GFDKFLHETSQNQNTTSDLDKYLSEPIFPRSGEFNILNYWKVHTPRYPVLSMMARDILGT  617

Query  357  PVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
            P+S   ADS F +    +D  + SL P+  +AL CA DW   E
Sbjct  618  PMSILGADSAFDSGRPVVDESKSSLNPDIRQALFCAHDWLSTE  660



>ref|XP_007133312.1| hypothetical protein PHAVU_011G169000g [Phaseolus vulgaris]
 gb|ESW05306.1| hypothetical protein PHAVU_011G169000g [Phaseolus vulgaris]
Length=672

 Score =   163 bits (413),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 92/227 (41%), Positives = 137/227 (60%), Gaps = 7/227 (3%)
 Frame = -2

Query  861  SDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVR  682
            S D F+  +   M+ KFDKYW  C L L++A ++DPRFKMKLVE+ +S IYG  A   ++
Sbjct  449  SSDSFLSPMAMKMKAKFDKYWGKCSLALALAAVLDPRFKMKLVEYYYSLIYGSTALERIK  508

Query  681  IVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMETSS  502
             V +GI ELF  Y      +  T I++ +    ++  +   S+ +  L  FD F+ ETS 
Sbjct  509  EVSDGIKELFNAY-----SICSTMIDQGSALPGSSLPSTSCSSRD-RLKGFDRFLHETSQ  562

Query  501  QQS-RSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVF  325
             QS  S+LD+YLEE + PR  +F+++ WWK++  +YP LS MARD+L  P+ST   +  F
Sbjct  563  SQSMTSDLDKYLEEPIFPRNSDFNILNWWKVHMPRYPILSMMARDVLGTPMSTLAPELAF  622

Query  324  STVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEVPI  184
            +T  + +D  R SL P+T EAL+C +DW +NE      +PI   +P+
Sbjct  623  TTGGRVLDSSRSSLNPDTREALICTQDWLRNESGDLNPSPIHSALPL  669



>ref|XP_010551474.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Tarenaya hassleriana]
 ref|XP_010551476.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Tarenaya hassleriana]
 ref|XP_010551477.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Tarenaya hassleriana]
Length=667

 Score =   163 bits (412),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 82/223 (37%), Positives = 134/223 (60%), Gaps = 1/223 (0%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I L     + + D F+  +  +M++KFD++W+   L L+IA I+DPRFKMKL+E+ +  +
Sbjct  442  IHLRLIELSKNPDDFISSMAVNMRKKFDEFWEKSNLALAIASILDPRFKMKLIEYYYPLL  501

Query  711  YGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTD  532
            YG  AS  +  + E I  L+ ++    L ++     +         +          LT+
Sbjct  502  YGASASELIDDISECIKALYNEHTVGSLLVSSEQAFDWQQQQQQQSNGVNGKGFSDRLTE  561

Query  531  FDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            FD +I +T   Q ++S+L++YLEE L PR  +FD++ WW+++  +YP LS MAR++L VP
Sbjct  562  FDRYINDTEPCQDTKSDLEKYLEEPLFPRNSDFDILNWWRVHTPRYPILSMMARNVLAVP  621

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  226
            +ST PA   F T  +++D+   SLRP TV+AL+CA+DW ++EL
Sbjct  622  MSTVPAGHAFGTRLRQVDQNWSSLRPSTVQALMCAQDWIRSEL  664



>gb|KJB45835.1| hypothetical protein B456_007G331900 [Gossypium raimondii]
 gb|KJB45836.1| hypothetical protein B456_007G331900 [Gossypium raimondii]
 gb|KJB45837.1| hypothetical protein B456_007G331900 [Gossypium raimondii]
 gb|KJB45838.1| hypothetical protein B456_007G331900 [Gossypium raimondii]
Length=672

 Score =   163 bits (412),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 127/208 (61%), Gaps = 7/208 (3%)
 Frame = -2

Query  861  SDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVR  682
            S D F+  L   M+ KFDKYW  C L L++A I+DPRFKMKLVE+ +S+IYG  A   ++
Sbjct  447  SSDAFLSSLATKMKAKFDKYWSKCSLGLAVAAILDPRFKMKLVEYYYSQIYGSTALERIK  506

Query  681  IVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMETS-  505
               +GI ELF  Y      +  T I++ +    ++  +    T +  L  FD F+ ETS 
Sbjct  507  EASDGIKELFNAY-----SICSTLIDQGSALPGSSLPSSSNDTRD-KLKGFDKFLHETSQ  560

Query  504  SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVF  325
            SQ + S+L++YL+E + PR  +F+++ WW+++  +YP LS MARD+L  P+ST   +  F
Sbjct  561  SQTAISDLEKYLDEPMFPRNCDFNILNWWRVHTPRYPILSMMARDVLGTPMSTVAQEFAF  620

Query  324  STVHKEMDRYRCSLRPETVEALVCAKDW  241
            +   + +D  + SL P+T +AL+C +DW
Sbjct  621  NAGGRILDSNQSSLPPDTRQALICTRDW  648



>gb|KHG07030.1| Putative AC transposase [Gossypium arboreum]
Length=672

 Score =   163 bits (412),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 127/208 (61%), Gaps = 7/208 (3%)
 Frame = -2

Query  861  SDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVR  682
            S D F+  L   M+ KFDKYW  C L L++A I+DPRFKMKLVE+ +S+IYG  A   ++
Sbjct  447  SSDAFLSSLATKMKAKFDKYWSKCSLALAVAAILDPRFKMKLVEYYYSQIYGSTALERIK  506

Query  681  IVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMETS-  505
               +GI ELF  Y      +  T I++ +    ++  +    T +  L  FD F+ ETS 
Sbjct  507  EASDGIKELFNAY-----SICSTLIDQGSALPGSSLPSSSNDTRD-RLKGFDKFLHETSQ  560

Query  504  SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVF  325
            SQ + S+L++YL+E + PR  +F+++ WW+++  +YP LS MARD+L  P+ST   +  F
Sbjct  561  SQTAISDLEKYLDEPVFPRNCDFNILNWWRVHTPRYPILSMMARDVLGTPMSTIAQEFAF  620

Query  324  STVHKEMDRYRCSLRPETVEALVCAKDW  241
            +   + +D  + SL P+T +AL+C +DW
Sbjct  621  NAGGRMLDSNQSSLPPDTQQALICTRDW  648



>ref|XP_009116606.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Brassica rapa]
 ref|XP_009116614.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Brassica rapa]
 ref|XP_009116622.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Brassica rapa]
 ref|XP_009116629.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Brassica rapa]
Length=675

 Score =   162 bits (409),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/223 (39%), Positives = 127/223 (57%), Gaps = 8/223 (4%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I ++      S+D F+  L   M+ KFD+YW  C  +L+IA I+DPRFKMKLVE+ +SKI
Sbjct  444  IHIQLIEWCKSEDSFLSSLAAKMKSKFDEYWNKCSFVLAIAAILDPRFKMKLVEYYYSKI  503

Query  711  YGEDASTYVRIVDEGIHELFQDY-VALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            YG  A   ++ V  G+ EL   Y +   +    ++    +G      DA++       L 
Sbjct  504  YGSTALDRIKEVSNGVKELLDAYSICSAIGDDSSFSGGGSGLGRGGMDARD------RLK  557

Query  534  DFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTV  358
             FD F+ ETS +Q + S+LD+YL E + PR  EF+++ +WK++  +YP LS MARDIL  
Sbjct  558  GFDKFLHETSQNQNTTSDLDKYLSEPIFPRSGEFNILNYWKVHTPRYPVLSMMARDILGT  617

Query  357  PVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
            P+S   ADS F +    +D  + SL P+  +AL CA DW   E
Sbjct  618  PMSILGADSAFDSGRPVVDDSKSSLNPDIRQALFCAHDWLSTE  660



>ref|XP_006407043.1| hypothetical protein EUTSA_v10020233mg [Eutrema salsugineum]
 gb|ESQ48496.1| hypothetical protein EUTSA_v10020233mg [Eutrema salsugineum]
Length=662

 Score =   162 bits (409),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/222 (39%), Positives = 124/222 (56%), Gaps = 7/222 (3%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I ++      + D F+  L   M+ KFD+YW  C L+L+IA I+DPRFKMKLVE+ +SKI
Sbjct  438  IHIQLIEWCKNQDSFLSSLAAKMKAKFDEYWNKCSLVLAIAAILDPRFKMKLVEYYYSKI  497

Query  711  YGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTD  532
            YG  A   ++ V  G+ EL   Y               +G A  + D ++       L  
Sbjct  498  YGSVALDRIKEVSNGVKELLDAYSMCSSIDGEDSSFSGSGLARGSMDTRD------RLKG  551

Query  531  FDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            FD F+ ETS +Q + S+LD+YL E + PR  EF+++ +WK++  +YP LS MARDIL  P
Sbjct  552  FDKFLHETSQNQNTTSDLDKYLSEPIFPRSGEFNILNYWKVHTPRYPILSMMARDILGTP  611

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
            +S    DS F++    +D  + SL P+  +AL CA DW   E
Sbjct  612  MSILAPDSTFNSGRPVIDESKSSLSPDIRQALFCAHDWLSTE  653



>ref|XP_010253168.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X1 [Nelumbo nucifera]
 ref|XP_010253169.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X1 [Nelumbo nucifera]
Length=684

 Score =   160 bits (406),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 83/221 (38%), Positives = 138/221 (62%), Gaps = 10/221 (5%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I+L       S+  +V  +   M++KFDKYW  CCL+L+IAV++DPRFKM++V + ++ I
Sbjct  433  IKLRLHMWQNSEYQYVRSMAYKMKQKFDKYWDECCLVLAIAVVLDPRFKMEVVTYYYNLI  492

Query  711  YGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTD  532
            YGE+A  ++  V   +++L+ +YV   +      +E+++    + +D       +  L+ 
Sbjct  493  YGENAERHIMRVRLALNDLYLEYVGNDV--GKKSLEDSSSAFPSQRDHDP----DDFLSG  546

Query  531  FDAFIMETSSQ----QSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDIL  364
            FD ++++  S       +SELD YLEE L PR  +FD++ +W+++  K+P LS++ARDIL
Sbjct  547  FDKWLVQERSNYCFGSRKSELDLYLEERLFPRDEDFDILRFWQVDCPKFPKLSRLARDIL  606

Query  363  TVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
             +P+ T  +++ FST  + +D+Y  SL PE VEALVC KDW
Sbjct  607  AIPILTVTSEATFSTKSRIVDQYHTSLLPEIVEALVCGKDW  647



>ref|XP_010253170.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X2 [Nelumbo nucifera]
Length=671

 Score =   160 bits (405),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 83/221 (38%), Positives = 138/221 (62%), Gaps = 10/221 (5%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I+L       S+  +V  +   M++KFDKYW  CCL+L+IAV++DPRFKM++V + ++ I
Sbjct  420  IKLRLHMWQNSEYQYVRSMAYKMKQKFDKYWDECCLVLAIAVVLDPRFKMEVVTYYYNLI  479

Query  711  YGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTD  532
            YGE+A  ++  V   +++L+ +YV   +      +E+++    + +D       +  L+ 
Sbjct  480  YGENAERHIMRVRLALNDLYLEYVGNDV--GKKSLEDSSSAFPSQRDHDP----DDFLSG  533

Query  531  FDAFIMETSSQ----QSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDIL  364
            FD ++++  S       +SELD YLEE L PR  +FD++ +W+++  K+P LS++ARDIL
Sbjct  534  FDKWLVQERSNYCFGSRKSELDLYLEERLFPRDEDFDILRFWQVDCPKFPKLSRLARDIL  593

Query  363  TVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
             +P+ T  +++ FST  + +D+Y  SL PE VEALVC KDW
Sbjct  594  AIPILTVTSEATFSTKSRIVDQYHTSLLPEIVEALVCGKDW  634



>gb|EYU28909.1| hypothetical protein MIMGU_mgv1a002591mg [Erythranthe guttata]
Length=656

 Score =   160 bits (405),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 82/218 (38%), Positives = 136/218 (62%), Gaps = 10/218 (5%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I L+        D F+  L   ++ KFD+YWK C LI++IA I+DPR+KM+LVE+ + +I
Sbjct  437  IHLQLIGWCQKSDEFISSLALKLKSKFDEYWKKCSLIMAIAAILDPRYKMQLVEYYYPQI  496

Query  711  YGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTD  532
            YG+ A   + IV   +  L+  + A+  PL+      A+G +  ++ +  +  ++L  T 
Sbjct  497  YGDSAPDCIDIVKNCMKALYSGH-AIYSPLS------AHGQSSASESSVSIVKDKL--TG  547

Query  531  FDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVP  355
            FD F+ ETS SQ ++S+LD+YLEE L PR +   V+ WWK++  +YP LS MAR+IL +P
Sbjct  548  FDRFLHETSVSQNTKSDLDKYLEEPLFPRKNVISVLNWWKVHEPRYPVLSMMARNILGIP  607

Query  354  VSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            +S    +S+F T  + +D    +++ +T++AL+C++DW
Sbjct  608  ISKVAVESLFDTGERALDHCWSTMKSDTLQALMCSRDW  645



>ref|XP_007216990.1| hypothetical protein PRUPE_ppa002590mg [Prunus persica]
 gb|EMJ18189.1| hypothetical protein PRUPE_ppa002590mg [Prunus persica]
Length=655

 Score =   159 bits (403),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 128/211 (61%), Gaps = 4/211 (2%)
 Frame = -2

Query  855  DPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVRIV  676
            D ++  L   M+ KF++YW  C L L++AV++DPRFKMK V++ +++ +G  A   +  V
Sbjct  446  DDYISSLALKMRSKFEEYWMRCSLSLAVAVMLDPRFKMKPVDYYYAQFFGSGAPGRISDV  505

Query  675  DEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMETSS-Q  499
             E +  L+ ++      +      +  G +      ++L      LT FD F+ ET+   
Sbjct  506  FECVKTLYNEHSTCLAYVDQGLAWQVGGSSRLPGSGRDLRDR---LTGFDKFLHETTEID  562

Query  498  QSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFST  319
             ++S+LD+YLEE L PR  EFD++ WWK++  +YP LS MAR++L +PVS  P DS F+T
Sbjct  563  GTKSDLDKYLEEPLFPRNAEFDILNWWKVHAPRYPILSMMARNVLGIPVSKVPIDSTFNT  622

Query  318  VHKEMDRYRCSLRPETVEALVCAKDWQQNEL  226
              + +DR   S+ P T++AL+CA+DW ++EL
Sbjct  623  GGRVLDRDWSSMNPATIQALMCAQDWIRSEL  653



>ref|XP_011044854.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X3 [Populus euphratica]
Length=843

 Score =   161 bits (407),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 95/119 (80%), Gaps = 2/119 (2%)
 Frame = -2

Query  585  VNTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  409
            ++TQD   LS  + GL+DFD +I E T  Q  +SELDQYLEESLLPRVHEFDV+GWWKLN
Sbjct  716  LHTQDLPMLSIGD-GLSDFDIYISEITCGQHFKSELDQYLEESLLPRVHEFDVLGWWKLN  774

Query  408  RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  232
            R+KYPTLSKMA DIL++PVST   DSVF T ++ +D YR SLRP T+EAL+CAKDW Q+
Sbjct  775  RLKYPTLSKMAVDILSIPVSTVTPDSVFDTENRRIDSYRSSLRPVTLEALICAKDWLQH  833


 Score =   123 bits (309),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE   AA+S DPFV  LTK ++EKFD+YW  C L+L+IAV++DPRFKMKL+EFSF K
Sbjct  438  KIQLELTSAAMSHDPFVRNLTKPLKEKFDQYWNDCFLVLAIAVVMDPRFKMKLLEFSFPK  497

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQEL  559
            ++GEDA  +++ VD+GIHEL   Y+     L  T +EE       + + QE+
Sbjct  498  VFGEDAGMWIKSVDDGIHELLVGYLTPNFHLPATDVEEGLVSIPQSDNLQEI  549



>ref|XP_011044853.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X2 [Populus euphratica]
Length=851

 Score =   161 bits (407),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 95/119 (80%), Gaps = 2/119 (2%)
 Frame = -2

Query  585  VNTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  409
            ++TQD   LS  + GL+DFD +I E T  Q  +SELDQYLEESLLPRVHEFDV+GWWKLN
Sbjct  724  LHTQDLPMLSIGD-GLSDFDIYISEITCGQHFKSELDQYLEESLLPRVHEFDVLGWWKLN  782

Query  408  RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  232
            R+KYPTLSKMA DIL++PVST   DSVF T ++ +D YR SLRP T+EAL+CAKDW Q+
Sbjct  783  RLKYPTLSKMAVDILSIPVSTVTPDSVFDTENRRIDSYRSSLRPVTLEALICAKDWLQH  841


 Score =   123 bits (309),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE   AA+S DPFV  LTK ++EKFD+YW  C L+L+IAV++DPRFKMKL+EFSF K
Sbjct  438  KIQLELTSAAMSHDPFVRNLTKPLKEKFDQYWNDCFLVLAIAVVMDPRFKMKLLEFSFPK  497

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQEL  559
            ++GEDA  +++ VD+GIHEL   Y+     L  T +EE       + + QE+
Sbjct  498  VFGEDAGMWIKSVDDGIHELLVGYLTPNFHLPATDVEEGLVSIPQSDNLQEI  549



>ref|XP_008784137.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Phoenix dactylifera]
 ref|XP_008784138.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Phoenix dactylifera]
Length=232

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 124/215 (58%), Gaps = 31/215 (14%)
 Frame = -2

Query  825  MQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYG--EDASTYVRIVDEGIHELF  652
            MQE+FDKYWK C  IL++ V++DPR+KMKL+++ F KIYG  + AS  ++ V + +  L+
Sbjct  6    MQEEFDKYWKQCSHILAVGVVLDPRYKMKLIKYCFQKIYGNGDRASFEIKKVYDVLQNLY  65

Query  651  QDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELG-------LTDFDAFIMETS-SQQ  496
             DY  L             G  V+    + + +   G       L D+  FI E   +Q 
Sbjct  66   DDYTIL------------YGANVSHVQVEAMVSTSHGRGDESFFLQDYKKFIREKEVAQP  113

Query  495  SRSELDQYLEESLLPRVH-----EFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADS  331
             +SE++ YLEE    +VH      FD++ +W+ N  KYP LS+M RDIL +PVST   +S
Sbjct  114  FKSEIEMYLEE----KVHSLGDQNFDILDYWRFNESKYPILSRMVRDILAIPVSTVAFES  169

Query  330  VFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  226
             FST  + +D +R SL P+ VEAL+C +DW ++ L
Sbjct  170  AFSTTGRVLDDFRSSLSPDMVEALICTQDWLRDTL  204



>ref|XP_006369306.1| hypothetical protein POPTR_0001s20900g [Populus trichocarpa]
 ref|XP_006369307.1| hypothetical protein POPTR_0001s20900g [Populus trichocarpa]
 gb|ERP65875.1| hypothetical protein POPTR_0001s20900g [Populus trichocarpa]
 gb|ERP65876.1| hypothetical protein POPTR_0001s20900g [Populus trichocarpa]
Length=1024

 Score =   162 bits (409),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 96/119 (81%), Gaps = 2/119 (2%)
 Frame = -2

Query  585   VNTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  409
             ++TQD   LS  + GL+DFD +I E TS Q  +SELDQYLEESLLPRVHEFDVVGWWKLN
Sbjct  887   LHTQDLPMLSIGD-GLSDFDIYISEITSGQHLKSELDQYLEESLLPRVHEFDVVGWWKLN  945

Query  408   RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  232
             R+KYPTLSKMA DIL++PVST   DSVF T ++++D YR SL P T+EALVCAKDW Q+
Sbjct  946   RLKYPTLSKMAADILSIPVSTVAPDSVFDTENRKIDSYRGSLLPITLEALVCAKDWLQH  1004


 Score =   135 bits (339),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE   A +S DPFV  L K M+EKFD+YWK C L+L+IAV++DPRFKMKL+EFSF K
Sbjct  438  KIQLELTHATMSQDPFVSNLIKPMKEKFDQYWKDCFLVLAIAVVMDPRFKMKLLEFSFPK  497

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQEL  559
            ++GEDA  +++ VD+GIHELF DY+A  + L   Y+EE +     +   QE+
Sbjct  498  VFGEDAGMWIKSVDDGIHELFLDYLAPNIHLPAAYVEEGHISLTQSDTLQEV  549



>ref|XP_006297141.1| hypothetical protein CARUB_v10013145mg [Capsella rubella]
 ref|XP_006297142.1| hypothetical protein CARUB_v10013145mg [Capsella rubella]
 gb|EOA30039.1| hypothetical protein CARUB_v10013145mg [Capsella rubella]
 gb|EOA30040.1| hypothetical protein CARUB_v10013145mg [Capsella rubella]
Length=667

 Score =   159 bits (403),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/224 (38%), Positives = 127/224 (57%), Gaps = 12/224 (5%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I ++      + D F+  L  SM+ KFD+YW  C L+L+IA I+DPR+KMKLVE+ +SKI
Sbjct  438  IHIQLIEWCKNQDNFLSSLAASMKAKFDEYWNKCSLVLAIAAILDPRYKMKLVEYYYSKI  497

Query  711  YGEDASTYVRIVDEGIHELFQDY--VALPLPLTPTYIEEANGGAVNTQDAQELSTNELGL  538
            YG  A   ++ V  G+ EL   Y   +  +    ++     G A++T+D          L
Sbjct  498  YGSTALDRIKEVSNGVKELLDAYSMCSAIVGEDSSFSGSGLGRAMDTRDR---------L  548

Query  537  TDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILT  361
              FD F+ ETS +Q + S+LD+YL E   PR  EF+++ +WK++  +YP LS MARDIL 
Sbjct  549  KGFDKFLHETSQNQNTTSDLDKYLSEPNFPRSGEFNILNYWKVHTPRYPILSMMARDILG  608

Query  360  VPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
             P+S    DS F++    +   + SL P+  +AL CA DW   E
Sbjct  609  TPISIIAPDSTFNSGTPMIADSQSSLNPDIRQALFCAHDWLSTE  652



>ref|XP_011044850.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Populus euphratica]
 ref|XP_011044851.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Populus euphratica]
 ref|XP_011044852.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Populus euphratica]
Length=886

 Score =   161 bits (407),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 95/119 (80%), Gaps = 2/119 (2%)
 Frame = -2

Query  585  VNTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  409
            ++TQD   LS  + GL+DFD +I E T  Q  +SELDQYLEESLLPRVHEFDV+GWWKLN
Sbjct  759  LHTQDLPMLSIGD-GLSDFDIYISEITCGQHFKSELDQYLEESLLPRVHEFDVLGWWKLN  817

Query  408  RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  232
            R+KYPTLSKMA DIL++PVST   DSVF T ++ +D YR SLRP T+EAL+CAKDW Q+
Sbjct  818  RLKYPTLSKMAVDILSIPVSTVTPDSVFDTENRRIDSYRSSLRPVTLEALICAKDWLQH  876


 Score =   123 bits (309),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE   AA+S DPFV  LTK ++EKFD+YW  C L+L+IAV++DPRFKMKL+EFSF K
Sbjct  438  KIQLELTSAAMSHDPFVRNLTKPLKEKFDQYWNDCFLVLAIAVVMDPRFKMKLLEFSFPK  497

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQEL  559
            ++GEDA  +++ VD+GIHEL   Y+     L  T +EE       + + QE+
Sbjct  498  VFGEDAGMWIKSVDDGIHELLVGYLTPNFHLPATDVEEGLVSIPQSDNLQEI  549



>ref|XP_006369308.1| hypothetical protein POPTR_0001s20900g [Populus trichocarpa]
 gb|ERP65877.1| hypothetical protein POPTR_0001s20900g [Populus trichocarpa]
Length=1099

 Score =   161 bits (408),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 96/119 (81%), Gaps = 2/119 (2%)
 Frame = -2

Query  585   VNTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  409
             ++TQD   LS  + GL+DFD +I E TS Q  +SELDQYLEESLLPRVHEFDVVGWWKLN
Sbjct  962   LHTQDLPMLSIGD-GLSDFDIYISEITSGQHLKSELDQYLEESLLPRVHEFDVVGWWKLN  1020

Query  408   RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  232
             R+KYPTLSKMA DIL++PVST   DSVF T ++++D YR SL P T+EALVCAKDW Q+
Sbjct  1021  RLKYPTLSKMAADILSIPVSTVAPDSVFDTENRKIDSYRGSLLPITLEALVCAKDWLQH  1079


 Score =   135 bits (339),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE   A +S DPFV  L K M+EKFD+YWK C L+L+IAV++DPRFKMKL+EFSF K
Sbjct  438  KIQLELTHATMSQDPFVSNLIKPMKEKFDQYWKDCFLVLAIAVVMDPRFKMKLLEFSFPK  497

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQEL  559
            ++GEDA  +++ VD+GIHELF DY+A  + L   Y+EE +     +   QE+
Sbjct  498  VFGEDAGMWIKSVDDGIHELFLDYLAPNIHLPAAYVEEGHISLTQSDTLQEV  549



>ref|XP_012073147.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
[Jatropha curcas]
Length=1198

 Score =   161 bits (408),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 96/128 (75%), Gaps = 0/128 (0%)
 Frame = -2

Query  618   PTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMETSSQQSRSELDQYLEESLLPRVHE  439
             P + +E     VN QD   LST   G +DF+ +I  TS+Q  +SELDQYLEESLLPRVH+
Sbjct  1052  PEFSQEMQPYEVNHQDLPLLSTIGDGYSDFEVYISATSNQHLKSELDQYLEESLLPRVHD  1111

Query  438   FDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEAL  259
             FDV+GWWKLN++KYPTLSKMA DIL++P+ST   DSVF T  K++D Y+ SLRP  +EAL
Sbjct  1112  FDVLGWWKLNKLKYPTLSKMAADILSIPISTVAPDSVFDTGSKKIDSYQSSLRPVILEAL  1171

Query  258   VCAKDWQQ  235
             +CAKDW Q
Sbjct  1172  ICAKDWLQ  1179


 Score =   131 bits (330),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE  R A+S DPFV  LTK ++EKFD+YWK   L+L IAV++DPRFKMKLVEFSFSK
Sbjct  441  KIQLELTRLAMSQDPFVSSLTKPLKEKFDQYWKDSFLVLVIAVVMDPRFKMKLVEFSFSK  500

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLT  619
            I+GEDA  +++IVD+GIHELF DY+   L +T
Sbjct  501  IFGEDAGMWIKIVDDGIHELFLDYLPPNLSVT  532



>dbj|BAB02646.1| Ac transposase-like protein [Arabidopsis thaliana]
 gb|AAL60024.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20091.1| unknown protein [Arabidopsis thaliana]
Length=662

 Score =   158 bits (400),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/233 (36%), Positives = 130/233 (56%), Gaps = 12/233 (5%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I ++      + D F+  L  +M+ KFD+YW  C L+L+IA I+DPRFKMKLVE+ +SKI
Sbjct  439  IHIQLVEWCKNQDNFLSSLAANMKAKFDEYWNKCSLVLAIAAILDPRFKMKLVEYYYSKI  498

Query  711  YGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGG--AVNTQDAQELSTNELGL  538
            YG  A   ++ V  G+ EL   Y      +       +  G  +++T+D          L
Sbjct  499  YGSTALDRIKEVSNGVKELLDAYSMCSAIVGEDSFSGSGLGRASMDTRDR---------L  549

Query  537  TDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILT  361
              FD F+ ETS +Q + ++LD+YL E + PR  EF+++ +WK++  +YP LS +ARDIL 
Sbjct  550  KGFDKFLHETSQNQNTTTDLDKYLSEPIFPRSGEFNILNYWKVHTPRYPILSLLARDILG  609

Query  360  VPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPI  202
             P+S    DS F++    +   + SL P+  +AL CA DW   E   +I+  I
Sbjct  610  TPMSICAPDSTFNSGTPVISDSQSSLNPDIRQALFCAHDWLSTETEGTISNSI  662



>ref|XP_011007706.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X4 [Populus euphratica]
Length=1017

 Score =   159 bits (403),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 95/119 (80%), Gaps = 2/119 (2%)
 Frame = -2

Query  585  VNTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  409
            ++TQD   LS  + GL+DFD +I E TS Q  +SELDQYLEESLLPRVHEFDVVGWWKLN
Sbjct  880  LHTQDLPMLSIGD-GLSDFDIYISEITSGQHLKSELDQYLEESLLPRVHEFDVVGWWKLN  938

Query  408  RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  232
            R+KYP LSKMA DIL++PVST   DSVF T ++++D YR SL P T+EALVCAKDW Q+
Sbjct  939  RLKYPMLSKMAADILSIPVSTVAPDSVFDTENRKIDSYRGSLLPITLEALVCAKDWLQH  997


 Score =   135 bits (339),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE   A +S DPFV  L K M+EKFD+YWK C L+L+IAV++DPRFKMKL+EFSF K
Sbjct  438  KIQLELTHATMSQDPFVSNLIKPMKEKFDQYWKDCFLVLAIAVVMDPRFKMKLLEFSFPK  497

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQEL  559
            ++GEDA  +++ VD+GIHELF DY+A  + L   Y+EE +     +   QE+
Sbjct  498  VFGEDAGMWIKSVDDGIHELFLDYLAPNIHLPAAYVEEGHISLTQSDTLQEV  549



>ref|XP_011007708.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X6 [Populus euphratica]
Length=902

 Score =   159 bits (402),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 95/119 (80%), Gaps = 2/119 (2%)
 Frame = -2

Query  585  VNTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  409
            ++TQD   LS  + GL+DFD +I E TS Q  +SELDQYLEESLLPRVHEFDVVGWWKLN
Sbjct  765  LHTQDLPMLSIGD-GLSDFDIYISEITSGQHLKSELDQYLEESLLPRVHEFDVVGWWKLN  823

Query  408  RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  232
            R+KYP LSKMA DIL++PVST   DSVF T ++++D YR SL P T+EALVCAKDW Q+
Sbjct  824  RLKYPMLSKMAADILSIPVSTVAPDSVFDTENRKIDSYRGSLLPITLEALVCAKDWLQH  882


 Score =   134 bits (337),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE   A +S DPFV  L K M+EKFD+YWK C L+L+IAV++DPRFKMKL+EFSF K
Sbjct  438  KIQLELTHATMSQDPFVSNLIKPMKEKFDQYWKDCFLVLAIAVVMDPRFKMKLLEFSFPK  497

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQEL  559
            ++GEDA  +++ VD+GIHELF DY+A  + L   Y+EE +     +   QE+
Sbjct  498  VFGEDAGMWIKSVDDGIHELFLDYLAPNIHLPAAYVEEGHISLTQSDTLQEV  549



>ref|XP_011007704.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X2 [Populus euphratica]
Length=1027

 Score =   159 bits (403),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 95/119 (80%), Gaps = 2/119 (2%)
 Frame = -2

Query  585   VNTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  409
             ++TQD   LS  + GL+DFD +I E TS Q  +SELDQYLEESLLPRVHEFDVVGWWKLN
Sbjct  890   LHTQDLPMLSIGD-GLSDFDIYISEITSGQHLKSELDQYLEESLLPRVHEFDVVGWWKLN  948

Query  408   RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  232
             R+KYP LSKMA DIL++PVST   DSVF T ++++D YR SL P T+EALVCAKDW Q+
Sbjct  949   RLKYPMLSKMAADILSIPVSTVAPDSVFDTENRKIDSYRGSLLPITLEALVCAKDWLQH  1007


 Score =   135 bits (339),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE   A +S DPFV  L K M+EKFD+YWK C L+L+IAV++DPRFKMKL+EFSF K
Sbjct  438  KIQLELTHATMSQDPFVSNLIKPMKEKFDQYWKDCFLVLAIAVVMDPRFKMKLLEFSFPK  497

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQEL  559
            ++GEDA  +++ VD+GIHELF DY+A  + L   Y+EE +     +   QE+
Sbjct  498  VFGEDAGMWIKSVDDGIHELFLDYLAPNIHLPAAYVEEGHISLTQSDTLQEV  549



>ref|XP_011007707.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X5 [Populus euphratica]
Length=920

 Score =   159 bits (402),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 95/119 (80%), Gaps = 2/119 (2%)
 Frame = -2

Query  585  VNTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  409
            ++TQD   LS  + GL+DFD +I E TS Q  +SELDQYLEESLLPRVHEFDVVGWWKLN
Sbjct  783  LHTQDLPMLSIGD-GLSDFDIYISEITSGQHLKSELDQYLEESLLPRVHEFDVVGWWKLN  841

Query  408  RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  232
            R+KYP LSKMA DIL++PVST   DSVF T ++++D YR SL P T+EALVCAKDW Q+
Sbjct  842  RLKYPMLSKMAADILSIPVSTVAPDSVFDTENRKIDSYRGSLLPITLEALVCAKDWLQH  900


 Score =   134 bits (337),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE   A +S DPFV  L K M+EKFD+YWK C L+L+IAV++DPRFKMKL+EFSF K
Sbjct  438  KIQLELTHATMSQDPFVSNLIKPMKEKFDQYWKDCFLVLAIAVVMDPRFKMKLLEFSFPK  497

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQEL  559
            ++GEDA  +++ VD+GIHELF DY+A  + L   Y+EE +     +   QE+
Sbjct  498  VFGEDAGMWIKSVDDGIHELFLDYLAPNIHLPAAYVEEGHISLTQSDTLQEV  549



>ref|XP_011007705.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X3 [Populus euphratica]
Length=1024

 Score =   159 bits (403),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 95/119 (80%), Gaps = 2/119 (2%)
 Frame = -2

Query  585   VNTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  409
             ++TQD   LS  + GL+DFD +I E TS Q  +SELDQYLEESLLPRVHEFDVVGWWKLN
Sbjct  887   LHTQDLPMLSIGD-GLSDFDIYISEITSGQHLKSELDQYLEESLLPRVHEFDVVGWWKLN  945

Query  408   RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  232
             R+KYP LSKMA DIL++PVST   DSVF T ++++D YR SL P T+EALVCAKDW Q+
Sbjct  946   RLKYPMLSKMAADILSIPVSTVAPDSVFDTENRKIDSYRGSLLPITLEALVCAKDWLQH  1004


 Score =   135 bits (339),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE   A +S DPFV  L K M+EKFD+YWK C L+L+IAV++DPRFKMKL+EFSF K
Sbjct  438  KIQLELTHATMSQDPFVSNLIKPMKEKFDQYWKDCFLVLAIAVVMDPRFKMKLLEFSFPK  497

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQEL  559
            ++GEDA  +++ VD+GIHELF DY+A  + L   Y+EE +     +   QE+
Sbjct  498  VFGEDAGMWIKSVDDGIHELFLDYLAPNIHLPAAYVEEGHISLTQSDTLQEV  549



>ref|XP_011007700.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Populus euphratica]
 ref|XP_011007701.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Populus euphratica]
 ref|XP_011007702.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Populus euphratica]
 ref|XP_011007703.1| PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like 
isoform X1 [Populus euphratica]
Length=1042

 Score =   159 bits (403),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 95/119 (80%), Gaps = 2/119 (2%)
 Frame = -2

Query  585   VNTQDAQELSTNELGLTDFDAFIME-TSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLN  409
             ++TQD   LS  + GL+DFD +I E TS Q  +SELDQYLEESLLPRVHEFDVVGWWKLN
Sbjct  905   LHTQDLPMLSIGD-GLSDFDIYISEITSGQHLKSELDQYLEESLLPRVHEFDVVGWWKLN  963

Query  408   RMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQN  232
             R+KYP LSKMA DIL++PVST   DSVF T ++++D YR SL P T+EALVCAKDW Q+
Sbjct  964   RLKYPMLSKMAADILSIPVSTVAPDSVFDTENRKIDSYRGSLLPITLEALVCAKDWLQH  1022


 Score =   135 bits (339),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            KIQLE   A +S DPFV  L K M+EKFD+YWK C L+L+IAV++DPRFKMKL+EFSF K
Sbjct  438  KIQLELTHATMSQDPFVSNLIKPMKEKFDQYWKDCFLVLAIAVVMDPRFKMKLLEFSFPK  497

Query  714  IYGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQEL  559
            ++GEDA  +++ VD+GIHELF DY+A  + L   Y+EE +     +   QE+
Sbjct  498  VFGEDAGMWIKSVDDGIHELFLDYLAPNIHLPAAYVEEGHISLTQSDTLQEV  549



>ref|XP_010465389.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Camelina sativa]
 ref|XP_010465390.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Camelina sativa]
 ref|XP_010465391.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Camelina sativa]
Length=669

 Score =   157 bits (396),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/228 (37%), Positives = 128/228 (56%), Gaps = 12/228 (5%)
 Frame = -2

Query  861  SDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVR  682
            + D F+  L  +M+ KFD+YW  C L+L+IA I+DPRFKMKLVE+ +SKIYG  A   ++
Sbjct  450  NQDNFLSSLAANMKTKFDEYWNKCSLVLAIAAILDPRFKMKLVEYYYSKIYGSTALDRIK  509

Query  681  IVDEGIHELFQDYVALP--LPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMET  508
             V  G+ EL   Y      +    ++     G A++T+D          L  FD F+ ET
Sbjct  510  EVSNGVKELLDAYSMCSSIVGEDSSFSGSGLGRAMDTRDR---------LKGFDKFLRET  560

Query  507  SSQ-QSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADS  331
            S    + S+LD+YL E + PR  EF+++ +WK++  +YP LS +ARDIL  P+S    DS
Sbjct  561  SQNLNTTSDLDKYLSEPMFPRTGEFNILNYWKVHTPRYPVLSLLARDILGTPMSILAPDS  620

Query  330  VFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPIKMEVP  187
             F++    +   + SL P+  +AL CA DW   E  +++    +  +P
Sbjct  621  TFNSGTPMIADSQSSLNPDIRQALFCAHDWLSTETEETLPLSRQYALP  668



>ref|XP_008343867.1| PREDICTED: uncharacterized protein LOC103406660 [Malus domestica]
Length=435

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/213 (38%), Positives = 122/213 (57%), Gaps = 25/213 (12%)
 Frame = -2

Query  855  DPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVRIV  676
            D F+  + + M  KF+KYW    LIL+IAVI DPR+K++ VE+ + K+YG++ S  ++ V
Sbjct  5    DDFMRRMGRYMNLKFEKYWSEYSLILAIAVIJDPRYKLQFVEWGYDKLYGKE-SRELKDV  63

Query  675  DEGIHELFQDY--------VALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAF  520
               +  LF  Y        V+ P+  TPT                E+   +    +FD  
Sbjct  64   SGTLFALFGSYMDKFSHLLVSNPVNQTPT----------------EIKVGDKLFEEFDNI  107

Query  519  IMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAP  340
              + S+   ++EL+ YLEE  L R  E D++ WWK  + +YP LS+MA D+LT+P+ST  
Sbjct  108  YQDGSTLVEKTELNLYLEEKRLDRKQELDILSWWKXEQFRYPVLSRMASDVLTIPISTVA  167

Query  339  ADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            ++S FS   + +D+YR SL PETV+AL+C +DW
Sbjct  168  SESAFSISGRVLDQYRSSLLPETVQALLCTRDW  200



>ref|XP_010684309.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Beta vulgaris subsp. vulgaris]
Length=423

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 127/220 (58%), Gaps = 7/220 (3%)
 Frame = -2

Query  894  KIQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSK  715
            K++L       S D F+  +   M EKF KYW     I+++AV++DPRFKM+ +++SF+K
Sbjct  157  KVRLLLKDEKSSSDNFMQRMATRMFEKFGKYWSEFSTIMAVAVVLDPRFKMQFIKWSFNK  216

Query  714  IYG--EDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELG  541
            +YG   D  + +  V + +  L+  Y    +      +       V         T++  
Sbjct  217  VYGFGPDYESELFKVKDRLQHLYDGYAMSSVSAATNNVAGCRFAGVTCD-----GTSDEF  271

Query  540  LTDFDAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILT  361
            +TDFD F  E  S+  +S+L  YLEE L+PR    ++V +W+ + ++YP ++KMA+D L 
Sbjct  272  MTDFDEFSNEQHSESVKSDLVSYLEEPLMPRSSNINIVSYWRTHEVRYPIVAKMAKDFLA  331

Query  360  VPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            +P+ST  ++S FST  + +D YR SL+P+TVEA++C +DW
Sbjct  332  IPMSTVASESAFSTGGRVLDCYRSSLKPKTVEAIICLRDW  371



>ref|XP_010035892.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Eucalyptus grandis]
 ref|XP_010035893.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Eucalyptus grandis]
 ref|XP_010035894.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Eucalyptus grandis]
 gb|KCW47397.1| hypothetical protein EUGRSUZ_K01194 [Eucalyptus grandis]
 gb|KCW47398.1| hypothetical protein EUGRSUZ_K01194 [Eucalyptus grandis]
Length=663

 Score =   155 bits (392),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/230 (37%), Positives = 138/230 (60%), Gaps = 15/230 (7%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I L+      S D ++  L   M+ +FD+YW  C L L++A  +DPRFKMKLVE+ F +I
Sbjct  439  IHLKLIGWCKSSDDYISSLALKMRSRFDEYWDKCSLGLAVAAFLDPRFKMKLVEYYFPQI  498

Query  711  YGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEA--NGGAVNT-----QDAQELST  553
            YG  +   +  +   I  L+ ++ ++  PL+  +  +A   GG+  +      DA++   
Sbjct  499  YGSTSLERIDEISSRIKALYNEH-SIGSPLSTLHHGQAWQVGGSTGSLSGPGNDAKD---  554

Query  552  NELGLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMA  376
                L  FD F+ ETS S  ++S+LD+YLEE L PR  +F+V+ WWK++  +YP LS MA
Sbjct  555  ---RLVGFDKFLNETSQSDGTKSDLDKYLEEPLFPRNVDFNVLNWWKVHTPRYPILSMMA  611

Query  375  RDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  226
            R++L  P+S   ++SVF+   + ++R R SL   T++AL+C++DW ++EL
Sbjct  612  RNVLGTPMSKVHSESVFNMGGRVLERDRSSLSSATLQALMCSQDWIKSEL  661



>ref|XP_010535019.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Tarenaya hassleriana]
Length=673

 Score =   155 bits (392),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 83/211 (39%), Positives = 126/211 (60%), Gaps = 7/211 (3%)
 Frame = -2

Query  855  DPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVRIV  676
            D F+  L + M+ KFD+YW  C L+L++A I+DPRFKMKLVE+ +SKIYG  A   ++ V
Sbjct  452  DHFLSSLAEKMKAKFDEYWSKCSLVLAMAAILDPRFKMKLVEYYYSKIYGTTALERIKEV  511

Query  675  DEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELG-LTDFDAFIMETS-S  502
              G  ELF  Y      +  T ++E +  + +      +S+     L  FD ++ ETS S
Sbjct  512  SNGFKELFDAY-----SICSTIVDEDSSSSFSGSGLGRISSETRDRLKGFDKYLHETSQS  566

Query  501  QQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFS  322
            Q   S+LD+YL E + PR  EF+++ +WK++  +YP LS MAR+IL+  +S    +S FS
Sbjct  567  QAGASDLDKYLSEPIFPRSGEFNILNYWKVHTPRYPILSMMAREILSTRMSILTPESEFS  626

Query  321  TVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
            +    +D  + SL P+  +AL CA+DW + E
Sbjct  627  SSRPMLDNGQSSLSPDVRQALFCARDWLRPE  657



>gb|KJB75465.1| hypothetical protein B456_012G042700 [Gossypium raimondii]
Length=658

 Score =   155 bits (392),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/227 (36%), Positives = 141/227 (62%), Gaps = 12/227 (5%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I L+      + D ++  L   M++KF++YW  C   L++A ++DPRFKMKL+E+ + ++
Sbjct  437  IHLQLIEWCKNPDEYISSLALKMRKKFEEYWYKCSSGLAVAAMLDPRFKMKLLEYYYPQL  496

Query  711  YGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIE----EANGGAVNTQDAQELSTNEL  544
            YG+ A+  +  V E I  L+ ++ ++  PL  +  +    +A+G   + +D+++      
Sbjct  497  YGDSATELIDDVFECIKSLYNEH-SIVSPLASSINQGLDWQASGSPGSGKDSRD------  549

Query  543  GLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  367
             L  FD F+ ETS ++ S S+LD+YLEE L PR  +F+V+ WWK++  +YP LS MAR+I
Sbjct  550  RLMGFDKFLHETSQAEGSSSDLDKYLEEPLFPRNVDFNVLNWWKVHTPRYPILSMMARNI  609

Query  366  LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  226
            L +P+S   A+S F T  + ++    SL P T++AL+C++DW ++EL
Sbjct  610  LGIPISKVAAESRFDTGGRMLNHNWSSLPPTTIQALMCSQDWIRSEL  656



>gb|KHN18108.1| Putative AC transposase [Glycine soja]
Length=527

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 139/225 (62%), Gaps = 5/225 (2%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            ++L     + + D F+  L   ++ KFD+YW+ C L L++A ++DPRFKMKLV++ + +I
Sbjct  303  VKLHLIEWSKNSDEFISSLASRLRSKFDEYWEKCSLGLAVAAMLDPRFKMKLVDYYYPQI  362

Query  711  YGEDASTYVRIVDEGIHELFQDY-VALPLPLTPTYIE-EANGGAVNTQDAQELSTNELGL  538
            +G  ++  +  V +G+  L+ ++ +  PL      +  +   G++  Q + + S + L  
Sbjct  363  FGSMSANRIEEVFDGVKALYNEHSICSPLASHDQGLAWQVGNGSLLLQGSAKDSRDRL--  420

Query  537  TDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILT  361
              FD F+ ET+  + ++S+LD+YLEE L PR  +F+++ WW+++  +YP LS MAR++L 
Sbjct  421  MGFDKFLHETTQGEGTKSDLDKYLEEPLFPRNVDFNILNWWRVHTPRYPVLSMMARNVLG  480

Query  360  VPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  226
            +P+S    +  F+   + +DR   SL P TV+ALVC++DW ++EL
Sbjct  481  IPMSKVAPELAFNHSARVLDRDWSSLNPATVQALVCSQDWIRSEL  525



>ref|XP_009631898.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like [Nicotiana tomentosiformis]
Length=519

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 92/244 (38%), Positives = 136/244 (56%), Gaps = 25/244 (10%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I+LE      S +P +  +  S+  KF KYW    +++ +A I D R+K+KLVEF   +I
Sbjct  275  IKLELEAWVKSLNPLLSSMATSILLKFKKYWDDVHILMGVATIFDLRYKIKLVEFYLVQI  334

Query  711  YGEDAST-YVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLT  535
            YGE+AS   ++ V     +LFQ+Y +  L                + ++ + S   +G+ 
Sbjct  335  YGEEASLDKIQEVRNHCFDLFQEYQSRKL---------------TSHESSQASNEVVGIV  379

Query  534  D------FDAFIMETSSQ-QSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMA  376
            D      FD F+  + +   +RSELD YLEESLLP    FD + W K N +K+PTL KMA
Sbjct  380  DGDWFYSFDQFVASSRANVDTRSELDVYLEESLLPSTPSFDSLSWQKTNGLKFPTLQKMA  439

Query  375  RDILTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNELVKSITAPI-K  199
            RD+L +PVST  ++S FST  + +  +R  L P T+EALVCA+ W  NE +  +T+ I K
Sbjct  440  RDLLAIPVSTVASESAFSTSGRLISPHRSRLHPTTLEALVCARTWLWNE-INGLTSSIDK  498

Query  198  MEVP  187
            +  P
Sbjct  499  VSCP  502



>ref|XP_010487284.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Camelina sativa]
 ref|XP_010487285.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Camelina sativa]
 ref|XP_010487286.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Camelina sativa]
Length=668

 Score =   154 bits (390),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 121/214 (57%), Gaps = 12/214 (6%)
 Frame = -2

Query  861  SDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVR  682
            + D F+  L  +M+ KFD+YW  C L+L+IA I+DPRFKMKLVE+ +SKIYG  A   ++
Sbjct  450  NQDNFLSSLAANMKAKFDEYWNKCSLVLAIAAILDPRFKMKLVEYYYSKIYGSTALDRIK  509

Query  681  IVDEGIHELFQDYVALPLPLT--PTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMET  508
             V  G+ EL   Y      +    ++     G  ++T+D          L  FD F+ ET
Sbjct  510  EVSNGVKELLDAYSMCSAIVGEDSSFSGSGLGRTMDTRDR---------LKGFDKFLRET  560

Query  507  SSQ-QSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADS  331
            S    + S+LD+YL E + PR  EF+++ +WK++  +YP LS +ARDIL  P+S    DS
Sbjct  561  SQNLNTASDLDKYLSEPVFPRTGEFNILNYWKVHTPRYPVLSLLARDILGTPMSILAPDS  620

Query  330  VFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
             F++    +   + SL P+  +AL CA DW   E
Sbjct  621  TFNSGTPMIADSQSSLNPDIRQALFCAHDWLSTE  654



>gb|KHM99619.1| Putative AC transposase [Glycine soja]
Length=661

 Score =   154 bits (390),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 78/226 (35%), Positives = 137/226 (61%), Gaps = 7/226 (3%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            ++L     + + D F+  L   ++ KFD+YW+ C L L++A ++DPRFKMKLV++ + +I
Sbjct  437  VKLHLIEWSKNSDEFISSLASRLRSKFDEYWEKCSLGLAVAAMLDPRFKMKLVDYYYPQI  496

Query  711  YGEDASTYVRIVDEGIHELFQDY-VALPLPLTPTYI--EEANGGAVNTQDAQELSTNELG  541
            YG  ++  +  V +G+  L+ ++ +  PL      +  +  NG  +     ++     +G
Sbjct  497  YGSMSANRIEEVFDGVKALYNEHSIGSPLASHDQGLAWQVGNGPLLLHGSGKDSRDRLMG  556

Query  540  LTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDIL  364
               FD F+ ETS  + ++S+LD+YLEE L PR  +F+++ WW+++  +YP LS MAR++L
Sbjct  557  ---FDKFLHETSQGEGTKSDLDKYLEEPLFPRNVDFNILNWWRVHTPRYPVLSMMARNVL  613

Query  363  TVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  226
             +P+S    +  F+   + +DR   SL P TV+ALVC++DW ++EL
Sbjct  614  GIPMSKVVPELAFNHSARVLDRDWSSLNPATVQALVCSQDWIRSEL  659



>ref|XP_007146367.1| hypothetical protein PHAVU_006G034500g [Phaseolus vulgaris]
 gb|ESW18361.1| hypothetical protein PHAVU_006G034500g [Phaseolus vulgaris]
Length=663

 Score =   154 bits (389),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 77/225 (34%), Positives = 138/225 (61%), Gaps = 5/225 (2%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            ++L       + D ++  L   ++ KFD+YW+ C L L++A ++DPRFKMKLV++ + +I
Sbjct  439  VKLHLIEWCKNSDEYISSLASRLRSKFDEYWEKCSLGLAVAAMLDPRFKMKLVDYYYPQI  498

Query  711  YGEDASTYVRIVDEGIHELFQDY-VALPLPLTPTYIE-EANGGAVNTQDAQELSTNELGL  538
            YG  +++ +  V +G+  L+ ++ +  PL      +  +   G +  Q + + S + L  
Sbjct  499  YGSMSASRIEEVFDGVKALYNEHSIGSPLASHDQGLAWQVGNGPLLLQGSAKDSRDRL--  556

Query  537  TDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILT  361
              FD F+ ETS  + ++S+LD+YLEE L PR  +F+++ WW+++  +YP LS MAR++L 
Sbjct  557  MGFDKFLHETSQGEGTKSDLDKYLEEPLFPRNVDFNILNWWRVHTPRYPVLSMMARNVLG  616

Query  360  VPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  226
            +P++    +  F+   + +DR   SL P TV+ALVC++DW ++EL
Sbjct  617  IPMAKVAPELAFNHSGRVLDRDWSSLNPATVQALVCSQDWIRSEL  661



>ref|XP_009356659.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like [Pyrus x bretschneideri]
Length=657

 Score =   154 bits (389),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 80/212 (38%), Positives = 130/212 (61%), Gaps = 5/212 (2%)
 Frame = -2

Query  855  DPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVRIV  676
            D +V  L   M+ +F++YW+ C L L++A I+DPRFKMKLVE+ + K++G  A +++   
Sbjct  447  DDYVRSLAFKMRSRFEEYWQRCSLGLAVAAILDPRFKMKLVEYYYGKVFGSGAPSHISGA  506

Query  675  DEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMETSS-Q  499
             E +  L+ ++      L      +  GG+ +   ++  S + L  + FD +I ET+   
Sbjct  507  FECVKALYNEHSNCLASLDQIVPWQV-GGSSHFPGSERESGDRL--SGFDKYIEETTQID  563

Query  498  QSRSELDQYLEESLLPR-VHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFS  322
             ++S+LD+YLEE   PR    FD++ WWK++  +YP LS MAR++L +PVS    DS F+
Sbjct  564  GTKSDLDKYLEEHAFPRHAPGFDILNWWKVHAPRYPVLSMMARNVLGIPVSKVAKDSAFN  623

Query  321  TVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  226
            T  + +DR   S+ P TV+AL+CA+DW ++EL
Sbjct  624  TGGRVLDRDWSSMNPATVQALMCARDWIRSEL  655



>ref|XP_009374222.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X1 [Pyrus x bretschneideri]
Length=285

 Score =   149 bits (375),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 120/216 (56%), Gaps = 31/216 (14%)
 Frame = -2

Query  855  DPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDA-------  697
            D F+  +   M  KF+KYW    LIL+I VI+DPR+K++ VE+ + K+YG++        
Sbjct  81   DDFMRRMGSYMNLKFEKYWSEYSLILAIGVILDPRYKLQFVEWGYDKLYGKELRKLKDVS  140

Query  696  ----STYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDF  529
                + + R +DE  H L    V+ P+  TPT                ++   +    +F
Sbjct  141  GTLFALFARYMDEFSHLL----VSNPVNQTPT----------------QIKVGDKLFEEF  180

Query  528  DAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVS  349
            D      S+   ++EL  YLEE  L R  E D++ WWKL + +YP LS MA D+LT+P+S
Sbjct  181  DNIYQNRSTSVEKTELHLYLEEKRLDRKQELDILSWWKLEQFRYPVLSCMASDVLTIPIS  240

Query  348  TAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            T  ++SVFS   + +D+YR SL PETV+AL+C +DW
Sbjct  241  TVASESVFSISGRVLDQYRSSLLPETVQALLCTRDW  276



>ref|XP_010502162.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like isoform X5 [Camelina sativa]
Length=668

 Score =   154 bits (388),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 122/214 (57%), Gaps = 12/214 (6%)
 Frame = -2

Query  861  SDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVR  682
            + D F+  L  +M+ KFD+YW  C L+L+IA I+DPRFKMKLVE+ +SKIYG  A   ++
Sbjct  450  NQDNFLSSLAANMKVKFDEYWNKCSLVLAIAAILDPRFKMKLVEYYYSKIYGSTALDRIK  509

Query  681  IVDEGIHELFQDY--VALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMET  508
             V  G+ EL   Y   +  +    ++     G  ++T+D          L  FD F+ ET
Sbjct  510  EVSNGVKELLDAYSMCSAIVGEDSSFSGSGLGRTMDTRDR---------LKGFDKFLRET  560

Query  507  SSQ-QSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADS  331
            S    + S+LD+YL E + PR  EF+++ +WK++  +YP LS +ARDIL  P+S    DS
Sbjct  561  SQNLNTASDLDKYLSEPVFPRTGEFNILNYWKVHTPRYPVLSLLARDILGTPMSILAPDS  620

Query  330  VFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
             F++    +   + SL P+  +AL CA DW   E
Sbjct  621  TFNSGTPMIADSQSSLNPDIRQALFCAHDWLSTE  654



>ref|XP_009374223.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
2-like isoform X2 [Pyrus x bretschneideri]
Length=284

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 120/216 (56%), Gaps = 31/216 (14%)
 Frame = -2

Query  855  DPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDA-------  697
            D F+  +   M  KF+KYW    LIL+I VI+DPR+K++ VE+ + K+YG++        
Sbjct  81   DDFMRRMGSYMNLKFEKYWSEYSLILAIGVILDPRYKLQFVEWGYDKLYGKELRKLKDVS  140

Query  696  ----STYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTDF  529
                + + R +DE  H L    V+ P+  TPT                ++   +    +F
Sbjct  141  GTLFALFARYMDEFSHLL----VSNPVNQTPT----------------QIKVGDKLFEEF  180

Query  528  DAFIMETSSQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVS  349
            D      S+   ++EL  YLEE  L R  E D++ WWKL + +YP LS MA D+LT+P+S
Sbjct  181  DNIYQNRSTSVEKTELHLYLEEKRLDRKQELDILSWWKLEQFRYPVLSCMASDVLTIPIS  240

Query  348  TAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDW  241
            T  ++SVFS   + +D+YR SL PETV+AL+C +DW
Sbjct  241  TVASESVFSISGRVLDQYRSSLLPETVQALLCTRDW  276



>ref|XP_010502139.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like isoform X2 [Camelina sativa]
Length=681

 Score =   154 bits (389),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 121/214 (57%), Gaps = 12/214 (6%)
 Frame = -2

Query  861  SDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVR  682
            + D F+  L  +M+ KFD+YW  C L+L+IA I+DPRFKMKLVE+ +SKIYG  A   ++
Sbjct  450  NQDNFLSSLAANMKVKFDEYWNKCSLVLAIAAILDPRFKMKLVEYYYSKIYGSTALDRIK  509

Query  681  IVDEGIHELFQDYVALPLPLT--PTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMET  508
             V  G+ EL   Y      +    ++     G  ++T+D          L  FD F+ ET
Sbjct  510  EVSNGVKELLDAYSMCSAIVGEDSSFSGSGLGRTMDTRDR---------LKGFDKFLRET  560

Query  507  SSQ-QSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADS  331
            S    + S+LD+YL E + PR  EF+++ +WK++  +YP LS +ARDIL  P+S    DS
Sbjct  561  SQNLNTASDLDKYLSEPVFPRTGEFNILNYWKVHTPRYPVLSLLARDILGTPMSILAPDS  620

Query  330  VFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
             F++    +   + SL P+  +AL CA DW   E
Sbjct  621  TFNSGTPMIADSQSSLNPDIRQALFCAHDWLSTE  654



>ref|XP_010502134.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like isoform X1 [Camelina sativa]
 ref|XP_010502145.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like isoform X3 [Camelina sativa]
 ref|XP_010502151.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like isoform X1 [Camelina sativa]
Length=681

 Score =   154 bits (389),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 121/214 (57%), Gaps = 12/214 (6%)
 Frame = -2

Query  861  SDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVR  682
            + D F+  L  +M+ KFD+YW  C L+L+IA I+DPRFKMKLVE+ +SKIYG  A   ++
Sbjct  450  NQDNFLSSLAANMKVKFDEYWNKCSLVLAIAAILDPRFKMKLVEYYYSKIYGSTALDRIK  509

Query  681  IVDEGIHELFQDYVALPLPLT--PTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMET  508
             V  G+ EL   Y      +    ++     G  ++T+D          L  FD F+ ET
Sbjct  510  EVSNGVKELLDAYSMCSAIVGEDSSFSGSGLGRTMDTRDR---------LKGFDKFLRET  560

Query  507  SSQ-QSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADS  331
            S    + S+LD+YL E + PR  EF+++ +WK++  +YP LS +ARDIL  P+S    DS
Sbjct  561  SQNLNTASDLDKYLSEPVFPRTGEFNILNYWKVHTPRYPVLSLLARDILGTPMSILAPDS  620

Query  330  VFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
             F++    +   + SL P+  +AL CA DW   E
Sbjct  621  TFNSGTPMIADSQSSLNPDIRQALFCAHDWLSTE  654



>ref|XP_010502154.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 
1-like isoform X4 [Camelina sativa]
Length=680

 Score =   154 bits (389),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 121/214 (57%), Gaps = 12/214 (6%)
 Frame = -2

Query  861  SDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVR  682
            + D F+  L  +M+ KFD+YW  C L+L+IA I+DPRFKMKLVE+ +SKIYG  A   ++
Sbjct  450  NQDNFLSSLAANMKVKFDEYWNKCSLVLAIAAILDPRFKMKLVEYYYSKIYGSTALDRIK  509

Query  681  IVDEGIHELFQDYVALPLPLT--PTYIEEANGGAVNTQDAQELSTNELGLTDFDAFIMET  508
             V  G+ EL   Y      +    ++     G  ++T+D          L  FD F+ ET
Sbjct  510  EVSNGVKELLDAYSMCSAIVGEDSSFSGSGLGRTMDTRDR---------LKGFDKFLRET  560

Query  507  SSQ-QSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADS  331
            S    + S+LD+YL E + PR  EF+++ +WK++  +YP LS +ARDIL  P+S    DS
Sbjct  561  SQNLNTASDLDKYLSEPVFPRTGEFNILNYWKVHTPRYPVLSLLARDILGTPMSILAPDS  620

Query  330  VFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNE  229
             F++    +   + SL P+  +AL CA DW   E
Sbjct  621  TFNSGTPMIADSQSSLNPDIRQALFCAHDWLSTE  654



>ref|XP_007048823.1| BED zinc finger,hAT family dimerization domain [Theobroma cacao]
 gb|EOX92980.1| BED zinc finger,hAT family dimerization domain [Theobroma cacao]
Length=657

 Score =   153 bits (387),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/227 (37%), Positives = 137/227 (60%), Gaps = 12/227 (5%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I L+      + D ++  L   M++KF+ YW  C L L++A ++DPRFKMKL+E+ + ++
Sbjct  436  IHLQLIEWCKNPDDYINSLAVKMRKKFEDYWDKCSLGLAVAAMLDPRFKMKLLEYYYPQL  495

Query  711  YGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIE----EANGGAVNTQDAQELSTNEL  544
            YG+ AS  +  V E I  L+ ++ ++  PL  +  +    + +G   + +D+++      
Sbjct  496  YGDSASELIDDVFECIKSLYNEH-SMVSPLASSLDQGLSWQVSGIPGSGKDSRD------  548

Query  543  GLTDFDAFIMETS-SQQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDI  367
             L  FD F+ ETS S  S S+LD+YLE+ L PR  +F+++ WWK++   YP LS MA +I
Sbjct  549  RLMGFDKFLHETSQSDGSNSDLDKYLEDPLFPRNVDFNILNWWKVHTPSYPILSMMAHNI  608

Query  366  LTVPVSTAPADSVFSTVHKEMDRYRCSLRPETVEALVCAKDWQQNEL  226
            L +P+S   A+S F T  + +D    SL P TV+AL+C++DW ++EL
Sbjct  609  LGIPISKVAAESTFDTGGRVVDHNWSSLPPTTVQALMCSQDWIRSEL  655



>gb|AAG52564.1|AC010675_12 unknown protein; 6859-4829 [Arabidopsis thaliana]
Length=676

 Score =   152 bits (385),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 86/231 (37%), Positives = 133/231 (58%), Gaps = 7/231 (3%)
 Frame = -2

Query  891  IQLEXARAAVSDDPFVGGLTKSMQEKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKI  712
            I L     + + D F+  L  +M++KFD +W    L+L+IA I+DPRFKMKLVE+ +   
Sbjct  447  IHLRLIEWSKNPDDFISSLVVNMRKKFDDFWDKNYLVLAIATILDPRFKMKLVEYYYPLF  506

Query  711  YGEDASTYVRIVDEGIHELFQDYVALPLPLTPTYIEEANGGAVNTQDAQELSTNELGLTD  532
            YG  AS  +  + E I  L+ ++    L  +     +       +         +  LT+
Sbjct  507  YGTSASELIEDISECIKLLYDEHSVGSLLASSNQALDWQNHHHRSNGVAHGKEPDDRLTE  566

Query  531  FDAFIMETSS---QQSRSELDQYLEESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILT  361
            FD +I ET++   Q S+S+L++YLEE L PR  +FD++ WWK++  KYP LS MAR++L 
Sbjct  567  FDRYINETTTTPGQDSKSDLEKYLEEPLFPRNSDFDILNWWKVHTPKYPILSMMARNVLA  626

Query  360  VP-VSTAPADSVFSTVHKEM--DRYRCSLRPETVEALVCAKDWQQNELVKS  217
            VP ++ +  +  F T  +    + +R SLRP TV+AL+CA+DW Q+EL  S
Sbjct  627  VPMLNVSSEEDAFETCQRRRVSETWR-SLRPSTVQALMCAQDWIQSELESS  676



>emb|CAN83599.1| hypothetical protein VITISV_015691 [Vitis vinifera]
Length=570

 Score =   151 bits (382),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 79/199 (40%), Positives = 117/199 (59%), Gaps = 6/199 (3%)
 Frame = -2

Query  819  EKFDKYWKSCCLILSIAVIVDPRFKMKLVEFSFSKIYGEDASTYVRIVDEGIHELFQDYV  640
            +KFDKYW  C ++++I  I  PR+K+K++EF F  +YG  AS  +  +    +EL  +Y 
Sbjct  324  QKFDKYWSGCHIVMAITTIFGPRYKIKILEFYFPLMYGSKASNEIEKIRGMCYELLSEYQ  383

Query  639  ALPLPLTPTYIEEANGGAVNTQDAQELSTNELG-LTDFDAFIMETSSQ-QSRSELDQYLE  466
            +       T     + G+       EL+ +E   L+ FD F+  T  +  ++SELD YLE
Sbjct  384  SKSKLGQKTSFYGTSSGST----LLELNYDEQDPLSKFDLFVHSTIGESHTKSELDYYLE  439

Query  465  ESLLPRVHEFDVVGWWKLNRMKYPTLSKMARDILTVPVSTAPADSVFSTVHKEMDRYRCS  286
            ES+LPR   FDV+ WWK N +KYPTL  + RDI  + VST  ++S FST  K + ++R  
Sbjct  440  ESILPRTSNFDVLSWWKTNGIKYPTLQMIVRDIYAILVSTVASESAFSTGGKVVSKHRSR  499

Query  285  LRPETVEALVCAKDWQQNE  229
            L P+T+EAL+CA+ W   E
Sbjct  500  LHPDTLEALMCAQSWLWKE  518



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2059730854950