BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig14079

Length=1640
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004243582.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    286   1e-86   
gb|ABC74567.1|  acetoacetyl-CoA thiolase                                285   2e-86   Picrorhiza kurrooa
ref|XP_006353096.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    284   5e-86   Solanum tuberosum [potatoes]
ref|XP_006357655.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    283   7e-86   
ref|XP_004239258.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    283   2e-85   
gb|EYU42778.1|  hypothetical protein MIMGU_mgv1a007511mg                282   2e-85   Erythranthe guttata [common monkey flower]
gb|EYU42777.1|  hypothetical protein MIMGU_mgv1a007511mg                282   2e-85   Erythranthe guttata [common monkey flower]
ref|XP_009761997.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    280   3e-85   Nicotiana sylvestris
ref|XP_009590926.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    282   3e-85   Nicotiana tomentosiformis
ref|XP_009759542.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    281   4e-85   Nicotiana sylvestris
ref|XP_009761996.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    280   5e-85   Nicotiana sylvestris
dbj|BAF98276.1|  acetyl-CoA C-acetyltransferase                         281   8e-85   Hevea brasiliensis [jebe]
ref|XP_009761989.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    279   3e-84   Nicotiana sylvestris
ref|XP_009361536.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    279   4e-84   Pyrus x bretschneideri [bai li]
gb|ACU87560.2|  acetyl-CoA C-acetyltransferase                          278   6e-84   Bacopa monnieri
ref|XP_011100512.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    278   6e-84   Sesamum indicum [beniseed]
gb|ABV08820.1|  acetoacetyl-coenzyme A thiolase                         278   7e-84   Salvia miltiorrhiza [Chinese salvia]
ref|XP_012081504.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    278   9e-84   Jatropha curcas
ref|XP_002532204.1|  acetyl-CoA acetyltransferase, mitochondrial,...    272   1e-83   
ref|XP_008365553.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    278   1e-83   
gb|AGH32909.1|  acetyl-CoA C-acetyltransferase                          277   2e-83   Camellia chekiangoleosa
gb|AIK21787.1|  acetyl-CoA C-acetyltransferase                          277   2e-83   Panax notoginseng [san-qi]
gb|KDO50952.1|  hypothetical protein CISIN_1g0154952mg                  272   3e-83   Citrus sinensis [apfelsine]
ref|XP_010252788.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    276   4e-83   Nelumbo nucifera [Indian lotus]
gb|ADD10719.1|  acetyl-CoA C-acetyltransferase protein                  276   4e-83   Camellia oleifera [abura-tsubaki]
gb|AEC13714.1|  acetoacetyl-CoA thiolase                                276   6e-83   Catharanthus roseus [chatas]
ref|XP_002265690.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    276   6e-83   Vitis vinifera
gb|EPS67778.1|  hypothetical protein M569_06996                         274   7e-83   Genlisea aurea
gb|AAL18928.1|AF429387_1  truncated acetyl Co-A acetyltransferase...    270   8e-83   Hevea brasiliensis [jebe]
gb|KJB42687.1|  hypothetical protein B456_007G165600                    273   1e-82   Gossypium raimondii
ref|XP_007215468.1|  hypothetical protein PRUPE_ppa006513mg             275   1e-82   Prunus persica
gb|KJB42688.1|  hypothetical protein B456_007G165600                    273   1e-82   Gossypium raimondii
ref|XP_008229933.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    275   1e-82   Prunus mume [ume]
gb|KCW58126.1|  hypothetical protein EUGRSUZ_H00849                     274   2e-82   Eucalyptus grandis [rose gum]
ref|XP_010069705.1|  PREDICTED: LOW QUALITY PROTEIN: acetyl-CoA a...    275   2e-82   Eucalyptus grandis [rose gum]
ref|XP_010547202.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    274   3e-82   Tarenaya hassleriana [spider flower]
gb|KHG30083.1|  Acetyl-CoA acetyltransferase, cytosolic 1 -like p...    274   3e-82   Gossypium arboreum [tree cotton]
gb|KJB42690.1|  hypothetical protein B456_007G165600                    273   5e-82   Gossypium raimondii
gb|KJB42689.1|  hypothetical protein B456_007G165600                    273   7e-82   Gossypium raimondii
ref|XP_003545555.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    273   8e-82   Glycine max [soybeans]
emb|CDP18953.1|  unnamed protein product                                273   1e-81   Coffea canephora [robusta coffee]
ref|XP_006469436.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    273   1e-81   Citrus sinensis [apfelsine]
ref|XP_003519682.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    273   1e-81   Glycine max [soybeans]
ref|XP_008462041.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    272   1e-81   Cucumis melo [Oriental melon]
emb|CDX86320.1|  BnaA06g30370D                                          273   2e-81   
gb|AEM42969.1|  acetyl-CoA C-acetyltransferase                          272   2e-81   Siraitia grosvenorii [arhat fruit]
ref|XP_004144550.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    271   3e-81   Cucumis sativus [cucumbers]
ref|XP_008342241.1|  PREDICTED: LOW QUALITY PROTEIN: acetyl-CoA a...    271   3e-81   
ref|XP_006395207.1|  hypothetical protein EUTSA_v10004340mg             271   4e-81   Eutrema salsugineum [saltwater cress]
ref|XP_007049378.1|  Acetoacetyl-CoA thiolase 2 isoform 1               271   4e-81   Theobroma cacao [chocolate]
ref|XP_007049379.1|  Acetoacetyl-CoA thiolase 2 isoform 2               271   5e-81   
gb|KHN46894.1|  Acetyl-CoA acetyltransferase, cytosolic 1               270   7e-81   Glycine soja [wild soybean]
ref|XP_009151624.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    270   8e-81   Brassica rapa
ref|XP_002320528.1|  truncated acetyl Co-A acetyltransferase-like...    270   8e-81   
ref|NP_568694.2|  acetoacetyl-CoA thiolase 2                            270   9e-81   Arabidopsis thaliana [mouse-ear cress]
gb|ACU19591.1|  unknown                                                 270   1e-80   Glycine max [soybeans]
gb|KFK31312.1|  hypothetical protein AALP_AA6G096400                    270   1e-80   Arabis alpina [alpine rockcress]
dbj|BAA97003.1|  acetyl-CoA C-acetyltransferase                         272   1e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004491616.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    270   2e-80   Cicer arietinum [garbanzo]
ref|XP_006447819.1|  hypothetical protein CICLE_v10015452mg             270   2e-80   Citrus clementina [clementine]
ref|XP_009111830.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    270   2e-80   Brassica rapa
dbj|BAF98277.1|  acetyl-CoA C-acetyltransferase                         270   2e-80   Hevea brasiliensis [jebe]
gb|EMT20974.1|  Putative acetyl-CoA acetyltransferase, cytosolic 2      269   2e-80   
ref|XP_011085410.1|  PREDICTED: LOW QUALITY PROTEIN: acetyl-CoA a...    268   4e-80   Sesamum indicum [beniseed]
ref|XP_004491615.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    269   4e-80   
ref|XP_010482068.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    268   4e-80   Camelina sativa [gold-of-pleasure]
ref|XP_011008068.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    268   5e-80   Populus euphratica
emb|CDY19963.1|  BnaA09g02880D                                          268   5e-80   Brassica napus [oilseed rape]
ref|XP_004977186.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    268   7e-80   Setaria italica
ref|XP_002865618.1|  acetoacetyl-CoA thiolase 2, embryo defective...    268   7e-80   
ref|XP_006280568.1|  hypothetical protein CARUB_v10026521mg             267   1e-79   Capsella rubella
ref|XP_010442239.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    267   1e-79   Camelina sativa [gold-of-pleasure]
ref|XP_010689228.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    267   1e-79   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009129716.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    267   1e-79   Brassica rapa
ref|XP_009129715.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    268   2e-79   
gb|ACX47470.1|  acetoacetyl-CoA thiolase                                267   2e-79   Medicago sativa [alfalfa]
ref|XP_010267979.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    266   2e-79   Nelumbo nucifera [Indian lotus]
gb|KDO78589.1|  hypothetical protein CISIN_1g015003mg                   264   3e-79   Citrus sinensis [apfelsine]
emb|CDY00071.1|  BnaC09g02300D                                          266   4e-79   
ref|XP_010267976.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    266   5e-79   Nelumbo nucifera [Indian lotus]
ref|XP_004303573.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    265   6e-79   Fragaria vesca subsp. vesca
ref|XP_007142529.1|  hypothetical protein PHAVU_008G288400g             265   6e-79   Phaseolus vulgaris [French bean]
emb|CDX85319.1|  BnaC07g26300D                                          266   7e-79   
ref|XP_002308755.1|  truncated acetyl Co-A acetyltransferase-like...    265   8e-79   Populus trichocarpa [western balsam poplar]
gb|AFI23434.1|  thiolase II                                             265   8e-79   Betula platyphylla [Asian white birch]
gb|KEH15899.1|  peroxisomal acetoacetyl-coenzyme A thiolase             263   9e-79   Medicago truncatula
ref|XP_010493636.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    265   9e-79   Camelina sativa [gold-of-pleasure]
tpg|DAA47710.1|  TPA: hypothetical protein ZEAMMB73_220204              264   1e-78   
ref|NP_001266315.1|  acetyl-CoA acetyltransferase, cytosolic 1          265   1e-78   
ref|XP_011654778.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    264   1e-78   Cucumis sativus [cucumbers]
gb|ACF85124.1|  unknown                                                 264   1e-78   Zea mays [maize]
emb|CDY48742.1|  BnaA02g30030D                                          264   1e-78   Brassica napus [oilseed rape]
gb|AAL18924.1|AF429383_1  acetyl Co-A acetyltransferase                 265   1e-78   Hevea brasiliensis [jebe]
gb|KDO78588.1|  hypothetical protein CISIN_1g015003mg                   264   2e-78   Citrus sinensis [apfelsine]
ref|XP_006467262.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    264   2e-78   Citrus sinensis [apfelsine]
ref|XP_006660462.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    264   2e-78   Oryza brachyantha
gb|KDO78587.1|  hypothetical protein CISIN_1g015003mg                   264   3e-78   Citrus sinensis [apfelsine]
ref|XP_004969865.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    263   3e-78   Setaria italica
ref|XP_004139514.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    263   4e-78   Cucumis sativus [cucumbers]
dbj|BAD22334.1|  putative acetyl-CoA C-acyltransferase                  263   6e-78   Oryza sativa Japonica Group [Japonica rice]
gb|AFI57868.1|  acetoacetyl-CoA thiolase                                259   6e-78   Elaeis guineensis
ref|XP_003618039.1|  Acetyl-CoA acetyltransferase, cytosolic            263   6e-78   Medicago truncatula
ref|XP_011002352.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    263   7e-78   Populus euphratica
ref|XP_011002351.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    263   7e-78   Populus euphratica
gb|AFK39138.1|  unknown                                                 263   7e-78   Medicago truncatula
ref|XP_011654773.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    263   8e-78   Cucumis sativus [cucumbers]
ref|XP_009396114.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    262   8e-78   
ref|XP_010088359.1|  Acetyl-CoA acetyltransferase, cytosolic 1          262   9e-78   
ref|XP_010942603.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    262   1e-77   Elaeis guineensis
ref|NP_001062685.1|  Os09g0252100                                       263   1e-77   
ref|XP_008811276.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    262   1e-77   Phoenix dactylifera
ref|XP_010481277.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    262   2e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010481278.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    261   2e-77   Camelina sativa [gold-of-pleasure]
ref|XP_002522876.1|  acetyl-CoA acetyltransferase, mitochondrial,...    261   2e-77   Ricinus communis
gb|ACJ84564.1|  unknown                                                 261   3e-77   Medicago truncatula
ref|XP_006449940.1|  hypothetical protein CICLE_v10015403mg             261   3e-77   Citrus clementina [clementine]
ref|XP_006449941.1|  hypothetical protein CICLE_v10015403mg             261   4e-77   Citrus clementina [clementine]
ref|XP_006449942.1|  hypothetical protein CICLE_v10015403mg             261   4e-77   
ref|NP_851154.1|  acetoacetyl-CoA thiolase 2                            260   5e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009399886.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    259   7e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399870.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    260   9e-77   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABD57973.1|  acetoacetyl-coenzyme A thiolase                         260   9e-77   Arnebia euchroma
ref|XP_009412128.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    259   1e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009412114.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    259   1e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_012074794.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    259   1e-76   Jatropha curcas
ref|XP_003580738.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    259   2e-76   Brachypodium distachyon [annual false brome]
ref|XP_008464274.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    259   3e-76   
ref|XP_008464273.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    259   3e-76   
ref|XP_010936771.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    258   4e-76   Elaeis guineensis
ref|XP_010495012.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    258   4e-76   Camelina sativa [gold-of-pleasure]
ref|NP_001148667.1|  acetyl-CoA acetyltransferase, cytosolic 1          258   4e-76   Zea mays [maize]
ref|XP_008464272.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    259   4e-76   
ref|XP_007211795.1|  hypothetical protein PRUPE_ppa006371mg             258   5e-76   Prunus persica
ref|XP_010495013.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    258   6e-76   
gb|AAU95619.1|  peroxisomal acetoacetyl-coenzyme A thiolase             257   1e-75   Nicotiana tabacum [American tobacco]
ref|XP_009608453.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    257   1e-75   Nicotiana tomentosiformis
ref|XP_007026385.1|  Thiolase family protein isoform 1                  257   1e-75   
gb|ABM66459.1|  acetyl CoA C-acetyltranseferase                         249   1e-75   Brassica juncea [brown mustard]
ref|XP_006279490.1|  hypothetical protein CARUB_v10026490mg             257   2e-75   Capsella rubella
ref|XP_010039422.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    256   2e-75   Eucalyptus grandis [rose gum]
gb|ACU18264.1|  unknown                                                 249   2e-75   Glycine max [soybeans]
ref|XP_006398472.1|  hypothetical protein EUTSA_v10000897mg             256   2e-75   
gb|ACX46381.1|  acetoacetyl-CoA thiolase                                255   4e-75   Helianthus annuus
ref|XP_006398474.1|  hypothetical protein EUTSA_v10000897mg             256   4e-75   
ref|XP_004293407.2|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    256   4e-75   Fragaria vesca subsp. vesca
ref|XP_008782420.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    255   5e-75   Phoenix dactylifera
ref|XP_008224638.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    255   5e-75   Prunus mume [ume]
gb|ACU15722.1|  unknown                                                 248   5e-75   Glycine max [soybeans]
gb|EYU27653.1|  hypothetical protein MIMGU_mgv1a007243mg                255   5e-75   Erythranthe guttata [common monkey flower]
ref|XP_006398473.1|  hypothetical protein EUTSA_v10000897mg             255   5e-75   
ref|XP_010647165.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    254   6e-75   Vitis vinifera
gb|KEH32696.1|  peroxisomal acetoacetyl-coenzyme A thiolase             251   6e-75   Medicago truncatula
ref|XP_010647164.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    254   7e-75   Vitis vinifera
ref|XP_010647163.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    254   7e-75   Vitis vinifera
ref|XP_009787709.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    255   8e-75   Nicotiana sylvestris
ref|XP_003635396.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    254   8e-75   Vitis vinifera
gb|AEI27246.1|  putative acetyl-CoA-C-acetyltransferase                 253   9e-75   Vanda hybrid cultivar
ref|XP_011628272.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    254   1e-74   Amborella trichopoda
ref|XP_010675964.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    254   1e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004507588.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    254   1e-74   Cicer arietinum [garbanzo]
ref|XP_011628271.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    254   1e-74   Amborella trichopoda
gb|ERN19239.1|  hypothetical protein AMTR_s00061p00203040               255   2e-74   Amborella trichopoda
ref|XP_006350251.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    254   2e-74   Solanum tuberosum [potatoes]
gb|AHZ96597.1|  acetyl-CoA C-acetyl transferase                         253   2e-74   Aquilaria sinensis
ref|XP_002865105.1|  hypothetical protein ARALYDRAFT_494196             253   3e-74   
ref|XP_004507587.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    254   3e-74   
ref|XP_010538441.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    253   3e-74   Tarenaya hassleriana [spider flower]
ref|XP_010538440.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    253   4e-74   Tarenaya hassleriana [spider flower]
ref|XP_003637597.1|  Acetyl-CoA acetyltransferase cytosolic             252   6e-74   
ref|XP_011095902.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    253   6e-74   Sesamum indicum [beniseed]
gb|EMS66391.1|  putative acetyl-CoA acetyltransferase, cytosolic 2      256   6e-74   Triticum urartu
ref|XP_006600286.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    253   6e-74   
ref|XP_003565785.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    253   7e-74   Brachypodium distachyon [annual false brome]
emb|CDP04540.1|  unnamed protein product                                252   7e-74   Coffea canephora [robusta coffee]
ref|XP_011095903.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    252   9e-74   Sesamum indicum [beniseed]
ref|XP_006600285.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    253   1e-73   Glycine max [soybeans]
gb|AEZ55671.1|  acetyl-CoA C-acetyltransferase 2                        251   2e-73   Salvia miltiorrhiza [Chinese salvia]
ref|XP_004236650.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    251   3e-73   Solanum lycopersicum
ref|XP_004967970.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    250   5e-73   Setaria italica
ref|NP_851150.1|  acetoacetyl-CoA thiolase 1                            250   5e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004967971.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    250   6e-73   Setaria italica
ref|NP_199583.1|  acetoacetyl-CoA thiolase 1                            250   6e-73   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001141874.1|  acetyl-CoA acetyltransferase, cytosolic 2 is...    249   1e-72   Zea mays [maize]
ref|XP_003551110.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    249   2e-72   Glycine max [soybeans]
gb|KEH32695.1|  peroxisomal acetoacetyl-coenzyme A thiolase             248   2e-72   Medicago truncatula
ref|XP_003529679.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    248   3e-72   
ref|XP_006584106.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    248   3e-72   Glycine max [soybeans]
emb|CAA55006.1|  Acetoacetyl-coenzyme A thiolase                        247   5e-72   Raphanus sativus
ref|XP_008654615.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    249   5e-72   Zea mays [maize]
gb|KHN42262.1|  Putative acetyl-CoA acetyltransferase, cytosolic 2      248   5e-72   Glycine soja [wild soybean]
ref|XP_008654616.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    248   7e-72   
emb|CDY25950.1|  BnaC09g20370D                                          246   2e-71   Brassica napus [oilseed rape]
emb|CDM80037.1|  unnamed protein product                                246   3e-71   Triticum aestivum [Canadian hard winter wheat]
gb|KHN03551.1|  Putative acetyl-CoA acetyltransferase, cytosolic 2      245   7e-71   Glycine soja [wild soybean]
ref|NP_001032028.1|  acetoacetyl-CoA thiolase 1                         244   1e-70   Arabidopsis thaliana [mouse-ear cress]
gb|EMT15552.1|  Putative acetyl-CoA acetyltransferase, cytosolic 2      245   1e-70   
ref|XP_009114255.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    243   2e-70   Brassica rapa
ref|XP_009114253.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    243   3e-70   
gb|EEC69797.1|  hypothetical protein OsI_00091                          241   1e-69   Oryza sativa Indica Group [Indian rice]
ref|NP_001041797.1|  Os01g0110400                                       241   1e-69   
gb|KGN43403.1|  hypothetical protein Csa_7G031640                       239   2e-69   Cucumis sativus [cucumbers]
ref|XP_010087672.1|  putative acetyl-CoA acetyltransferase, cytos...    240   6e-69   
ref|XP_010497269.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    231   7e-69   
ref|XP_008384190.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    238   1e-68   Malus domestica [apple tree]
ref|XP_008384188.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    238   1e-68   Malus domestica [apple tree]
gb|ACN40771.1|  unknown                                                 237   3e-68   Picea sitchensis
ref|XP_003618040.1|  Acetyl-CoA acetyltransferase, cytosolic            236   4e-68   
ref|XP_010092017.1|  putative acetyl-CoA acetyltransferase, cytos...    236   5e-68   
ref|XP_009374845.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    237   6e-68   Pyrus x bretschneideri [bai li]
ref|XP_009374846.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    236   6e-68   Pyrus x bretschneideri [bai li]
ref|XP_008811278.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    236   7e-68   
ref|XP_009412135.1|  PREDICTED: acetyl-CoA acetyltransferase, cyt...    231   3e-66   
gb|ACN41149.1|  unknown                                                 232   4e-66   Picea sitchensis
ref|XP_010441408.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    231   7e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010441409.1|  PREDICTED: probable acetyl-CoA acetyltransfe...    230   8e-66   Camelina sativa [gold-of-pleasure]
ref|XP_002968816.1|  hypothetical protein SELMODRAFT_146037             231   1e-65   Selaginella moellendorffii
ref|XP_002974156.1|  hypothetical protein SELMODRAFT_173909             230   1e-65   
gb|EMT07958.1|  Putative acetyl-CoA acetyltransferase, cytosolic 2      229   5e-65   
gb|KJB68525.1|  hypothetical protein B456_010G248300                    227   9e-65   Gossypium raimondii
gb|KJB68526.1|  hypothetical protein B456_010G248300                    227   1e-64   Gossypium raimondii
gb|AID51434.1|  acetoacetyl-coenzyme A thiolase                         227   2e-64   Astragalus membranaceus
dbj|BAH57117.1|  AT5G47720                                              227   2e-64   Arabidopsis thaliana [mouse-ear cress]
gb|KJB68524.1|  hypothetical protein B456_010G248300                    227   2e-64   Gossypium raimondii
gb|KJB68523.1|  hypothetical protein B456_010G248300                    227   2e-64   Gossypium raimondii
gb|KHG07894.1|  hypothetical protein F383_03812                         227   2e-64   Gossypium arboreum [tree cotton]
ref|XP_007154060.1|  hypothetical protein PHAVU_003G087600g             225   1e-63   Phaseolus vulgaris [French bean]
gb|EPS62555.1|  hypothetical protein M569_12233                         223   2e-63   Genlisea aurea
ref|XP_001773218.1|  predicted protein                                  216   3e-60   
gb|AFQ62006.1|  acetyl-CoA acetyltransferase                            213   2e-59   Euphorbia lathyris
emb|CDY05692.1|  BnaC02g38450D                                          189   2e-52   
ref|WP_020082106.1|  acetyl-CoA acetyltransferase                       191   4e-51   
gb|EMS56611.1|  putative acetyl-CoA acetyltransferase, cytosolic 2      188   2e-50   Triticum urartu
gb|ESA20734.1|  hypothetical protein GLOINDRAFT_43599                   184   3e-50   
ref|WP_036784849.1|  acetyl-CoA acetyltransferase                       187   1e-49   Polaribacter
ref|WP_026777333.1|  acetyl-CoA acetyltransferase                       186   3e-49   Polaribacter sp. Hel_I_88
ref|WP_036822109.1|  acetyl-CoA acetyltransferase                       185   4e-49   Polaribacter sp. Hel1_85
gb|EXX68470.1|  acetyl-CoA C-acetyltransferase                          185   6e-49   Rhizophagus irregularis DAOM 197198w
ref|WP_034258137.1|  acetyl-CoA acetyltransferase                       185   7e-49   Altibacter lentus
ref|WP_028980206.1|  acetyl-CoA acetyltransferase                       185   7e-49   Sporocytophaga myxococcoides
ref|WP_004570201.1|  acetyl-CoA acetyltransferase                       184   1e-48   Polaribacter irgensii
ref|XP_001619139.1|  hypothetical protein NEMVEDRAFT_v1g46486           177   1e-48   Nematostella vectensis
ref|WP_013688178.1|  acetyl-CoA acetyltransferase                       184   2e-48   Fluviicola taffensis
ref|WP_019987186.1|  acetyl-CoA acetyltransferase                       184   2e-48   Rudanella lutea
ref|WP_045469619.1|  acetyl-CoA acetyltransferase                       183   2e-48   Sporocytophaga myxococcoides
ref|WP_041383877.1|  acetyl-CoA acetyltransferase                       183   3e-48   Polaribacter sp. MED152
ref|WP_035077204.1|  acetyl-CoA acetyltransferase                       183   3e-48   Anditalea andensis
ref|XP_011401582.1|  putative acetyl-CoA acetyltransferase, cytos...    184   4e-48   Auxenochlorella protothecoides
gb|EAQ42003.1|  acetyl-CoA acetyltransferase                            183   4e-48   Polaribacter sp. MED152
ref|WP_026812948.1|  acetyl-CoA acetyltransferase                       182   6e-48   Arenibacter certesii
ref|WP_027003578.1|  acetyl-CoA acetyltransferase                       182   6e-48   Hugenholtzia roseola
ref|WP_026970012.1|  acetyl-CoA acetyltransferase                       182   1e-47   Algoriphagus terrigena
dbj|BAA13846.1|  unnamed protein product                                181   1e-47   Schizosaccharomyces pombe
ref|NP_596686.1|  acetyl-CoA C-acetyltransferase Erg10 (predicted)      181   1e-47   Schizosaccharomyces pombe
emb|CCX30791.1|  Similar to Acetyl-CoA acetyltransferase; acc. no...    181   1e-47   Pyronema omphalodes CBS 100304
ref|WP_013752222.1|  acetyl-CoA acetyltransferase                       181   2e-47   Dokdonia sp. 4H-3-7-5
emb|CBL88173.1|  acetoacetyl-CoA thiolase                               181   2e-47   uncultured Leeuwenhoekiella sp.
gb|KEY68336.1|  hypothetical protein S7711_01115                        181   2e-47   Stachybotrys chartarum IBT 7711
ref|XP_002959312.1|  hypothetical protein VOLCADRAFT_84843              175   3e-47   Volvox carteri f. nagariensis
gb|KFA60838.1|  hypothetical protein S40285_06173                       180   3e-47   Stachybotrys chlorohalonata IBT 40285
ref|WP_012794011.1|  acetyl-CoA acetyltransferase                       180   3e-47   Chitinophaga pinensis
ref|WP_014773656.1|  acetyl-CoA acetyltransferase                       180   4e-47   Belliella baltica
ref|WP_027391341.1|  acetyl-CoA acetyltransferase                       180   4e-47   Aquimarina
ref|WP_009583742.1|  Acetyl-CoA acetyltransferase                       180   4e-47   Fulvivirga imtechensis
ref|WP_044019139.1|  acetyl-CoA acetyltransferase                       180   5e-47   Hymenobacter sp. APR13
ref|WP_028887593.1|  acetyl-CoA acetyltransferase                       179   5e-47   Tenacibaculum ovolyticum
gb|AII54220.1|  acetyl-CoA acetyltransferase                            179   5e-47   Hymenobacter sp. APR13
ref|WP_028282246.1|  acetyl-CoA acetyltransferase                       179   5e-47   Olleya marilimosa
emb|CCH01373.1|  acetyl-CoA acetyltransferase                           181   6e-47   Fibrella aestuarina BUZ 2
ref|WP_041258018.1|  acetyl-CoA acetyltransferase                       179   6e-47   Fibrella aestuarina
ref|WP_008623621.1|  Acetyl-CoA acetyltransferase                       179   7e-47   Mariniradius saccharolyticus
emb|CEG70625.1|  Putative Acetyl-CoA C-acetyltransferase                179   7e-47   Rhizopus microsporus
ref|WP_017732195.1|  acetyl-CoA acetyltransferase                       179   7e-47   Nafulsella turpanensis
ref|WP_028873447.1|  acetyl-CoA acetyltransferase                       179   7e-47   Psychroserpens burtonensis
emb|CDS14271.1|  Putative Acetyl-CoA C-acetyltransferase                179   8e-47   Lichtheimia ramosa
gb|EPR68685.1|  Acetyl-CoA acetyltransferase                            175   8e-47   Cyclobacterium qasimii M12-11B
gb|KFH73378.1|  acetyl-CoA C-acetyltransferase                          179   8e-47   Mortierella verticillata NRRL 6337
ref|WP_009779700.1|  acetyl-CoA acetyltransferase                       179   8e-47   Leeuwenhoekiella blandensis
ref|WP_026916136.1|  acetyl-CoA acetyltransferase                       179   1e-46   Gramella portivictoriae
gb|KEQ76920.1|  acetyl-CoA acetyltransferase IB                         179   1e-46   Aureobasidium namibiae CBS 147.97
ref|WP_018474789.1|  acetyl-CoA acetyltransferase                       179   1e-46   
gb|KEQ82191.1|  thiolase                                                179   1e-46   
ref|WP_028375928.1|  acetyl-CoA acetyltransferase                       179   1e-46   
ref|WP_008201390.1|  acetyl-CoA acetyltransferase                       179   1e-46   
ref|WP_026952373.1|  acetyl-CoA acetyltransferase                       178   1e-46   
ref|WP_040279763.1|  acetyl-CoA acetyltransferase                       178   1e-46   
gb|EHK39793.1|  putative acetyl-CoA acetyltransferase                   178   2e-46   
ref|XP_005844265.1|  hypothetical protein CHLNCDRAFT_27161              178   2e-46   
ref|WP_028608122.1|  acetyl-CoA acetyltransferase                       178   2e-46   
ref|WP_034044886.1|  acetyl-CoA acetyltransferase                       178   2e-46   
ref|WP_011709392.1|  acetyl-CoA acetyltransferase                       178   2e-46   
ref|WP_028890799.1|  acetyl-CoA acetyltransferase                       178   2e-46   
gb|EFA78071.1|  acetyl-CoA C-acetyltransferase                          178   2e-46   
ref|WP_019387161.1|  acetyl-CoA acetyltransferase                       178   2e-46   
ref|WP_007657939.1|  acetyl-CoA acetyltransferase                       177   3e-46   
ref|WP_028290392.1|  acetyl-CoA acetyltransferase                       177   3e-46   
ref|WP_038527996.1|  acetyl-CoA acetyltransferase                       177   3e-46   
gb|EPY53539.1|  acetyl-CoA C-acetyltransferase Erg10                    177   3e-46   
ref|WP_026954269.1|  acetyl-CoA acetyltransferase                       177   3e-46   
ref|WP_009282665.1|  acetyl-CoA acetyltransferase                       177   3e-46   
ref|WP_013621977.1|  MULTISPECIES: acetyl-CoA acetyltransferase         177   3e-46   
gb|KEQ65331.1|  thiolase                                                177   3e-46   
ref|WP_037438375.1|  acetyl-CoA acetyltransferase                       177   3e-46   
ref|WP_024740986.1|  acetyl-CoA acetyltransferase                       177   4e-46   
ref|XP_003054621.1|  predicted protein                                  177   4e-46   
ref|WP_020600625.1|  acetyl-CoA acetyltransferase                       177   4e-46   
ref|WP_045080921.1|  acetyl-CoA acetyltransferase                       177   5e-46   
ref|WP_035337039.1|  acetyl-CoA acetyltransferase                       177   5e-46   
ref|WP_042248191.1|  acetyl-CoA acetyltransferase                       177   5e-46   
ref|WP_026879909.1|  acetyl-CoA acetyltransferase                       177   5e-46   
gb|ABW74130.1|  acetyl coA acetyl transferase                           173   5e-46   
gb|KIX01474.1|  hypothetical protein Z518_09200                         177   6e-46   
ref|WP_015022798.1|  acetyl-CoA acetyltransferase                       177   6e-46   
ref|WP_019039328.1|  acetyl-CoA acetyltransferase                       177   6e-46   
gb|KEQ98968.1|  hypothetical protein AUEXF2481DRAFT_45917               177   6e-46   
ref|XP_005646381.1|  acetyl-CoA acetyltransferase                       177   7e-46   
ref|WP_026994755.1|  acetyl-CoA acetyltransferase                       176   7e-46   
ref|WP_009185550.1|  acetyl-CoA acetyltransferase                       176   7e-46   
ref|WP_026810850.1|  acetyl-CoA acetyltransferase                       176   8e-46   
gb|EIE89881.1|  hypothetical protein RO3G_14592                         176   9e-46   
ref|WP_032130967.1|  acetyl-CoA acetyltransferase                       176   1e-45   
ref|WP_039344220.1|  acetyl-CoA acetyltransferase                       176   1e-45   
ref|WP_026465024.1|  acetyl-CoA acetyltransferase                       176   1e-45   
ref|WP_035567509.1|  acetyl-CoA acetyltransferase                       176   1e-45   
ref|WP_044225645.1|  acetyl-CoA acetyltransferase                       176   1e-45   
ref|WP_006987456.1|  acetyl-CoA acetyltransferase                       176   1e-45   
ref|WP_034892482.1|  acetyl-CoA acetyltransferase                       176   1e-45   
ref|WP_003436677.1|  acetyl-CoA acetyltransferase                       176   1e-45   
gb|EIE90233.1|  hypothetical protein RO3G_14944                         176   1e-45   
ref|WP_044516645.1|  acetyl-CoA acetyltransferase                       176   1e-45   
ref|XP_009261111.1|  hypothetical protein FPSE_09719                    176   2e-45   
ref|XP_011328435.1|  acetyl-CoA acetyltransferase IB                    176   2e-45   
gb|EAY28999.1|  acetyl-CoA acetyltransferase                            176   2e-45   
ref|WP_024282655.1|  acetyl-CoA acetyltransferase                       176   2e-45   
ref|WP_007649376.1|  Acetyl-CoA acetyltransferase                       176   2e-45   
ref|WP_026946557.1|  acetyl-CoA acetyltransferase                       175   2e-45   
gb|EDM44119.1|  acetyl-CoA acetyltransferase                            175   2e-45   
ref|WP_013599011.1|  acetyl-CoA acetyltransferase                       175   2e-45   
ref|WP_027067692.1|  acetyl-CoA acetyltransferase                       175   2e-45   
ref|WP_018616805.1|  hypothetical protein                               175   2e-45   
ref|WP_028825299.1|  acetyl-CoA acetyltransferase                       175   2e-45   
ref|WP_018479111.1|  acetyl-CoA acetyltransferase                       175   2e-45   
ref|WP_013072016.1|  acetyl-CoA acetyltransferase                       175   3e-45   
ref|WP_027879072.1|  acetyl-CoA acetyltransferase                       175   3e-45   
ref|WP_019940843.1|  acetyl-CoA acetyltransferase                       175   3e-45   
ref|WP_041889423.1|  acetyl-CoA acetyltransferase                       175   3e-45   
ref|XP_002959306.1|  hypothetical protein VOLCADRAFT_84837              176   3e-45   
gb|EGE01205.1|  acetyl-CoA acetyltransferase                            175   3e-45   
ref|WP_027126725.1|  acetyl-CoA acetyltransferase                       175   3e-45   
gb|EGD95948.1|  acetyl-CoA acetyltransferase                            175   3e-45   
ref|XP_002844004.1|  acetyl-CoA acetyltransferase                       175   3e-45   
ref|WP_045113576.1|  acetyl-CoA acetyltransferase                       175   3e-45   
ref|WP_010227649.1|  acetyl-CoA acetyltransferase                       175   3e-45   
ref|WP_020566994.1|  hypothetical protein                               175   3e-45   
gb|EZF35979.1|  hypothetical protein H101_00494                         175   3e-45   
ref|WP_012927217.1|  acetyl-CoA acetyltransferase                       174   4e-45   
gb|EPX71259.1|  acetyl-CoA C-acetyltransferase Erg10                    174   4e-45   
ref|XP_003024790.1|  hypothetical protein TRV_01072                     175   4e-45   
ref|XP_008725301.1|  hypothetical protein G647_02733                    175   4e-45   
gb|EGU82764.1|  hypothetical protein FOXB_06715                         174   4e-45   
gb|EWG41745.1|  acetyl-CoA C-acetyltransferase                          174   4e-45   
emb|CCT64668.1|  probable acetoacetyl-CoA thiolase                      174   4e-45   
ref|WP_006926764.1|  acetyl-CoA acetyltransferase                       174   5e-45   
dbj|GAD92647.1|  acetyl-CoA acetyltransferase, putative                 174   5e-45   
ref|WP_042503846.1|  acetyl-CoA acetyltransferase                       174   5e-45   
ref|WP_042494758.1|  acetyl-CoA acetyltransferase                       174   5e-45   
ref|WP_042279346.1|  acetyl-CoA acetyltransferase                       174   5e-45   
gb|EWZ42896.1|  acetyl-CoA C-acetyltransferase                          174   5e-45   
ref|WP_011985817.1|  acetyl-CoA acetyltransferase                       174   5e-45   
ref|WP_026934443.1|  acetyl-CoA acetyltransferase                       174   6e-45   
ref|XP_002171694.1|  acetyl-CoA C-acetyltransferase Erg10               174   7e-45   
gb|KDD72406.1|  thiolase                                                169   8e-45   
gb|KIL93171.1|  hypothetical protein FAVG1_03148                        174   8e-45   
ref|WP_014797750.1|  acetyl-CoA acetyltransferase                       174   8e-45   
gb|AKA36023.1|  acetyl-CoA acetyltransferase                            174   8e-45   
ref|WP_034917416.1|  acetyl-CoA acetyltransferase                       174   8e-45   
ref|WP_026838433.1|  acetyl-CoA acetyltransferase                       174   8e-45   
ref|WP_031504331.1|  acetyl-CoA acetyltransferase                       173   9e-45   
ref|WP_014783533.1|  acetyl-CoA acetyltransferase                       173   1e-44   
gb|EPB89923.1|  acetyl-CoA C-acetyltransferase                          173   1e-44   
ref|WP_039347783.1|  acetyl-CoA acetyltransferase                       173   1e-44   
ref|XP_002790487.1|  acetyl-CoA acetyltransferase                       173   1e-44   
gb|EYE95911.1|  thiolase                                                173   1e-44   
ref|WP_012239713.1|  acetyl-CoA acetyltransferase                       173   1e-44   
ref|WP_016989103.1|  acetyl-CoA acetyltransferase                       173   1e-44   
gb|KIW03890.1|  hypothetical protein PV09_04735                         173   2e-44   
ref|WP_027137433.1|  acetyl-CoA acetyltransferase                       173   2e-44   
ref|WP_045474553.1|  acetyl-CoA acetyltransferase                       172   2e-44   
ref|XP_002951943.1|  hypothetical protein VOLCADRAFT_75176              173   2e-44   
gb|EPB83074.1|  acetyl-CoA C-acetyltransferase                          172   2e-44   
emb|CCG85020.1|  protein of unknown function                            172   2e-44   
ref|WP_012525550.1|  acetyl-CoA acetyltransferase                       172   2e-44   
ref|WP_044238319.1|  acetyl-CoA acetyltransferase                       172   2e-44   
dbj|GAA89398.1|  acetyl-CoA acetyltransferase                           172   2e-44   
ref|WP_012632869.1|  acetyl-CoA acetyltransferase                       172   2e-44   
ref|WP_008271322.1|  acetyl-CoA acetyltransferase                       172   2e-44   
ref|WP_014033773.1|  acetyl-CoA acetyltransferase                       172   2e-44   
gb|EIM78381.1|  acetyl-CoA acetyltransferase                            169   2e-44   
ref|XP_009834114.1|  hypothetical protein H257_09568                    172   3e-44   
ref|WP_011421417.1|  acetyl-CoA acetyltransferase                       172   3e-44   
ref|XP_002628078.1|  acetyl-CoA acetyltransferase                       172   3e-44   
gb|KIW83871.1|  hypothetical protein Z517_03117                         172   3e-44   
ref|WP_034716040.1|  acetyl-CoA acetyltransferase                       172   3e-44   
ref|WP_045802606.1|  acetyl-CoA acetyltransferase                       172   3e-44   
ref|WP_027378013.1|  acetyl-CoA acetyltransferase                       172   3e-44   
ref|WP_020536260.1|  hypothetical protein                               172   3e-44   
ref|WP_041886776.1|  acetyl-CoA acetyltransferase                       172   3e-44   
ref|XP_003237150.1|  acetyl-CoA acetyltransferase                       172   3e-44   
ref|WP_029034877.1|  acetyl-CoA acetyltransferase                       172   3e-44   
ref|XP_001261945.1|  acetyl-CoA acetyltransferase, putative             172   3e-44   
dbj|GAO04494.1|  acetyl-CoA acetyltransferase                           172   3e-44   
ref|WP_017843017.1|  hypothetical protein                               172   3e-44   
ref|WP_009033786.1|  acetyl-CoA acetyltransferase                       172   3e-44   
ref|WP_026309063.1|  acetyl-CoA acetyltransferase                       172   3e-44   
ref|WP_026351419.1|  acetyl-CoA acetyltransferase                       172   3e-44   
ref|WP_019598700.1|  acetyl-CoA acetyltransferase                       172   4e-44   
ref|WP_031443004.1|  acetyl-CoA acetyltransferase                       172   4e-44   
ref|WP_018622243.1|  acetyl-CoA acetyltransferase                       172   4e-44   
ref|WP_015811898.1|  acetyl-CoA acetyltransferase                       172   4e-44   
gb|KEF63337.1|  acetyl-CoA C-acetyltransferase                          172   4e-44   
ref|XP_001398216.1|  acetyl-CoA acetyltransferase IA                    172   4e-44   
dbj|GAN09574.1|  acetyl-CoA acetyltransferase                           172   4e-44   
ref|WP_044639650.1|  acetyl-CoA acetyltransferase                       171   4e-44   
ref|WP_036155655.1|  acetyl-CoA acetyltransferase                       171   4e-44   
ref|XP_007737475.1|  acetyl-CoA C-acetyltransferase                     172   4e-44   
ref|WP_026753482.1|  acetyl-CoA acetyltransferase                       171   4e-44   
ref|WP_015363227.1|  acetoacetyl-CoA thiolase                           171   5e-44   
gb|KIW23519.1|  hypothetical protein PV07_11711                         172   5e-44   
gb|ETZ21014.1|  acetyl-CoA acetyltransferase                            171   5e-44   
ref|WP_020740158.1|  acetyl-CoA acetyltransferase                       171   5e-44   
ref|WP_025607404.1|  acetyl-CoA acetyltransferase                       171   5e-44   
ref|XP_010758591.1|  hypothetical protein PADG_02751                    171   6e-44   
ref|WP_041252540.1|  acetyl-CoA acetyltransferase                       171   6e-44   
ref|WP_036674127.1|  acetyl-CoA acetyltransferase                       171   6e-44   
ref|XP_011156240.1|  PREDICTED: acetyl-CoA acetyltransferase, mit...    164   7e-44   
emb|CEP17093.1|  hypothetical protein                                   171   7e-44   
gb|EEH17778.1|  hypothetical protein PABG_00341                         171   7e-44   
gb|ACU07416.1|  Acetyl-CoA acetyltransferase                            171   7e-44   
ref|WP_015808709.1|  acetyl-CoA acetyltransferase                       171   8e-44   
ref|XP_007759544.1|  acetyl-CoA C-acetyltransferase                     171   8e-44   
ref|WP_020894851.1|  Acetyl-CoA acetyltransferase                       171   9e-44   
ref|WP_035135233.1|  acetyl-CoA acetyltransferase                       171   9e-44   
gb|EFZ20262.1|  hypothetical protein SINV_14231                         164   9e-44   
ref|WP_015267459.1|  acetyl-CoA acetyltransferase                       171   1e-43   
ref|XP_002837135.1|  hypothetical protein                               171   1e-43   
ref|WP_028032353.1|  acetyl-CoA acetyltransferase                       170   1e-43   
gb|KIW51366.1|  hypothetical protein PV05_10096                         171   1e-43   
ref|XP_001694888.1|  predicted protein                                  171   1e-43   
ref|WP_036383602.1|  acetyl-CoA acetyltransferase                       170   1e-43   
ref|XP_002680072.1|  predicted protein                                  171   1e-43   
gb|EZG03697.1|  hypothetical protein H106_06361                         171   1e-43   
dbj|GAM21810.1|  hypothetical protein SAMD00019534_049850               171   1e-43   
ref|XP_007914536.1|  putative acetyl- acetyltransferase protein         171   1e-43   
ref|XP_007748144.1|  acetyl-CoA C-acetyltransferase                     171   1e-43   
ref|WP_033958933.1|  acetyl-CoA acetyltransferase                       170   1e-43   
ref|WP_008612817.1|  acetyl-CoA acetyltransferase                       170   1e-43   
ref|WP_028298670.1|  acetyl-CoA acetyltransferase                       170   1e-43   
gb|KIY03573.1|  hypothetical protein Z520_00264                         171   1e-43   
ref|WP_026629988.1|  acetyl-CoA acetyltransferase                       170   1e-43   
ref|WP_044397600.1|  acetyl-CoA acetyltransferase                       170   1e-43   
gb|KIW97610.1|  hypothetical protein Z519_01194                         171   1e-43   
ref|WP_002663851.1|  acetyl-CoA acetyltransferase                       170   1e-43   
ref|WP_013871224.1|  acetyl-CoA acetyltransferase                       170   1e-43   
ref|WP_022834269.1|  acetyl-CoA acetyltransferase                       170   1e-43   
gb|KEY82509.1|  acetyl CoA acetyltransferase                            170   1e-43   
ref|WP_038986007.1|  acetyl-CoA acetyltransferase                       170   2e-43   
ref|WP_036124196.1|  acetyl-CoA acetyltransferase                       170   2e-43   
gb|KIW65562.1|  hypothetical protein PV04_07812                         171   2e-43   
ref|XP_747207.1|  acetyl-CoA acetyltransferase                          170   2e-43   
ref|WP_020527430.1|  hypothetical protein                               170   2e-43   
ref|WP_027883870.1|  acetyl-CoA acetyltransferase                       170   2e-43   
ref|WP_038262486.1|  acetyl-CoA acetyltransferase                       170   2e-43   
ref|WP_027381559.1|  acetyl-CoA acetyltransferase                       170   2e-43   
ref|WP_010180350.1|  acetyl-CoA acetyltransferase                       170   2e-43   
ref|XP_005714876.1|  acetyl-CoA acetyltransferase                       170   2e-43   
ref|XP_003172381.1|  acetyl-CoA acetyltransferase                       170   2e-43   
gb|EER40753.1|  acetyl-CoA acetyltransferase                            169   2e-43   
ref|WP_045640255.1|  acetyl-CoA acetyltransferase                       169   2e-43   
ref|WP_024769215.1|  acetyl-CoA acetyltransferase                       170   2e-43   
ref|WP_025663617.1|  acetyl-CoA acetyltransferase                       169   2e-43   
ref|WP_039749612.1|  acetyl-CoA acetyltransferase                       169   2e-43   
ref|XP_005854429.1|  acetyl-CoA C-acetyltransferase                     167   2e-43   
ref|WP_029036843.1|  acetyl-CoA acetyltransferase                       169   2e-43   
ref|WP_037360172.1|  acetyl-CoA acetyltransferase                       169   2e-43   
gb|KIW38412.1|  hypothetical protein PV06_09378                         170   2e-43   
ref|WP_010522422.1|  acetyl-CoA acetyltransferase                       169   3e-43   
ref|WP_031428406.1|  acetyl-CoA acetyltransferase                       169   3e-43   
ref|XP_008865251.1|  hypothetical protein H310_03237                    170   3e-43   
ref|WP_029293462.1|  acetyl-CoA acetyltransferase                       169   3e-43   
ref|WP_039129170.1|  acetyl-CoA acetyltransferase                       169   3e-43   
tpe|CBF84799.1|  TPA: acetyl-CoA acetyltransferase, putative (AFU...    169   3e-43   
ref|XP_011121747.1|  hypothetical protein AOL_s00078g182                169   3e-43   
ref|WP_008238601.1|  acetyl-CoA acetyltransferase                       169   3e-43   
ref|WP_018676768.1|  acetyl-CoA acetyltransferase                       169   3e-43   
ref|XP_009160237.1|  acetyl-CoA C-acetyltransferase                     169   3e-43   
ref|WP_035672870.1|  acetyl-CoA acetyltransferase                       169   4e-43   
ref|WP_019670031.1|  acetyl-CoA acetyltransferase                       169   4e-43   
ref|WP_013551674.1|  acetyl-CoA acetyltransferase                       169   4e-43   
ref|WP_013762893.1|  acetyl-CoA acetyltransferase                       169   5e-43   
ref|XP_001220611.1|  hypothetical protein CHGG_01390                    169   5e-43   
gb|KKA26239.1|  hypothetical protein TD95_000060                        169   5e-43   



>ref|XP_004243582.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Solanum 
lycopersicum]
 ref|XP_010323906.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Solanum 
lycopersicum]
 ref|XP_010323907.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Solanum 
lycopersicum]
 ref|XP_010323908.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Solanum 
lycopersicum]
Length=404

 Score =   286 bits (731),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAPA A+TI  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIE ALK+ +VDPSLVEE
Sbjct  1     MAPAAADTIKPRDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIEGALKKANVDPSLVEE  60

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAG+PNTVVC+TVNKVCASG+KATMLAAQSIQLGIN+VV
Sbjct  61    VFFGNVLSANLGQAPARQAALGAGLPNTVVCTTVNKVCASGLKATMLAAQSIQLGINEVV  120

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  121   VAGGMESMSNVPKYIAEARKGSRLGHDSLVDGML  154


 Score =   248 bits (632),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAPA A+TI  RDVCIVGVARTPMGGFLGSLSSLPATKLGS+AIE ALK+A+VDPSLVEE
Sbjct  1    MAPAAADTIKPRDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIEGALKKANVDPSLVEE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAG+PNTVVC+TVNKVCASG+KAT+LAAQSIQLGIN+VV
Sbjct  61   VFFGNVLSANLGQAPARQAALGAGLPNTVVCTTVNKVCASGLKATMLAAQSIQLGINEVV  120

Query  669  VAGGMESMSNVHKYFAEAR  725
            VAGGMESMSNV KY AEAR
Sbjct  121  VAGGMESMSNVPKYIAEAR  139



>gb|ABC74567.1| acetoacetyl-CoA thiolase [Picrorhiza kurrooa]
Length=404

 Score =   285 bits (728),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAPA A++I  RDVCIVGV+RTPMGGFLGS+SSLPATKLGSIAIESALKR +VDPS V+E
Sbjct  1     MAPAAADSIKPRDVCIVGVSRTPMGGFLGSISSLPATKLGSIAIESALKRANVDPSHVQE  60

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPNTV+C+TVNKVCASGMKA MLAAQSIQLGINDVV
Sbjct  61    VFFGNVLSANLGQAPARQAALGAGIPNTVICTTVNKVCASGMKAAMLAAQSIQLGINDVV  120

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  121   VAGGMESMSNVPKYLAEARKGSRLGHDSLVDGML  154


 Score =   246 bits (629),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAPA A++I  RDVCIVGV+RTPMGGFLGS+SSLPATKLGS+AIESALKRA+VDPS V+E
Sbjct  1    MAPAAADSIKPRDVCIVGVSRTPMGGFLGSISSLPATKLGSIAIESALKRANVDPSHVQE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPNTV+C+TVNKVCASGMKA +LAAQSIQLGINDVV
Sbjct  61   VFFGNVLSANLGQAPARQAALGAGIPNTVICTTVNKVCASGMKAAMLAAQSIQLGINDVV  120

Query  669  VAGGMESMSNVHKYFAEAR  725
            VAGGMESMSNV KY AEAR
Sbjct  121  VAGGMESMSNVPKYLAEAR  139



>ref|XP_006353096.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Solanum 
tuberosum]
Length=404

 Score =   284 bits (726),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAPATAE+I  RDVC+VGVARTPMGGFLGSLSS+ ATKLGSIAI  A+KR +VDPSLVEE
Sbjct  1     MAPATAESIKPRDVCVVGVARTPMGGFLGSLSSVSATKLGSIAIAGAIKRANVDPSLVEE  60

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAG+PNTV+C+TVNKVCASGMKATMLAAQSIQLGINDVV
Sbjct  61    VFFGNVLSANLGQAPARQAALGAGLPNTVICTTVNKVCASGMKATMLAAQSIQLGINDVV  120

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGME+MSNVPKYFAEARKGSRLGHDSLVDGML
Sbjct  121   VAGGMENMSNVPKYFAEARKGSRLGHDSLVDGML  154


 Score =   246 bits (628),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAPATAE+I  RDVC+VGVARTPMGGFLGSLSS+ ATKLGS+AI  A+KRA+VDPSLVEE
Sbjct  1    MAPATAESIKPRDVCVVGVARTPMGGFLGSLSSVSATKLGSIAIAGAIKRANVDPSLVEE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAG+PNTV+C+TVNKVCASGMKAT+LAAQSIQLGINDVV
Sbjct  61   VFFGNVLSANLGQAPARQAALGAGLPNTVICTTVNKVCASGMKATMLAAQSIQLGINDVV  120

Query  669  VAGGMESMSNVHKYFAEAR  725
            VAGGME+MSNV KYFAEAR
Sbjct  121  VAGGMENMSNVPKYFAEAR  139



>ref|XP_006357655.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Solanum 
tuberosum]
Length=404

 Score =   283 bits (725),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAPA A+TI  RDVCIVGVARTPMG FLGSLSSLPATKLGSIAIE ALK+ +VDPSLVEE
Sbjct  1     MAPAAADTIKPRDVCIVGVARTPMGSFLGSLSSLPATKLGSIAIEGALKKANVDPSLVEE  60

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAG+PNTVVC+TVNKVCASG+KATMLAAQSIQLGIN+VV
Sbjct  61    VFFGNVLSANLGQAPARQAALGAGLPNTVVCTTVNKVCASGLKATMLAAQSIQLGINEVV  120

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  121   VAGGMESMSNVPKYIAEARKGSRLGHDSLVDGML  154


 Score =   245 bits (626),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAPA A+TI  RDVCIVGVARTPMG FLGSLSSLPATKLGS+AIE ALK+A+VDPSLVEE
Sbjct  1    MAPAAADTIKPRDVCIVGVARTPMGSFLGSLSSLPATKLGSIAIEGALKKANVDPSLVEE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAG+PNTVVC+TVNKVCASG+KAT+LAAQSIQLGIN+VV
Sbjct  61   VFFGNVLSANLGQAPARQAALGAGLPNTVVCTTVNKVCASGLKATMLAAQSIQLGINEVV  120

Query  669  VAGGMESMSNVHKYFAEAR  725
            VAGGMESMSNV KY AEAR
Sbjct  121  VAGGMESMSNVPKYIAEAR  139



>ref|XP_004239258.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Solanum 
lycopersicum]
Length=404

 Score =   283 bits (723),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAPATAE+I  RD+C+VGVARTPMGGFLGSLSS+ ATKLGSIAI  A+KR ++DP+LVEE
Sbjct  1     MAPATAESIKPRDICVVGVARTPMGGFLGSLSSVSATKLGSIAIAGAIKRANIDPALVEE  60

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPNTV+C+TVNKVCASGMKATMLAAQSIQLGINDVV
Sbjct  61    VFFGNVLSANLGQAPARQAALGAGIPNTVICTTVNKVCASGMKATMLAAQSIQLGINDVV  120

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGME+MSNVPKYFAEARKGSRLGHDSLVDGML
Sbjct  121   VAGGMENMSNVPKYFAEARKGSRLGHDSLVDGML  154


 Score =   245 bits (625),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAPATAE+I  RD+C+VGVARTPMGGFLGSLSS+ ATKLGS+AI  A+KRA++DP+LVEE
Sbjct  1    MAPATAESIKPRDICVVGVARTPMGGFLGSLSSVSATKLGSIAIAGAIKRANIDPALVEE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPNTV+C+TVNKVCASGMKAT+LAAQSIQLGINDVV
Sbjct  61   VFFGNVLSANLGQAPARQAALGAGIPNTVICTTVNKVCASGMKATMLAAQSIQLGINDVV  120

Query  669  VAGGMESMSNVHKYFAEAR  725
            VAGGME+MSNV KYFAEAR
Sbjct  121  VAGGMENMSNVPKYFAEAR  139



>gb|EYU42778.1| hypothetical protein MIMGU_mgv1a007511mg [Erythranthe guttata]
Length=401

 Score =   282 bits (722),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 147/155 (95%), Gaps = 1/155 (1%)
 Frame = +2

Query  1178  MAPATA-ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             MAPA A ++I  RDVCIVGVARTPMG FLGSLSS+PATKLGS+AIE ALKR ++DPSLVE
Sbjct  1     MAPAAANDSIKPRDVCIVGVARTPMGAFLGSLSSVPATKLGSVAIEGALKRANIDPSLVE  60

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EVFFGNVLSANLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKATMLAAQSIQLGINDV
Sbjct  61    EVFFGNVLSANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMLAAQSIQLGINDV  120

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VVAGGMESMSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  121   VVAGGMESMSNVPKYLAEARKGSRLGHDSLVDGML  155


 Score =   244 bits (623),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 131/140 (94%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPATA-ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            MAPA A ++I  RDVCIVGVARTPMG FLGSLSS+PATKLGS+AIE ALKRA++DPSLVE
Sbjct  1    MAPAAANDSIKPRDVCIVGVARTPMGAFLGSLSSVPATKLGSVAIEGALKRANIDPSLVE  60

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EVFFGNVL ANLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKAT+LAAQSIQLGINDV
Sbjct  61   EVFFGNVLSANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMLAAQSIQLGINDV  120

Query  666  VVAGGMESMSNVHKYFAEAR  725
            VVAGGMESMSNV KY AEAR
Sbjct  121  VVAGGMESMSNVPKYLAEAR  140



>gb|EYU42777.1| hypothetical protein MIMGU_mgv1a007511mg [Erythranthe guttata]
Length=405

 Score =   282 bits (722),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/155 (90%), Positives = 147/155 (95%), Gaps = 1/155 (1%)
 Frame = +2

Query  1178  MAPATA-ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             MAPA A ++I  RDVCIVGVARTPMG FLGSLSS+PATKLGS+AIE ALKR ++DPSLVE
Sbjct  1     MAPAAANDSIKPRDVCIVGVARTPMGAFLGSLSSVPATKLGSVAIEGALKRANIDPSLVE  60

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EVFFGNVLSANLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKATMLAAQSIQLGINDV
Sbjct  61    EVFFGNVLSANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMLAAQSIQLGINDV  120

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VVAGGMESMSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  121   VVAGGMESMSNVPKYLAEARKGSRLGHDSLVDGML  155


 Score =   244 bits (624),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 131/140 (94%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPATA-ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            MAPA A ++I  RDVCIVGVARTPMG FLGSLSS+PATKLGS+AIE ALKRA++DPSLVE
Sbjct  1    MAPAAANDSIKPRDVCIVGVARTPMGAFLGSLSSVPATKLGSVAIEGALKRANIDPSLVE  60

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EVFFGNVL ANLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKAT+LAAQSIQLGINDV
Sbjct  61   EVFFGNVLSANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMLAAQSIQLGINDV  120

Query  666  VVAGGMESMSNVHKYFAEAR  725
            VVAGGMESMSNV KY AEAR
Sbjct  121  VVAGGMESMSNVPKYLAEAR  140



>ref|XP_009761997.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X3 [Nicotiana sylvestris]
 ref|XP_009761998.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X3 [Nicotiana sylvestris]
Length=332

 Score =   280 bits (715),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAPATAE+I  RDVC+VGVARTPMGGFLGSLSSL ATKLGSIAI  AL+R +VDPSLVEE
Sbjct  1     MAPATAESIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIAGALQRANVDPSLVEE  60

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAAL AGIPN+V+C+TVNKVCASGMKATMLAAQS+QLGINDVV
Sbjct  61    VFFGNVLSANLGQAPARQAALSAGIPNSVICTTVNKVCASGMKATMLAAQSVQLGINDVV  120

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGME+MSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  121   VAGGMENMSNVPKYIAEARKGSRLGHDSLVDGML  154


 Score =   241 bits (616),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAPATAE+I  RDVC+VGVARTPMGGFLGSLSSL ATKLGS+AI  AL+RA+VDPSLVEE
Sbjct  1    MAPATAESIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIAGALQRANVDPSLVEE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAAL AGIPN+V+C+TVNKVCASGMKAT+LAAQS+QLGINDVV
Sbjct  61   VFFGNVLSANLGQAPARQAALSAGIPNSVICTTVNKVCASGMKATMLAAQSVQLGINDVV  120

Query  669  VAGGMESMSNVHKYFAEAR  725
            VAGGME+MSNV KY AEAR
Sbjct  121  VAGGMENMSNVPKYIAEAR  139



>ref|XP_009590926.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Nicotiana 
tomentosiformis]
 gb|AAU95618.1| cytosolic acetoacetyl-coenzyme A thiolase [Nicotiana tabacum]
Length=404

 Score =   282 bits (721),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAPA A++I  RDVCIVGVARTPMGGFLGSLSSL ATKLGSIAIE ALK+ +VDPSLVEE
Sbjct  1     MAPAAADSIKPRDVCIVGVARTPMGGFLGSLSSLSATKLGSIAIEGALKKANVDPSLVEE  60

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPNTVVC+ VNKVCASG+KATMLAAQSIQLGINDVV
Sbjct  61    VFFGNVLSANLGQAPARQAALGAGIPNTVVCTAVNKVCASGLKATMLAAQSIQLGINDVV  120

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  121   VAGGMESMSNVPKYIAEARKGSRLGHDSLVDGML  154


 Score =   244 bits (622),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAPA A++I  RDVCIVGVARTPMGGFLGSLSSL ATKLGS+AIE ALK+A+VDPSLVEE
Sbjct  1    MAPAAADSIKPRDVCIVGVARTPMGGFLGSLSSLSATKLGSIAIEGALKKANVDPSLVEE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPNTVVC+ VNKVCASG+KAT+LAAQSIQLGINDVV
Sbjct  61   VFFGNVLSANLGQAPARQAALGAGIPNTVVCTAVNKVCASGLKATMLAAQSIQLGINDVV  120

Query  669  VAGGMESMSNVHKYFAEAR  725
            VAGGMESMSNV KY AEAR
Sbjct  121  VAGGMESMSNVPKYIAEAR  139



>ref|XP_009759542.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Nicotiana 
sylvestris]
Length=404

 Score =   281 bits (720),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAPA A++I  RDVCIVGVARTPMG FLGSLSSL ATKLGSIAIE ALK+ +VDPSLVEE
Sbjct  1     MAPAAADSIKPRDVCIVGVARTPMGAFLGSLSSLSATKLGSIAIEGALKKANVDPSLVEE  60

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPNTVVC+TVNKVCASG+KATMLAAQSIQLGINDVV
Sbjct  61    VFFGNVLSANLGQAPARQAALGAGIPNTVVCTTVNKVCASGLKATMLAAQSIQLGINDVV  120

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  121   VAGGMESMSNVPKYIAEARKGSRLGHDSLVDGML  154


 Score =   244 bits (622),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAPA A++I  RDVCIVGVARTPMG FLGSLSSL ATKLGS+AIE ALK+A+VDPSLVEE
Sbjct  1    MAPAAADSIKPRDVCIVGVARTPMGAFLGSLSSLSATKLGSIAIEGALKKANVDPSLVEE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPNTVVC+TVNKVCASG+KAT+LAAQSIQLGINDVV
Sbjct  61   VFFGNVLSANLGQAPARQAALGAGIPNTVVCTTVNKVCASGLKATMLAAQSIQLGINDVV  120

Query  669  VAGGMESMSNVHKYFAEAR  725
            VAGGMESMSNV KY AEAR
Sbjct  121  VAGGMESMSNVPKYIAEAR  139



>ref|XP_009761996.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X2 [Nicotiana sylvestris]
Length=348

 Score =   280 bits (715),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAPATAE+I  RDVC+VGVARTPMGGFLGSLSSL ATKLGSIAI  AL+R +VDPSLVEE
Sbjct  1     MAPATAESIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIAGALQRANVDPSLVEE  60

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAAL AGIPN+V+C+TVNKVCASGMKATMLAAQS+QLGINDVV
Sbjct  61    VFFGNVLSANLGQAPARQAALSAGIPNSVICTTVNKVCASGMKATMLAAQSVQLGINDVV  120

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGME+MSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  121   VAGGMENMSNVPKYIAEARKGSRLGHDSLVDGML  154


 Score =   242 bits (617),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAPATAE+I  RDVC+VGVARTPMGGFLGSLSSL ATKLGS+AI  AL+RA+VDPSLVEE
Sbjct  1    MAPATAESIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIAGALQRANVDPSLVEE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAAL AGIPN+V+C+TVNKVCASGMKAT+LAAQS+QLGINDVV
Sbjct  61   VFFGNVLSANLGQAPARQAALSAGIPNSVICTTVNKVCASGMKATMLAAQSVQLGINDVV  120

Query  669  VAGGMESMSNVHKYFAEAR  725
            VAGGME+MSNV KY AEAR
Sbjct  121  VAGGMENMSNVPKYIAEAR  139



>dbj|BAF98276.1| acetyl-CoA C-acetyltransferase [Hevea brasiliensis]
Length=404

 Score =   281 bits (718),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAP  A  I  RDVCIVGVARTPMGGFLG LS+LPATKLGSIAIE+ALKR SVDPSLV+E
Sbjct  1     MAPVAAAEIKPRDVCIVGVARTPMGGFLGLLSTLPATKLGSIAIEAALKRASVDPSLVQE  60

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPN+VVC+TVNKVCASGMKATMLAAQSIQLGINDVV
Sbjct  61    VFFGNVLSANLGQAPARQAALGAGIPNSVVCTTVNKVCASGMKATMLAAQSIQLGINDVV  120

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSN PKY AEARKGSRLGHDSLVDGML
Sbjct  121   VAGGMESMSNAPKYLAEARKGSRLGHDSLVDGML  154


 Score =   243 bits (619),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAP  A  I  RDVCIVGVARTPMGGFLG LS+LPATKLGS+AIE+ALKRASVDPSLV+E
Sbjct  1    MAPVAAAEIKPRDVCIVGVARTPMGGFLGLLSTLPATKLGSIAIEAALKRASVDPSLVQE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPN+VVC+TVNKVCASGMKAT+LAAQSIQLGINDVV
Sbjct  61   VFFGNVLSANLGQAPARQAALGAGIPNSVVCTTVNKVCASGMKATMLAAQSIQLGINDVV  120

Query  669  VAGGMESMSNVHKYFAEAR  725
            VAGGMESMSN  KY AEAR
Sbjct  121  VAGGMESMSNAPKYLAEAR  139



>ref|XP_009761989.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009761990.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009761991.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009761992.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009761993.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009761994.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009761995.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Nicotiana sylvestris]
Length=404

 Score =   279 bits (714),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAPATAE+I  RDVC+VGVARTPMGGFLGSLSSL ATKLGSIAI  AL+R +VDPSLVEE
Sbjct  1     MAPATAESIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIAGALQRANVDPSLVEE  60

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAAL AGIPN+V+C+TVNKVCASGMKATMLAAQS+QLGINDVV
Sbjct  61    VFFGNVLSANLGQAPARQAALSAGIPNSVICTTVNKVCASGMKATMLAAQSVQLGINDVV  120

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGME+MSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  121   VAGGMENMSNVPKYIAEARKGSRLGHDSLVDGML  154


 Score =   241 bits (614),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAPATAE+I  RDVC+VGVARTPMGGFLGSLSSL ATKLGS+AI  AL+RA+VDPSLVEE
Sbjct  1    MAPATAESIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIAGALQRANVDPSLVEE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAAL AGIPN+V+C+TVNKVCASGMKAT+LAAQS+QLGINDVV
Sbjct  61   VFFGNVLSANLGQAPARQAALSAGIPNSVICTTVNKVCASGMKATMLAAQSVQLGINDVV  120

Query  669  VAGGMESMSNVHKYFAEAR  725
            VAGGME+MSNV KY AEAR
Sbjct  121  VAGGMENMSNVPKYIAEAR  139



>ref|XP_009361536.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Pyrus x 
bretschneideri]
Length=408

 Score =   279 bits (713),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 149/158 (94%), Gaps = 4/158 (3%)
 Frame = +2

Query  1178  MAPATAE----TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPS  1345
             MAP  AE    +I  RDVCIVGVARTPMGGFLG+LSS+PATKLGSIAIE+ALKR +VDP+
Sbjct  1     MAPVAAEACSDSIKPRDVCIVGVARTPMGGFLGALSSVPATKLGSIAIEAALKRANVDPA  60

Query  1346  LVEEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGI  1525
             LVEEVFFGNVLSANLGQAPARQAALGAG+PN+V+C+TVNKVCASG+KATMLAAQSIQLGI
Sbjct  61    LVEEVFFGNVLSANLGQAPARQAALGAGLPNSVICTTVNKVCASGLKATMLAAQSIQLGI  120

Query  1526  NDVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             NDVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML
Sbjct  121   NDVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  158


 Score =   241 bits (614),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 133/143 (93%), Gaps = 4/143 (3%)
 Frame = +3

Query  309  MAPATAE----TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPS  476
            MAP  AE    +I  RDVCIVGVARTPMGGFLG+LSS+PATKLGS+AIE+ALKRA+VDP+
Sbjct  1    MAPVAAEACSDSIKPRDVCIVGVARTPMGGFLGALSSVPATKLGSIAIEAALKRANVDPA  60

Query  477  LVEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGI  656
            LVEEVFFGNVL ANLGQAPARQAALGAG+PN+V+C+TVNKVCASG+KAT+LAAQSIQLGI
Sbjct  61   LVEEVFFGNVLSANLGQAPARQAALGAGLPNSVICTTVNKVCASGLKATMLAAQSIQLGI  120

Query  657  NDVVVAGGMESMSNVHKYFAEAR  725
            NDVVVAGGMESMSNV KYFAEAR
Sbjct  121  NDVVVAGGMESMSNVPKYFAEAR  143



>gb|ACU87560.2| acetyl-CoA C-acetyltransferase [Bacopa monnieri]
Length=405

 Score =   278 bits (712),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 148/155 (95%), Gaps = 1/155 (1%)
 Frame = +2

Query  1178  MAPATA-ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             MAPA A ++I  ++VCIVGVARTPMGGFLGSLSSL ATKLGS+AIESALKR ++DPSLV+
Sbjct  1     MAPAAAADSIQPKNVCIVGVARTPMGGFLGSLSSLSATKLGSVAIESALKRANLDPSLVQ  60

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EVFFGNVLSANLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKATMLAAQSIQLGINDV
Sbjct  61    EVFFGNVLSANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMLAAQSIQLGINDV  120

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VVAGGMESMSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  121   VVAGGMESMSNVPKYLAEARKGSRLGHDSLVDGML  155


 Score =   241 bits (614),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 132/140 (94%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPATA-ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            MAPA A ++I  ++VCIVGVARTPMGGFLGSLSSL ATKLGS+AIESALKRA++DPSLV+
Sbjct  1    MAPAAAADSIQPKNVCIVGVARTPMGGFLGSLSSLSATKLGSVAIESALKRANLDPSLVQ  60

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EVFFGNVL ANLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKAT+LAAQSIQLGINDV
Sbjct  61   EVFFGNVLSANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMLAAQSIQLGINDV  120

Query  666  VVAGGMESMSNVHKYFAEAR  725
            VVAGGMESMSNV KY AEAR
Sbjct  121  VVAGGMESMSNVPKYLAEAR  140



>ref|XP_011100512.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Sesamum 
indicum]
Length=403

 Score =   278 bits (712),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 146/154 (95%), Gaps = 1/154 (1%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAPA  ++I  RDVCIVGVARTPMGGFLGSLSSL ATKLGSIAIESALKR +VDPS V+E
Sbjct  1     MAPA-GDSIKPRDVCIVGVARTPMGGFLGSLSSLSATKLGSIAIESALKRANVDPSSVQE  59

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAA+GAGIPNTVVC+TVNKVCASGMKATMLAAQSIQLGINDVV
Sbjct  60    VFFGNVLSANLGQAPARQAAIGAGIPNTVVCTTVNKVCASGMKATMLAAQSIQLGINDVV  119

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  120   VAGGMESMSNVPKYLAEARKGSRLGHDSLVDGML  153


 Score =   241 bits (614),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 130/139 (94%), Gaps = 1/139 (1%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAPA  ++I  RDVCIVGVARTPMGGFLGSLSSL ATKLGS+AIESALKRA+VDPS V+E
Sbjct  1    MAPA-GDSIKPRDVCIVGVARTPMGGFLGSLSSLSATKLGSIAIESALKRANVDPSSVQE  59

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAA+GAGIPNTVVC+TVNKVCASGMKAT+LAAQSIQLGINDVV
Sbjct  60   VFFGNVLSANLGQAPARQAAIGAGIPNTVVCTTVNKVCASGMKATMLAAQSIQLGINDVV  119

Query  669  VAGGMESMSNVHKYFAEAR  725
            VAGGMESMSNV KY AEAR
Sbjct  120  VAGGMESMSNVPKYLAEAR  138



>gb|ABV08820.1| acetoacetyl-coenzyme A thiolase [Salvia miltiorrhiza]
Length=399

 Score =   278 bits (711),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 148/154 (96%), Gaps = 1/154 (1%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAP  A +IN +DVCIVGVARTPMGGFLGSLSS+PATKLGS+AI+SALKR ++DPSLV+E
Sbjct  1     MAPEAA-SINPKDVCIVGVARTPMGGFLGSLSSVPATKLGSVAIQSALKRANIDPSLVQE  59

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKATMLAAQSIQLG+NDVV
Sbjct  60    VFFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKATMLAAQSIQLGLNDVV  119

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  120   VAGGMESMSNVPKYIAEARKGSRLGHDSLVDGML  153


 Score =   240 bits (613),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 132/139 (95%), Gaps = 1/139 (1%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAP  A +IN +DVCIVGVARTPMGGFLGSLSS+PATKLGS+AI+SALKRA++DPSLV+E
Sbjct  1    MAPEAA-SINPKDVCIVGVARTPMGGFLGSLSSVPATKLGSVAIQSALKRANIDPSLVQE  59

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKAT+LAAQSIQLG+NDVV
Sbjct  60   VFFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKATMLAAQSIQLGLNDVV  119

Query  669  VAGGMESMSNVHKYFAEAR  725
            VAGGMESMSNV KY AEAR
Sbjct  120  VAGGMESMSNVPKYIAEAR  138



>ref|XP_012081504.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Jatropha 
curcas]
 ref|XP_012081505.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Jatropha 
curcas]
 gb|KDP29950.1| hypothetical protein JCGZ_18519 [Jatropha curcas]
Length=403

 Score =   278 bits (711),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 145/154 (94%), Gaps = 1/154 (1%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAPA AE +  RDVCIVGVARTPMGGFLG+LSSLPATKLGSIAIE+ALKR  VDPSLV+E
Sbjct  1     MAPAAAE-VKPRDVCIVGVARTPMGGFLGTLSSLPATKLGSIAIEAALKRAHVDPSLVQE  59

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGI N+VVC+TVNKVCASGMKATMLAAQSIQLGINDVV
Sbjct  60    VFFGNVLSANLGQAPARQAALGAGISNSVVCTTVNKVCASGMKATMLAAQSIQLGINDVV  119

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSN PKY AEARKGSRLGHDSLVDGML
Sbjct  120   VAGGMESMSNTPKYLAEARKGSRLGHDSLVDGML  153


 Score =   240 bits (612),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 129/139 (93%), Gaps = 1/139 (1%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAPA AE +  RDVCIVGVARTPMGGFLG+LSSLPATKLGS+AIE+ALKRA VDPSLV+E
Sbjct  1    MAPAAAE-VKPRDVCIVGVARTPMGGFLGTLSSLPATKLGSIAIEAALKRAHVDPSLVQE  59

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGI N+VVC+TVNKVCASGMKAT+LAAQSIQLGINDVV
Sbjct  60   VFFGNVLSANLGQAPARQAALGAGISNSVVCTTVNKVCASGMKATMLAAQSIQLGINDVV  119

Query  669  VAGGMESMSNVHKYFAEAR  725
            VAGGMESMSN  KY AEAR
Sbjct  120  VAGGMESMSNTPKYLAEAR  138



>ref|XP_002532204.1| acetyl-CoA acetyltransferase, mitochondrial, putative [Ricinus 
communis]
 gb|EEF30173.1| acetyl-CoA acetyltransferase, mitochondrial, putative [Ricinus 
communis]
Length=232

 Score =   272 bits (695),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 144/154 (94%), Gaps = 4/154 (3%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAP     I  RDVCIVGVARTPMGGFLGSLSSL ATKLGS+AIE+ALKR ++DPSLV+E
Sbjct  1     MAP----EIKPRDVCIVGVARTPMGGFLGSLSSLSATKLGSLAIEAALKRANLDPSLVQE  56

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPN+VVC+TVNKVCASGMKATMLAAQSIQLGINDVV
Sbjct  57    VFFGNVLSANLGQAPARQAALGAGIPNSVVCTTVNKVCASGMKATMLAAQSIQLGINDVV  116

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  117   VAGGMESMSNVPKYLAEARKGSRLGHDSLVDGML  150


 Score =   236 bits (603),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 128/139 (92%), Gaps = 4/139 (3%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAP     I  RDVCIVGVARTPMGGFLGSLSSL ATKLGSLAIE+ALKRA++DPSLV+E
Sbjct  1    MAP----EIKPRDVCIVGVARTPMGGFLGSLSSLSATKLGSLAIEAALKRANLDPSLVQE  56

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPN+VVC+TVNKVCASGMKAT+LAAQSIQLGINDVV
Sbjct  57   VFFGNVLSANLGQAPARQAALGAGIPNSVVCTTVNKVCASGMKATMLAAQSIQLGINDVV  116

Query  669  VAGGMESMSNVHKYFAEAR  725
            VAGGMESMSNV KY AEAR
Sbjct  117  VAGGMESMSNVPKYLAEAR  135



>ref|XP_008365553.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Malus domestica]
Length=408

 Score =   278 bits (710),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 149/158 (94%), Gaps = 4/158 (3%)
 Frame = +2

Query  1178  MAPATAE----TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPS  1345
             MAP +AE    +IN RDVCIVG+ARTPMG FLG+LSS+PATKLGSIAIE+ALKR +VDP+
Sbjct  1     MAPVSAEACSDSINPRDVCIVGIARTPMGAFLGALSSVPATKLGSIAIEAALKRANVDPA  60

Query  1346  LVEEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGI  1525
             LVEEVFFGNVLSANLGQAPARQAALGAGIPN+V+C+TVNKVCASG+KATMLAAQSIQLGI
Sbjct  61    LVEEVFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGLKATMLAAQSIQLGI  120

Query  1526  NDVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             NDVVVAGGMESMSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  121   NDVVVAGGMESMSNVPKYLAEARKGSRLGHDSLVDGML  158


 Score =   239 bits (611),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 133/143 (93%), Gaps = 4/143 (3%)
 Frame = +3

Query  309  MAPATAE----TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPS  476
            MAP +AE    +IN RDVCIVG+ARTPMG FLG+LSS+PATKLGS+AIE+ALKRA+VDP+
Sbjct  1    MAPVSAEACSDSINPRDVCIVGIARTPMGAFLGALSSVPATKLGSIAIEAALKRANVDPA  60

Query  477  LVEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGI  656
            LVEEVFFGNVL ANLGQAPARQAALGAGIPN+V+C+TVNKVCASG+KAT+LAAQSIQLGI
Sbjct  61   LVEEVFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGLKATMLAAQSIQLGI  120

Query  657  NDVVVAGGMESMSNVHKYFAEAR  725
            NDVVVAGGMESMSNV KY AEAR
Sbjct  121  NDVVVAGGMESMSNVPKYLAEAR  143



>gb|AGH32909.1| acetyl-CoA C-acetyltransferase [Camellia chekiangoleosa]
Length=408

 Score =   277 bits (709),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/148 (91%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = +2

Query  1196  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  1375
             +++ +RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAI SALKR  VDPSLV+EVFFGNV
Sbjct  11    DSVKSRDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIGSALKRAHVDPSLVQEVFFGNV  70

Query  1376  LSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGME  1555
             LSANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKATMLAAQSIQLGINDVVVAGGME
Sbjct  71    LSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKATMLAAQSIQLGINDVVVAGGME  130

Query  1556  SMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             SMSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  131   SMSNVPKYLAEARKGSRLGHDSLVDGML  158


 Score =   239 bits (611),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 127/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  327  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNV  506
            +++ +RDVCIVGVARTPMGGFLGSLSSLPATKLGS+AI SALKRA VDPSLV+EVFFGNV
Sbjct  11   DSVKSRDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIGSALKRAHVDPSLVQEVFFGNV  70

Query  507  LGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGME  686
            L ANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKAT+LAAQSIQLGINDVVVAGGME
Sbjct  71   LSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKATMLAAQSIQLGINDVVVAGGME  130

Query  687  SMSNVHKYFAEAR  725
            SMSNV KY AEAR
Sbjct  131  SMSNVPKYLAEAR  143



>gb|AIK21787.1| acetyl-CoA C-acetyltransferase [Panax notoginseng]
Length=408

 Score =   277 bits (708),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 148/158 (94%), Gaps = 4/158 (3%)
 Frame = +2

Query  1178  MAPATA----ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPS  1345
             MAPA A    E+I ARDVCIVG ARTPMGGFLG+LSSL ATKLGSIAI+SALKR +VDP+
Sbjct  1     MAPAAATDCSESIKARDVCIVGAARTPMGGFLGTLSSLSATKLGSIAIQSALKRANVDPA  60

Query  1346  LVEEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGI  1525
             LV+EVFFGNVLSANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKATMLAAQSIQLGI
Sbjct  61    LVQEVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKATMLAAQSIQLGI  120

Query  1526  NDVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             ND+VVAGGMESMSNVPKY AEARKGSRLGHDSLVDG+L
Sbjct  121   NDIVVAGGMESMSNVPKYLAEARKGSRLGHDSLVDGLL  158


 Score =   240 bits (612),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 132/143 (92%), Gaps = 4/143 (3%)
 Frame = +3

Query  309  MAPATA----ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPS  476
            MAPA A    E+I ARDVCIVG ARTPMGGFLG+LSSL ATKLGS+AI+SALKRA+VDP+
Sbjct  1    MAPAAATDCSESIKARDVCIVGAARTPMGGFLGTLSSLSATKLGSIAIQSALKRANVDPA  60

Query  477  LVEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGI  656
            LV+EVFFGNVL ANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKAT+LAAQSIQLGI
Sbjct  61   LVQEVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKATMLAAQSIQLGI  120

Query  657  NDVVVAGGMESMSNVHKYFAEAR  725
            ND+VVAGGMESMSNV KY AEAR
Sbjct  121  NDIVVAGGMESMSNVPKYLAEAR  143



>gb|KDO50952.1| hypothetical protein CISIN_1g0154952mg, partial [Citrus sinensis]
Length=262

 Score =   272 bits (695),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 146/155 (94%), Gaps = 1/155 (1%)
 Frame = +2

Query  1178  MAPATA-ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             MAPA A ++I  RDVCIVGVARTPMGGFLG+LSSL ATKLGSIAIE+ALKR +VDPSLV+
Sbjct  1     MAPAAASDSIKPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIEAALKRANVDPSLVQ  60

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EVFFGNVLSANLGQAPARQAALGAGIPN+VVC+TVNKVCASG+KA MLA+QSIQLGINDV
Sbjct  61    EVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTVNKVCASGLKAIMLASQSIQLGINDV  120

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             +VAGGMESMSN PKY AEARKGSRLGHDSLVDGML
Sbjct  121   IVAGGMESMSNAPKYLAEARKGSRLGHDSLVDGML  155


 Score =   234 bits (598),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 130/140 (93%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPATA-ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            MAPA A ++I  RDVCIVGVARTPMGGFLG+LSSL ATKLGS+AIE+ALKRA+VDPSLV+
Sbjct  1    MAPAAASDSIKPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIEAALKRANVDPSLVQ  60

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EVFFGNVL ANLGQAPARQAALGAGIPN+VVC+TVNKVCASG+KA +LA+QSIQLGINDV
Sbjct  61   EVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTVNKVCASGLKAIMLASQSIQLGINDV  120

Query  666  VVAGGMESMSNVHKYFAEAR  725
            +VAGGMESMSN  KY AEAR
Sbjct  121  IVAGGMESMSNAPKYLAEAR  140



>ref|XP_010252788.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Nelumbo 
nucifera]
 ref|XP_010252789.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Nelumbo 
nucifera]
Length=406

 Score =   276 bits (706),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +2

Query  1172  LAMAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLV  1351
             +A A A A++I  RDVCIVGVARTPMGGFLGSLSSL ATKLGSIAIE ALKR +VDPSLV
Sbjct  1     MAPAAAVADSIKPRDVCIVGVARTPMGGFLGSLSSLSATKLGSIAIECALKRANVDPSLV  60

Query  1352  EEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGIND  1531
             +EVFFGNVLSANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKATMLAAQSIQLGIND
Sbjct  61    QEVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKATMLAAQSIQLGIND  120

Query  1532  VVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             +VVAGGMESMSN PKY AEARKGSRLGHD+LVDGML
Sbjct  121   IVVAGGMESMSNAPKYLAEARKGSRLGHDTLVDGML  156


 Score =   239 bits (610),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = +3

Query  303  LAMAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLV  482
            +A A A A++I  RDVCIVGVARTPMGGFLGSLSSL ATKLGS+AIE ALKRA+VDPSLV
Sbjct  1    MAPAAAVADSIKPRDVCIVGVARTPMGGFLGSLSSLSATKLGSIAIECALKRANVDPSLV  60

Query  483  EEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGIND  662
            +EVFFGNVL ANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKAT+LAAQSIQLGIND
Sbjct  61   QEVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKATMLAAQSIQLGIND  120

Query  663  VVVAGGMESMSNVHKYFAEAR  725
            +VVAGGMESMSN  KY AEAR
Sbjct  121  IVVAGGMESMSNAPKYLAEAR  141



>gb|ADD10719.1| acetyl-CoA C-acetyltransferase protein [Camellia oleifera]
Length=408

 Score =   276 bits (706),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 135/148 (91%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = +2

Query  1196  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  1375
             +++  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAI SALKR  VDPSLV+EVFFGNV
Sbjct  11    DSVKPRDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIGSALKRAHVDPSLVQEVFFGNV  70

Query  1376  LSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGME  1555
             LSANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKATMLAAQSIQLGINDVVVAGGME
Sbjct  71    LSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKATMLAAQSIQLGINDVVVAGGME  130

Query  1556  SMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             SMSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  131   SMSNVPKYLAEARKGSRLGHDSLVDGML  158


 Score =   239 bits (609),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 117/133 (88%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  327  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNV  506
            +++  RDVCIVGVARTPMGGFLGSLSSLPATKLGS+AI SALKRA VDPSLV+EVFFGNV
Sbjct  11   DSVKPRDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIGSALKRAHVDPSLVQEVFFGNV  70

Query  507  LGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGME  686
            L ANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKAT+LAAQSIQLGINDVVVAGGME
Sbjct  71   LSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKATMLAAQSIQLGINDVVVAGGME  130

Query  687  SMSNVHKYFAEAR  725
            SMSNV KY AEAR
Sbjct  131  SMSNVPKYLAEAR  143



>gb|AEC13714.1| acetoacetyl-CoA thiolase [Catharanthus roseus]
Length=405

 Score =   276 bits (705),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 147/155 (95%), Gaps = 1/155 (1%)
 Frame = +2

Query  1178  MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             MAPA A+ +I  RDVCIVGVARTPMGGFLG+LSSL ATKLGSIAIESALKR  VDPSLV+
Sbjct  1     MAPAAAKNSIKPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIESALKRAKVDPSLVQ  60

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EVFFGNVLSANLGQAPARQAALGAGIPNTV+C+T+NKVCASGMKATMLAAQSIQLG+ND+
Sbjct  61    EVFFGNVLSANLGQAPARQAALGAGIPNTVICTTINKVCASGMKATMLAAQSIQLGVNDI  120

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VVAGGMESMSNVPKY A+ARKGSRLGHD+LVDGM+
Sbjct  121   VVAGGMESMSNVPKYIADARKGSRLGHDTLVDGMM  155


 Score =   240 bits (613),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 131/140 (94%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            MAPA A+ +I  RDVCIVGVARTPMGGFLG+LSSL ATKLGS+AIESALKRA VDPSLV+
Sbjct  1    MAPAAAKNSIKPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIESALKRAKVDPSLVQ  60

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EVFFGNVL ANLGQAPARQAALGAGIPNTV+C+T+NKVCASGMKAT+LAAQSIQLG+ND+
Sbjct  61   EVFFGNVLSANLGQAPARQAALGAGIPNTVICTTINKVCASGMKATMLAAQSIQLGVNDI  120

Query  666  VVAGGMESMSNVHKYFAEAR  725
            VVAGGMESMSNV KY A+AR
Sbjct  121  VVAGGMESMSNVPKYIADAR  140



>ref|XP_002265690.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Vitis vinifera]
 ref|XP_010657485.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Vitis vinifera]
 emb|CBI28461.3| unnamed protein product [Vitis vinifera]
Length=404

 Score =   276 bits (705),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAPA A +I  RDVCIVGVARTPMGGFLG+LSSL ATKLGSIAIE+ALKR +VD SLV+E
Sbjct  1     MAPAAAASIKPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIEAALKRANVDASLVQE  60

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKATMLAAQSIQLG+ND+V
Sbjct  61    VFFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKATMLAAQSIQLGVNDIV  120

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             V+GGMESMSNVPKY AEARKGSR GHDSLVDGML
Sbjct  121   VSGGMESMSNVPKYLAEARKGSRFGHDSLVDGML  154


 Score =   239 bits (609),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAPA A +I  RDVCIVGVARTPMGGFLG+LSSL ATKLGS+AIE+ALKRA+VD SLV+E
Sbjct  1    MAPAAAASIKPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIEAALKRANVDASLVQE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKAT+LAAQSIQLG+ND+V
Sbjct  61   VFFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKATMLAAQSIQLGVNDIV  120

Query  669  VAGGMESMSNVHKYFAEAR  725
            V+GGMESMSNV KY AEAR
Sbjct  121  VSGGMESMSNVPKYLAEAR  139



>gb|EPS67778.1| hypothetical protein M569_06996, partial [Genlisea aurea]
Length=348

 Score =   274 bits (700),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 146/156 (94%), Gaps = 2/156 (1%)
 Frame = +2

Query  1178  MAPA--TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLV  1351
             MAPA  T +TI  RDVCIVGVARTPMGGFLG+LSSL A K+GS+AI++ALKR +VDPSL+
Sbjct  1     MAPAADTTDTIKPRDVCIVGVARTPMGGFLGTLSSLSAIKIGSVAIQAALKRANVDPSLI  60

Query  1352  EEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGIND  1531
             +EVFFGNVLSANLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKATMLAAQSI+LGIND
Sbjct  61    QEVFFGNVLSANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMLAAQSIELGIND  120

Query  1532  VVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
              VVAGGMESMSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  121   FVVAGGMESMSNVPKYLAEARKGSRLGHDSLVDGML  156


 Score =   236 bits (603),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 130/141 (92%), Gaps = 2/141 (1%)
 Frame = +3

Query  309  MAPA--TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLV  482
            MAPA  T +TI  RDVCIVGVARTPMGGFLG+LSSL A K+GS+AI++ALKRA+VDPSL+
Sbjct  1    MAPAADTTDTIKPRDVCIVGVARTPMGGFLGTLSSLSAIKIGSVAIQAALKRANVDPSLI  60

Query  483  EEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGIND  662
            +EVFFGNVL ANLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKAT+LAAQSI+LGIND
Sbjct  61   QEVFFGNVLSANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMLAAQSIELGIND  120

Query  663  VVVAGGMESMSNVHKYFAEAR  725
             VVAGGMESMSNV KY AEAR
Sbjct  121  FVVAGGMESMSNVPKYLAEAR  141



>gb|AAL18928.1|AF429387_1 truncated acetyl Co-A acetyltransferase-like protein [Hevea brasiliensis]
Length=232

 Score =   270 bits (689),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +2

Query  1202  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  1381
             I  RDVCIVGVARTPMGGFLGSL +L ATKLGSIAIE+ALKR +VDPSLV+EVFFGNVLS
Sbjct  13    IKPRDVCIVGVARTPMGGFLGSLCTLSATKLGSIAIEAALKRANVDPSLVQEVFFGNVLS  72

Query  1382  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESM  1561
             ANLGQAPARQAALGAGIPN+VVC+TVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESM
Sbjct  73    ANLGQAPARQAALGAGIPNSVVCTTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESM  132

Query  1562  SNVPKYFAEARKGSRLGHDSLVDGML  1639
             SN PKY AEARKGSRLGHDSLVDGML
Sbjct  133   SNAPKYLAEARKGSRLGHDSLVDGML  158


 Score =   231 bits (589),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +3

Query  333  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLG  512
            I  RDVCIVGVARTPMGGFLGSL +L ATKLGS+AIE+ALKRA+VDPSLV+EVFFGNVL 
Sbjct  13   IKPRDVCIVGVARTPMGGFLGSLCTLSATKLGSIAIEAALKRANVDPSLVQEVFFGNVLS  72

Query  513  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESM  692
            ANLGQAPARQAALGAGIPN+VVC+TVNKVCASGMKAT+LAAQSIQLGINDVVVAGGMESM
Sbjct  73   ANLGQAPARQAALGAGIPNSVVCTTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESM  132

Query  693  SNVHKYFAEAR  725
            SN  KY AEAR
Sbjct  133  SNAPKYLAEAR  143



>gb|KJB42687.1| hypothetical protein B456_007G165600 [Gossypium raimondii]
Length=352

 Score =   273 bits (699),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 148/157 (94%), Gaps = 3/157 (2%)
 Frame = +2

Query  1178  MAP---ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSL  1348
             MAP   A++++I  RDVC+VGVARTPMGGFLGSLSSL ATKLGSIAIE+ALKR +V+PSL
Sbjct  1     MAPVAAASSDSIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIEAALKRANVNPSL  60

Query  1349  VEEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGIN  1528
             V+EVFFGNVLSANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKATMLAAQSIQLGIN
Sbjct  61    VQEVFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKATMLAAQSIQLGIN  120

Query  1529  DVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             DVVVAGGMESMSNVPKY  EARKGSRLGHD+LVDGML
Sbjct  121   DVVVAGGMESMSNVPKYLGEARKGSRLGHDTLVDGML  157


 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 132/142 (93%), Gaps = 3/142 (2%)
 Frame = +3

Query  309  MAP---ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSL  479
            MAP   A++++I  RDVC+VGVARTPMGGFLGSLSSL ATKLGS+AIE+ALKRA+V+PSL
Sbjct  1    MAPVAAASSDSIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIEAALKRANVNPSL  60

Query  480  VEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGIN  659
            V+EVFFGNVL ANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKAT+LAAQSIQLGIN
Sbjct  61   VQEVFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKATMLAAQSIQLGIN  120

Query  660  DVVVAGGMESMSNVHKYFAEAR  725
            DVVVAGGMESMSNV KY  EAR
Sbjct  121  DVVVAGGMESMSNVPKYLGEAR  142



>ref|XP_007215468.1| hypothetical protein PRUPE_ppa006513mg [Prunus persica]
 gb|EMJ16667.1| hypothetical protein PRUPE_ppa006513mg [Prunus persica]
Length=408

 Score =   275 bits (704),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 147/158 (93%), Gaps = 4/158 (3%)
 Frame = +2

Query  1178  MAPATAE----TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPS  1345
             MAP TAE    +I  RDV IVGVARTPMG FLG+LSSLPATKLGSIAIE+ALKR +VDPS
Sbjct  1     MAPVTAEACSDSIKPRDVYIVGVARTPMGAFLGALSSLPATKLGSIAIEAALKRANVDPS  60

Query  1346  LVEEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGI  1525
             LVEEVFFGNVLSANLGQAPARQAALGAGIPN+V+C+TVNKVCASG+KATMLAAQSIQLGI
Sbjct  61    LVEEVFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGLKATMLAAQSIQLGI  120

Query  1526  NDVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             NDVVVAGGMESMSNVPKY AEARKGSRLGHD+LVDGML
Sbjct  121   NDVVVAGGMESMSNVPKYLAEARKGSRLGHDTLVDGML  158


 Score =   238 bits (607),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 131/143 (92%), Gaps = 4/143 (3%)
 Frame = +3

Query  309  MAPATAE----TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPS  476
            MAP TAE    +I  RDV IVGVARTPMG FLG+LSSLPATKLGS+AIE+ALKRA+VDPS
Sbjct  1    MAPVTAEACSDSIKPRDVYIVGVARTPMGAFLGALSSLPATKLGSIAIEAALKRANVDPS  60

Query  477  LVEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGI  656
            LVEEVFFGNVL ANLGQAPARQAALGAGIPN+V+C+TVNKVCASG+KAT+LAAQSIQLGI
Sbjct  61   LVEEVFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGLKATMLAAQSIQLGI  120

Query  657  NDVVVAGGMESMSNVHKYFAEAR  725
            NDVVVAGGMESMSNV KY AEAR
Sbjct  121  NDVVVAGGMESMSNVPKYLAEAR  143



>gb|KJB42688.1| hypothetical protein B456_007G165600 [Gossypium raimondii]
Length=353

 Score =   273 bits (699),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 148/157 (94%), Gaps = 3/157 (2%)
 Frame = +2

Query  1178  MAP---ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSL  1348
             MAP   A++++I  RDVC+VGVARTPMGGFLGSLSSL ATKLGSIAIE+ALKR +V+PSL
Sbjct  1     MAPVAAASSDSIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIEAALKRANVNPSL  60

Query  1349  VEEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGIN  1528
             V+EVFFGNVLSANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKATMLAAQSIQLGIN
Sbjct  61    VQEVFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKATMLAAQSIQLGIN  120

Query  1529  DVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             DVVVAGGMESMSNVPKY  EARKGSRLGHD+LVDGML
Sbjct  121   DVVVAGGMESMSNVPKYLGEARKGSRLGHDTLVDGML  157


 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 132/142 (93%), Gaps = 3/142 (2%)
 Frame = +3

Query  309  MAP---ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSL  479
            MAP   A++++I  RDVC+VGVARTPMGGFLGSLSSL ATKLGS+AIE+ALKRA+V+PSL
Sbjct  1    MAPVAAASSDSIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIEAALKRANVNPSL  60

Query  480  VEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGIN  659
            V+EVFFGNVL ANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKAT+LAAQSIQLGIN
Sbjct  61   VQEVFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKATMLAAQSIQLGIN  120

Query  660  DVVVAGGMESMSNVHKYFAEAR  725
            DVVVAGGMESMSNV KY  EAR
Sbjct  121  DVVVAGGMESMSNVPKYLGEAR  142



>ref|XP_008229933.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Prunus 
mume]
Length=408

 Score =   275 bits (703),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 147/158 (93%), Gaps = 4/158 (3%)
 Frame = +2

Query  1178  MAPATAE----TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPS  1345
             MAP TAE    +I  RDV IVGVARTPMG FLG+LSSLPATKLGSIAIE+ALKR +VDPS
Sbjct  1     MAPVTAEACSDSIKPRDVYIVGVARTPMGAFLGALSSLPATKLGSIAIEAALKRANVDPS  60

Query  1346  LVEEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGI  1525
             LVEEVFFGNVLSANLGQAPARQAALGAGIPN+V+C+TVNKVCASG+KATMLAAQSIQLGI
Sbjct  61    LVEEVFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGLKATMLAAQSIQLGI  120

Query  1526  NDVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             NDVVVAGGMESMSNVPKY AEARKGSRLGHD+LVDGML
Sbjct  121   NDVVVAGGMESMSNVPKYLAEARKGSRLGHDTLVDGML  158


 Score =   238 bits (607),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 131/143 (92%), Gaps = 4/143 (3%)
 Frame = +3

Query  309  MAPATAE----TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPS  476
            MAP TAE    +I  RDV IVGVARTPMG FLG+LSSLPATKLGS+AIE+ALKRA+VDPS
Sbjct  1    MAPVTAEACSDSIKPRDVYIVGVARTPMGAFLGALSSLPATKLGSIAIEAALKRANVDPS  60

Query  477  LVEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGI  656
            LVEEVFFGNVL ANLGQAPARQAALGAGIPN+V+C+TVNKVCASG+KAT+LAAQSIQLGI
Sbjct  61   LVEEVFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGLKATMLAAQSIQLGI  120

Query  657  NDVVVAGGMESMSNVHKYFAEAR  725
            NDVVVAGGMESMSNV KY AEAR
Sbjct  121  NDVVVAGGMESMSNVPKYLAEAR  143



>gb|KCW58126.1| hypothetical protein EUGRSUZ_H00849 [Eucalyptus grandis]
Length=388

 Score =   274 bits (701),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 147/155 (95%), Gaps = 1/155 (1%)
 Frame = +2

Query  1178  MAPA-TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             MAPA +  +I  RDVCIVGVARTPMGGFLG+LSSLPATKLGSIAIE+ALKR +VDPSLV+
Sbjct  1     MAPAASTASIKPRDVCIVGVARTPMGGFLGTLSSLPATKLGSIAIEAALKRANVDPSLVQ  60

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EV FGNVLSANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKAT++AAQSIQLG+NDV
Sbjct  61    EVLFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKATIIAAQSIQLGVNDV  120

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VVAGGMESMSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  121   VVAGGMESMSNVPKYLAEARKGSRLGHDSLVDGML  155


 Score =   239 bits (609),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 131/140 (94%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPA-TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            MAPA +  +I  RDVCIVGVARTPMGGFLG+LSSLPATKLGS+AIE+ALKRA+VDPSLV+
Sbjct  1    MAPAASTASIKPRDVCIVGVARTPMGGFLGTLSSLPATKLGSIAIEAALKRANVDPSLVQ  60

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EV FGNVL ANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKATI+AAQSIQLG+NDV
Sbjct  61   EVLFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKATIIAAQSIQLGVNDV  120

Query  666  VVAGGMESMSNVHKYFAEAR  725
            VVAGGMESMSNV KY AEAR
Sbjct  121  VVAGGMESMSNVPKYLAEAR  140



>ref|XP_010069705.1| PREDICTED: LOW QUALITY PROTEIN: acetyl-CoA acetyltransferase, 
cytosolic 1-like [Eucalyptus grandis]
Length=405

 Score =   275 bits (702),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 147/155 (95%), Gaps = 1/155 (1%)
 Frame = +2

Query  1178  MAPA-TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             MAPA +  +I  RDVCIVGVARTPMGGFLG+LSSLPATKLGSIAIE+ALKR +VDPSLV+
Sbjct  1     MAPAASTASIKPRDVCIVGVARTPMGGFLGTLSSLPATKLGSIAIEAALKRANVDPSLVQ  60

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EV FGNVLSANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKAT++AAQSIQLG+NDV
Sbjct  61    EVLFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKATIIAAQSIQLGVNDV  120

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VVAGGMESMSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  121   VVAGGMESMSNVPKYLAEARKGSRLGHDSLVDGML  155


 Score =   239 bits (610),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 131/140 (94%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPA-TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            MAPA +  +I  RDVCIVGVARTPMGGFLG+LSSLPATKLGS+AIE+ALKRA+VDPSLV+
Sbjct  1    MAPAASTASIKPRDVCIVGVARTPMGGFLGTLSSLPATKLGSIAIEAALKRANVDPSLVQ  60

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EV FGNVL ANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKATI+AAQSIQLG+NDV
Sbjct  61   EVLFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKATIIAAQSIQLGVNDV  120

Query  666  VVAGGMESMSNVHKYFAEAR  725
            VVAGGMESMSNV KY AEAR
Sbjct  121  VVAGGMESMSNVPKYLAEAR  140



>ref|XP_010547202.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Tarenaya 
hassleriana]
Length=403

 Score =   274 bits (701),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 147/154 (95%), Gaps = 1/154 (1%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAPA A+++ +RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIE+ALKR +VDPSLV+E
Sbjct  1     MAPA-ADSVKSRDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIEAALKRANVDPSLVQE  59

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             V FGNVLSANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA MLAAQSIQLG+N++V
Sbjct  60    VIFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVMLAAQSIQLGVNEIV  119

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSNVPKY AEARKGSR GHDSLVDGML
Sbjct  120   VAGGMESMSNVPKYLAEARKGSRFGHDSLVDGML  153


 Score =   238 bits (606),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 132/139 (95%), Gaps = 1/139 (1%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAPA A+++ +RDVCIVGVARTPMGGFLGSLSSLPATKLGS+AIE+ALKRA+VDPSLV+E
Sbjct  1    MAPA-ADSVKSRDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIEAALKRANVDPSLVQE  59

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            V FGNVL ANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA +LAAQSIQLG+N++V
Sbjct  60   VIFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVMLAAQSIQLGVNEIV  119

Query  669  VAGGMESMSNVHKYFAEAR  725
            VAGGMESMSNV KY AEAR
Sbjct  120  VAGGMESMSNVPKYLAEAR  138



>gb|KHG30083.1| Acetyl-CoA acetyltransferase, cytosolic 1 -like protein [Gossypium 
arboreum]
Length=407

 Score =   274 bits (700),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 136/157 (87%), Positives = 146/157 (93%), Gaps = 3/157 (2%)
 Frame = +2

Query  1178  MAPATA---ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSL  1348
             MAP  A   ++I  RDVC+VGVARTPMGGFLGSLSSL ATKLGSIAIE+ALKR +VDPSL
Sbjct  1     MAPVAATSSDSIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIEAALKRANVDPSL  60

Query  1349  VEEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGIN  1528
             V+EVFFGNVLSANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKATMLAAQSIQLGIN
Sbjct  61    VQEVFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKATMLAAQSIQLGIN  120

Query  1529  DVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             DVVVAGGMESMSNVPKY  EARKGSRLGHD+LVDGML
Sbjct  121   DVVVAGGMESMSNVPKYLGEARKGSRLGHDTLVDGML  157


 Score =   237 bits (605),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 130/142 (92%), Gaps = 3/142 (2%)
 Frame = +3

Query  309  MAPATA---ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSL  479
            MAP  A   ++I  RDVC+VGVARTPMGGFLGSLSSL ATKLGS+AIE+ALKRA+VDPSL
Sbjct  1    MAPVAATSSDSIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIEAALKRANVDPSL  60

Query  480  VEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGIN  659
            V+EVFFGNVL ANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKAT+LAAQSIQLGIN
Sbjct  61   VQEVFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKATMLAAQSIQLGIN  120

Query  660  DVVVAGGMESMSNVHKYFAEAR  725
            DVVVAGGMESMSNV KY  EAR
Sbjct  121  DVVVAGGMESMSNVPKYLGEAR  142



>gb|KJB42690.1| hypothetical protein B456_007G165600 [Gossypium raimondii]
Length=407

 Score =   273 bits (699),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 148/157 (94%), Gaps = 3/157 (2%)
 Frame = +2

Query  1178  MAP---ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSL  1348
             MAP   A++++I  RDVC+VGVARTPMGGFLGSLSSL ATKLGSIAIE+ALKR +V+PSL
Sbjct  1     MAPVAAASSDSIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIEAALKRANVNPSL  60

Query  1349  VEEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGIN  1528
             V+EVFFGNVLSANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKATMLAAQSIQLGIN
Sbjct  61    VQEVFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKATMLAAQSIQLGIN  120

Query  1529  DVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             DVVVAGGMESMSNVPKY  EARKGSRLGHD+LVDGML
Sbjct  121   DVVVAGGMESMSNVPKYLGEARKGSRLGHDTLVDGML  157


 Score =   236 bits (603),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 132/142 (93%), Gaps = 3/142 (2%)
 Frame = +3

Query  309  MAP---ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSL  479
            MAP   A++++I  RDVC+VGVARTPMGGFLGSLSSL ATKLGS+AIE+ALKRA+V+PSL
Sbjct  1    MAPVAAASSDSIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIEAALKRANVNPSL  60

Query  480  VEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGIN  659
            V+EVFFGNVL ANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKAT+LAAQSIQLGIN
Sbjct  61   VQEVFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKATMLAAQSIQLGIN  120

Query  660  DVVVAGGMESMSNVHKYFAEAR  725
            DVVVAGGMESMSNV KY  EAR
Sbjct  121  DVVVAGGMESMSNVPKYLGEAR  142



>gb|KJB42689.1| hypothetical protein B456_007G165600 [Gossypium raimondii]
Length=405

 Score =   273 bits (698),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 148/157 (94%), Gaps = 3/157 (2%)
 Frame = +2

Query  1178  MAP---ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSL  1348
             MAP   A++++I  RDVC+VGVARTPMGGFLGSLSSL ATKLGSIAIE+ALKR +V+PSL
Sbjct  1     MAPVAAASSDSIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIEAALKRANVNPSL  60

Query  1349  VEEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGIN  1528
             V+EVFFGNVLSANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKATMLAAQSIQLGIN
Sbjct  61    VQEVFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKATMLAAQSIQLGIN  120

Query  1529  DVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             DVVVAGGMESMSNVPKY  EARKGSRLGHD+LVDGML
Sbjct  121   DVVVAGGMESMSNVPKYLGEARKGSRLGHDTLVDGML  157


 Score =   236 bits (603),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 132/142 (93%), Gaps = 3/142 (2%)
 Frame = +3

Query  309  MAP---ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSL  479
            MAP   A++++I  RDVC+VGVARTPMGGFLGSLSSL ATKLGS+AIE+ALKRA+V+PSL
Sbjct  1    MAPVAAASSDSIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIEAALKRANVNPSL  60

Query  480  VEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGIN  659
            V+EVFFGNVL ANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKAT+LAAQSIQLGIN
Sbjct  61   VQEVFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKATMLAAQSIQLGIN  120

Query  660  DVVVAGGMESMSNVHKYFAEAR  725
            DVVVAGGMESMSNV KY  EAR
Sbjct  121  DVVVAGGMESMSNVPKYLGEAR  142



>ref|XP_003545555.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Glycine 
max]
Length=407

 Score =   273 bits (698),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 136/157 (87%), Positives = 146/157 (93%), Gaps = 3/157 (2%)
 Frame = +2

Query  1178  MAP---ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSL  1348
             MAP   A++++I  RDVCIVGVARTPMGGFLG+LSSL ATKLGSIAIE+ALKR +VDPSL
Sbjct  1     MAPVAAASSDSIKPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIEAALKRANVDPSL  60

Query  1349  VEEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGIN  1528
             VEEVFFGNVLSANLGQAPARQAALGAGI N+V+C+TVNKVCASGMKA MLAAQSIQLG N
Sbjct  61    VEEVFFGNVLSANLGQAPARQAALGAGISNSVICTTVNKVCASGMKAAMLAAQSIQLGTN  120

Query  1529  DVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             DVVVAGGMESMSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  121   DVVVAGGMESMSNVPKYLAEARKGSRLGHDSLVDGML  157


 Score =   235 bits (599),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 130/142 (92%), Gaps = 3/142 (2%)
 Frame = +3

Query  309  MAP---ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSL  479
            MAP   A++++I  RDVCIVGVARTPMGGFLG+LSSL ATKLGS+AIE+ALKRA+VDPSL
Sbjct  1    MAPVAAASSDSIKPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIEAALKRANVDPSL  60

Query  480  VEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGIN  659
            VEEVFFGNVL ANLGQAPARQAALGAGI N+V+C+TVNKVCASGMKA +LAAQSIQLG N
Sbjct  61   VEEVFFGNVLSANLGQAPARQAALGAGISNSVICTTVNKVCASGMKAAMLAAQSIQLGTN  120

Query  660  DVVVAGGMESMSNVHKYFAEAR  725
            DVVVAGGMESMSNV KY AEAR
Sbjct  121  DVVVAGGMESMSNVPKYLAEAR  142



>emb|CDP18953.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   273 bits (697),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 145/155 (94%), Gaps = 1/155 (1%)
 Frame = +2

Query  1178  MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             MAPA +E +I   DVCIVGVARTPMGGFLGSLSS+PATKLGSIAIE ALK  +VDPSLV+
Sbjct  1     MAPAASENSIKPTDVCIVGVARTPMGGFLGSLSSIPATKLGSIAIERALKGANVDPSLVQ  60

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EV+FGNVLSANLGQAPARQAALGAGIPNTV+C+T+NKVCASGMKATMLAAQSIQLGINDV
Sbjct  61    EVYFGNVLSANLGQAPARQAALGAGIPNTVICTTINKVCASGMKATMLAAQSIQLGINDV  120

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VVAGGMESMSNVPKY  EARKGSRLGHD+LVDGM+
Sbjct  121   VVAGGMESMSNVPKYLGEARKGSRLGHDTLVDGMM  155


 Score =   236 bits (603),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 129/140 (92%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            MAPA +E +I   DVCIVGVARTPMGGFLGSLSS+PATKLGS+AIE ALK A+VDPSLV+
Sbjct  1    MAPAASENSIKPTDVCIVGVARTPMGGFLGSLSSIPATKLGSIAIERALKGANVDPSLVQ  60

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EV+FGNVL ANLGQAPARQAALGAGIPNTV+C+T+NKVCASGMKAT+LAAQSIQLGINDV
Sbjct  61   EVYFGNVLSANLGQAPARQAALGAGIPNTVICTTINKVCASGMKATMLAAQSIQLGINDV  120

Query  666  VVAGGMESMSNVHKYFAEAR  725
            VVAGGMESMSNV KY  EAR
Sbjct  121  VVAGGMESMSNVPKYLGEAR  140



>ref|XP_006469436.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Citrus 
sinensis]
Length=405

 Score =   273 bits (697),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 146/155 (94%), Gaps = 1/155 (1%)
 Frame = +2

Query  1178  MAPATA-ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             MAPA A ++I  RDVCIVGVARTPMGGFLG+LSSL ATKLGSIAIE+ALKR +VDPSLV+
Sbjct  1     MAPAAASDSIKPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIEAALKRANVDPSLVQ  60

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EVFFGNVLSANLGQAPARQAALGAGIPN+VVC+TVNKVCASG+KA MLA+QSIQLGINDV
Sbjct  61    EVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTVNKVCASGLKAIMLASQSIQLGINDV  120

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             +VAGGMESMSN PKY AEARKGSRLGHDSLVDGML
Sbjct  121   IVAGGMESMSNAPKYLAEARKGSRLGHDSLVDGML  155


 Score =   234 bits (598),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 130/140 (93%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPATA-ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            MAPA A ++I  RDVCIVGVARTPMGGFLG+LSSL ATKLGS+AIE+ALKRA+VDPSLV+
Sbjct  1    MAPAAASDSIKPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIEAALKRANVDPSLVQ  60

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EVFFGNVL ANLGQAPARQAALGAGIPN+VVC+TVNKVCASG+KA +LA+QSIQLGINDV
Sbjct  61   EVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTVNKVCASGLKAIMLASQSIQLGINDV  120

Query  666  VVAGGMESMSNVHKYFAEAR  725
            +VAGGMESMSN  KY AEAR
Sbjct  121  IVAGGMESMSNAPKYLAEAR  140



>ref|XP_003519682.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Glycine max]
 ref|XP_006575748.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Glycine max]
 gb|KHN43976.1| Acetyl-CoA acetyltransferase, cytosolic 1 [Glycine soja]
Length=407

 Score =   273 bits (697),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/157 (87%), Positives = 146/157 (93%), Gaps = 3/157 (2%)
 Frame = +2

Query  1178  MAP---ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSL  1348
             MAP   A++++I  RDVCIVGVARTPMGGFLG+LSSL ATKLGSIAIE+ALKR +VDPSL
Sbjct  1     MAPVAAASSDSIKPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIEAALKRANVDPSL  60

Query  1349  VEEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGIN  1528
             VEEVFFGNVLSANLGQAPARQAALGAGI N+V+C+TVNKVCASGMKA MLAAQSIQL IN
Sbjct  61    VEEVFFGNVLSANLGQAPARQAALGAGISNSVICTTVNKVCASGMKAAMLAAQSIQLSIN  120

Query  1529  DVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             DVVVAGGMESMSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  121   DVVVAGGMESMSNVPKYLAEARKGSRLGHDSLVDGML  157


 Score =   234 bits (598),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 130/142 (92%), Gaps = 3/142 (2%)
 Frame = +3

Query  309  MAP---ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSL  479
            MAP   A++++I  RDVCIVGVARTPMGGFLG+LSSL ATKLGS+AIE+ALKRA+VDPSL
Sbjct  1    MAPVAAASSDSIKPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIEAALKRANVDPSL  60

Query  480  VEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGIN  659
            VEEVFFGNVL ANLGQAPARQAALGAGI N+V+C+TVNKVCASGMKA +LAAQSIQL IN
Sbjct  61   VEEVFFGNVLSANLGQAPARQAALGAGISNSVICTTVNKVCASGMKAAMLAAQSIQLSIN  120

Query  660  DVVVAGGMESMSNVHKYFAEAR  725
            DVVVAGGMESMSNV KY AEAR
Sbjct  121  DVVVAGGMESMSNVPKYLAEAR  142



>ref|XP_008462041.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Cucumis 
melo]
Length=406

 Score =   272 bits (696),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = +2

Query  1196  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  1375
             E+IN RDVCIVGVARTPMGGFLG+LSSL ATKLGSIAIE+ALKR  VDP+LV+EV FGNV
Sbjct  9     ESINPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIEAALKRAKVDPALVQEVIFGNV  68

Query  1376  LSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGME  1555
             LSANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKATMLAAQSIQLG+NDVVV+GGME
Sbjct  69    LSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKATMLAAQSIQLGLNDVVVSGGME  128

Query  1556  SMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             SMSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  129   SMSNVPKYLAEARKGSRLGHDSLVDGML  156


 Score =   234 bits (597),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  327  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNV  506
            E+IN RDVCIVGVARTPMGGFLG+LSSL ATKLGS+AIE+ALKRA VDP+LV+EV FGNV
Sbjct  9    ESINPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIEAALKRAKVDPALVQEVIFGNV  68

Query  507  LGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGME  686
            L ANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKAT+LAAQSIQLG+NDVVV+GGME
Sbjct  69   LSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKATMLAAQSIQLGLNDVVVSGGME  128

Query  687  SMSNVHKYFAEAR  725
            SMSNV KY AEAR
Sbjct  129  SMSNVPKYLAEAR  141



>emb|CDX86320.1| BnaA06g30370D [Brassica napus]
Length=425

 Score =   273 bits (697),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 154/189 (81%), Gaps = 16/189 (8%)
 Frame = +2

Query  1073  PPLFPIQLASFHSFSLPRNQHYNQHRSSICIH*LAMAPATAETINARDVCIVGVARTPMG  1252
             P L P ++ SF+S    R +  +                TA+++N RDVCIVGVARTPMG
Sbjct  3     PLLSPYRIKSFNSMPFCRFRMAH----------------TADSVNPRDVCIVGVARTPMG  46

Query  1253  GFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLGQAPARQAALGAGI  1432
             GFLGSLSSLPATKLGS+AI +ALKR +VDPSLV+EV FGNVLSANLGQAPARQAALGAGI
Sbjct  47    GFLGSLSSLPATKLGSVAIAAALKRANVDPSLVQEVVFGNVLSANLGQAPARQAALGAGI  106

Query  1433  PNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNVPKYFAEARKGSRLG  1612
             PN+V+C+TVNKVCASGMKA M+AAQSIQLGINDVVVAGGMESMSN PKY AEARKGSR G
Sbjct  107   PNSVICTTVNKVCASGMKAVMIAAQSIQLGINDVVVAGGMESMSNTPKYLAEARKGSRFG  166

Query  1613  HDSLVDGML  1639
             HDSLVDGML
Sbjct  167   HDSLVDGML  175


 Score =   235 bits (600),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 138/174 (79%), Gaps = 16/174 (9%)
 Frame = +3

Query  204  PPLXPIQFASYHSFSLPRNQHYNQHRSSICIH*LAMAPATAETINARDVCIVGVARTPMG  383
            P L P +  S++S    R +  +                TA+++N RDVCIVGVARTPMG
Sbjct  3    PLLSPYRIKSFNSMPFCRFRMAH----------------TADSVNPRDVCIVGVARTPMG  46

Query  384  GFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGANLGQAPARQAALGAGI  563
            GFLGSLSSLPATKLGS+AI +ALKRA+VDPSLV+EV FGNVL ANLGQAPARQAALGAGI
Sbjct  47   GFLGSLSSLPATKLGSVAIAAALKRANVDPSLVQEVVFGNVLSANLGQAPARQAALGAGI  106

Query  564  PNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNVHKYFAEAR  725
            PN+V+C+TVNKVCASGMKA ++AAQSIQLGINDVVVAGGMESMSN  KY AEAR
Sbjct  107  PNSVICTTVNKVCASGMKAVMIAAQSIQLGINDVVVAGGMESMSNTPKYLAEAR  160



>gb|AEM42969.1| acetyl-CoA C-acetyltransferase [Siraitia grosvenorii]
Length=407

 Score =   272 bits (695),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/157 (87%), Positives = 145/157 (92%), Gaps = 3/157 (2%)
 Frame = +2

Query  1178  MAPATA---ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSL  1348
             MAPA A   ++I+ RDVCIVGVARTPMGGFLGSLSSL ATKLGSIAIE+ALKR  VDPS 
Sbjct  1     MAPAAAASTDSIHPRDVCIVGVARTPMGGFLGSLSSLSATKLGSIAIEAALKRAKVDPSQ  60

Query  1349  VEEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGIN  1528
             V+EV FGNVLSANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKATMLAAQSIQLGIN
Sbjct  61    VQEVIFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKATMLAAQSIQLGIN  120

Query  1529  DVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             DVVV+GGMESMSN PKY AEARKGSRLGHDSLVDGML
Sbjct  121   DVVVSGGMESMSNAPKYLAEARKGSRLGHDSLVDGML  157


 Score =   234 bits (596),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 129/142 (91%), Gaps = 3/142 (2%)
 Frame = +3

Query  309  MAPATA---ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSL  479
            MAPA A   ++I+ RDVCIVGVARTPMGGFLGSLSSL ATKLGS+AIE+ALKRA VDPS 
Sbjct  1    MAPAAAASTDSIHPRDVCIVGVARTPMGGFLGSLSSLSATKLGSIAIEAALKRAKVDPSQ  60

Query  480  VEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGIN  659
            V+EV FGNVL ANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKAT+LAAQSIQLGIN
Sbjct  61   VQEVIFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKATMLAAQSIQLGIN  120

Query  660  DVVVAGGMESMSNVHKYFAEAR  725
            DVVV+GGMESMSN  KY AEAR
Sbjct  121  DVVVSGGMESMSNAPKYLAEAR  142



>ref|XP_004144550.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Cucumis 
sativus]
Length=407

 Score =   271 bits (694),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 142/148 (96%), Gaps = 0/148 (0%)
 Frame = +2

Query  1196  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  1375
             E+IN RDVCIVGVARTPMGGFLG+LSSL ATKLGS+AIE+ALKR  VDP+LV+EV FGNV
Sbjct  10    ESINPRDVCIVGVARTPMGGFLGTLSSLSATKLGSLAIEAALKRAKVDPALVQEVIFGNV  69

Query  1376  LSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGME  1555
             LSANLGQAPARQAALGAGIPN+VVC+TVNKVCASGMKATMLAAQSIQLG+NDVVV+GGME
Sbjct  70    LSANLGQAPARQAALGAGIPNSVVCTTVNKVCASGMKATMLAAQSIQLGLNDVVVSGGME  129

Query  1556  SMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             SMSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  130   SMSNVPKYLAEARKGSRLGHDSLVDGML  157


 Score =   236 bits (601),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  327  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNV  506
            E+IN RDVCIVGVARTPMGGFLG+LSSL ATKLGSLAIE+ALKRA VDP+LV+EV FGNV
Sbjct  10   ESINPRDVCIVGVARTPMGGFLGTLSSLSATKLGSLAIEAALKRAKVDPALVQEVIFGNV  69

Query  507  LGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGME  686
            L ANLGQAPARQAALGAGIPN+VVC+TVNKVCASGMKAT+LAAQSIQLG+NDVVV+GGME
Sbjct  70   LSANLGQAPARQAALGAGIPNSVVCTTVNKVCASGMKATMLAAQSIQLGLNDVVVSGGME  129

Query  687  SMSNVHKYFAEAR  725
            SMSNV KY AEAR
Sbjct  130  SMSNVPKYLAEAR  142



>ref|XP_008342241.1| PREDICTED: LOW QUALITY PROTEIN: acetyl-CoA acetyltransferase, 
cytosolic 1-like [Malus domestica]
Length=408

 Score =   271 bits (694),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 147/158 (93%), Gaps = 4/158 (3%)
 Frame = +2

Query  1178  MAPATAE----TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPS  1345
             MAP  AE    +I  RDV IVGVARTPMGGFLG+LSS+PATKLGSIAI +ALKR +VDP+
Sbjct  1     MAPVAAEACSDSIKPRDVYIVGVARTPMGGFLGALSSVPATKLGSIAIGAALKRANVDPA  60

Query  1346  LVEEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGI  1525
             LVEEVFFGNVLSANLGQAPARQAALGAG+PN+V+C+TVNKVCASG+KATMLAAQSIQLGI
Sbjct  61    LVEEVFFGNVLSANLGQAPARQAALGAGLPNSVICTTVNKVCASGLKATMLAAQSIQLGI  120

Query  1526  NDVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             NDVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML
Sbjct  121   NDVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  158


 Score =   233 bits (595),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 131/143 (92%), Gaps = 4/143 (3%)
 Frame = +3

Query  309  MAPATAE----TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPS  476
            MAP  AE    +I  RDV IVGVARTPMGGFLG+LSS+PATKLGS+AI +ALKRA+VDP+
Sbjct  1    MAPVAAEACSDSIKPRDVYIVGVARTPMGGFLGALSSVPATKLGSIAIGAALKRANVDPA  60

Query  477  LVEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGI  656
            LVEEVFFGNVL ANLGQAPARQAALGAG+PN+V+C+TVNKVCASG+KAT+LAAQSIQLGI
Sbjct  61   LVEEVFFGNVLSANLGQAPARQAALGAGLPNSVICTTVNKVCASGLKATMLAAQSIQLGI  120

Query  657  NDVVVAGGMESMSNVHKYFAEAR  725
            NDVVVAGGMESMSNV KYFAEAR
Sbjct  121  NDVVVAGGMESMSNVPKYFAEAR  143



>ref|XP_006395207.1| hypothetical protein EUTSA_v10004340mg [Eutrema salsugineum]
 gb|ESQ32493.1| hypothetical protein EUTSA_v10004340mg [Eutrema salsugineum]
Length=403

 Score =   271 bits (693),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +2

Query  1190  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  1369
             TA+ +N RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAI +ALKR +VDPSLV+EV FG
Sbjct  4     TADFVNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIAAALKRANVDPSLVQEVIFG  63

Query  1370  NVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGG  1549
             NVLSANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA M+AAQSIQLGINDVVVAGG
Sbjct  64    NVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVMVAAQSIQLGINDVVVAGG  123

Query  1550  MESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             MESMSN PKY AEARKGSR GHDSLVDGML
Sbjct  124   MESMSNTPKYLAEARKGSRFGHDSLVDGML  153


 Score =   234 bits (597),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  321  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFG  500
            TA+ +N RDVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKRA+VDPSLV+EV FG
Sbjct  4    TADFVNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIAAALKRANVDPSLVQEVIFG  63

Query  501  NVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGG  680
            NVL ANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA ++AAQSIQLGINDVVVAGG
Sbjct  64   NVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVMVAAQSIQLGINDVVVAGG  123

Query  681  MESMSNVHKYFAEAR  725
            MESMSN  KY AEAR
Sbjct  124  MESMSNTPKYLAEAR  138



>ref|XP_007049378.1| Acetoacetyl-CoA thiolase 2 isoform 1 [Theobroma cacao]
 gb|EOX93535.1| Acetoacetyl-CoA thiolase 2 isoform 1 [Theobroma cacao]
Length=407

 Score =   271 bits (693),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 146/157 (93%), Gaps = 3/157 (2%)
 Frame = +2

Query  1178  MAP---ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSL  1348
             MAP   A +++I  RDVC+VGVARTPMGGFLGSLSSL ATKLGSIAIE+ALKR +VDPSL
Sbjct  1     MAPTAAAASDSIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIEAALKRANVDPSL  60

Query  1349  VEEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGIN  1528
             V+EV FGNVLSANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKATMLAAQSIQLGIN
Sbjct  61    VQEVIFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKATMLAAQSIQLGIN  120

Query  1529  DVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             DVVVAGGMESMSN PKY AEARKGSRLGHD+LVDGM+
Sbjct  121   DVVVAGGMESMSNAPKYLAEARKGSRLGHDTLVDGMM  157


 Score =   235 bits (599),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 130/142 (92%), Gaps = 3/142 (2%)
 Frame = +3

Query  309  MAP---ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSL  479
            MAP   A +++I  RDVC+VGVARTPMGGFLGSLSSL ATKLGS+AIE+ALKRA+VDPSL
Sbjct  1    MAPTAAAASDSIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIEAALKRANVDPSL  60

Query  480  VEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGIN  659
            V+EV FGNVL ANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKAT+LAAQSIQLGIN
Sbjct  61   VQEVIFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKATMLAAQSIQLGIN  120

Query  660  DVVVAGGMESMSNVHKYFAEAR  725
            DVVVAGGMESMSN  KY AEAR
Sbjct  121  DVVVAGGMESMSNAPKYLAEAR  142



>ref|XP_007049379.1| Acetoacetyl-CoA thiolase 2 isoform 2 [Theobroma cacao]
 gb|EOX93536.1| Acetoacetyl-CoA thiolase 2 isoform 2 [Theobroma cacao]
Length=408

 Score =   271 bits (692),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 146/157 (93%), Gaps = 3/157 (2%)
 Frame = +2

Query  1178  MAP---ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSL  1348
             MAP   A +++I  RDVC+VGVARTPMGGFLGSLSSL ATKLGSIAIE+ALKR +VDPSL
Sbjct  1     MAPTAAAASDSIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIEAALKRANVDPSL  60

Query  1349  VEEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGIN  1528
             V+EV FGNVLSANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKATMLAAQSIQLGIN
Sbjct  61    VQEVIFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKATMLAAQSIQLGIN  120

Query  1529  DVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             DVVVAGGMESMSN PKY AEARKGSRLGHD+LVDGM+
Sbjct  121   DVVVAGGMESMSNAPKYLAEARKGSRLGHDTLVDGMM  157


 Score =   235 bits (599),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 130/142 (92%), Gaps = 3/142 (2%)
 Frame = +3

Query  309  MAP---ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSL  479
            MAP   A +++I  RDVC+VGVARTPMGGFLGSLSSL ATKLGS+AIE+ALKRA+VDPSL
Sbjct  1    MAPTAAAASDSIKPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIEAALKRANVDPSL  60

Query  480  VEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGIN  659
            V+EV FGNVL ANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKAT+LAAQSIQLGIN
Sbjct  61   VQEVIFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKATMLAAQSIQLGIN  120

Query  660  DVVVAGGMESMSNVHKYFAEAR  725
            DVVVAGGMESMSN  KY AEAR
Sbjct  121  DVVVAGGMESMSNAPKYLAEAR  142



>gb|KHN46894.1| Acetyl-CoA acetyltransferase, cytosolic 1 [Glycine soja]
Length=407

 Score =   270 bits (691),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 145/157 (92%), Gaps = 3/157 (2%)
 Frame = +2

Query  1178  MAP---ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSL  1348
             MAP   A++++I  RDVCIVGVARTPMGGFLG+L SL ATKLGSIAIE+ALKR +VDPSL
Sbjct  1     MAPVAAASSDSIKPRDVCIVGVARTPMGGFLGTLPSLSATKLGSIAIEAALKRANVDPSL  60

Query  1349  VEEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGIN  1528
             VEEVFFGNVLSANLGQAPARQAALGAGI N+V+C+TVNKVCASGMKA MLAAQSIQLG N
Sbjct  61    VEEVFFGNVLSANLGQAPARQAALGAGISNSVICTTVNKVCASGMKAAMLAAQSIQLGTN  120

Query  1529  DVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             DVVVAGGMESMSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  121   DVVVAGGMESMSNVPKYLAEARKGSRLGHDSLVDGML  157


 Score =   233 bits (593),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 129/142 (91%), Gaps = 3/142 (2%)
 Frame = +3

Query  309  MAP---ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSL  479
            MAP   A++++I  RDVCIVGVARTPMGGFLG+L SL ATKLGS+AIE+ALKRA+VDPSL
Sbjct  1    MAPVAAASSDSIKPRDVCIVGVARTPMGGFLGTLPSLSATKLGSIAIEAALKRANVDPSL  60

Query  480  VEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGIN  659
            VEEVFFGNVL ANLGQAPARQAALGAGI N+V+C+TVNKVCASGMKA +LAAQSIQLG N
Sbjct  61   VEEVFFGNVLSANLGQAPARQAALGAGISNSVICTTVNKVCASGMKAAMLAAQSIQLGTN  120

Query  660  DVVVAGGMESMSNVHKYFAEAR  725
            DVVVAGGMESMSNV KY AEAR
Sbjct  121  DVVVAGGMESMSNVPKYLAEAR  142



>ref|XP_009151624.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Brassica 
rapa]
Length=403

 Score =   270 bits (691),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +2

Query  1190  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  1369
             TA+++N RDVCIVGVARTPMGGFLGSLSS PATKLGS+AI +ALKR +VDPSLV+EV FG
Sbjct  4     TADSVNPRDVCIVGVARTPMGGFLGSLSSFPATKLGSVAIAAALKRANVDPSLVQEVVFG  63

Query  1370  NVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGG  1549
             NVLSANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA M+AAQSIQLGINDVVVAGG
Sbjct  64    NVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVMIAAQSIQLGINDVVVAGG  123

Query  1550  MESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             MESMSN PKY AEARKGSR GHDSLVDGML
Sbjct  124   MESMSNTPKYLAEARKGSRFGHDSLVDGML  153


 Score =   234 bits (596),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  321  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFG  500
            TA+++N RDVCIVGVARTPMGGFLGSLSS PATKLGS+AI +ALKRA+VDPSLV+EV FG
Sbjct  4    TADSVNPRDVCIVGVARTPMGGFLGSLSSFPATKLGSVAIAAALKRANVDPSLVQEVVFG  63

Query  501  NVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGG  680
            NVL ANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA ++AAQSIQLGINDVVVAGG
Sbjct  64   NVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVMIAAQSIQLGINDVVVAGG  123

Query  681  MESMSNVHKYFAEAR  725
            MESMSN  KY AEAR
Sbjct  124  MESMSNTPKYLAEAR  138



>ref|XP_002320528.1| truncated acetyl Co-A acetyltransferase-like family protein [Populus 
trichocarpa]
 gb|EEE98843.1| truncated acetyl Co-A acetyltransferase-like family protein [Populus 
trichocarpa]
Length=401

 Score =   270 bits (691),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 133/150 (89%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +2

Query  1190  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  1369
             T+  I  RDVC+VGVARTPMGGFLGSLSSLPATKLGSIAIE+ALKR +VDPS V+EVFFG
Sbjct  2     TSAEIKPRDVCVVGVARTPMGGFLGSLSSLPATKLGSIAIEAALKRANVDPSTVQEVFFG  61

Query  1370  NVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGG  1549
             NVL ANLGQAPARQAALGAGI N+VVC+T+NKVCASGMKATMLAAQSIQLGINDVVVAGG
Sbjct  62    NVLCANLGQAPARQAALGAGISNSVVCTTINKVCASGMKATMLAAQSIQLGINDVVVAGG  121

Query  1550  MESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             MESMSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  122   MESMSNVPKYLAEARKGSRLGHDSLVDGML  151


 Score =   234 bits (596),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  321  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFG  500
            T+  I  RDVC+VGVARTPMGGFLGSLSSLPATKLGS+AIE+ALKRA+VDPS V+EVFFG
Sbjct  2    TSAEIKPRDVCVVGVARTPMGGFLGSLSSLPATKLGSIAIEAALKRANVDPSTVQEVFFG  61

Query  501  NVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGG  680
            NVL ANLGQAPARQAALGAGI N+VVC+T+NKVCASGMKAT+LAAQSIQLGINDVVVAGG
Sbjct  62   NVLCANLGQAPARQAALGAGISNSVVCTTINKVCASGMKATMLAAQSIQLGINDVVVAGG  121

Query  681  MESMSNVHKYFAEAR  725
            MESMSNV KY AEAR
Sbjct  122  MESMSNVPKYLAEAR  136



>ref|NP_568694.2| acetoacetyl-CoA thiolase 2 [Arabidopsis thaliana]
 sp|Q8S4Y1.1|THIC1_ARATH RecName: Full=Acetyl-CoA acetyltransferase, cytosolic 1; AltName: 
Full=Cytosolic acetoacetyl-CoA thiolase 1; Short=Thiolase 
1; AltName: Full=Protein EMBRYO DEFECTIVE 1276 [Arabidopsis 
thaliana]
 gb|AAM00280.1|AF364059_1 acetoacetyl-CoA thiolase [Arabidopsis thaliana]
 dbj|BAH19918.1| AT5G48230 [Arabidopsis thaliana]
 gb|AED95638.1| acetoacetyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=403

 Score =   270 bits (690),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +2

Query  1190  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  1369
             T+E++N RDVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKR +VDP+LV+EV FG
Sbjct  4     TSESVNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIAAALKRANVDPALVQEVVFG  63

Query  1370  NVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGG  1549
             NVLSANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA M+AAQSIQLGINDVVVAGG
Sbjct  64    NVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVMIAAQSIQLGINDVVVAGG  123

Query  1550  MESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             MESMSN PKY AEARKGSR GHDSLVDGML
Sbjct  124   MESMSNTPKYLAEARKGSRFGHDSLVDGML  153


 Score =   235 bits (600),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = +3

Query  321  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFG  500
            T+E++N RDVCIVGVARTPMGGFLGSLSSLPATKLGSLAI +ALKRA+VDP+LV+EV FG
Sbjct  4    TSESVNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIAAALKRANVDPALVQEVVFG  63

Query  501  NVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGG  680
            NVL ANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA ++AAQSIQLGINDVVVAGG
Sbjct  64   NVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVMIAAQSIQLGINDVVVAGG  123

Query  681  MESMSNVHKYFAEAR  725
            MESMSN  KY AEAR
Sbjct  124  MESMSNTPKYLAEAR  138



>gb|ACU19591.1| unknown [Glycine max]
Length=407

 Score =   270 bits (690),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 145/157 (92%), Gaps = 3/157 (2%)
 Frame = +2

Query  1178  MAP---ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSL  1348
             MAP   A++++I  RDVCIVGVARTPMGGFLG+LSSL ATKLGSIAIE+AL R +VDPSL
Sbjct  1     MAPVAAASSDSIKPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIEAALTRANVDPSL  60

Query  1349  VEEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGIN  1528
             VEEVFFGNVLSANLGQAPARQAALGAGI N+V+C+TVNKVCASGMKA MLAAQSIQLG N
Sbjct  61    VEEVFFGNVLSANLGQAPARQAALGAGISNSVICTTVNKVCASGMKAAMLAAQSIQLGTN  120

Query  1529  DVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             DVVVAGGMESMSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  121   DVVVAGGMESMSNVPKYLAEARKGSRLGHDSLVDGML  157


 Score =   232 bits (592),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 129/142 (91%), Gaps = 3/142 (2%)
 Frame = +3

Query  309  MAP---ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSL  479
            MAP   A++++I  RDVCIVGVARTPMGGFLG+LSSL ATKLGS+AIE+AL RA+VDPSL
Sbjct  1    MAPVAAASSDSIKPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIEAALTRANVDPSL  60

Query  480  VEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGIN  659
            VEEVFFGNVL ANLGQAPARQAALGAGI N+V+C+TVNKVCASGMKA +LAAQSIQLG N
Sbjct  61   VEEVFFGNVLSANLGQAPARQAALGAGISNSVICTTVNKVCASGMKAAMLAAQSIQLGTN  120

Query  660  DVVVAGGMESMSNVHKYFAEAR  725
            DVVVAGGMESMSNV KY AEAR
Sbjct  121  DVVVAGGMESMSNVPKYLAEAR  142



>gb|KFK31312.1| hypothetical protein AALP_AA6G096400 [Arabis alpina]
Length=404

 Score =   270 bits (689),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MA +   ++N RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAI +ALKR +VDPSLV+E
Sbjct  1     MAHSPDSSVNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIAAALKRANVDPSLVQE  60

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             V FGNVLSANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA MLAAQSIQLGINDVV
Sbjct  61    VIFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVMLAAQSIQLGINDVV  120

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSN PKY +EARKGSR GHDSLVDGML
Sbjct  121   VAGGMESMSNTPKYLSEARKGSRFGHDSLVDGML  154


 Score =   233 bits (595),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MA +   ++N RDVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKRA+VDPSLV+E
Sbjct  1    MAHSPDSSVNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIAAALKRANVDPSLVQE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            V FGNVL ANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA +LAAQSIQLGINDVV
Sbjct  61   VIFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVMLAAQSIQLGINDVV  120

Query  669  VAGGMESMSNVHKYFAEAR  725
            VAGGMESMSN  KY +EAR
Sbjct  121  VAGGMESMSNTPKYLSEAR  139



>dbj|BAA97003.1| acetyl-CoA C-acetyltransferase [Arabidopsis thaliana]
Length=486

 Score =   272 bits (696),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 159/193 (82%), Gaps = 8/193 (4%)
 Frame = +2

Query  1076  PLFPIQL-----ASFHSFSLPRNQHYNQHRSSICIH*LAMAPATAETINARDVCIVGVAR  1240
             P F +Q        FH+ SL      +  RS + +   AMA  T+E++N RDVCIVGVAR
Sbjct  47    PCFSLQFYCRIRCHFHNDSLL--SALSIRRSLLELKNQAMA-HTSESVNPRDVCIVGVAR  103

Query  1241  TPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLGQAPARQAAL  1420
             TPMGGFLGSLSSLPATKLGS+AI +ALKR +VDP+LV+EV FGNVLSANLGQAPARQAAL
Sbjct  104   TPMGGFLGSLSSLPATKLGSLAIAAALKRANVDPALVQEVVFGNVLSANLGQAPARQAAL  163

Query  1421  GAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNVPKYFAEARKG  1600
             GAGIPN+V+C+TVNKVCASGMKA M+AAQSIQLGINDVVVAGGMESMSN PKY AEARKG
Sbjct  164   GAGIPNSVICTTVNKVCASGMKAVMIAAQSIQLGINDVVVAGGMESMSNTPKYLAEARKG  223

Query  1601  SRLGHDSLVDGML  1639
             SR GHDSLVDGML
Sbjct  224   SRFGHDSLVDGML  236


 Score =   236 bits (601),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 134/150 (89%), Gaps = 1/150 (1%)
 Frame = +3

Query  276  HRSSICIH*LAMAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALK  455
             RS + +   AMA  T+E++N RDVCIVGVARTPMGGFLGSLSSLPATKLGSLAI +ALK
Sbjct  73   RRSLLELKNQAMA-HTSESVNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIAAALK  131

Query  456  RASVDPSLVEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAA  635
            RA+VDP+LV+EV FGNVL ANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA ++AA
Sbjct  132  RANVDPALVQEVVFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVMIAA  191

Query  636  QSIQLGINDVVVAGGMESMSNVHKYFAEAR  725
            QSIQLGINDVVVAGGMESMSN  KY AEAR
Sbjct  192  QSIQLGINDVVVAGGMESMSNTPKYLAEAR  221



>ref|XP_004491616.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Cicer arietinum]
Length=406

 Score =   270 bits (689),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 146/156 (94%), Gaps = 2/156 (1%)
 Frame = +2

Query  1178  MAPATA--ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLV  1351
             MAPA A  ++I  RDVCIVGVARTPMGGFLG+LSS+PATKLGSIAIE+ALKR +VDPSLV
Sbjct  1     MAPAAAASDSIQPRDVCIVGVARTPMGGFLGTLSSVPATKLGSIAIEAALKRANVDPSLV  60

Query  1352  EEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGIND  1531
             EEV+FGNVLSANLGQAPARQAALGAG+  +V C+T+NKVCASGMKATMLAAQSIQLGIND
Sbjct  61    EEVYFGNVLSANLGQAPARQAALGAGLSKSVACTTINKVCASGMKATMLAAQSIQLGIND  120

Query  1532  VVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VVVAGGME+MS+VPKY AEARKGSRLGHDSLVDGML
Sbjct  121   VVVAGGMENMSSVPKYLAEARKGSRLGHDSLVDGML  156


 Score =   231 bits (590),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 130/141 (92%), Gaps = 2/141 (1%)
 Frame = +3

Query  309  MAPATA--ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLV  482
            MAPA A  ++I  RDVCIVGVARTPMGGFLG+LSS+PATKLGS+AIE+ALKRA+VDPSLV
Sbjct  1    MAPAAAASDSIQPRDVCIVGVARTPMGGFLGTLSSVPATKLGSIAIEAALKRANVDPSLV  60

Query  483  EEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGIND  662
            EEV+FGNVL ANLGQAPARQAALGAG+  +V C+T+NKVCASGMKAT+LAAQSIQLGIND
Sbjct  61   EEVYFGNVLSANLGQAPARQAALGAGLSKSVACTTINKVCASGMKATMLAAQSIQLGIND  120

Query  663  VVVAGGMESMSNVHKYFAEAR  725
            VVVAGGME+MS+V KY AEAR
Sbjct  121  VVVAGGMENMSSVPKYLAEAR  141



>ref|XP_006447819.1| hypothetical protein CICLE_v10015452mg [Citrus clementina]
 ref|XP_006447820.1| hypothetical protein CICLE_v10015452mg [Citrus clementina]
 gb|ESR61059.1| hypothetical protein CICLE_v10015452mg [Citrus clementina]
 gb|ESR61060.1| hypothetical protein CICLE_v10015452mg [Citrus clementina]
Length=405

 Score =   270 bits (689),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 145/155 (94%), Gaps = 1/155 (1%)
 Frame = +2

Query  1178  MAPATA-ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             MAPA A ++I  RDVCIVGVARTPMGGFLG+LSSL ATKLGSIAIE+ALKR +VDPSLV+
Sbjct  1     MAPAAASDSIKPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIEAALKRANVDPSLVQ  60

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EVFFGNVLSANLGQAPARQAALGAGIPN+VVC+TVNKVCAS +KA MLA+QSIQLGINDV
Sbjct  61    EVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTVNKVCASRLKAIMLASQSIQLGINDV  120

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             +VAGGMESMSN PKY AEARKGSRLGHDSLVDGML
Sbjct  121   IVAGGMESMSNAPKYLAEARKGSRLGHDSLVDGML  155


 Score =   231 bits (590),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 129/140 (92%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPATA-ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            MAPA A ++I  RDVCIVGVARTPMGGFLG+LSSL ATKLGS+AIE+ALKRA+VDPSLV+
Sbjct  1    MAPAAASDSIKPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIEAALKRANVDPSLVQ  60

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EVFFGNVL ANLGQAPARQAALGAGIPN+VVC+TVNKVCAS +KA +LA+QSIQLGINDV
Sbjct  61   EVFFGNVLSANLGQAPARQAALGAGIPNSVVCTTVNKVCASRLKAIMLASQSIQLGINDV  120

Query  666  VVAGGMESMSNVHKYFAEAR  725
            +VAGGMESMSN  KY AEAR
Sbjct  121  IVAGGMESMSNAPKYLAEAR  140



>ref|XP_009111830.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Brassica 
rapa]
Length=403

 Score =   270 bits (689),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/150 (87%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +2

Query  1190  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  1369
             +A+++N RDVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKR +VDPSLV+EV FG
Sbjct  4     SADSVNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSVAITAALKRATVDPSLVQEVVFG  63

Query  1370  NVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGG  1549
             NVLSANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA +LAAQSIQLGINDVVVAGG
Sbjct  64    NVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVVLAAQSIQLGINDVVVAGG  123

Query  1550  MESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             MESMSN PKY AEARKGSR GHDSLVDGML
Sbjct  124   MESMSNTPKYLAEARKGSRFGHDSLVDGML  153


 Score =   236 bits (601),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = +3

Query  321  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFG  500
            +A+++N RDVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKRA+VDPSLV+EV FG
Sbjct  4    SADSVNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSVAITAALKRATVDPSLVQEVVFG  63

Query  501  NVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGG  680
            NVL ANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA +LAAQSIQLGINDVVVAGG
Sbjct  64   NVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVVLAAQSIQLGINDVVVAGG  123

Query  681  MESMSNVHKYFAEAR  725
            MESMSN  KY AEAR
Sbjct  124  MESMSNTPKYLAEAR  138



>dbj|BAF98277.1| acetyl-CoA C-acetyltransferase [Hevea brasiliensis]
Length=408

 Score =   270 bits (689),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +2

Query  1202  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  1381
             I  RDVCIVGVARTPMGGFLGSL +L ATKLGSIAIE+ALKR +VDPSLV+EVFFGNVLS
Sbjct  13    IKPRDVCIVGVARTPMGGFLGSLCTLSATKLGSIAIEAALKRANVDPSLVQEVFFGNVLS  72

Query  1382  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESM  1561
             ANLGQAPARQAALGAGIPN+VVC+TVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESM
Sbjct  73    ANLGQAPARQAALGAGIPNSVVCTTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESM  132

Query  1562  SNVPKYFAEARKGSRLGHDSLVDGML  1639
             SN PKY AEARKGSRLGHDSLVDGML
Sbjct  133   SNAPKYLAEARKGSRLGHDSLVDGML  158


 Score =   231 bits (590),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +3

Query  333  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLG  512
            I  RDVCIVGVARTPMGGFLGSL +L ATKLGS+AIE+ALKRA+VDPSLV+EVFFGNVL 
Sbjct  13   IKPRDVCIVGVARTPMGGFLGSLCTLSATKLGSIAIEAALKRANVDPSLVQEVFFGNVLS  72

Query  513  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESM  692
            ANLGQAPARQAALGAGIPN+VVC+TVNKVCASGMKAT+LAAQSIQLGINDVVVAGGMESM
Sbjct  73   ANLGQAPARQAALGAGIPNSVVCTTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESM  132

Query  693  SNVHKYFAEAR  725
            SN  KY AEAR
Sbjct  133  SNAPKYLAEAR  143



>gb|EMT20974.1| Putative acetyl-CoA acetyltransferase, cytosolic 2 [Aegilops 
tauschii]
Length=409

 Score =   269 bits (688),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +2

Query  1205  NARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSA  1384
             +ARDVC+VGVARTPMG FLG LSSLPATKLGSIAIE+AL+R +VDPSLV+EVFFGNVLSA
Sbjct  15    DARDVCVVGVARTPMGSFLGGLSSLPATKLGSIAIEAALRRANVDPSLVQEVFFGNVLSA  74

Query  1385  NLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMS  1564
             NLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKATM AAQSIQLGIND+VVAGGMESMS
Sbjct  75    NLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMFAAQSIQLGINDIVVAGGMESMS  134

Query  1565  NVPKYFAEARKGSRLGHDSLVDGML  1639
             N PKY AEARKGSR GHDSLVDGML
Sbjct  135   NAPKYIAEARKGSRFGHDSLVDGML  159


 Score =   233 bits (593),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +3

Query  336  NARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGA  515
            +ARDVC+VGVARTPMG FLG LSSLPATKLGS+AIE+AL+RA+VDPSLV+EVFFGNVL A
Sbjct  15   DARDVCVVGVARTPMGSFLGGLSSLPATKLGSIAIEAALRRANVDPSLVQEVFFGNVLSA  74

Query  516  NLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMS  695
            NLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKAT+ AAQSIQLGIND+VVAGGMESMS
Sbjct  75   NLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMFAAQSIQLGINDIVVAGGMESMS  134

Query  696  NVHKYFAEAR  725
            N  KY AEAR
Sbjct  135  NAPKYIAEAR  144



>ref|XP_011085410.1| PREDICTED: LOW QUALITY PROTEIN: acetyl-CoA acetyltransferase, 
cytosolic 1-like [Sesamum indicum]
Length=403

 Score =   268 bits (686),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 143/154 (93%), Gaps = 1/154 (1%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             M+PA  ++I  RDVCIVGVARTPMGGFLGSLSSL ATKLGSIAI SALKR ++DPSLVEE
Sbjct  1     MSPAARDSIKPRDVCIVGVARTPMGGFLGSLSSLSATKLGSIAIASALKRANIDPSLVEE  60

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLG  PARQAA+GAGIPNTVVC+TVNKVCASGMKATMLAAQSIQLG NDVV
Sbjct  61    VFFGNVLSANLG-XPARQAAIGAGIPNTVVCTTVNKVCASGMKATMLAAQSIQLGTNDVV  119

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSNVPKY +EARKGSRLGHDS+VDGML
Sbjct  120   VAGGMESMSNVPKYLSEARKGSRLGHDSVVDGML  153


 Score =   233 bits (593),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 127/139 (91%), Gaps = 1/139 (1%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            M+PA  ++I  RDVCIVGVARTPMGGFLGSLSSL ATKLGS+AI SALKRA++DPSLVEE
Sbjct  1    MSPAARDSIKPRDVCIVGVARTPMGGFLGSLSSLSATKLGSIAIASALKRANIDPSLVEE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLG  PARQAA+GAGIPNTVVC+TVNKVCASGMKAT+LAAQSIQLG NDVV
Sbjct  61   VFFGNVLSANLG-XPARQAAIGAGIPNTVVCTTVNKVCASGMKATMLAAQSIQLGTNDVV  119

Query  669  VAGGMESMSNVHKYFAEAR  725
            VAGGMESMSNV KY +EAR
Sbjct  120  VAGGMESMSNVPKYLSEAR  138



>ref|XP_004491615.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Cicer arietinum]
Length=423

 Score =   269 bits (688),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 146/156 (94%), Gaps = 2/156 (1%)
 Frame = +2

Query  1178  MAPATA--ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLV  1351
             MAPA A  ++I  RDVCIVGVARTPMGGFLG+LSS+PATKLGSIAIE+ALKR +VDPSLV
Sbjct  1     MAPAAAASDSIQPRDVCIVGVARTPMGGFLGTLSSVPATKLGSIAIEAALKRANVDPSLV  60

Query  1352  EEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGIND  1531
             EEV+FGNVLSANLGQAPARQAALGAG+  +V C+T+NKVCASGMKATMLAAQSIQLGIND
Sbjct  61    EEVYFGNVLSANLGQAPARQAALGAGLSKSVACTTINKVCASGMKATMLAAQSIQLGIND  120

Query  1532  VVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VVVAGGME+MS+VPKY AEARKGSRLGHDSLVDGML
Sbjct  121   VVVAGGMENMSSVPKYLAEARKGSRLGHDSLVDGML  156


 Score =   231 bits (589),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 130/141 (92%), Gaps = 2/141 (1%)
 Frame = +3

Query  309  MAPATA--ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLV  482
            MAPA A  ++I  RDVCIVGVARTPMGGFLG+LSS+PATKLGS+AIE+ALKRA+VDPSLV
Sbjct  1    MAPAAAASDSIQPRDVCIVGVARTPMGGFLGTLSSVPATKLGSIAIEAALKRANVDPSLV  60

Query  483  EEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGIND  662
            EEV+FGNVL ANLGQAPARQAALGAG+  +V C+T+NKVCASGMKAT+LAAQSIQLGIND
Sbjct  61   EEVYFGNVLSANLGQAPARQAALGAGLSKSVACTTINKVCASGMKATMLAAQSIQLGIND  120

Query  663  VVVAGGMESMSNVHKYFAEAR  725
            VVVAGGME+MS+V KY AEAR
Sbjct  121  VVVAGGMENMSSVPKYLAEAR  141



>ref|XP_010482068.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Camelina 
sativa]
Length=403

 Score =   268 bits (686),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +2

Query  1190  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  1369
             TA+++N +DVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKR +VDPSLV+EV FG
Sbjct  4     TADSVNPKDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIAAALKRANVDPSLVQEVVFG  63

Query  1370  NVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGG  1549
             NVLSANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA M+AAQSIQLGINDVVVAGG
Sbjct  64    NVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVMIAAQSIQLGINDVVVAGG  123

Query  1550  MESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             MESMSN PKY AEARKGSR GHDS+VDGML
Sbjct  124   MESMSNTPKYLAEARKGSRFGHDSVVDGML  153


 Score =   235 bits (600),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = +3

Query  321  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFG  500
            TA+++N +DVCIVGVARTPMGGFLGSLSSLPATKLGSLAI +ALKRA+VDPSLV+EV FG
Sbjct  4    TADSVNPKDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIAAALKRANVDPSLVQEVVFG  63

Query  501  NVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGG  680
            NVL ANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA ++AAQSIQLGINDVVVAGG
Sbjct  64   NVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVMIAAQSIQLGINDVVVAGG  123

Query  681  MESMSNVHKYFAEAR  725
            MESMSN  KY AEAR
Sbjct  124  MESMSNTPKYLAEAR  138



>ref|XP_011008068.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Populus 
euphratica]
Length=401

 Score =   268 bits (685),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +2

Query  1190  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  1369
             T+  I  RDVC+VGVARTPMG FLGSLSSLPATKLGSIAIE+ALKR +VDPS V+EVFFG
Sbjct  2     TSAEIKPRDVCVVGVARTPMGAFLGSLSSLPATKLGSIAIEAALKRANVDPSTVQEVFFG  61

Query  1370  NVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGG  1549
             NVL ANLGQAPARQAALGAGI N+VVC+T+NKVCASGMKATMLAAQSIQLGINDVVVAGG
Sbjct  62    NVLCANLGQAPARQAALGAGISNSVVCTTINKVCASGMKATMLAAQSIQLGINDVVVAGG  121

Query  1550  MESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             MESMSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  122   MESMSNVPKYLAEARKGSRLGHDSLVDGML  151


 Score =   231 bits (590),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  321  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFG  500
            T+  I  RDVC+VGVARTPMG FLGSLSSLPATKLGS+AIE+ALKRA+VDPS V+EVFFG
Sbjct  2    TSAEIKPRDVCVVGVARTPMGAFLGSLSSLPATKLGSIAIEAALKRANVDPSTVQEVFFG  61

Query  501  NVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGG  680
            NVL ANLGQAPARQAALGAGI N+VVC+T+NKVCASGMKAT+LAAQSIQLGINDVVVAGG
Sbjct  62   NVLCANLGQAPARQAALGAGISNSVVCTTINKVCASGMKATMLAAQSIQLGINDVVVAGG  121

Query  681  MESMSNVHKYFAEAR  725
            MESMSNV KY AEAR
Sbjct  122  MESMSNVPKYLAEAR  136



>emb|CDY19963.1| BnaA09g02880D [Brassica napus]
Length=403

 Score =   268 bits (685),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +2

Query  1190  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  1369
             +A+++N RDVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKR +VDPSLV+EV FG
Sbjct  4     SADSVNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSVAITAALKRANVDPSLVQEVVFG  63

Query  1370  NVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGG  1549
             NVLSANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA ++AAQSIQLGINDVVVAGG
Sbjct  64    NVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVVIAAQSIQLGINDVVVAGG  123

Query  1550  MESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             MESMSN PKY AEARKGSR GHDSLVDGML
Sbjct  124   MESMSNTPKYLAEARKGSRFGHDSLVDGML  153


 Score =   234 bits (597),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = +3

Query  321  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFG  500
            +A+++N RDVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKRA+VDPSLV+EV FG
Sbjct  4    SADSVNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSVAITAALKRANVDPSLVQEVVFG  63

Query  501  NVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGG  680
            NVL ANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA ++AAQSIQLGINDVVVAGG
Sbjct  64   NVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVVIAAQSIQLGINDVVVAGG  123

Query  681  MESMSNVHKYFAEAR  725
            MESMSN  KY AEAR
Sbjct  124  MESMSNTPKYLAEAR  138



>ref|XP_004977186.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Setaria italica]
 ref|XP_004977187.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Setaria italica]
Length=401

 Score =   268 bits (684),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 141/149 (95%), Gaps = 0/149 (0%)
 Frame = +2

Query  1193  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  1372
             ++ I  RDVC+VGVARTPMGGFLG+LSSLPATKLGSIAIE+ALKR +VDP+LV+EV+FGN
Sbjct  3     SDGIAPRDVCVVGVARTPMGGFLGALSSLPATKLGSIAIEAALKRANVDPALVQEVYFGN  62

Query  1373  VLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGM  1552
             VLSANLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKATM AAQSIQLGIND+VVAGGM
Sbjct  63    VLSANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMFAAQSIQLGINDIVVAGGM  122

Query  1553  ESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             ESMSN PKY AEARKGSR GHD+LVDGML
Sbjct  123   ESMSNAPKYIAEARKGSRFGHDTLVDGML  151


 Score =   232 bits (591),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +3

Query  324  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGN  503
            ++ I  RDVC+VGVARTPMGGFLG+LSSLPATKLGS+AIE+ALKRA+VDP+LV+EV+FGN
Sbjct  3    SDGIAPRDVCVVGVARTPMGGFLGALSSLPATKLGSIAIEAALKRANVDPALVQEVYFGN  62

Query  504  VLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGM  683
            VL ANLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKAT+ AAQSIQLGIND+VVAGGM
Sbjct  63   VLSANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMFAAQSIQLGINDIVVAGGM  122

Query  684  ESMSNVHKYFAEAR  725
            ESMSN  KY AEAR
Sbjct  123  ESMSNAPKYIAEAR  136



>ref|XP_002865618.1| acetoacetyl-CoA thiolase 2, embryo defective 1276 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH41877.1| acetoacetyl-CoA thiolase 2, embryo defective 1276 [Arabidopsis 
lyrata subsp. lyrata]
Length=403

 Score =   268 bits (684),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +2

Query  1190  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  1369
             T+E++  RDVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKR +VDP+LV+EV FG
Sbjct  4     TSESVKPRDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIAAALKRANVDPALVQEVVFG  63

Query  1370  NVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGG  1549
             NVLSANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA M+AAQSIQLGINDVVVAGG
Sbjct  64    NVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVMIAAQSIQLGINDVVVAGG  123

Query  1550  MESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             MESMSN PKY AEARKGSR GHDSLVDGML
Sbjct  124   MESMSNTPKYLAEARKGSRFGHDSLVDGML  153


 Score =   233 bits (594),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  321  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFG  500
            T+E++  RDVCIVGVARTPMGGFLGSLSSLPATKLGSLAI +ALKRA+VDP+LV+EV FG
Sbjct  4    TSESVKPRDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIAAALKRANVDPALVQEVVFG  63

Query  501  NVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGG  680
            NVL ANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA ++AAQSIQLGINDVVVAGG
Sbjct  64   NVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVMIAAQSIQLGINDVVVAGG  123

Query  681  MESMSNVHKYFAEAR  725
            MESMSN  KY AEAR
Sbjct  124  MESMSNTPKYLAEAR  138



>ref|XP_006280568.1| hypothetical protein CARUB_v10026521mg [Capsella rubella]
 gb|EOA13466.1| hypothetical protein CARUB_v10026521mg [Capsella rubella]
Length=403

 Score =   267 bits (683),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +2

Query  1190  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  1369
             TA+++N +DVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKR +VDP+LV+EV FG
Sbjct  4     TADSVNPKDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIAAALKRANVDPALVQEVVFG  63

Query  1370  NVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGG  1549
             NVLSANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA M+AAQSIQLGINDVVVAGG
Sbjct  64    NVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVMIAAQSIQLGINDVVVAGG  123

Query  1550  MESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             MESMSN PKY AEARKGSR GHDS+VDGML
Sbjct  124   MESMSNTPKYLAEARKGSRFGHDSVVDGML  153


 Score =   234 bits (597),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = +3

Query  321  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFG  500
            TA+++N +DVCIVGVARTPMGGFLGSLSSLPATKLGSLAI +ALKRA+VDP+LV+EV FG
Sbjct  4    TADSVNPKDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIAAALKRANVDPALVQEVVFG  63

Query  501  NVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGG  680
            NVL ANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA ++AAQSIQLGINDVVVAGG
Sbjct  64   NVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVMIAAQSIQLGINDVVVAGG  123

Query  681  MESMSNVHKYFAEAR  725
            MESMSN  KY AEAR
Sbjct  124  MESMSNTPKYLAEAR  138



>ref|XP_010442239.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Camelina 
sativa]
Length=403

 Score =   267 bits (682),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +2

Query  1190  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  1369
             TA+++N +DVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKR +VDP+LV+EV FG
Sbjct  4     TADSVNPKDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIAAALKRANVDPALVQEVVFG  63

Query  1370  NVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGG  1549
             NVLSANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA M+AAQSIQLGINDVVVAGG
Sbjct  64    NVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVMIAAQSIQLGINDVVVAGG  123

Query  1550  MESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             MESMSN PKY AEARKGSR GHDS+VDGML
Sbjct  124   MESMSNTPKYLAEARKGSRFGHDSVVDGML  153


 Score =   234 bits (596),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = +3

Query  321  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFG  500
            TA+++N +DVCIVGVARTPMGGFLGSLSSLPATKLGSLAI +ALKRA+VDP+LV+EV FG
Sbjct  4    TADSVNPKDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIAAALKRANVDPALVQEVVFG  63

Query  501  NVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGG  680
            NVL ANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA ++AAQSIQLGINDVVVAGG
Sbjct  64   NVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVMIAAQSIQLGINDVVVAGG  123

Query  681  MESMSNVHKYFAEAR  725
            MESMSN  KY AEAR
Sbjct  124  MESMSNTPKYLAEAR  138



>ref|XP_010689228.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Beta vulgaris 
subsp. vulgaris]
Length=405

 Score =   267 bits (682),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 144/155 (93%), Gaps = 1/155 (1%)
 Frame = +2

Query  1178  MAPA-TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             MAP   +E+IN +DVCIVGVARTPMGGFLG+LSSLPATKLGS+AI+ ALKR ++DPSLV+
Sbjct  1     MAPVPNSESINPKDVCIVGVARTPMGGFLGTLSSLPATKLGSVAIQGALKRANIDPSLVQ  60

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EV FGNVLSANLGQAPARQAALGAGI +TVVC+TVNKVCASGMKA MLAAQSIQLGIND+
Sbjct  61    EVIFGNVLSANLGQAPARQAALGAGISDTVVCTTVNKVCASGMKAVMLAAQSIQLGINDI  120

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VVAGGMESMSN PKY AEARKGSRLGHD+LVDGML
Sbjct  121   VVAGGMESMSNAPKYIAEARKGSRLGHDTLVDGML  155


 Score =   230 bits (587),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 128/140 (91%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPA-TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            MAP   +E+IN +DVCIVGVARTPMGGFLG+LSSLPATKLGS+AI+ ALKRA++DPSLV+
Sbjct  1    MAPVPNSESINPKDVCIVGVARTPMGGFLGTLSSLPATKLGSVAIQGALKRANIDPSLVQ  60

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EV FGNVL ANLGQAPARQAALGAGI +TVVC+TVNKVCASGMKA +LAAQSIQLGIND+
Sbjct  61   EVIFGNVLSANLGQAPARQAALGAGISDTVVCTTVNKVCASGMKAVMLAAQSIQLGINDI  120

Query  666  VVAGGMESMSNVHKYFAEAR  725
            VVAGGMESMSN  KY AEAR
Sbjct  121  VVAGGMESMSNAPKYIAEAR  140



>ref|XP_009129716.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Brassica rapa]
Length=403

 Score =   267 bits (682),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +2

Query  1190  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  1369
             +A+++N RDVCIVGVARTPMGGFLGS+SSLPATKLGS+AI +ALKR +VDPSLV+EV FG
Sbjct  4     SADSVNPRDVCIVGVARTPMGGFLGSISSLPATKLGSVAIAAALKRANVDPSLVQEVVFG  63

Query  1370  NVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGG  1549
             NVLSANLGQAPARQAALGAGI N+V+C+TVNKVCASGMKA MLAAQSIQLGINDVVVAGG
Sbjct  64    NVLSANLGQAPARQAALGAGISNSVICTTVNKVCASGMKAVMLAAQSIQLGINDVVVAGG  123

Query  1550  MESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             MESMSN PKY AEARKGSR GHDSLVDGML
Sbjct  124   MESMSNTPKYLAEARKGSRFGHDSLVDGML  153


 Score =   230 bits (587),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  321  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFG  500
            +A+++N RDVCIVGVARTPMGGFLGS+SSLPATKLGS+AI +ALKRA+VDPSLV+EV FG
Sbjct  4    SADSVNPRDVCIVGVARTPMGGFLGSISSLPATKLGSVAIAAALKRANVDPSLVQEVVFG  63

Query  501  NVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGG  680
            NVL ANLGQAPARQAALGAGI N+V+C+TVNKVCASGMKA +LAAQSIQLGINDVVVAGG
Sbjct  64   NVLSANLGQAPARQAALGAGISNSVICTTVNKVCASGMKAVMLAAQSIQLGINDVVVAGG  123

Query  681  MESMSNVHKYFAEAR  725
            MESMSN  KY AEAR
Sbjct  124  MESMSNTPKYLAEAR  138



>ref|XP_009129715.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Brassica rapa]
Length=435

 Score =   268 bits (685),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 148/169 (88%), Gaps = 3/169 (2%)
 Frame = +2

Query  1133  HYNQHRSSICIH*LAMAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIE  1312
             H  +  + +C   +A    +A+++N RDVCIVGVARTPMGGFLGS+SSLPATKLGS+AI 
Sbjct  20    HVKKASTYLCSFLMAH---SADSVNPRDVCIVGVARTPMGGFLGSISSLPATKLGSVAIA  76

Query  1313  SALKRGSVDPSLVEEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKAT  1492
             +ALKR +VDPSLV+EV FGNVLSANLGQAPARQAALGAGI N+V+C+TVNKVCASGMKA 
Sbjct  77    AALKRANVDPSLVQEVVFGNVLSANLGQAPARQAALGAGISNSVICTTVNKVCASGMKAV  136

Query  1493  MLAAQSIQLGINDVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             MLAAQSIQLGINDVVVAGGMESMSN PKY AEARKGSR GHDSLVDGML
Sbjct  137   MLAAQSIQLGINDVVVAGGMESMSNTPKYLAEARKGSRFGHDSLVDGML  185


 Score =   231 bits (589),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 133/154 (86%), Gaps = 3/154 (2%)
 Frame = +3

Query  264  HYNQHRSSICIH*LAMAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIE  443
            H  +  + +C   +A    +A+++N RDVCIVGVARTPMGGFLGS+SSLPATKLGS+AI 
Sbjct  20   HVKKASTYLCSFLMAH---SADSVNPRDVCIVGVARTPMGGFLGSISSLPATKLGSVAIA  76

Query  444  SALKRASVDPSLVEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKAT  623
            +ALKRA+VDPSLV+EV FGNVL ANLGQAPARQAALGAGI N+V+C+TVNKVCASGMKA 
Sbjct  77   AALKRANVDPSLVQEVVFGNVLSANLGQAPARQAALGAGISNSVICTTVNKVCASGMKAV  136

Query  624  ILAAQSIQLGINDVVVAGGMESMSNVHKYFAEAR  725
            +LAAQSIQLGINDVVVAGGMESMSN  KY AEAR
Sbjct  137  MLAAQSIQLGINDVVVAGGMESMSNTPKYLAEAR  170



>gb|ACX47470.1| acetoacetyl-CoA thiolase [Medicago sativa]
Length=403

 Score =   267 bits (682),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +2

Query  1187  ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFF  1366
             A+  TI  RDVCIVGVARTPMG FLG+LSS+PATKLGSIAIE+ALKR +VDP++VEEVFF
Sbjct  3     ASDSTITPRDVCIVGVARTPMGVFLGTLSSVPATKLGSIAIEAALKRANVDPAIVEEVFF  62

Query  1367  GNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAG  1546
             GNVLSANLGQAPARQAALGAG+  +VVC+TVNKVCASGMKATMLAAQSIQLGINDVVVAG
Sbjct  63    GNVLSANLGQAPARQAALGAGLSKSVVCTTVNKVCASGMKATMLAAQSIQLGINDVVVAG  122

Query  1547  GMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             GME+MSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  123   GMENMSNVPKYLAEARKGSRLGHDSLVDGML  153


 Score =   228 bits (582),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = +3

Query  318  ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFF  497
            A+  TI  RDVCIVGVARTPMG FLG+LSS+PATKLGS+AIE+ALKRA+VDP++VEEVFF
Sbjct  3    ASDSTITPRDVCIVGVARTPMGVFLGTLSSVPATKLGSIAIEAALKRANVDPAIVEEVFF  62

Query  498  GNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAG  677
            GNVL ANLGQAPARQAALGAG+  +VVC+TVNKVCASGMKAT+LAAQSIQLGINDVVVAG
Sbjct  63   GNVLSANLGQAPARQAALGAGLSKSVVCTTVNKVCASGMKATMLAAQSIQLGINDVVVAG  122

Query  678  GMESMSNVHKYFAEAR  725
            GME+MSNV KY AEAR
Sbjct  123  GMENMSNVPKYLAEAR  138



>ref|XP_010267979.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Nelumbo nucifera]
Length=407

 Score =   266 bits (681),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/148 (86%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = +2

Query  1196  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  1375
             ++I  RDVC++GVARTPMGGFLGSLSSL ATKLGSIAIE ALKR +VDP+LV+EVFFGNV
Sbjct  10    DSIKPRDVCVIGVARTPMGGFLGSLSSLSATKLGSIAIECALKRANVDPALVQEVFFGNV  69

Query  1376  LSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGME  1555
             LSANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKAT+LAAQSIQLGINDVVVAGGME
Sbjct  70    LSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKATILAAQSIQLGINDVVVAGGME  129

Query  1556  SMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             SMSN PKY AEARKGSRLGHD++VDGML
Sbjct  130   SMSNAPKYIAEARKGSRLGHDTIVDGML  157


 Score =   233 bits (595),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +3

Query  327  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNV  506
            ++I  RDVC++GVARTPMGGFLGSLSSL ATKLGS+AIE ALKRA+VDP+LV+EVFFGNV
Sbjct  10   DSIKPRDVCVIGVARTPMGGFLGSLSSLSATKLGSIAIECALKRANVDPALVQEVFFGNV  69

Query  507  LGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGME  686
            L ANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKATILAAQSIQLGINDVVVAGGME
Sbjct  70   LSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKATILAAQSIQLGINDVVVAGGME  129

Query  687  SMSNVHKYFAEAR  725
            SMSN  KY AEAR
Sbjct  130  SMSNAPKYIAEAR  142



>gb|KDO78589.1| hypothetical protein CISIN_1g015003mg [Citrus sinensis]
Length=339

 Score =   264 bits (675),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = +2

Query  1193  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  1372
             +E+I ARDVCIVGVARTPMGGFLGSLSS+ ATKLGSIAIE ALKR +V P LV+EVFFGN
Sbjct  7     SESIKARDVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANVKPLLVQEVFFGN  66

Query  1373  VLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGM  1552
             VLSANLGQAPARQAALGAGIPN+VVC+T+NKVC+SGMKA MLAAQSIQLGIND+VVAGGM
Sbjct  67    VLSANLGQAPARQAALGAGIPNSVVCTTINKVCSSGMKAVMLAAQSIQLGINDIVVAGGM  126

Query  1553  ESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             ESMSN PKY AEARKGSRLGHD++VDGML
Sbjct  127   ESMSNAPKYLAEARKGSRLGHDTIVDGML  155


 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  324  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGN  503
            +E+I ARDVCIVGVARTPMGGFLGSLSS+ ATKLGS+AIE ALKRA+V P LV+EVFFGN
Sbjct  7    SESIKARDVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANVKPLLVQEVFFGN  66

Query  504  VLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGM  683
            VL ANLGQAPARQAALGAGIPN+VVC+T+NKVC+SGMKA +LAAQSIQLGIND+VVAGGM
Sbjct  67   VLSANLGQAPARQAALGAGIPNSVVCTTINKVCSSGMKAVMLAAQSIQLGINDIVVAGGM  126

Query  684  ESMSNVHKYFAEAR  725
            ESMSN  KY AEAR
Sbjct  127  ESMSNAPKYLAEAR  140



>emb|CDY00071.1| BnaC09g02300D [Brassica napus]
Length=403

 Score =   266 bits (679),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +2

Query  1190  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  1369
             +A+++N RDVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKR +VDPSLV+EV FG
Sbjct  4     SADSVNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSVAITAALKRANVDPSLVQEVVFG  63

Query  1370  NVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGG  1549
             NVLSANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA ++AAQSIQLGINDVVVAGG
Sbjct  64    NVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVVIAAQSIQLGINDVVVAGG  123

Query  1550  MESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             MESMSN PKY AEARKGSR GHD LVDGML
Sbjct  124   MESMSNTPKYLAEARKGSRFGHDFLVDGML  153


 Score =   234 bits (597),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = +3

Query  321  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFG  500
            +A+++N RDVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKRA+VDPSLV+EV FG
Sbjct  4    SADSVNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSVAITAALKRANVDPSLVQEVVFG  63

Query  501  NVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGG  680
            NVL ANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA ++AAQSIQLGINDVVVAGG
Sbjct  64   NVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVVIAAQSIQLGINDVVVAGG  123

Query  681  MESMSNVHKYFAEAR  725
            MESMSN  KY AEAR
Sbjct  124  MESMSNTPKYLAEAR  138



>ref|XP_010267976.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010267978.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Nelumbo nucifera]
Length=417

 Score =   266 bits (680),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 128/148 (86%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = +2

Query  1196  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  1375
             ++I  RDVC++GVARTPMGGFLGSLSSL ATKLGSIAIE ALKR +VDP+LV+EVFFGNV
Sbjct  10    DSIKPRDVCVIGVARTPMGGFLGSLSSLSATKLGSIAIECALKRANVDPALVQEVFFGNV  69

Query  1376  LSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGME  1555
             LSANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKAT+LAAQSIQLGINDVVVAGGME
Sbjct  70    LSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKATILAAQSIQLGINDVVVAGGME  129

Query  1556  SMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             SMSN PKY AEARKGSRLGHD++VDGML
Sbjct  130   SMSNAPKYIAEARKGSRLGHDTIVDGML  157


 Score =   233 bits (595),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +3

Query  327  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNV  506
            ++I  RDVC++GVARTPMGGFLGSLSSL ATKLGS+AIE ALKRA+VDP+LV+EVFFGNV
Sbjct  10   DSIKPRDVCVIGVARTPMGGFLGSLSSLSATKLGSIAIECALKRANVDPALVQEVFFGNV  69

Query  507  LGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGME  686
            L ANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKATILAAQSIQLGINDVVVAGGME
Sbjct  70   LSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKATILAAQSIQLGINDVVVAGGME  129

Query  687  SMSNVHKYFAEAR  725
            SMSN  KY AEAR
Sbjct  130  SMSNAPKYIAEAR  142



>ref|XP_004303573.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Fragaria 
vesca subsp. vesca]
Length=405

 Score =   265 bits (678),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 146/155 (94%), Gaps = 1/155 (1%)
 Frame = +2

Query  1178  MAP-ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             MAP A A++I+ R V IVGVARTPMG FLG+LSSLPATKLGSIAIE+ALKR +VDPSLVE
Sbjct  1     MAPEACADSISPRGVYIVGVARTPMGAFLGALSSLPATKLGSIAIEAALKRANVDPSLVE  60

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EVFFGNVLSANLGQAPARQAALGAG+ ++V+C+TVNKVCASG+KATMLAAQSIQLGINDV
Sbjct  61    EVFFGNVLSANLGQAPARQAALGAGLSHSVICTTVNKVCASGLKATMLAAQSIQLGINDV  120

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VVAGGMESMSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  121   VVAGGMESMSNVPKYLAEARKGSRLGHDSLVDGML  155


 Score =   227 bits (579),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 130/140 (93%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAP-ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            MAP A A++I+ R V IVGVARTPMG FLG+LSSLPATKLGS+AIE+ALKRA+VDPSLVE
Sbjct  1    MAPEACADSISPRGVYIVGVARTPMGAFLGALSSLPATKLGSIAIEAALKRANVDPSLVE  60

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EVFFGNVL ANLGQAPARQAALGAG+ ++V+C+TVNKVCASG+KAT+LAAQSIQLGINDV
Sbjct  61   EVFFGNVLSANLGQAPARQAALGAGLSHSVICTTVNKVCASGLKATMLAAQSIQLGINDV  120

Query  666  VVAGGMESMSNVHKYFAEAR  725
            VVAGGMESMSNV KY AEAR
Sbjct  121  VVAGGMESMSNVPKYLAEAR  140



>ref|XP_007142529.1| hypothetical protein PHAVU_008G288400g [Phaseolus vulgaris]
 gb|ESW14523.1| hypothetical protein PHAVU_008G288400g [Phaseolus vulgaris]
Length=407

 Score =   265 bits (678),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +2

Query  1190  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  1369
             +++ I  RDVCIVGVARTPMGGFLG+LSSL ATKLGSIAIE+ALKR +VDPSLVEEV FG
Sbjct  8     SSDDIKPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIEAALKRANVDPSLVEEVIFG  67

Query  1370  NVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGG  1549
             NVLSANLGQAPARQAALGAGIPN+VVC+TVNKVCASGMKA MLAAQSIQLG N+VVVAGG
Sbjct  68    NVLSANLGQAPARQAALGAGIPNSVVCTTVNKVCASGMKAAMLAAQSIQLGTNNVVVAGG  127

Query  1550  MESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             ME MSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  128   MECMSNVPKYLAEARKGSRLGHDSLVDGML  157


 Score =   228 bits (580),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +3

Query  321  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFG  500
            +++ I  RDVCIVGVARTPMGGFLG+LSSL ATKLGS+AIE+ALKRA+VDPSLVEEV FG
Sbjct  8    SSDDIKPRDVCIVGVARTPMGGFLGTLSSLSATKLGSIAIEAALKRANVDPSLVEEVIFG  67

Query  501  NVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGG  680
            NVL ANLGQAPARQAALGAGIPN+VVC+TVNKVCASGMKA +LAAQSIQLG N+VVVAGG
Sbjct  68   NVLSANLGQAPARQAALGAGIPNSVVCTTVNKVCASGMKAAMLAAQSIQLGTNNVVVAGG  127

Query  681  MESMSNVHKYFAEAR  725
            ME MSNV KY AEAR
Sbjct  128  MECMSNVPKYLAEAR  142



>emb|CDX85319.1| BnaC07g26300D [Brassica napus]
Length=425

 Score =   266 bits (679),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +2

Query  1190  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  1369
             TA+++N R+VCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKR +VDPSLV+EV FG
Sbjct  26    TADSVNPREVCIVGVARTPMGGFLGSLSSLPATKLGSVAIAAALKRANVDPSLVQEVVFG  85

Query  1370  NVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGG  1549
             NVLSANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA M+AAQSIQLGINDVVVAGG
Sbjct  86    NVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVMIAAQSIQLGINDVVVAGG  145

Query  1550  MESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             MESMSN PKY AEARKGSR G+DSLVDGML
Sbjct  146   MESMSNTPKYLAEARKGSRFGNDSLVDGML  175


 Score =   233 bits (594),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = +3

Query  321  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFG  500
            TA+++N R+VCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKRA+VDPSLV+EV FG
Sbjct  26   TADSVNPREVCIVGVARTPMGGFLGSLSSLPATKLGSVAIAAALKRANVDPSLVQEVVFG  85

Query  501  NVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGG  680
            NVL ANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA ++AAQSIQLGINDVVVAGG
Sbjct  86   NVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVMIAAQSIQLGINDVVVAGG  145

Query  681  MESMSNVHKYFAEAR  725
            MESMSN  KY AEAR
Sbjct  146  MESMSNTPKYLAEAR  160



>ref|XP_002308755.1| truncated acetyl Co-A acetyltransferase-like family protein [Populus 
trichocarpa]
 gb|EEE92278.1| truncated acetyl Co-A acetyltransferase-like family protein [Populus 
trichocarpa]
Length=412

 Score =   265 bits (678),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +2

Query  1187  ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFF  1366
             A++++I  RDVCIVGVARTPMGGFLGSLSS  ATKLGSIAI+ AL+R ++DPSLV+EVFF
Sbjct  2     ASSDSIKPRDVCIVGVARTPMGGFLGSLSSFSATKLGSIAIQCALQRANIDPSLVQEVFF  61

Query  1367  GNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAG  1546
             GNVLSANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKATMLAAQ+IQLGINDVVVAG
Sbjct  62    GNVLSANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMLAAQTIQLGINDVVVAG  121

Query  1547  GMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             GMESMSN PKY A+ARKGSRLGHD++VDGM+
Sbjct  122   GMESMSNAPKYLADARKGSRLGHDTIVDGMM  152


 Score =   230 bits (587),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 127/136 (93%), Gaps = 0/136 (0%)
 Frame = +3

Query  318  ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFF  497
            A++++I  RDVCIVGVARTPMGGFLGSLSS  ATKLGS+AI+ AL+RA++DPSLV+EVFF
Sbjct  2    ASSDSIKPRDVCIVGVARTPMGGFLGSLSSFSATKLGSIAIQCALQRANIDPSLVQEVFF  61

Query  498  GNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAG  677
            GNVL ANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKAT+LAAQ+IQLGINDVVVAG
Sbjct  62   GNVLSANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMLAAQTIQLGINDVVVAG  121

Query  678  GMESMSNVHKYFAEAR  725
            GMESMSN  KY A+AR
Sbjct  122  GMESMSNAPKYLADAR  137



>gb|AFI23434.1| thiolase II [Betula platyphylla]
Length=400

 Score =   265 bits (677),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 140/151 (93%), Gaps = 2/151 (1%)
 Frame = +2

Query  1187  ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFF  1366
             A +++I  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIE ALKR +VDPSLV+EVFF
Sbjct  2     AASDSIKPRDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIECALKRANVDPSLVQEVFF  61

Query  1367  GNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAG  1546
             GNVL ANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKATMLAAQSI  GINDVVVAG
Sbjct  62    GNVLCANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMLAAQSI--GINDVVVAG  119

Query  1547  GMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             GMESMSNVPKY  EARKGSR GHDSLVDGML
Sbjct  120   GMESMSNVPKYITEARKGSRFGHDSLVDGML  150


 Score =   229 bits (585),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 126/136 (93%), Gaps = 2/136 (1%)
 Frame = +3

Query  318  ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFF  497
            A +++I  RDVCIVGVARTPMGGFLGSLSSLPATKLGS+AIE ALKRA+VDPSLV+EVFF
Sbjct  2    AASDSIKPRDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIECALKRANVDPSLVQEVFF  61

Query  498  GNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAG  677
            GNVL ANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKAT+LAAQSI  GINDVVVAG
Sbjct  62   GNVLCANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMLAAQSI--GINDVVVAG  119

Query  678  GMESMSNVHKYFAEAR  725
            GMESMSNV KY  EAR
Sbjct  120  GMESMSNVPKYITEAR  135



>gb|KEH15899.1| peroxisomal acetoacetyl-coenzyme A thiolase, partial [Medicago 
truncatula]
Length=350

 Score =   263 bits (672),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +2

Query  1202  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  1381
             I  RDVCIVGVARTPMG FLG+LSS+PATKLGSIAIE+ALKR +VDP++VEEVFFGNVLS
Sbjct  12    IQPRDVCIVGVARTPMGAFLGTLSSVPATKLGSIAIEAALKRANVDPAIVEEVFFGNVLS  71

Query  1382  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESM  1561
             ANLGQAPARQAALGAG+  +VVC+TVNKVCASGMKATMLAAQSIQLGINDVVVAGGME+M
Sbjct  72    ANLGQAPARQAALGAGLSKSVVCTTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMENM  131

Query  1562  SNVPKYFAEARKGSRLGHDSLVDGML  1639
             S+VPKY AEARKGSRLGHDSLVDGML
Sbjct  132   SSVPKYLAEARKGSRLGHDSLVDGML  157


 Score =   225 bits (573),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +3

Query  333  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLG  512
            I  RDVCIVGVARTPMG FLG+LSS+PATKLGS+AIE+ALKRA+VDP++VEEVFFGNVL 
Sbjct  12   IQPRDVCIVGVARTPMGAFLGTLSSVPATKLGSIAIEAALKRANVDPAIVEEVFFGNVLS  71

Query  513  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESM  692
            ANLGQAPARQAALGAG+  +VVC+TVNKVCASGMKAT+LAAQSIQLGINDVVVAGGME+M
Sbjct  72   ANLGQAPARQAALGAGLSKSVVCTTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMENM  131

Query  693  SNVHKYFAEAR  725
            S+V KY AEAR
Sbjct  132  SSVPKYLAEAR  142



>ref|XP_010493636.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Camelina 
sativa]
Length=403

 Score =   265 bits (677),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +2

Query  1190  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  1369
             TA+++N +DVCIVGVARTPM GFLGSLSSLPATKLGS+AI +ALKR +VDP+LV+EV FG
Sbjct  4     TADSVNPKDVCIVGVARTPMSGFLGSLSSLPATKLGSLAIAAALKRANVDPALVQEVVFG  63

Query  1370  NVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGG  1549
             NVLSANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA M+AAQSIQLGINDVVVAGG
Sbjct  64    NVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVMIAAQSIQLGINDVVVAGG  123

Query  1550  MESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             MESMSN PKY AEARKGSR GHDS+VDGML
Sbjct  124   MESMSNTPKYLAEARKGSRFGHDSVVDGML  153


 Score =   231 bits (590),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  321  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFG  500
            TA+++N +DVCIVGVARTPM GFLGSLSSLPATKLGSLAI +ALKRA+VDP+LV+EV FG
Sbjct  4    TADSVNPKDVCIVGVARTPMSGFLGSLSSLPATKLGSLAIAAALKRANVDPALVQEVVFG  63

Query  501  NVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGG  680
            NVL ANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA ++AAQSIQLGINDVVVAGG
Sbjct  64   NVLSANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVMIAAQSIQLGINDVVVAGG  123

Query  681  MESMSNVHKYFAEAR  725
            MESMSN  KY AEAR
Sbjct  124  MESMSNTPKYLAEAR  138



>tpg|DAA47710.1| TPA: hypothetical protein ZEAMMB73_220204 [Zea mays]
Length=394

 Score =   264 bits (675),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +2

Query  1202  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  1381
             I  RDVC+VGVARTP+GGFLG+LSSLPATKLGSIAIE+ALKR +VDP+LV+EVFFGNVLS
Sbjct  6     IAPRDVCVVGVARTPLGGFLGALSSLPATKLGSIAIEAALKRANVDPALVQEVFFGNVLS  65

Query  1382  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESM  1561
             ANLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKATM AAQSIQLGIND+VVAGGMESM
Sbjct  66    ANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMFAAQSIQLGINDIVVAGGMESM  125

Query  1562  SNVPKYFAEARKGSRLGHDSLVDGML  1639
             SN PKY AEARKGSR GHD+LVD ML
Sbjct  126   SNAPKYIAEARKGSRFGHDTLVDAML  151


 Score =   231 bits (589),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +3

Query  333  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLG  512
            I  RDVC+VGVARTP+GGFLG+LSSLPATKLGS+AIE+ALKRA+VDP+LV+EVFFGNVL 
Sbjct  6    IAPRDVCVVGVARTPLGGFLGALSSLPATKLGSIAIEAALKRANVDPALVQEVFFGNVLS  65

Query  513  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESM  692
            ANLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKAT+ AAQSIQLGIND+VVAGGMESM
Sbjct  66   ANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMFAAQSIQLGINDIVVAGGMESM  125

Query  693  SNVHKYFAEAR  725
            SN  KY AEAR
Sbjct  126  SNAPKYIAEAR  136



>ref|NP_001266315.1| acetyl-CoA acetyltransferase, cytosolic 1 [Zea mays]
 gb|ACG34735.1| acetyl-CoA acetyltransferase, cytosolic 1 [Zea mays]
Length=401

 Score =   265 bits (676),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +2

Query  1202  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  1381
             I  RDVC+VGVARTP+GGFLG+LSSLPATKLGSIAIE+ALKR +VDP+LV+EVFFGNVLS
Sbjct  6     IAPRDVCVVGVARTPLGGFLGALSSLPATKLGSIAIEAALKRANVDPALVQEVFFGNVLS  65

Query  1382  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESM  1561
             ANLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKATM AAQSIQLGIND+VVAGGMESM
Sbjct  66    ANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMFAAQSIQLGINDIVVAGGMESM  125

Query  1562  SNVPKYFAEARKGSRLGHDSLVDGML  1639
             SN PKY AEARKGSR GHD+LVD ML
Sbjct  126   SNAPKYIAEARKGSRFGHDTLVDAML  151


 Score =   231 bits (589),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +3

Query  333  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLG  512
            I  RDVC+VGVARTP+GGFLG+LSSLPATKLGS+AIE+ALKRA+VDP+LV+EVFFGNVL 
Sbjct  6    IAPRDVCVVGVARTPLGGFLGALSSLPATKLGSIAIEAALKRANVDPALVQEVFFGNVLS  65

Query  513  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESM  692
            ANLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKAT+ AAQSIQLGIND+VVAGGMESM
Sbjct  66   ANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMFAAQSIQLGINDIVVAGGMESM  125

Query  693  SNVHKYFAEAR  725
            SN  KY AEAR
Sbjct  126  SNAPKYIAEAR  136



>ref|XP_011654778.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X3 [Cucumis sativus]
Length=381

 Score =   264 bits (674),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAP ++++IN RDVCIVGVARTPMGGFLGSLSS  AT+LGSIAIE ALKR +VDPSLV+E
Sbjct  1     MAPLSSDSINPRDVCIVGVARTPMGGFLGSLSSFSATQLGSIAIECALKRANVDPSLVQE  60

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKATM+AA +IQLGINDVV
Sbjct  61    VFFGNVLSANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMIAAHTIQLGINDVV  120

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             V+GGMESMSN PKY  E RKGSR G+D++VDGML
Sbjct  121   VSGGMESMSNTPKYLQEVRKGSRFGNDAVVDGML  154


 Score =   233 bits (594),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAP ++++IN RDVCIVGVARTPMGGFLGSLSS  AT+LGS+AIE ALKRA+VDPSLV+E
Sbjct  1    MAPLSSDSINPRDVCIVGVARTPMGGFLGSLSSFSATQLGSIAIECALKRANVDPSLVQE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKAT++AA +IQLGINDVV
Sbjct  61   VFFGNVLSANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMIAAHTIQLGINDVV  120

Query  669  VAGGMESMSNVHKYFAEAR  725
            V+GGMESMSN  KY  E R
Sbjct  121  VSGGMESMSNTPKYLQEVR  139



>gb|ACF85124.1| unknown [Zea mays]
 tpg|DAA47708.1| TPA: acetoacetyl CoA thiolase isoform 1 [Zea mays]
 tpg|DAA47709.1| TPA: acetoacetyl CoA thiolase isoform 2 [Zea mays]
Length=401

 Score =   264 bits (675),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +2

Query  1202  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  1381
             I  RDVC+VGVARTP+GGFLG+LSSLPATKLGSIAIE+ALKR +VDP+LV+EVFFGNVLS
Sbjct  6     IAPRDVCVVGVARTPLGGFLGALSSLPATKLGSIAIEAALKRANVDPALVQEVFFGNVLS  65

Query  1382  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESM  1561
             ANLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKATM AAQSIQLGIND+VVAGGMESM
Sbjct  66    ANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMFAAQSIQLGINDIVVAGGMESM  125

Query  1562  SNVPKYFAEARKGSRLGHDSLVDGML  1639
             SN PKY AEARKGSR GHD+LVD ML
Sbjct  126   SNAPKYIAEARKGSRFGHDTLVDAML  151


 Score =   231 bits (589),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +3

Query  333  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLG  512
            I  RDVC+VGVARTP+GGFLG+LSSLPATKLGS+AIE+ALKRA+VDP+LV+EVFFGNVL 
Sbjct  6    IAPRDVCVVGVARTPLGGFLGALSSLPATKLGSIAIEAALKRANVDPALVQEVFFGNVLS  65

Query  513  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESM  692
            ANLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKAT+ AAQSIQLGIND+VVAGGMESM
Sbjct  66   ANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMFAAQSIQLGINDIVVAGGMESM  125

Query  693  SNVHKYFAEAR  725
            SN  KY AEAR
Sbjct  126  SNAPKYIAEAR  136



>emb|CDY48742.1| BnaA02g30030D [Brassica napus]
Length=403

 Score =   264 bits (675),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +2

Query  1190  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  1369
             +A+++N RDVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKR +VDPSLV+EV FG
Sbjct  4     SADSVNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSVAIAAALKRANVDPSLVQEVVFG  63

Query  1370  NVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGG  1549
             NVLSANLGQAPARQAALGAGI N+V+C+TVNKVCASGMKA M+AAQSIQLGI+DVVVAGG
Sbjct  64    NVLSANLGQAPARQAALGAGISNSVICTTVNKVCASGMKAVMIAAQSIQLGISDVVVAGG  123

Query  1550  MESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             MESMSN PKY AEARKGSR GHDSLVDGML
Sbjct  124   MESMSNTPKYLAEARKGSRFGHDSLVDGML  153


 Score =   228 bits (581),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = +3

Query  321  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFG  500
            +A+++N RDVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKRA+VDPSLV+EV FG
Sbjct  4    SADSVNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSVAIAAALKRANVDPSLVQEVVFG  63

Query  501  NVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGG  680
            NVL ANLGQAPARQAALGAGI N+V+C+TVNKVCASGMKA ++AAQSIQLGI+DVVVAGG
Sbjct  64   NVLSANLGQAPARQAALGAGISNSVICTTVNKVCASGMKAVMIAAQSIQLGISDVVVAGG  123

Query  681  MESMSNVHKYFAEAR  725
            MESMSN  KY AEAR
Sbjct  124  MESMSNTPKYLAEAR  138



>gb|AAL18924.1|AF429383_1 acetyl Co-A acetyltransferase [Hevea brasiliensis]
Length=411

 Score =   265 bits (676),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 146/154 (95%), Gaps = 1/154 (1%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             M+P++ ++IN RDVCIVGVARTPMGGFLGSLSS  ATKLGSIAI++ALKR +VDPSLV+E
Sbjct  1     MSPSS-DSINPRDVCIVGVARTPMGGFLGSLSSFSATKLGSIAIQAALKRANVDPSLVQE  59

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKATMLAA +IQ+GIND+V
Sbjct  60    VFFGNVLSANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMLAALTIQVGINDIV  119

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSN PKY AEAR+GSRLGHD+++DGML
Sbjct  120   VAGGMESMSNAPKYLAEARRGSRLGHDTIIDGML  153


 Score =   230 bits (586),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/139 (81%), Positives = 130/139 (94%), Gaps = 1/139 (1%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            M+P++ ++IN RDVCIVGVARTPMGGFLGSLSS  ATKLGS+AI++ALKRA+VDPSLV+E
Sbjct  1    MSPSS-DSINPRDVCIVGVARTPMGGFLGSLSSFSATKLGSIAIQAALKRANVDPSLVQE  59

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKAT+LAA +IQ+GIND+V
Sbjct  60   VFFGNVLSANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMLAALTIQVGINDIV  119

Query  669  VAGGMESMSNVHKYFAEAR  725
            VAGGMESMSN  KY AEAR
Sbjct  120  VAGGMESMSNAPKYLAEAR  138



>gb|KDO78588.1| hypothetical protein CISIN_1g015003mg [Citrus sinensis]
Length=404

 Score =   264 bits (675),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = +2

Query  1193  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  1372
             +E+I ARDVCIVGVARTPMGGFLGSLSS+ ATKLGSIAIE ALKR +V P LV+EVFFGN
Sbjct  7     SESIKARDVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANVKPLLVQEVFFGN  66

Query  1373  VLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGM  1552
             VLSANLGQAPARQAALGAGIPN+VVC+T+NKVC+SGMKA MLAAQSIQLGIND+VVAGGM
Sbjct  67    VLSANLGQAPARQAALGAGIPNSVVCTTINKVCSSGMKAVMLAAQSIQLGINDIVVAGGM  126

Query  1553  ESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             ESMSN PKY AEARKGSRLGHD++VDGML
Sbjct  127   ESMSNAPKYLAEARKGSRLGHDTIVDGML  155


 Score =   228 bits (581),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  324  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGN  503
            +E+I ARDVCIVGVARTPMGGFLGSLSS+ ATKLGS+AIE ALKRA+V P LV+EVFFGN
Sbjct  7    SESIKARDVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANVKPLLVQEVFFGN  66

Query  504  VLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGM  683
            VL ANLGQAPARQAALGAGIPN+VVC+T+NKVC+SGMKA +LAAQSIQLGIND+VVAGGM
Sbjct  67   VLSANLGQAPARQAALGAGIPNSVVCTTINKVCSSGMKAVMLAAQSIQLGINDIVVAGGM  126

Query  684  ESMSNVHKYFAEAR  725
            ESMSN  KY AEAR
Sbjct  127  ESMSNAPKYLAEAR  140



>ref|XP_006467262.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2-like 
[Citrus sinensis]
Length=414

 Score =   264 bits (675),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = +2

Query  1193  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  1372
             +E+I ARDVCIVGVARTPMGGFLGSLSS+ ATKLGSIAIE ALKR +V P LV+EVFFGN
Sbjct  7     SESIKARDVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANVKPLLVQEVFFGN  66

Query  1373  VLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGM  1552
             VLSANLGQAPARQAALGAGIPN+VVC+T+NKVC+SGMKA MLAAQSIQLGIND+VVAGGM
Sbjct  67    VLSANLGQAPARQAALGAGIPNSVVCTTINKVCSSGMKAVMLAAQSIQLGINDIVVAGGM  126

Query  1553  ESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             ESMSN PKY AEARKGSRLGHD++VDGML
Sbjct  127   ESMSNAPKYLAEARKGSRLGHDTIVDGML  155


 Score =   228 bits (582),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  324  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGN  503
            +E+I ARDVCIVGVARTPMGGFLGSLSS+ ATKLGS+AIE ALKRA+V P LV+EVFFGN
Sbjct  7    SESIKARDVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANVKPLLVQEVFFGN  66

Query  504  VLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGM  683
            VL ANLGQAPARQAALGAGIPN+VVC+T+NKVC+SGMKA +LAAQSIQLGIND+VVAGGM
Sbjct  67   VLSANLGQAPARQAALGAGIPNSVVCTTINKVCSSGMKAVMLAAQSIQLGINDIVVAGGM  126

Query  684  ESMSNVHKYFAEAR  725
            ESMSN  KY AEAR
Sbjct  127  ESMSNAPKYLAEAR  140



>ref|XP_006660462.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Oryza brachyantha]
 ref|XP_006660463.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Oryza brachyantha]
Length=401

 Score =   264 bits (674),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = +2

Query  1193  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  1372
             ++ + +RDVC+VGVARTPMGGFLGSLSSL ATKLGS+AIE+ALKR +VDP+LV+EVFFGN
Sbjct  3     SDNVGSRDVCVVGVARTPMGGFLGSLSSLSATKLGSVAIEAALKRANVDPALVQEVFFGN  62

Query  1373  VLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGM  1552
             VLSANLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKATM AAQSI LGIND+VVAGGM
Sbjct  63    VLSANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMFAAQSILLGINDIVVAGGM  122

Query  1553  ESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             ESMSN PKY AEARKGSR GHD+LVDGML
Sbjct  123   ESMSNAPKYIAEARKGSRFGHDTLVDGML  151


 Score =   228 bits (582),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  324  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGN  503
            ++ + +RDVC+VGVARTPMGGFLGSLSSL ATKLGS+AIE+ALKRA+VDP+LV+EVFFGN
Sbjct  3    SDNVGSRDVCVVGVARTPMGGFLGSLSSLSATKLGSVAIEAALKRANVDPALVQEVFFGN  62

Query  504  VLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGM  683
            VL ANLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKAT+ AAQSI LGIND+VVAGGM
Sbjct  63   VLSANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMFAAQSILLGINDIVVAGGM  122

Query  684  ESMSNVHKYFAEAR  725
            ESMSN  KY AEAR
Sbjct  123  ESMSNAPKYIAEAR  136



>gb|KDO78587.1| hypothetical protein CISIN_1g015003mg [Citrus sinensis]
Length=414

 Score =   264 bits (674),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = +2

Query  1193  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  1372
             +E+I ARDVCIVGVARTPMGGFLGSLSS+ ATKLGSIAIE ALKR +V P LV+EVFFGN
Sbjct  7     SESIKARDVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANVKPLLVQEVFFGN  66

Query  1373  VLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGM  1552
             VLSANLGQAPARQAALGAGIPN+VVC+T+NKVC+SGMKA MLAAQSIQLGIND+VVAGGM
Sbjct  67    VLSANLGQAPARQAALGAGIPNSVVCTTINKVCSSGMKAVMLAAQSIQLGINDIVVAGGM  126

Query  1553  ESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             ESMSN PKY AEARKGSRLGHD++VDGML
Sbjct  127   ESMSNAPKYLAEARKGSRLGHDTIVDGML  155


 Score =   228 bits (581),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  324  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGN  503
            +E+I ARDVCIVGVARTPMGGFLGSLSS+ ATKLGS+AIE ALKRA+V P LV+EVFFGN
Sbjct  7    SESIKARDVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANVKPLLVQEVFFGN  66

Query  504  VLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGM  683
            VL ANLGQAPARQAALGAGIPN+VVC+T+NKVC+SGMKA +LAAQSIQLGIND+VVAGGM
Sbjct  67   VLSANLGQAPARQAALGAGIPNSVVCTTINKVCSSGMKAVMLAAQSIQLGINDIVVAGGM  126

Query  684  ESMSNVHKYFAEAR  725
            ESMSN  KY AEAR
Sbjct  127  ESMSNAPKYLAEAR  140



>ref|XP_004969865.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Setaria 
italica]
Length=401

 Score =   263 bits (673),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = +2

Query  1193  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  1372
             ++ I  RDVC+VGVARTPMGGFLG+LSSLPATKLGSIAIE+ALKR +VDP LV+EV+FGN
Sbjct  3     SDGITPRDVCVVGVARTPMGGFLGALSSLPATKLGSIAIEAALKRANVDPVLVQEVYFGN  62

Query  1373  VLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGM  1552
             VLSANLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKAT+ AAQSIQLGIND+VVAGGM
Sbjct  63    VLSANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATVFAAQSIQLGINDIVVAGGM  122

Query  1553  ESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             ESMSN PKY AEARKGSR GHD+LVD ML
Sbjct  123   ESMSNAPKYIAEARKGSRFGHDTLVDAML  151


 Score =   232 bits (592),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  324  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGN  503
            ++ I  RDVC+VGVARTPMGGFLG+LSSLPATKLGS+AIE+ALKRA+VDP LV+EV+FGN
Sbjct  3    SDGITPRDVCVVGVARTPMGGFLGALSSLPATKLGSIAIEAALKRANVDPVLVQEVYFGN  62

Query  504  VLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGM  683
            VL ANLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKAT+ AAQSIQLGIND+VVAGGM
Sbjct  63   VLSANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATVFAAQSIQLGINDIVVAGGM  122

Query  684  ESMSNVHKYFAEAR  725
            ESMSN  KY AEAR
Sbjct  123  ESMSNAPKYIAEAR  136



>ref|XP_004139514.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Cucumis sativus]
Length=404

 Score =   263 bits (672),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAP ++++IN RDVCIVGVARTPMGGFLGSLSS  AT+LGSIAIE ALKR +VDPSLV+E
Sbjct  1     MAPLSSDSINPRDVCIVGVARTPMGGFLGSLSSFSATQLGSIAIECALKRANVDPSLVQE  60

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKATM+AA +IQLGINDVV
Sbjct  61    VFFGNVLSANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMIAAHTIQLGINDVV  120

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             V+GGMESMSN PKY  E RKGSR G+D++VDGML
Sbjct  121   VSGGMESMSNTPKYLQEVRKGSRFGNDAVVDGML  154


 Score =   233 bits (593),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAP ++++IN RDVCIVGVARTPMGGFLGSLSS  AT+LGS+AIE ALKRA+VDPSLV+E
Sbjct  1    MAPLSSDSINPRDVCIVGVARTPMGGFLGSLSSFSATQLGSIAIECALKRANVDPSLVQE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKAT++AA +IQLGINDVV
Sbjct  61   VFFGNVLSANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMIAAHTIQLGINDVV  120

Query  669  VAGGMESMSNVHKYFAEAR  725
            V+GGMESMSN  KY  E R
Sbjct  121  VSGGMESMSNTPKYLQEVR  139



>dbj|BAD22334.1| putative acetyl-CoA C-acyltransferase [Oryza sativa Japonica 
Group]
 gb|EAZ08304.1| hypothetical protein OsI_30555 [Oryza sativa Indica Group]
 gb|EAZ43919.1| hypothetical protein OsJ_28542 [Oryza sativa Japonica Group]
 dbj|BAG95604.1| unnamed protein product [Oryza sativa Japonica Group]
Length=401

 Score =   263 bits (671),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = +2

Query  1193  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  1372
             ++ I +RDVC+VGVARTPMGGFLG+LSSL ATKLGSIAIE+ALKR +VDP+LV+EVFFGN
Sbjct  3     SDNIGSRDVCVVGVARTPMGGFLGALSSLSATKLGSIAIEAALKRANVDPALVQEVFFGN  62

Query  1373  VLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGM  1552
             VLSANLGQAPARQAALGAGIPNTVVCS VNKVCASGMKATM AAQSI LGIND+VVAGGM
Sbjct  63    VLSANLGQAPARQAALGAGIPNTVVCSAVNKVCASGMKATMFAAQSILLGINDIVVAGGM  122

Query  1553  ESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             ESMSN PKY AEARKGSR GHD+LVDGML
Sbjct  123   ESMSNAPKYIAEARKGSRFGHDTLVDGML  151


 Score =   228 bits (580),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  324  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGN  503
            ++ I +RDVC+VGVARTPMGGFLG+LSSL ATKLGS+AIE+ALKRA+VDP+LV+EVFFGN
Sbjct  3    SDNIGSRDVCVVGVARTPMGGFLGALSSLSATKLGSIAIEAALKRANVDPALVQEVFFGN  62

Query  504  VLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGM  683
            VL ANLGQAPARQAALGAGIPNTVVCS VNKVCASGMKAT+ AAQSI LGIND+VVAGGM
Sbjct  63   VLSANLGQAPARQAALGAGIPNTVVCSAVNKVCASGMKATMFAAQSILLGINDIVVAGGM  122

Query  684  ESMSNVHKYFAEAR  725
            ESMSN  KY AEAR
Sbjct  123  ESMSNAPKYIAEAR  136



>gb|AFI57868.1| acetoacetyl-CoA thiolase, partial [Elaeis guineensis]
Length=282

 Score =   259 bits (661),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 142/155 (92%), Gaps = 1/155 (1%)
 Frame = +2

Query  1178  MAPA-TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             MAP+   + +  RDVCIVGVARTPMGGFLG+LSSL ATKLGS+AI+ ALKR +V+P+LV+
Sbjct  1     MAPSGVYDDLKPRDVCIVGVARTPMGGFLGALSSLSATKLGSVAIQCALKRANVEPALVQ  60

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EVFFGNVLSANLGQAPARQAALGAGIPNTVVC+T+NKVC+SGMKATM A+QSIQLGINDV
Sbjct  61    EVFFGNVLSANLGQAPARQAALGAGIPNTVVCTTINKVCSSGMKATMFASQSIQLGINDV  120

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VVAGGMESMSN PKY AEARKGSR G+DSL+DGML
Sbjct  121   VVAGGMESMSNAPKYLAEARKGSRFGNDSLIDGML  155


 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 127/140 (91%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPA-TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            MAP+   + +  RDVCIVGVARTPMGGFLG+LSSL ATKLGS+AI+ ALKRA+V+P+LV+
Sbjct  1    MAPSGVYDDLKPRDVCIVGVARTPMGGFLGALSSLSATKLGSVAIQCALKRANVEPALVQ  60

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EVFFGNVL ANLGQAPARQAALGAGIPNTVVC+T+NKVC+SGMKAT+ A+QSIQLGINDV
Sbjct  61   EVFFGNVLSANLGQAPARQAALGAGIPNTVVCTTINKVCSSGMKATMFASQSIQLGINDV  120

Query  666  VVAGGMESMSNVHKYFAEAR  725
            VVAGGMESMSN  KY AEAR
Sbjct  121  VVAGGMESMSNAPKYLAEAR  140



>ref|XP_003618039.1| Acetyl-CoA acetyltransferase, cytosolic [Medicago truncatula]
 gb|AET00998.1| peroxisomal acetoacetyl-coenzyme A thiolase [Medicago truncatula]
Length=407

 Score =   263 bits (671),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +2

Query  1202  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  1381
             I  RDVCIVGVARTPMG FLG+LSS+PATKLGSIAIE+ALKR +VDP++VEEVFFGNVLS
Sbjct  12    IQPRDVCIVGVARTPMGAFLGTLSSVPATKLGSIAIEAALKRANVDPAIVEEVFFGNVLS  71

Query  1382  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESM  1561
             ANLGQAPARQAALGAG+  +VVC+TVNKVCASGMKATMLAAQSIQLGINDVVVAGGME+M
Sbjct  72    ANLGQAPARQAALGAGLSKSVVCTTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMENM  131

Query  1562  SNVPKYFAEARKGSRLGHDSLVDGML  1639
             S+VPKY AEARKGSRLGHDSLVDGML
Sbjct  132   SSVPKYLAEARKGSRLGHDSLVDGML  157


 Score =   224 bits (572),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +3

Query  333  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLG  512
            I  RDVCIVGVARTPMG FLG+LSS+PATKLGS+AIE+ALKRA+VDP++VEEVFFGNVL 
Sbjct  12   IQPRDVCIVGVARTPMGAFLGTLSSVPATKLGSIAIEAALKRANVDPAIVEEVFFGNVLS  71

Query  513  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESM  692
            ANLGQAPARQAALGAG+  +VVC+TVNKVCASGMKAT+LAAQSIQLGINDVVVAGGME+M
Sbjct  72   ANLGQAPARQAALGAGLSKSVVCTTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMENM  131

Query  693  SNVHKYFAEAR  725
            S+V KY AEAR
Sbjct  132  SSVPKYLAEAR  142



>ref|XP_011002352.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Populus euphratica]
Length=402

 Score =   263 bits (671),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +2

Query  1187  ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFF  1366
             A++++I  RDVCIVGVARTPMGGFLGSLSS  ATKLGSIAI+ AL+R ++DPSLV+EVFF
Sbjct  2     ASSDSIKPRDVCIVGVARTPMGGFLGSLSSFSATKLGSIAIQCALQRANIDPSLVQEVFF  61

Query  1367  GNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAG  1546
             GNVLSANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKATMLAAQ+IQLGINDVVVAG
Sbjct  62    GNVLSANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMLAAQTIQLGINDVVVAG  121

Query  1547  GMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             G ESMSN PKY A+ARKGSRLGHD++VDGM+
Sbjct  122   GTESMSNAPKYLADARKGSRLGHDTIVDGMM  152


 Score =   228 bits (580),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = +3

Query  318  ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFF  497
            A++++I  RDVCIVGVARTPMGGFLGSLSS  ATKLGS+AI+ AL+RA++DPSLV+EVFF
Sbjct  2    ASSDSIKPRDVCIVGVARTPMGGFLGSLSSFSATKLGSIAIQCALQRANIDPSLVQEVFF  61

Query  498  GNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAG  677
            GNVL ANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKAT+LAAQ+IQLGINDVVVAG
Sbjct  62   GNVLSANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMLAAQTIQLGINDVVVAG  121

Query  678  GMESMSNVHKYFAEAR  725
            G ESMSN  KY A+AR
Sbjct  122  GTESMSNAPKYLADAR  137



>ref|XP_011002351.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Populus euphratica]
Length=412

 Score =   263 bits (671),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +2

Query  1187  ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFF  1366
             A++++I  RDVCIVGVARTPMGGFLGSLSS  ATKLGSIAI+ AL+R ++DPSLV+EVFF
Sbjct  2     ASSDSIKPRDVCIVGVARTPMGGFLGSLSSFSATKLGSIAIQCALQRANIDPSLVQEVFF  61

Query  1367  GNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAG  1546
             GNVLSANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKATMLAAQ+IQLGINDVVVAG
Sbjct  62    GNVLSANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMLAAQTIQLGINDVVVAG  121

Query  1547  GMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             G ESMSN PKY A+ARKGSRLGHD++VDGM+
Sbjct  122   GTESMSNAPKYLADARKGSRLGHDTIVDGMM  152


 Score =   228 bits (580),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = +3

Query  318  ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFF  497
            A++++I  RDVCIVGVARTPMGGFLGSLSS  ATKLGS+AI+ AL+RA++DPSLV+EVFF
Sbjct  2    ASSDSIKPRDVCIVGVARTPMGGFLGSLSSFSATKLGSIAIQCALQRANIDPSLVQEVFF  61

Query  498  GNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAG  677
            GNVL ANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKAT+LAAQ+IQLGINDVVVAG
Sbjct  62   GNVLSANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMLAAQTIQLGINDVVVAG  121

Query  678  GMESMSNVHKYFAEAR  725
            G ESMSN  KY A+AR
Sbjct  122  GTESMSNAPKYLADAR  137



>gb|AFK39138.1| unknown [Medicago truncatula]
Length=407

 Score =   263 bits (671),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +2

Query  1202  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  1381
             I  RDVCIVGVARTPMG FLG+LSS+PATKLGSIAIE+ALKR +VDP++VEEVFFGNVLS
Sbjct  12    IQPRDVCIVGVARTPMGAFLGTLSSVPATKLGSIAIEAALKRANVDPAIVEEVFFGNVLS  71

Query  1382  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESM  1561
             ANLGQAPARQAALGAG+  +VVC+TVNKVCASGMKATMLAAQSIQLGINDVVVAGGME+M
Sbjct  72    ANLGQAPARQAALGAGLSKSVVCTTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMENM  131

Query  1562  SNVPKYFAEARKGSRLGHDSLVDGML  1639
             S+VPKY AEARKGSRLGHDSLVDGML
Sbjct  132   SSVPKYLAEARKGSRLGHDSLVDGML  157


 Score =   224 bits (571),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +3

Query  333  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLG  512
            I  RDVCIVGVARTPMG FLG+LSS+PATKLGS+AIE+ALKRA+VDP++VEEVFFGNVL 
Sbjct  12   IQPRDVCIVGVARTPMGAFLGTLSSVPATKLGSIAIEAALKRANVDPAIVEEVFFGNVLS  71

Query  513  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESM  692
            ANLGQAPARQAALGAG+  +VVC+TVNKVCASGMKAT+LAAQSIQLGINDVVVAGGME+M
Sbjct  72   ANLGQAPARQAALGAGLSKSVVCTTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMENM  131

Query  693  SNVHKYFAEAR  725
            S+V KY AEAR
Sbjct  132  SSVPKYLAEAR  142



>ref|XP_011654773.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Cucumis sativus]
 gb|KGN64993.1| hypothetical protein Csa_1G173130 [Cucumis sativus]
Length=414

 Score =   263 bits (671),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAP ++++IN RDVCIVGVARTPMGGFLGSLSS  AT+LGSIAIE ALKR +VDPSLV+E
Sbjct  1     MAPLSSDSINPRDVCIVGVARTPMGGFLGSLSSFSATQLGSIAIECALKRANVDPSLVQE  60

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKATM+AA +IQLGINDVV
Sbjct  61    VFFGNVLSANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMIAAHTIQLGINDVV  120

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             V+GGMESMSN PKY  E RKGSR G+D++VDGML
Sbjct  121   VSGGMESMSNTPKYLQEVRKGSRFGNDAVVDGML  154


 Score =   233 bits (593),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAP ++++IN RDVCIVGVARTPMGGFLGSLSS  AT+LGS+AIE ALKRA+VDPSLV+E
Sbjct  1    MAPLSSDSINPRDVCIVGVARTPMGGFLGSLSSFSATQLGSIAIECALKRANVDPSLVQE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKAT++AA +IQLGINDVV
Sbjct  61   VFFGNVLSANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMIAAHTIQLGINDVV  120

Query  669  VAGGMESMSNVHKYFAEAR  725
            V+GGMESMSN  KY  E R
Sbjct  121  VSGGMESMSNTPKYLQEVR  139



>ref|XP_009396114.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009396123.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Musa 
acuminata subsp. malaccensis]
Length=401

 Score =   262 bits (670),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +2

Query  1193  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  1372
             ++ I  RDVC+VGVARTPMG FLG+LSSL ATKLGS+AIE ALKR  +DP+LV+EVFFGN
Sbjct  3     SDLIQPRDVCVVGVARTPMGSFLGALSSLSATKLGSVAIECALKRAGIDPALVQEVFFGN  62

Query  1373  VLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGM  1552
             VLSANLGQAPARQAALGAGIPNTVVC+T+NKVCASGMKATM AAQSIQLGINDVVVAGGM
Sbjct  63    VLSANLGQAPARQAALGAGIPNTVVCTTINKVCASGMKATMFAAQSIQLGINDVVVAGGM  122

Query  1553  ESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             ESMSN PKY AEARKGSR GHD+LVDGML
Sbjct  123   ESMSNAPKYVAEARKGSRFGHDTLVDGML  151


 Score =   227 bits (578),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +3

Query  324  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGN  503
            ++ I  RDVC+VGVARTPMG FLG+LSSL ATKLGS+AIE ALKRA +DP+LV+EVFFGN
Sbjct  3    SDLIQPRDVCVVGVARTPMGSFLGALSSLSATKLGSVAIECALKRAGIDPALVQEVFFGN  62

Query  504  VLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGM  683
            VL ANLGQAPARQAALGAGIPNTVVC+T+NKVCASGMKAT+ AAQSIQLGINDVVVAGGM
Sbjct  63   VLSANLGQAPARQAALGAGIPNTVVCTTINKVCASGMKATMFAAQSIQLGINDVVVAGGM  122

Query  684  ESMSNVHKYFAEAR  725
            ESMSN  KY AEAR
Sbjct  123  ESMSNAPKYVAEAR  136



>ref|XP_010088359.1| Acetyl-CoA acetyltransferase, cytosolic 1 [Morus notabilis]
 gb|EXB34477.1| Acetyl-CoA acetyltransferase, cytosolic 1 [Morus notabilis]
Length=399

 Score =   262 bits (669),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  1214  DVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLG  1393
             DVCIVGVARTPMGGFLG+LSSL ATKLGSI IE+ALKR  V+PSLV+EVFFGNVLSANLG
Sbjct  8     DVCIVGVARTPMGGFLGALSSLSATKLGSIVIEAALKRAGVNPSLVQEVFFGNVLSANLG  67

Query  1394  QAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNVP  1573
             QAPARQAALGAGIPNTVVC+T+NKVCASGMKAT+LAAQSIQLGINDVVVAGGMESMSN P
Sbjct  68    QAPARQAALGAGIPNTVVCTTINKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNTP  127

Query  1574  KYFAEARKGSRLGHDSLVDGML  1639
             KY AEARKGSRLGHDSLVDGML
Sbjct  128   KYLAEARKGSRLGHDSLVDGML  149


 Score =   227 bits (579),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +3

Query  345  DVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGANLG  524
            DVCIVGVARTPMGGFLG+LSSL ATKLGS+ IE+ALKRA V+PSLV+EVFFGNVL ANLG
Sbjct  8    DVCIVGVARTPMGGFLGALSSLSATKLGSIVIEAALKRAGVNPSLVQEVFFGNVLSANLG  67

Query  525  QAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNVH  704
            QAPARQAALGAGIPNTVVC+T+NKVCASGMKATILAAQSIQLGINDVVVAGGMESMSN  
Sbjct  68   QAPARQAALGAGIPNTVVCTTINKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNTP  127

Query  705  KYFAEAR  725
            KY AEAR
Sbjct  128  KYLAEAR  134



>ref|XP_010942603.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Elaeis 
guineensis]
 ref|XP_010942604.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Elaeis 
guineensis]
Length=401

 Score =   262 bits (669),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = +2

Query  1193  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  1372
             ++ I  RDVC+VGVARTPMGGFLG+LSSL ATKLGS+AI+ ALKR +V P+LV+EVFFGN
Sbjct  3     SDQIKPRDVCVVGVARTPMGGFLGALSSLSATKLGSVAIDCALKRANVAPALVQEVFFGN  62

Query  1373  VLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGM  1552
             VLSANLGQAPARQAALGAGIPNTVVC+T+NKVCASGMKATMLAAQSIQLGINDVVVAGGM
Sbjct  63    VLSANLGQAPARQAALGAGIPNTVVCTTINKVCASGMKATMLAAQSIQLGINDVVVAGGM  122

Query  1553  ESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             ESMSN PKY AEARKGSR GHD+LVDGML
Sbjct  123   ESMSNAPKYIAEARKGSRFGHDTLVDGML  151


 Score =   227 bits (578),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  324  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGN  503
            ++ I  RDVC+VGVARTPMGGFLG+LSSL ATKLGS+AI+ ALKRA+V P+LV+EVFFGN
Sbjct  3    SDQIKPRDVCVVGVARTPMGGFLGALSSLSATKLGSVAIDCALKRANVAPALVQEVFFGN  62

Query  504  VLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGM  683
            VL ANLGQAPARQAALGAGIPNTVVC+T+NKVCASGMKAT+LAAQSIQLGINDVVVAGGM
Sbjct  63   VLSANLGQAPARQAALGAGIPNTVVCTTINKVCASGMKATMLAAQSIQLGINDVVVAGGM  122

Query  684  ESMSNVHKYFAEAR  725
            ESMSN  KY AEAR
Sbjct  123  ESMSNAPKYIAEAR  136



>ref|NP_001062685.1| Os09g0252100 [Oryza sativa Japonica Group]
 dbj|BAF24599.1| Os09g0252100, partial [Oryza sativa Japonica Group]
Length=433

 Score =   263 bits (672),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = +2

Query  1193  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  1372
             ++ I +RDVC+VGVARTPMGGFLG+LSSL ATKLGSIAIE+ALKR +VDP+LV+EVFFGN
Sbjct  35    SDNIGSRDVCVVGVARTPMGGFLGALSSLSATKLGSIAIEAALKRANVDPALVQEVFFGN  94

Query  1373  VLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGM  1552
             VLSANLGQAPARQAALGAGIPNTVVCS VNKVCASGMKATM AAQSI LGIND+VVAGGM
Sbjct  95    VLSANLGQAPARQAALGAGIPNTVVCSAVNKVCASGMKATMFAAQSILLGINDIVVAGGM  154

Query  1553  ESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             ESMSN PKY AEARKGSR GHD+LVDGML
Sbjct  155   ESMSNAPKYIAEARKGSRFGHDTLVDGML  183


 Score =   227 bits (579),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  324  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGN  503
            ++ I +RDVC+VGVARTPMGGFLG+LSSL ATKLGS+AIE+ALKRA+VDP+LV+EVFFGN
Sbjct  35   SDNIGSRDVCVVGVARTPMGGFLGALSSLSATKLGSIAIEAALKRANVDPALVQEVFFGN  94

Query  504  VLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGM  683
            VL ANLGQAPARQAALGAGIPNTVVCS VNKVCASGMKAT+ AAQSI LGIND+VVAGGM
Sbjct  95   VLSANLGQAPARQAALGAGIPNTVVCSAVNKVCASGMKATMFAAQSILLGINDIVVAGGM  154

Query  684  ESMSNVHKYFAEAR  725
            ESMSN  KY AEAR
Sbjct  155  ESMSNAPKYIAEAR  168



>ref|XP_008811276.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008811277.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Phoenix dactylifera]
Length=401

 Score =   262 bits (669),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = +2

Query  1193  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  1372
             ++ I  RDVC+VG+ARTPMGGFLG+LS+L ATKLGSI IESALKR +V P+LV+EVFFGN
Sbjct  3     SDQIKPRDVCVVGIARTPMGGFLGALSTLSATKLGSIVIESALKRANVAPALVQEVFFGN  62

Query  1373  VLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGM  1552
             VLSANLGQAPARQAALGAGIPNTVVC+T+NKVCASG+KATMLAAQSIQLGINDVVVAGGM
Sbjct  63    VLSANLGQAPARQAALGAGIPNTVVCTTINKVCASGLKATMLAAQSIQLGINDVVVAGGM  122

Query  1553  ESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             ESMSN PKY AEARKGSR GHD+LVDGML
Sbjct  123   ESMSNAPKYIAEARKGSRFGHDTLVDGML  151


 Score =   226 bits (576),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  324  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGN  503
            ++ I  RDVC+VG+ARTPMGGFLG+LS+L ATKLGS+ IESALKRA+V P+LV+EVFFGN
Sbjct  3    SDQIKPRDVCVVGIARTPMGGFLGALSTLSATKLGSIVIESALKRANVAPALVQEVFFGN  62

Query  504  VLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGM  683
            VL ANLGQAPARQAALGAGIPNTVVC+T+NKVCASG+KAT+LAAQSIQLGINDVVVAGGM
Sbjct  63   VLSANLGQAPARQAALGAGIPNTVVCTTINKVCASGLKATMLAAQSIQLGINDVVVAGGM  122

Query  684  ESMSNVHKYFAEAR  725
            ESMSN  KY AEAR
Sbjct  123  ESMSNAPKYIAEAR  136



>ref|XP_010481277.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X1 [Camelina sativa]
Length=415

 Score =   262 bits (669),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 146/155 (94%), Gaps = 1/155 (1%)
 Frame = +2

Query  1178  MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             MAP+ ++ ++N RDVC+VGVARTPMGGFLGSLSSL AT+LGSIAIE+AL+R +VDP+LVE
Sbjct  1     MAPSVSDDSVNPRDVCVVGVARTPMGGFLGSLSSLTATRLGSIAIEAALRRANVDPALVE  60

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EVFFGNVL+ANLGQAPARQAALGAGIP +V+C+TVNKVCA+GMKA MLAAQSIQLG+NDV
Sbjct  61    EVFFGNVLTANLGQAPARQAALGAGIPYSVICTTVNKVCAAGMKAVMLAAQSIQLGLNDV  120

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VVAGGMESMSNVPKY  +AR+GSRLGHD+LVDGM+
Sbjct  121   VVAGGMESMSNVPKYLPDARRGSRLGHDTLVDGMM  155


 Score =   228 bits (580),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 130/140 (93%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            MAP+ ++ ++N RDVC+VGVARTPMGGFLGSLSSL AT+LGS+AIE+AL+RA+VDP+LVE
Sbjct  1    MAPSVSDDSVNPRDVCVVGVARTPMGGFLGSLSSLTATRLGSIAIEAALRRANVDPALVE  60

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EVFFGNVL ANLGQAPARQAALGAGIP +V+C+TVNKVCA+GMKA +LAAQSIQLG+NDV
Sbjct  61   EVFFGNVLTANLGQAPARQAALGAGIPYSVICTTVNKVCAAGMKAVMLAAQSIQLGLNDV  120

Query  666  VVAGGMESMSNVHKYFAEAR  725
            VVAGGMESMSNV KY  +AR
Sbjct  121  VVAGGMESMSNVPKYLPDAR  140



>ref|XP_010481278.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Camelina sativa]
Length=405

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 146/155 (94%), Gaps = 1/155 (1%)
 Frame = +2

Query  1178  MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             MAP+ ++ ++N RDVC+VGVARTPMGGFLGSLSSL AT+LGSIAIE+AL+R +VDP+LVE
Sbjct  1     MAPSVSDDSVNPRDVCVVGVARTPMGGFLGSLSSLTATRLGSIAIEAALRRANVDPALVE  60

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EVFFGNVL+ANLGQAPARQAALGAGIP +V+C+TVNKVCA+GMKA MLAAQSIQLG+NDV
Sbjct  61    EVFFGNVLTANLGQAPARQAALGAGIPYSVICTTVNKVCAAGMKAVMLAAQSIQLGLNDV  120

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VVAGGMESMSNVPKY  +AR+GSRLGHD+LVDGM+
Sbjct  121   VVAGGMESMSNVPKYLPDARRGSRLGHDTLVDGMM  155


 Score =   227 bits (579),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 130/140 (93%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            MAP+ ++ ++N RDVC+VGVARTPMGGFLGSLSSL AT+LGS+AIE+AL+RA+VDP+LVE
Sbjct  1    MAPSVSDDSVNPRDVCVVGVARTPMGGFLGSLSSLTATRLGSIAIEAALRRANVDPALVE  60

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EVFFGNVL ANLGQAPARQAALGAGIP +V+C+TVNKVCA+GMKA +LAAQSIQLG+NDV
Sbjct  61   EVFFGNVLTANLGQAPARQAALGAGIPYSVICTTVNKVCAAGMKAVMLAAQSIQLGLNDV  120

Query  666  VVAGGMESMSNVHKYFAEAR  725
            VVAGGMESMSNV KY  +AR
Sbjct  121  VVAGGMESMSNVPKYLPDAR  140



>ref|XP_002522876.1| acetyl-CoA acetyltransferase, mitochondrial, putative [Ricinus 
communis]
 gb|EEF39476.1| acetyl-CoA acetyltransferase, mitochondrial, putative [Ricinus 
communis]
Length=402

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 140/154 (91%), Gaps = 2/154 (1%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAP   +++  RDVCIVGVARTPMGGFLGSLSSL ATKLGSIAI  AL+R  VDPSLVEE
Sbjct  1     MAPT--DSLKPRDVCIVGVARTPMGGFLGSLSSLSATKLGSIAIHCALERARVDPSLVEE  58

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKATMLAAQ+IQ GIND+V
Sbjct  59    VFFGNVLSANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMLAAQTIQAGINDIV  118

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSN PKY AEAR GSRLGHD+++DGML
Sbjct  119   VAGGMESMSNAPKYLAEARNGSRLGHDTIIDGML  152


 Score =   229 bits (583),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 126/140 (90%), Gaps = 2/140 (1%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAP   +++  RDVCIVGVARTPMGGFLGSLSSL ATKLGS+AI  AL+RA VDPSLVEE
Sbjct  1    MAPT--DSLKPRDVCIVGVARTPMGGFLGSLSSLSATKLGSIAIHCALERARVDPSLVEE  58

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKAT+LAAQ+IQ GIND+V
Sbjct  59   VFFGNVLSANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMLAAQTIQAGINDIV  118

Query  669  VAGGMESMSNVHKYFAEARS  728
            VAGGMESMSN  KY AEAR+
Sbjct  119  VAGGMESMSNAPKYLAEARN  138



>gb|ACJ84564.1| unknown [Medicago truncatula]
 gb|AFK36455.1| unknown [Medicago truncatula]
Length=407

 Score =   261 bits (667),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +2

Query  1202  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  1381
             I  RDVCIVGVARTPMG FLG+LSS+PATKLGSIAIE+ALKR +VDP++VEEVFFGNVLS
Sbjct  12    IQPRDVCIVGVARTPMGAFLGTLSSVPATKLGSIAIEAALKRANVDPAIVEEVFFGNVLS  71

Query  1382  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESM  1561
             ANLGQAPARQ ALGAG+  +VVC+TVNKVCASGMKATMLAAQSIQLGINDVVVAGGME+M
Sbjct  72    ANLGQAPARQTALGAGLSKSVVCTTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMENM  131

Query  1562  SNVPKYFAEARKGSRLGHDSLVDGML  1639
             S+VPKY AEARKGSRLGHDSLVDGML
Sbjct  132   SSVPKYLAEARKGSRLGHDSLVDGML  157


 Score =   223 bits (567),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +3

Query  333  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLG  512
            I  RDVCIVGVARTPMG FLG+LSS+PATKLGS+AIE+ALKRA+VDP++VEEVFFGNVL 
Sbjct  12   IQPRDVCIVGVARTPMGAFLGTLSSVPATKLGSIAIEAALKRANVDPAIVEEVFFGNVLS  71

Query  513  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESM  692
            ANLGQAPARQ ALGAG+  +VVC+TVNKVCASGMKAT+LAAQSIQLGINDVVVAGGME+M
Sbjct  72   ANLGQAPARQTALGAGLSKSVVCTTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMENM  131

Query  693  SNVHKYFAEAR  725
            S+V KY AEAR
Sbjct  132  SSVPKYLAEAR  142



>ref|XP_006449940.1| hypothetical protein CICLE_v10015403mg [Citrus clementina]
 gb|ESR63180.1| hypothetical protein CICLE_v10015403mg [Citrus clementina]
Length=404

 Score =   261 bits (666),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +2

Query  1193  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  1372
             +E+I ARDVCIVGVARTPMGGFLGSLSS+ ATKLGSIAIE ALKR +V P LV+EVFFGN
Sbjct  7     SESIKARDVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANVKPLLVQEVFFGN  66

Query  1373  VLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGM  1552
             VLSANLGQAPARQA LGAGIPN+ VC+T+NKVC+SGMKA MLAAQSIQLGIND+VVAGGM
Sbjct  67    VLSANLGQAPARQATLGAGIPNSAVCTTINKVCSSGMKAVMLAAQSIQLGINDIVVAGGM  126

Query  1553  ESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             ESMSN PKY AEARKGSRLGHD++VDGML
Sbjct  127   ESMSNAPKYLAEARKGSRLGHDTIVDGML  155


 Score =   224 bits (572),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +3

Query  324  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGN  503
            +E+I ARDVCIVGVARTPMGGFLGSLSS+ ATKLGS+AIE ALKRA+V P LV+EVFFGN
Sbjct  7    SESIKARDVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANVKPLLVQEVFFGN  66

Query  504  VLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGM  683
            VL ANLGQAPARQA LGAGIPN+ VC+T+NKVC+SGMKA +LAAQSIQLGIND+VVAGGM
Sbjct  67   VLSANLGQAPARQATLGAGIPNSAVCTTINKVCSSGMKAVMLAAQSIQLGINDIVVAGGM  126

Query  684  ESMSNVHKYFAEAR  725
            ESMSN  KY AEAR
Sbjct  127  ESMSNAPKYLAEAR  140



>ref|XP_006449941.1| hypothetical protein CICLE_v10015403mg [Citrus clementina]
 gb|ESR63181.1| hypothetical protein CICLE_v10015403mg [Citrus clementina]
Length=414

 Score =   261 bits (667),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +2

Query  1193  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  1372
             +E+I ARDVCIVGVARTPMGGFLGSLSS+ ATKLGSIAIE ALKR +V P LV+EVFFGN
Sbjct  7     SESIKARDVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANVKPLLVQEVFFGN  66

Query  1373  VLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGM  1552
             VLSANLGQAPARQA LGAGIPN+ VC+T+NKVC+SGMKA MLAAQSIQLGIND+VVAGGM
Sbjct  67    VLSANLGQAPARQATLGAGIPNSAVCTTINKVCSSGMKAVMLAAQSIQLGINDIVVAGGM  126

Query  1553  ESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             ESMSN PKY AEARKGSRLGHD++VDGML
Sbjct  127   ESMSNAPKYLAEARKGSRLGHDTIVDGML  155


 Score =   225 bits (573),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +3

Query  324  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGN  503
            +E+I ARDVCIVGVARTPMGGFLGSLSS+ ATKLGS+AIE ALKRA+V P LV+EVFFGN
Sbjct  7    SESIKARDVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANVKPLLVQEVFFGN  66

Query  504  VLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGM  683
            VL ANLGQAPARQA LGAGIPN+ VC+T+NKVC+SGMKA +LAAQSIQLGIND+VVAGGM
Sbjct  67   VLSANLGQAPARQATLGAGIPNSAVCTTINKVCSSGMKAVMLAAQSIQLGINDIVVAGGM  126

Query  684  ESMSNVHKYFAEAR  725
            ESMSN  KY AEAR
Sbjct  127  ESMSNAPKYLAEAR  140



>ref|XP_006449942.1| hypothetical protein CICLE_v10015403mg [Citrus clementina]
 gb|ESR63182.1| hypothetical protein CICLE_v10015403mg [Citrus clementina]
Length=412

 Score =   261 bits (666),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +2

Query  1193  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  1372
             +E+I ARDVCIVGVARTPMGGFLGSLSS+ ATKLGSIAIE ALKR +V P LV+EVFFGN
Sbjct  7     SESIKARDVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANVKPLLVQEVFFGN  66

Query  1373  VLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGM  1552
             VLSANLGQAPARQA LGAGIPN+ VC+T+NKVC+SGMKA MLAAQSIQLGIND+VVAGGM
Sbjct  67    VLSANLGQAPARQATLGAGIPNSAVCTTINKVCSSGMKAVMLAAQSIQLGINDIVVAGGM  126

Query  1553  ESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             ESMSN PKY AEARKGSRLGHD++VDGML
Sbjct  127   ESMSNAPKYLAEARKGSRLGHDTIVDGML  155


 Score =   225 bits (573),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +3

Query  324  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGN  503
            +E+I ARDVCIVGVARTPMGGFLGSLSS+ ATKLGS+AIE ALKRA+V P LV+EVFFGN
Sbjct  7    SESIKARDVCIVGVARTPMGGFLGSLSSVSATKLGSIAIECALKRANVKPLLVQEVFFGN  66

Query  504  VLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGM  683
            VL ANLGQAPARQA LGAGIPN+ VC+T+NKVC+SGMKA +LAAQSIQLGIND+VVAGGM
Sbjct  67   VLSANLGQAPARQATLGAGIPNSAVCTTINKVCSSGMKAVMLAAQSIQLGINDIVVAGGM  126

Query  684  ESMSNVHKYFAEAR  725
            ESMSN  KY AEAR
Sbjct  127  ESMSNAPKYLAEAR  140



>ref|NP_851154.1| acetoacetyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAL24148.1| putative acetyl-CoA C-acetyltransferase [Arabidopsis thaliana]
 gb|AAM14210.1| putative acetyl-CoA C-acetyltransferase [Arabidopsis thaliana]
 gb|AED95639.1| acetoacetyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=398

 Score =   260 bits (665),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = +2

Query  1199  TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVL  1378
              ++  DVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKR +VDP+LV+EV FGNVL
Sbjct  2     NVDESDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIAAALKRANVDPALVQEVVFGNVL  61

Query  1379  SANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMES  1558
             SANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA M+AAQSIQLGINDVVVAGGMES
Sbjct  62    SANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVMIAAQSIQLGINDVVVAGGMES  121

Query  1559  MSNVPKYFAEARKGSRLGHDSLVDGML  1639
             MSN PKY AEARKGSR GHDSLVDGML
Sbjct  122   MSNTPKYLAEARKGSRFGHDSLVDGML  148


 Score =   226 bits (575),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  330  TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVL  509
             ++  DVCIVGVARTPMGGFLGSLSSLPATKLGSLAI +ALKRA+VDP+LV+EV FGNVL
Sbjct  2    NVDESDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIAAALKRANVDPALVQEVVFGNVL  61

Query  510  GANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMES  689
             ANLGQAPARQAALGAGIPN+V+C+TVNKVCASGMKA ++AAQSIQLGINDVVVAGGMES
Sbjct  62   SANLGQAPARQAALGAGIPNSVICTTVNKVCASGMKAVMIAAQSIQLGINDVVVAGGMES  121

Query  690  MSNVHKYFAEAR  725
            MSN  KY AEAR
Sbjct  122  MSNTPKYLAEAR  133



>ref|XP_009399886.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=401

 Score =   259 bits (663),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +2

Query  1193  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  1372
             +E I  RDVC+VGVARTPMGGFLG+LSSL A +LGS+AI+ AL+R ++DP+LV+EVFFGN
Sbjct  3     SEKIKPRDVCVVGVARTPMGGFLGALSSLSAMQLGSMAIKYALRRANIDPALVQEVFFGN  62

Query  1373  VLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGM  1552
             VLSANLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKATM AAQSI+LGINDVVVAGGM
Sbjct  63    VLSANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMFAAQSIELGINDVVVAGGM  122

Query  1553  ESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             ESMSN PKY AEARKGSR GHDSLVDGML
Sbjct  123   ESMSNAPKYIAEARKGSRFGHDSLVDGML  151


 Score =   225 bits (573),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +3

Query  324  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGN  503
            +E I  RDVC+VGVARTPMGGFLG+LSSL A +LGS+AI+ AL+RA++DP+LV+EVFFGN
Sbjct  3    SEKIKPRDVCVVGVARTPMGGFLGALSSLSAMQLGSMAIKYALRRANIDPALVQEVFFGN  62

Query  504  VLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGM  683
            VL ANLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKAT+ AAQSI+LGINDVVVAGGM
Sbjct  63   VLSANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMFAAQSIELGINDVVVAGGM  122

Query  684  ESMSNVHKYFAEAR  725
            ESMSN  KY AEAR
Sbjct  123  ESMSNAPKYIAEAR  136



>ref|XP_009399870.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009399878.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=411

 Score =   260 bits (664),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +2

Query  1193  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  1372
             +E I  RDVC+VGVARTPMGGFLG+LSSL A +LGS+AI+ AL+R ++DP+LV+EVFFGN
Sbjct  3     SEKIKPRDVCVVGVARTPMGGFLGALSSLSAMQLGSMAIKYALRRANIDPALVQEVFFGN  62

Query  1373  VLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGM  1552
             VLSANLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKATM AAQSI+LGINDVVVAGGM
Sbjct  63    VLSANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMFAAQSIELGINDVVVAGGM  122

Query  1553  ESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             ESMSN PKY AEARKGSR GHDSLVDGML
Sbjct  123   ESMSNAPKYIAEARKGSRFGHDSLVDGML  151


 Score =   224 bits (572),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +3

Query  324  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGN  503
            +E I  RDVC+VGVARTPMGGFLG+LSSL A +LGS+AI+ AL+RA++DP+LV+EVFFGN
Sbjct  3    SEKIKPRDVCVVGVARTPMGGFLGALSSLSAMQLGSMAIKYALRRANIDPALVQEVFFGN  62

Query  504  VLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGM  683
            VL ANLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKAT+ AAQSI+LGINDVVVAGGM
Sbjct  63   VLSANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMFAAQSIELGINDVVVAGGM  122

Query  684  ESMSNVHKYFAEAR  725
            ESMSN  KY AEAR
Sbjct  123  ESMSNAPKYIAEAR  136



>gb|ABD57973.1| acetoacetyl-coenzyme A thiolase [Arnebia euchroma]
Length=419

 Score =   260 bits (664),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = +2

Query  1196  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  1375
             ++I  RDVCIVGVARTPMGGFLGSLSSL AT+LGSIAI+SALKR +VDPSLV+EV FGNV
Sbjct  4     DSIKPRDVCIVGVARTPMGGFLGSLSSLSATELGSIAIKSALKRANVDPSLVQEVIFGNV  63

Query  1376  LSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGME  1555
             LSANLGQAPARQAALGAG+PNTV C+TVNKVCASGMKATMLAAQ+IQLGINDVVVAGGM 
Sbjct  64    LSANLGQAPARQAALGAGLPNTVSCTTVNKVCASGMKATMLAAQTIQLGINDVVVAGGMG  123

Query  1556  SMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             SMSN PKY AEAR+GSRLGHDSLVDGML
Sbjct  124   SMSNCPKYLAEARRGSRLGHDSLVDGML  151


 Score =   224 bits (571),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  327  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNV  506
            ++I  RDVCIVGVARTPMGGFLGSLSSL AT+LGS+AI+SALKRA+VDPSLV+EV FGNV
Sbjct  4    DSIKPRDVCIVGVARTPMGGFLGSLSSLSATELGSIAIKSALKRANVDPSLVQEVIFGNV  63

Query  507  LGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGME  686
            L ANLGQAPARQAALGAG+PNTV C+TVNKVCASGMKAT+LAAQ+IQLGINDVVVAGGM 
Sbjct  64   LSANLGQAPARQAALGAGLPNTVSCTTVNKVCASGMKATMLAAQTIQLGINDVVVAGGMG  123

Query  687  SMSNVHKYFAEAR  725
            SMSN  KY AEAR
Sbjct  124  SMSNCPKYLAEAR  136



>ref|XP_009412128.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=401

 Score =   259 bits (662),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +2

Query  1193  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  1372
             +E I  RDVC+VG+ARTPMGGFLG+LSSL AT+LGSIAI+ AL R ++DP+LV+EVFFGN
Sbjct  3     SEQIKPRDVCVVGIARTPMGGFLGALSSLSATQLGSIAIKHALARANLDPALVQEVFFGN  62

Query  1373  VLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGM  1552
             VLSANLGQAPARQAALGAGIPNTVVC+T+NKVCASGMKA MLAAQSIQLGIND+VVAGGM
Sbjct  63    VLSANLGQAPARQAALGAGIPNTVVCTTINKVCASGMKAAMLAAQSIQLGINDIVVAGGM  122

Query  1553  ESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             ESMSN PKY AEARKGSR GHD++VDGML
Sbjct  123   ESMSNAPKYIAEARKGSRFGHDTIVDGML  151


 Score =   224 bits (571),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +3

Query  324  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGN  503
            +E I  RDVC+VG+ARTPMGGFLG+LSSL AT+LGS+AI+ AL RA++DP+LV+EVFFGN
Sbjct  3    SEQIKPRDVCVVGIARTPMGGFLGALSSLSATQLGSIAIKHALARANLDPALVQEVFFGN  62

Query  504  VLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGM  683
            VL ANLGQAPARQAALGAGIPNTVVC+T+NKVCASGMKA +LAAQSIQLGIND+VVAGGM
Sbjct  63   VLSANLGQAPARQAALGAGIPNTVVCTTINKVCASGMKAAMLAAQSIQLGINDIVVAGGM  122

Query  684  ESMSNVHKYFAEAR  725
            ESMSN  KY AEAR
Sbjct  123  ESMSNAPKYIAEAR  136



>ref|XP_009412114.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009412121.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=411

 Score =   259 bits (663),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +2

Query  1193  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  1372
             +E I  RDVC+VG+ARTPMGGFLG+LSSL AT+LGSIAI+ AL R ++DP+LV+EVFFGN
Sbjct  3     SEQIKPRDVCVVGIARTPMGGFLGALSSLSATQLGSIAIKHALARANLDPALVQEVFFGN  62

Query  1373  VLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGM  1552
             VLSANLGQAPARQAALGAGIPNTVVC+T+NKVCASGMKA MLAAQSIQLGIND+VVAGGM
Sbjct  63    VLSANLGQAPARQAALGAGIPNTVVCTTINKVCASGMKAAMLAAQSIQLGINDIVVAGGM  122

Query  1553  ESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             ESMSN PKY AEARKGSR GHD++VDGML
Sbjct  123   ESMSNAPKYIAEARKGSRFGHDTIVDGML  151


 Score =   224 bits (572),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +3

Query  324  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGN  503
            +E I  RDVC+VG+ARTPMGGFLG+LSSL AT+LGS+AI+ AL RA++DP+LV+EVFFGN
Sbjct  3    SEQIKPRDVCVVGIARTPMGGFLGALSSLSATQLGSIAIKHALARANLDPALVQEVFFGN  62

Query  504  VLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGM  683
            VL ANLGQAPARQAALGAGIPNTVVC+T+NKVCASGMKA +LAAQSIQLGIND+VVAGGM
Sbjct  63   VLSANLGQAPARQAALGAGIPNTVVCTTINKVCASGMKAAMLAAQSIQLGINDIVVAGGM  122

Query  684  ESMSNVHKYFAEAR  725
            ESMSN  KY AEAR
Sbjct  123  ESMSNAPKYIAEAR  136



>ref|XP_012074794.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Jatropha 
curcas]
 gb|KDP35512.1| hypothetical protein JCGZ_08950 [Jatropha curcas]
Length=412

 Score =   259 bits (663),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = +2

Query  1187  ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFF  1366
             A++++IN RDVC+VGVARTPMGGFLGSLSSL ATKLGSIAI+SALKR +VDPSLV+EVFF
Sbjct  3     ASSDSINPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIQSALKRANVDPSLVQEVFF  62

Query  1367  GNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAG  1546
             GNVLSANLGQAPARQAALGAGIPN+V C+T+NKVC+SGMKATM+AA SIQ GIND+VV G
Sbjct  63    GNVLSANLGQAPARQAALGAGIPNSVNCTTINKVCSSGMKATMIAALSIQAGINDIVVVG  122

Query  1547  GMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             GMESMS  PKY AEARKGSRLGHD+++DGML
Sbjct  123   GMESMSKAPKYLAEARKGSRLGHDTIIDGML  153


 Score =   224 bits (572),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +3

Query  318  ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFF  497
            A++++IN RDVC+VGVARTPMGGFLGSLSSL ATKLGS+AI+SALKRA+VDPSLV+EVFF
Sbjct  3    ASSDSINPRDVCVVGVARTPMGGFLGSLSSLSATKLGSIAIQSALKRANVDPSLVQEVFF  62

Query  498  GNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAG  677
            GNVL ANLGQAPARQAALGAGIPN+V C+T+NKVC+SGMKAT++AA SIQ GIND+VV G
Sbjct  63   GNVLSANLGQAPARQAALGAGIPNSVNCTTINKVCSSGMKATMIAALSIQAGINDIVVVG  122

Query  678  GMESMSNVHKYFAEAR  725
            GMESMS   KY AEAR
Sbjct  123  GMESMSKAPKYLAEAR  138



>ref|XP_003580738.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Brachypodium 
distachyon]
Length=401

 Score =   259 bits (661),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +2

Query  1193  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  1372
             ++ +  RDVC+VGVARTPMGGFLG+LSSLPATKLGSIAIE+ALKR  VDPSLV+EV+FGN
Sbjct  3     SDNVGPRDVCVVGVARTPMGGFLGALSSLPATKLGSIAIEAALKRAHVDPSLVQEVYFGN  62

Query  1373  VLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGM  1552
             VLSANLGQAPARQAALGA IPNTVVC+TVNKVCASGMKATM AAQSI LG ND+VVAGGM
Sbjct  63    VLSANLGQAPARQAALGARIPNTVVCTTVNKVCASGMKATMFAAQSILLGSNDIVVAGGM  122

Query  1553  ESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             ESMSN PKY  EARKGSR GHDSL+DGML
Sbjct  123   ESMSNAPKYIGEARKGSRFGHDSLIDGML  151


 Score =   223 bits (568),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +3

Query  324  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGN  503
            ++ +  RDVC+VGVARTPMGGFLG+LSSLPATKLGS+AIE+ALKRA VDPSLV+EV+FGN
Sbjct  3    SDNVGPRDVCVVGVARTPMGGFLGALSSLPATKLGSIAIEAALKRAHVDPSLVQEVYFGN  62

Query  504  VLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGM  683
            VL ANLGQAPARQAALGA IPNTVVC+TVNKVCASGMKAT+ AAQSI LG ND+VVAGGM
Sbjct  63   VLSANLGQAPARQAALGARIPNTVVCTTVNKVCASGMKATMFAAQSILLGSNDIVVAGGM  122

Query  684  ESMSNVHKYFAEAR  725
            ESMSN  KY  EAR
Sbjct  123  ESMSNAPKYIGEAR  136



>ref|XP_008464274.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X3 [Cucumis melo]
Length=439

 Score =   259 bits (663),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAP +++++N RDVCIVGVARTPMGGFLGSLSS  AT+LGSIAIE ALKR +VDPS+V+E
Sbjct  48    MAPISSDSVNLRDVCIVGVARTPMGGFLGSLSSFSATQLGSIAIECALKRANVDPSIVQE  107

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVL ANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKATM+AA +IQLGINDVV
Sbjct  108   VFFGNVLGANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMIAAHTIQLGINDVV  167

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             V+GGMESMSN PKY  E RKGSR G+D++VDGML
Sbjct  168   VSGGMESMSNAPKYLQEVRKGSRFGNDTVVDGML  201


 Score =   233 bits (593),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAP +++++N RDVCIVGVARTPMGGFLGSLSS  AT+LGS+AIE ALKRA+VDPS+V+E
Sbjct  48   MAPISSDSVNLRDVCIVGVARTPMGGFLGSLSSFSATQLGSIAIECALKRANVDPSIVQE  107

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVLGANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKAT++AA +IQLGINDVV
Sbjct  108  VFFGNVLGANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMIAAHTIQLGINDVV  167

Query  669  VAGGMESMSNVHKYFAEAR  725
            V+GGMESMSN  KY  E R
Sbjct  168  VSGGMESMSNAPKYLQEVR  186



>ref|XP_008464273.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Cucumis melo]
Length=451

 Score =   259 bits (663),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAP +++++N RDVCIVGVARTPMGGFLGSLSS  AT+LGSIAIE ALKR +VDPS+V+E
Sbjct  48    MAPISSDSVNLRDVCIVGVARTPMGGFLGSLSSFSATQLGSIAIECALKRANVDPSIVQE  107

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVL ANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKATM+AA +IQLGINDVV
Sbjct  108   VFFGNVLGANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMIAAHTIQLGINDVV  167

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             V+GGMESMSN PKY  E RKGSR G+D++VDGML
Sbjct  168   VSGGMESMSNAPKYLQEVRKGSRFGNDTVVDGML  201


 Score =   233 bits (593),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAP +++++N RDVCIVGVARTPMGGFLGSLSS  AT+LGS+AIE ALKRA+VDPS+V+E
Sbjct  48   MAPISSDSVNLRDVCIVGVARTPMGGFLGSLSSFSATQLGSIAIECALKRANVDPSIVQE  107

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVLGANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKAT++AA +IQLGINDVV
Sbjct  108  VFFGNVLGANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMIAAHTIQLGINDVV  167

Query  669  VAGGMESMSNVHKYFAEAR  725
            V+GGMESMSN  KY  E R
Sbjct  168  VSGGMESMSNAPKYLQEVR  186



>ref|XP_010936771.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Elaeis 
guineensis]
 ref|XP_010936772.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Elaeis 
guineensis]
Length=415

 Score =   258 bits (660),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 142/155 (92%), Gaps = 1/155 (1%)
 Frame = +2

Query  1178  MAPA-TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             MAP+   + +  RDVCIVGVARTPMGGFLG+LSSL ATKLGS+AI+ ALKR +V+P+LV+
Sbjct  1     MAPSGVYDDLKPRDVCIVGVARTPMGGFLGALSSLSATKLGSVAIQCALKRANVEPALVQ  60

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EVFFGNVLSANLGQAPARQAALGAGIPNTVVC+T+NKVC+SGMKATM A+QSIQLGINDV
Sbjct  61    EVFFGNVLSANLGQAPARQAALGAGIPNTVVCTTINKVCSSGMKATMFASQSIQLGINDV  120

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VVAGGMESMSN PKY AEARKGSR G+DSL+DGML
Sbjct  121   VVAGGMESMSNAPKYLAEARKGSRFGNDSLIDGML  155


 Score =   226 bits (576),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 127/140 (91%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPA-TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            MAP+   + +  RDVCIVGVARTPMGGFLG+LSSL ATKLGS+AI+ ALKRA+V+P+LV+
Sbjct  1    MAPSGVYDDLKPRDVCIVGVARTPMGGFLGALSSLSATKLGSVAIQCALKRANVEPALVQ  60

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EVFFGNVL ANLGQAPARQAALGAGIPNTVVC+T+NKVC+SGMKAT+ A+QSIQLGINDV
Sbjct  61   EVFFGNVLSANLGQAPARQAALGAGIPNTVVCTTINKVCSSGMKATMFASQSIQLGINDV  120

Query  666  VVAGGMESMSNVHKYFAEAR  725
            VVAGGMESMSN  KY AEAR
Sbjct  121  VVAGGMESMSNAPKYLAEAR  140



>ref|XP_010495012.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X1 [Camelina sativa]
Length=415

 Score =   258 bits (660),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 145/155 (94%), Gaps = 1/155 (1%)
 Frame = +2

Query  1178  MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             MAP+ ++ ++  RDVC+VGVARTPMGGFLGSLSSL AT+LGSIAIE+AL+R +VDP+LVE
Sbjct  1     MAPSVSDDSVKPRDVCVVGVARTPMGGFLGSLSSLTATRLGSIAIEAALRRANVDPALVE  60

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EVFFGNVL+ANLGQAPARQAALGAGIP +V+C+TVNKVCA+GMKA MLAAQSIQLG+NDV
Sbjct  61    EVFFGNVLTANLGQAPARQAALGAGIPYSVICTTVNKVCAAGMKAVMLAAQSIQLGLNDV  120

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VVAGGMESMSNVPKY  +AR+GSRLGHD++VDGM+
Sbjct  121   VVAGGMESMSNVPKYLPDARRGSRLGHDTVVDGMM  155


 Score =   226 bits (575),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 129/140 (92%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            MAP+ ++ ++  RDVC+VGVARTPMGGFLGSLSSL AT+LGS+AIE+AL+RA+VDP+LVE
Sbjct  1    MAPSVSDDSVKPRDVCVVGVARTPMGGFLGSLSSLTATRLGSIAIEAALRRANVDPALVE  60

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EVFFGNVL ANLGQAPARQAALGAGIP +V+C+TVNKVCA+GMKA +LAAQSIQLG+NDV
Sbjct  61   EVFFGNVLTANLGQAPARQAALGAGIPYSVICTTVNKVCAAGMKAVMLAAQSIQLGLNDV  120

Query  666  VVAGGMESMSNVHKYFAEAR  725
            VVAGGMESMSNV KY  +AR
Sbjct  121  VVAGGMESMSNVPKYLPDAR  140



>ref|NP_001148667.1| acetyl-CoA acetyltransferase, cytosolic 1 [Zea mays]
 ref|XP_008676213.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Zea mays]
 gb|ACF78705.1| unknown [Zea mays]
 gb|ACF87104.1| unknown [Zea mays]
 gb|ACG32450.1| acetyl-CoA acetyltransferase, cytosolic 1 [Zea mays]
 gb|ACG34415.1| acetyl-CoA acetyltransferase, cytosolic 1 [Zea mays]
 tpg|DAA45681.1| TPA: acetyl-CoA acetyltransferase, cytosolic 1 [Zea mays]
Length=401

 Score =   258 bits (658),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +2

Query  1193  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  1372
             ++ I  RDVC+VGVARTPMGGFLG+LS LPATKLGSI I++AL+R +VDP+LV+EV+FGN
Sbjct  3     SDGIGPRDVCVVGVARTPMGGFLGALSPLPATKLGSIVIQAALERANVDPALVQEVYFGN  62

Query  1373  VLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGM  1552
             VLSANLGQAPARQAALGAGIPN+VVC+TVNKVCASGMKATM AAQSIQLGIND+VVAGGM
Sbjct  63    VLSANLGQAPARQAALGAGIPNSVVCTTVNKVCASGMKATMFAAQSIQLGINDIVVAGGM  122

Query  1553  ESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             ESMSN PKY AEARKGSR GHD+LVD ML
Sbjct  123   ESMSNAPKYIAEARKGSRFGHDTLVDAML  151


 Score =   225 bits (573),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  324  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGN  503
            ++ I  RDVC+VGVARTPMGGFLG+LS LPATKLGS+ I++AL+RA+VDP+LV+EV+FGN
Sbjct  3    SDGIGPRDVCVVGVARTPMGGFLGALSPLPATKLGSIVIQAALERANVDPALVQEVYFGN  62

Query  504  VLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGM  683
            VL ANLGQAPARQAALGAGIPN+VVC+TVNKVCASGMKAT+ AAQSIQLGIND+VVAGGM
Sbjct  63   VLSANLGQAPARQAALGAGIPNSVVCTTVNKVCASGMKATMFAAQSIQLGINDIVVAGGM  122

Query  684  ESMSNVHKYFAEAR  725
            ESMSN  KY AEAR
Sbjct  123  ESMSNAPKYIAEAR  136



>ref|XP_008464272.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Cucumis melo]
Length=461

 Score =   259 bits (663),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAP +++++N RDVCIVGVARTPMGGFLGSLSS  AT+LGSIAIE ALKR +VDPS+V+E
Sbjct  48    MAPISSDSVNLRDVCIVGVARTPMGGFLGSLSSFSATQLGSIAIECALKRANVDPSIVQE  107

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVL ANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKATM+AA +IQLGINDVV
Sbjct  108   VFFGNVLGANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMIAAHTIQLGINDVV  167

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             V+GGMESMSN PKY  E RKGSR G+D++VDGML
Sbjct  168   VSGGMESMSNAPKYLQEVRKGSRFGNDTVVDGML  201


 Score =   233 bits (593),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAP +++++N RDVCIVGVARTPMGGFLGSLSS  AT+LGS+AIE ALKRA+VDPS+V+E
Sbjct  48   MAPISSDSVNLRDVCIVGVARTPMGGFLGSLSSFSATQLGSIAIECALKRANVDPSIVQE  107

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVLGANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKAT++AA +IQLGINDVV
Sbjct  108  VFFGNVLGANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMIAAHTIQLGINDVV  167

Query  669  VAGGMESMSNVHKYFAEAR  725
            V+GGMESMSN  KY  E R
Sbjct  168  VSGGMESMSNAPKYLQEVR  186



>ref|XP_007211795.1| hypothetical protein PRUPE_ppa006371mg [Prunus persica]
 gb|EMJ12994.1| hypothetical protein PRUPE_ppa006371mg [Prunus persica]
Length=415

 Score =   258 bits (659),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             M+P+++E+I  RDVCIVGVARTPMGGFLGSLSS+ AT+LGS+AI  ALKR ++DPSLV+E
Sbjct  2     MSPSSSESIKPRDVCIVGVARTPMGGFLGSLSSVTATQLGSLAIRCALKRANLDPSLVQE  61

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPN+V+C+T+NKVC+SGMKATMLAAQ+IQLG+N +V
Sbjct  62    VFFGNVLSANLGQAPARQAALGAGIPNSVICTTINKVCSSGMKATMLAAQTIQLGLNHIV  121

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSN PKY   AR+GSRLGHD++VDGML
Sbjct  122   VAGGMESMSNAPKYLPAARQGSRLGHDTIVDGML  155


 Score =   226 bits (576),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            M+P+++E+I  RDVCIVGVARTPMGGFLGSLSS+ AT+LGSLAI  ALKRA++DPSLV+E
Sbjct  2    MSPSSSESIKPRDVCIVGVARTPMGGFLGSLSSVTATQLGSLAIRCALKRANLDPSLVQE  61

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPN+V+C+T+NKVC+SGMKAT+LAAQ+IQLG+N +V
Sbjct  62   VFFGNVLSANLGQAPARQAALGAGIPNSVICTTINKVCSSGMKATMLAAQTIQLGLNHIV  121

Query  669  VAGGMESMSNVHKYFAEAR  725
            VAGGMESMSN  KY   AR
Sbjct  122  VAGGMESMSNAPKYLPAAR  140



>ref|XP_010495013.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Camelina sativa]
Length=405

 Score =   258 bits (658),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 145/155 (94%), Gaps = 1/155 (1%)
 Frame = +2

Query  1178  MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             MAP+ ++ ++  RDVC+VGVARTPMGGFLGSLSSL AT+LGSIAIE+AL+R +VDP+LVE
Sbjct  1     MAPSVSDDSVKPRDVCVVGVARTPMGGFLGSLSSLTATRLGSIAIEAALRRANVDPALVE  60

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EVFFGNVL+ANLGQAPARQAALGAGIP +V+C+TVNKVCA+GMKA MLAAQSIQLG+NDV
Sbjct  61    EVFFGNVLTANLGQAPARQAALGAGIPYSVICTTVNKVCAAGMKAVMLAAQSIQLGLNDV  120

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VVAGGMESMSNVPKY  +AR+GSRLGHD++VDGM+
Sbjct  121   VVAGGMESMSNVPKYLPDARRGSRLGHDTVVDGMM  155


 Score =   225 bits (573),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 129/140 (92%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            MAP+ ++ ++  RDVC+VGVARTPMGGFLGSLSSL AT+LGS+AIE+AL+RA+VDP+LVE
Sbjct  1    MAPSVSDDSVKPRDVCVVGVARTPMGGFLGSLSSLTATRLGSIAIEAALRRANVDPALVE  60

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EVFFGNVL ANLGQAPARQAALGAGIP +V+C+TVNKVCA+GMKA +LAAQSIQLG+NDV
Sbjct  61   EVFFGNVLTANLGQAPARQAALGAGIPYSVICTTVNKVCAAGMKAVMLAAQSIQLGLNDV  120

Query  666  VVAGGMESMSNVHKYFAEAR  725
            VVAGGMESMSNV KY  +AR
Sbjct  121  VVAGGMESMSNVPKYLPDAR  140



>gb|AAU95619.1| peroxisomal acetoacetyl-coenzyme A thiolase [Nicotiana tabacum]
Length=414

 Score =   257 bits (657),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MA    ++I  RDVCIVGVARTPMGGFLGSLSSL AT+LGS+AI +ALKR +VDPSLV+E
Sbjct  1     MAKMVNDSIKPRDVCIVGVARTPMGGFLGSLSSLSATELGSVAIRAALKRANVDPSLVQE  60

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPN+V+C+T+NKVC+SG+KATM+AAQ+IQ G ND+V
Sbjct  61    VFFGNVLSANLGQAPARQAALGAGIPNSVICTTINKVCSSGLKATMIAAQTIQSGSNDIV  120

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             V GGMESMSNVPKY A+ARKGSRLGHD++VDGML
Sbjct  121   VTGGMESMSNVPKYLAQARKGSRLGHDTIVDGML  154


 Score =   221 bits (564),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MA    ++I  RDVCIVGVARTPMGGFLGSLSSL AT+LGS+AI +ALKRA+VDPSLV+E
Sbjct  1    MAKMVNDSIKPRDVCIVGVARTPMGGFLGSLSSLSATELGSVAIRAALKRANVDPSLVQE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPN+V+C+T+NKVC+SG+KAT++AAQ+IQ G ND+V
Sbjct  61   VFFGNVLSANLGQAPARQAALGAGIPNSVICTTINKVCSSGLKATMIAAQTIQSGSNDIV  120

Query  669  VAGGMESMSNVHKYFAEAR  725
            V GGMESMSNV KY A+AR
Sbjct  121  VTGGMESMSNVPKYLAQAR  139



>ref|XP_009608453.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Nicotiana 
tomentosiformis]
Length=414

 Score =   257 bits (657),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MA    ++I  RDVCIVGVARTPMGGFLGSLSSL AT+LGS+AI +ALKR +VDPSLV+E
Sbjct  1     MAKMVNDSIKPRDVCIVGVARTPMGGFLGSLSSLSATELGSVAIRAALKRANVDPSLVQE  60

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPN+V+C+T+NKVC+SG+KATM+AAQ+IQ G ND+V
Sbjct  61    VFFGNVLSANLGQAPARQAALGAGIPNSVICTTINKVCSSGLKATMIAAQTIQSGSNDIV  120

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             V GGMESMSNVPKY A+ARKGSRLGHD++VDGML
Sbjct  121   VTGGMESMSNVPKYLAQARKGSRLGHDTIVDGML  154


 Score =   221 bits (564),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MA    ++I  RDVCIVGVARTPMGGFLGSLSSL AT+LGS+AI +ALKRA+VDPSLV+E
Sbjct  1    MAKMVNDSIKPRDVCIVGVARTPMGGFLGSLSSLSATELGSVAIRAALKRANVDPSLVQE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPN+V+C+T+NKVC+SG+KAT++AAQ+IQ G ND+V
Sbjct  61   VFFGNVLSANLGQAPARQAALGAGIPNSVICTTINKVCSSGLKATMIAAQTIQSGSNDIV  120

Query  669  VAGGMESMSNVHKYFAEAR  725
            V GGMESMSNV KY A+AR
Sbjct  121  VTGGMESMSNVPKYLAQAR  139



>ref|XP_007026385.1| Thiolase family protein isoform 1 [Theobroma cacao]
 ref|XP_007026386.1| Thiolase family protein isoform 1 [Theobroma cacao]
 ref|XP_007026387.1| Thiolase family protein isoform 1 [Theobroma cacao]
 gb|EOY29007.1| Thiolase family protein isoform 1 [Theobroma cacao]
 gb|EOY29008.1| Thiolase family protein isoform 1 [Theobroma cacao]
 gb|EOY29009.1| Thiolase family protein isoform 1 [Theobroma cacao]
Length=422

 Score =   257 bits (657),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +2

Query  1202  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  1381
             I  RDVCIVGVARTPMG FLGSLSS  AT+LGSIAI SALKR ++DPSLV+EVFFGNVLS
Sbjct  17    IRPRDVCIVGVARTPMGAFLGSLSSFSATQLGSIAIHSALKRANLDPSLVQEVFFGNVLS  76

Query  1382  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESM  1561
             ANLGQAPARQAALGAGIPN+++C+TVNKVCASGMKA MLA+Q+IQLGINDVV+AGGMESM
Sbjct  77    ANLGQAPARQAALGAGIPNSIICTTVNKVCASGMKAVMLASQTIQLGINDVVIAGGMESM  136

Query  1562  SNVPKYFAEARKGSRLGHDSLVDGML  1639
             SN PKY AEARKGSRLGHD+++DGML
Sbjct  137   SNAPKYLAEARKGSRLGHDTIIDGML  162


 Score =   222 bits (565),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  333  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLG  512
            I  RDVCIVGVARTPMG FLGSLSS  AT+LGS+AI SALKRA++DPSLV+EVFFGNVL 
Sbjct  17   IRPRDVCIVGVARTPMGAFLGSLSSFSATQLGSIAIHSALKRANLDPSLVQEVFFGNVLS  76

Query  513  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESM  692
            ANLGQAPARQAALGAGIPN+++C+TVNKVCASGMKA +LA+Q+IQLGINDVV+AGGMESM
Sbjct  77   ANLGQAPARQAALGAGIPNSIICTTVNKVCASGMKAVMLASQTIQLGINDVVIAGGMESM  136

Query  693  SNVHKYFAEAR  725
            SN  KY AEAR
Sbjct  137  SNAPKYLAEAR  147



>gb|ABM66459.1| acetyl CoA C-acetyltranseferase [Brassica juncea]
Length=189

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +2

Query  1202  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  1381
             +  RDVC+VGVARTPMG FLGSLSSL A +LGSIAIE+AL+R +VDPSLVEEVFFGNVL+
Sbjct  8     VQPRDVCVVGVARTPMGDFLGSLSSLTAPRLGSIAIEAALRRANVDPSLVEEVFFGNVLT  67

Query  1382  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESM  1561
             ANLGQAPARQAALGAGIP +V+C+TVNKVCASGMKA MLAAQSIQLG+NDVVVAGGMESM
Sbjct  68    ANLGQAPARQAALGAGIPYSVICTTVNKVCASGMKAVMLAAQSIQLGLNDVVVAGGMESM  127

Query  1562  SNVPKYFAEARKGSRLGHDSLVDGM  1636
             SNVPKY  +AR+GS+LGHD++VDGM
Sbjct  128   SNVPKYLPDARRGSKLGHDTVVDGM  152


 Score =   219 bits (558),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  333  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLG  512
            +  RDVC+VGVARTPMG FLGSLSSL A +LGS+AIE+AL+RA+VDPSLVEEVFFGNVL 
Sbjct  8    VQPRDVCVVGVARTPMGDFLGSLSSLTAPRLGSIAIEAALRRANVDPSLVEEVFFGNVLT  67

Query  513  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESM  692
            ANLGQAPARQAALGAGIP +V+C+TVNKVCASGMKA +LAAQSIQLG+NDVVVAGGMESM
Sbjct  68   ANLGQAPARQAALGAGIPYSVICTTVNKVCASGMKAVMLAAQSIQLGLNDVVVAGGMESM  127

Query  693  SNVHKYFAEAR  725
            SNV KY  +AR
Sbjct  128  SNVPKYLPDAR  138



>ref|XP_006279490.1| hypothetical protein CARUB_v10026490mg [Capsella rubella]
 gb|EOA12388.1| hypothetical protein CARUB_v10026490mg [Capsella rubella]
Length=414

 Score =   257 bits (656),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 145/155 (94%), Gaps = 1/155 (1%)
 Frame = +2

Query  1178  MAPA-TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             MAP+ + +++  RDVC+VGVARTPMGGFLGSLSSL AT+LGSIAIE++L+R +VDP+LVE
Sbjct  1     MAPSFSDDSVQPRDVCVVGVARTPMGGFLGSLSSLTATRLGSIAIEASLRRANVDPALVE  60

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EVFFGNVL+ANLGQAPARQAALGAGIP +V+C+TVNKVCA+GMKA MLAAQSIQLG+NDV
Sbjct  61    EVFFGNVLTANLGQAPARQAALGAGIPYSVICTTVNKVCAAGMKAVMLAAQSIQLGLNDV  120

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VVAGGMESMSNVPKY  +AR+GSRLGHD++VDGM+
Sbjct  121   VVAGGMESMSNVPKYLPDARRGSRLGHDTVVDGMM  155


 Score =   224 bits (571),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 129/140 (92%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPA-TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            MAP+ + +++  RDVC+VGVARTPMGGFLGSLSSL AT+LGS+AIE++L+RA+VDP+LVE
Sbjct  1    MAPSFSDDSVQPRDVCVVGVARTPMGGFLGSLSSLTATRLGSIAIEASLRRANVDPALVE  60

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EVFFGNVL ANLGQAPARQAALGAGIP +V+C+TVNKVCA+GMKA +LAAQSIQLG+NDV
Sbjct  61   EVFFGNVLTANLGQAPARQAALGAGIPYSVICTTVNKVCAAGMKAVMLAAQSIQLGLNDV  120

Query  666  VVAGGMESMSNVHKYFAEAR  725
            VVAGGMESMSNV KY  +AR
Sbjct  121  VVAGGMESMSNVPKYLPDAR  140



>ref|XP_010039422.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Eucalyptus 
grandis]
 gb|KCW45974.1| hypothetical protein EUGRSUZ_L00148 [Eucalyptus grandis]
Length=413

 Score =   256 bits (655),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 140/154 (91%), Gaps = 1/154 (1%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MA A+ E+I  +DVCIVGVARTPMGG LGSLSS  AT+LGSIAI+ ALKR +VDP+LV+E
Sbjct  1     MASAS-ESIRPQDVCIVGVARTPMGGLLGSLSSFSATQLGSIAIQCALKRANVDPALVQE  59

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPN+V+C+TVNKVCA+GMKATMLAA +IQLGIND V
Sbjct  60    VFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCAAGMKATMLAAHTIQLGINDFV  119

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSN PKY AEARKGSRLGHD +VDGML
Sbjct  120   VAGGMESMSNAPKYLAEARKGSRLGHDIIVDGML  153


 Score =   221 bits (564),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 125/139 (90%), Gaps = 1/139 (1%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MA A+ E+I  +DVCIVGVARTPMGG LGSLSS  AT+LGS+AI+ ALKRA+VDP+LV+E
Sbjct  1    MASAS-ESIRPQDVCIVGVARTPMGGLLGSLSSFSATQLGSIAIQCALKRANVDPALVQE  59

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPN+V+C+TVNKVCA+GMKAT+LAA +IQLGIND V
Sbjct  60   VFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCAAGMKATMLAAHTIQLGINDFV  119

Query  669  VAGGMESMSNVHKYFAEAR  725
            VAGGMESMSN  KY AEAR
Sbjct  120  VAGGMESMSNAPKYLAEAR  138



>gb|ACU18264.1| unknown [Glycine max]
Length=204

 Score =   249 bits (636),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +2

Query  1202  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  1381
             + +RDVCIVGVARTP+GG LG+LSSL AT+LGSIAI++ALKR +VDPSLV+EVFFGNVLS
Sbjct  5     VKSRDVCIVGVARTPIGGLLGTLSSLSATELGSIAIKTALKRANVDPSLVQEVFFGNVLS  64

Query  1382  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESM  1561
             ANLGQAPARQAALGAGIP +V+C+T+NKVCASGMKATMLAA +IQ G+NDVVVAGGMESM
Sbjct  65    ANLGQAPARQAALGAGIPTSVICTTINKVCASGMKATMLAALTIQFGLNDVVVAGGMESM  124

Query  1562  SNVPKYFAEARKGSRLGHDSLVDGML  1639
             SN PKY AEARKGSR GHD+++DGM+
Sbjct  125   SNAPKYIAEARKGSRYGHDTIIDGMV  150


 Score =   216 bits (551),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  333  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLG  512
            + +RDVCIVGVARTP+GG LG+LSSL AT+LGS+AI++ALKRA+VDPSLV+EVFFGNVL 
Sbjct  5    VKSRDVCIVGVARTPIGGLLGTLSSLSATELGSIAIKTALKRANVDPSLVQEVFFGNVLS  64

Query  513  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESM  692
            ANLGQAPARQAALGAGIP +V+C+T+NKVCASGMKAT+LAA +IQ G+NDVVVAGGMESM
Sbjct  65   ANLGQAPARQAALGAGIPTSVICTTINKVCASGMKATMLAALTIQFGLNDVVVAGGMESM  124

Query  693  SNVHKYFAEAR  725
            SN  KY AEAR
Sbjct  125  SNAPKYIAEAR  135



>ref|XP_006398472.1| hypothetical protein EUTSA_v10000897mg [Eutrema salsugineum]
 gb|ESQ39925.1| hypothetical protein EUTSA_v10000897mg [Eutrema salsugineum]
Length=400

 Score =   256 bits (653),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 142/154 (92%), Gaps = 1/154 (1%)
 Frame = +2

Query  1178  MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             MAP+ ++ +I  RDVC+VGVARTPMGGFLGSLSS+ AT+LGSIAIE+AL+R  VDP LVE
Sbjct  1     MAPSVSDGSIQPRDVCVVGVARTPMGGFLGSLSSMTATRLGSIAIEAALRRAKVDPRLVE  60

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EVFFGNVL+ANLGQAPARQAALGAGIP +V+C+TVNKVCA+GMK+ MLAAQSIQLG+NDV
Sbjct  61    EVFFGNVLTANLGQAPARQAALGAGIPYSVICTTVNKVCAAGMKSAMLAAQSIQLGLNDV  120

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGM  1636
             VVAGGMESMSNVPKY  +AR+GSRLGHD++VDGM
Sbjct  121   VVAGGMESMSNVPKYLPDARRGSRLGHDTVVDGM  154


 Score =   224 bits (570),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 127/140 (91%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            MAP+ ++ +I  RDVC+VGVARTPMGGFLGSLSS+ AT+LGS+AIE+AL+RA VDP LVE
Sbjct  1    MAPSVSDGSIQPRDVCVVGVARTPMGGFLGSLSSMTATRLGSIAIEAALRRAKVDPRLVE  60

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EVFFGNVL ANLGQAPARQAALGAGIP +V+C+TVNKVCA+GMK+ +LAAQSIQLG+NDV
Sbjct  61   EVFFGNVLTANLGQAPARQAALGAGIPYSVICTTVNKVCAAGMKSAMLAAQSIQLGLNDV  120

Query  666  VVAGGMESMSNVHKYFAEAR  725
            VVAGGMESMSNV KY  +AR
Sbjct  121  VVAGGMESMSNVPKYLPDAR  140



>gb|ACX46381.1| acetoacetyl-CoA thiolase [Helianthus annuus]
Length=411

 Score =   255 bits (652),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = +2

Query  1196  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  1375
             + IN RDVCIVGVARTPMG FLGSLSSLPATKLGSIAI+SAL+R ++DP LV+EVFFGNV
Sbjct  5     DKINPRDVCIVGVARTPMGDFLGSLSSLPATKLGSIAIQSALQRANIDPRLVQEVFFGNV  64

Query  1376  LSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGME  1555
             LSANLGQAPARQAALGAGIP+TVVC+T+NKVC+SGMKATM+AAQSIQ+G ND+VVAGGME
Sbjct  65    LSANLGQAPARQAALGAGIPDTVVCTTINKVCSSGMKATMIAAQSIQVGANDIVVAGGME  124

Query  1556  SMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             SMSN PKY A +R+GSRLGHD+++DGM+
Sbjct  125   SMSNTPKYVAGSRRGSRLGHDAIIDGMI  152


 Score =   223 bits (568),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 107/133 (80%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  327  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNV  506
            + IN RDVCIVGVARTPMG FLGSLSSLPATKLGS+AI+SAL+RA++DP LV+EVFFGNV
Sbjct  5    DKINPRDVCIVGVARTPMGDFLGSLSSLPATKLGSIAIQSALQRANIDPRLVQEVFFGNV  64

Query  507  LGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGME  686
            L ANLGQAPARQAALGAGIP+TVVC+T+NKVC+SGMKAT++AAQSIQ+G ND+VVAGGME
Sbjct  65   LSANLGQAPARQAALGAGIPDTVVCTTINKVCSSGMKATMIAAQSIQVGANDIVVAGGME  124

Query  687  SMSNVHKYFAEAR  725
            SMSN  KY A +R
Sbjct  125  SMSNTPKYVAGSR  137



>ref|XP_006398474.1| hypothetical protein EUTSA_v10000897mg [Eutrema salsugineum]
 gb|ESQ39927.1| hypothetical protein EUTSA_v10000897mg [Eutrema salsugineum]
Length=415

 Score =   256 bits (653),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 142/154 (92%), Gaps = 1/154 (1%)
 Frame = +2

Query  1178  MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             MAP+ ++ +I  RDVC+VGVARTPMGGFLGSLSS+ AT+LGSIAIE+AL+R  VDP LVE
Sbjct  1     MAPSVSDGSIQPRDVCVVGVARTPMGGFLGSLSSMTATRLGSIAIEAALRRAKVDPRLVE  60

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EVFFGNVL+ANLGQAPARQAALGAGIP +V+C+TVNKVCA+GMK+ MLAAQSIQLG+NDV
Sbjct  61    EVFFGNVLTANLGQAPARQAALGAGIPYSVICTTVNKVCAAGMKSAMLAAQSIQLGLNDV  120

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGM  1636
             VVAGGMESMSNVPKY  +AR+GSRLGHD++VDGM
Sbjct  121   VVAGGMESMSNVPKYLPDARRGSRLGHDTVVDGM  154


 Score =   223 bits (569),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 127/140 (91%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            MAP+ ++ +I  RDVC+VGVARTPMGGFLGSLSS+ AT+LGS+AIE+AL+RA VDP LVE
Sbjct  1    MAPSVSDGSIQPRDVCVVGVARTPMGGFLGSLSSMTATRLGSIAIEAALRRAKVDPRLVE  60

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EVFFGNVL ANLGQAPARQAALGAGIP +V+C+TVNKVCA+GMK+ +LAAQSIQLG+NDV
Sbjct  61   EVFFGNVLTANLGQAPARQAALGAGIPYSVICTTVNKVCAAGMKSAMLAAQSIQLGLNDV  120

Query  666  VVAGGMESMSNVHKYFAEAR  725
            VVAGGMESMSNV KY  +AR
Sbjct  121  VVAGGMESMSNVPKYLPDAR  140



>ref|XP_004293407.2| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Fragaria 
vesca subsp. vesca]
Length=414

 Score =   256 bits (653),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MA ++  +I  RDVCIVGVARTPMGGFLGSLSSL AT+LGSIAIE+ALKR  VDPSLV+E
Sbjct  1     MASSSDSSIKPRDVCIVGVARTPMGGFLGSLSSLSATRLGSIAIETALKRAKVDPSLVQE  60

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIP +V+C+T+NKVC+SGMKA M+AAQ+IQLG ND+V
Sbjct  61    VFFGNVLSANLGQAPARQAALGAGIPTSVICTTINKVCSSGMKAAMIAAQTIQLGHNDIV  120

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSN PKY   AR+GSRLGHD++VDGML
Sbjct  121   VAGGMESMSNAPKYLPNARQGSRLGHDNIVDGML  154


 Score =   222 bits (565),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MA ++  +I  RDVCIVGVARTPMGGFLGSLSSL AT+LGS+AIE+ALKRA VDPSLV+E
Sbjct  1    MASSSDSSIKPRDVCIVGVARTPMGGFLGSLSSLSATRLGSIAIETALKRAKVDPSLVQE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIP +V+C+T+NKVC+SGMKA ++AAQ+IQLG ND+V
Sbjct  61   VFFGNVLSANLGQAPARQAALGAGIPTSVICTTINKVCSSGMKAAMIAAQTIQLGHNDIV  120

Query  669  VAGGMESMSNVHKYFAEAR  725
            VAGGMESMSN  KY   AR
Sbjct  121  VAGGMESMSNAPKYLPNAR  139



>ref|XP_008782420.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Phoenix 
dactylifera]
 ref|XP_008782421.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Phoenix 
dactylifera]
Length=415

 Score =   255 bits (652),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = +2

Query  1178  MAPA-TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             MAP+   + +N RDVCIVGVARTPMGGFLG+LSSL ATKLGSI I+ ALKR +VD +LV+
Sbjct  1     MAPSGFCDDLNPRDVCIVGVARTPMGGFLGALSSLSATKLGSIVIQCALKRANVDTTLVQ  60

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EVFFGNVLSANLGQAPARQAALGAGIPNTVVC+T+NKVC+SG+KATM AAQSIQLGINDV
Sbjct  61    EVFFGNVLSANLGQAPARQAALGAGIPNTVVCTTINKVCSSGIKATMFAAQSIQLGINDV  120

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VVAGGMESMSN PKY  EARKGSR G+D+L+DGML
Sbjct  121   VVAGGMESMSNAPKYLTEARKGSRFGNDTLIDGML  155


 Score =   223 bits (568),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 125/140 (89%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPA-TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            MAP+   + +N RDVCIVGVARTPMGGFLG+LSSL ATKLGS+ I+ ALKRA+VD +LV+
Sbjct  1    MAPSGFCDDLNPRDVCIVGVARTPMGGFLGALSSLSATKLGSIVIQCALKRANVDTTLVQ  60

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EVFFGNVL ANLGQAPARQAALGAGIPNTVVC+T+NKVC+SG+KAT+ AAQSIQLGINDV
Sbjct  61   EVFFGNVLSANLGQAPARQAALGAGIPNTVVCTTINKVCSSGIKATMFAAQSIQLGINDV  120

Query  666  VVAGGMESMSNVHKYFAEAR  725
            VVAGGMESMSN  KY  EAR
Sbjct  121  VVAGGMESMSNAPKYLTEAR  140



>ref|XP_008224638.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 [Prunus 
mume]
Length=415

 Score =   255 bits (652),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             M+P+++++I  RDVCIVGVARTPMGGFLGSLSS+ AT+LGS+AI  ALKR ++DPSLV+E
Sbjct  2     MSPSSSDSIKPRDVCIVGVARTPMGGFLGSLSSVSATQLGSLAIRCALKRANLDPSLVQE  61

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPN+V+C+T+NKVC+SG+KATMLAAQ+IQLG+N +V
Sbjct  62    VFFGNVLSANLGQAPARQAALGAGIPNSVICTTINKVCSSGLKATMLAAQTIQLGLNHIV  121

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSN PKY   AR+GSRLGHD++VDGML
Sbjct  122   VAGGMESMSNAPKYLPAARQGSRLGHDTIVDGML  155


 Score =   223 bits (569),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            M+P+++++I  RDVCIVGVARTPMGGFLGSLSS+ AT+LGSLAI  ALKRA++DPSLV+E
Sbjct  2    MSPSSSDSIKPRDVCIVGVARTPMGGFLGSLSSVSATQLGSLAIRCALKRANLDPSLVQE  61

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPN+V+C+T+NKVC+SG+KAT+LAAQ+IQLG+N +V
Sbjct  62   VFFGNVLSANLGQAPARQAALGAGIPNSVICTTINKVCSSGLKATMLAAQTIQLGLNHIV  121

Query  669  VAGGMESMSNVHKYFAEAR  725
            VAGGMESMSN  KY   AR
Sbjct  122  VAGGMESMSNAPKYLPAAR  140



>gb|ACU15722.1| unknown [Glycine max]
Length=196

 Score =   248 bits (633),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +2

Query  1208  ARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSAN  1387
             +RDVCIVGVARTP+GG LG+LSSL AT+LGSIAI+SAL+R +VDPSLV+EVFFGNVLSAN
Sbjct  7     SRDVCIVGVARTPIGGLLGTLSSLSATELGSIAIKSALERANVDPSLVQEVFFGNVLSAN  66

Query  1388  LGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSN  1567
             LGQAPARQAALGAGIP +V+C+T+NKVCASGMKATMLAA +IQ G+NDVVVAGGMESMSN
Sbjct  67    LGQAPARQAALGAGIPTSVICTTINKVCASGMKATMLAALTIQFGLNDVVVAGGMESMSN  126

Query  1568  VPKYFAEARKGSRLGHDSLVDGML  1639
              PKY AEARKGSR GHD+++DGM+
Sbjct  127   APKYLAEARKGSRYGHDTIIDGMV  150


 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 120/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  336  NARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGA  515
             +RDVCIVGVARTP+GG LG+LSSL AT+LGS+AI+SAL+RA+VDPSLV+EVFFGNVL A
Sbjct  6    KSRDVCIVGVARTPIGGLLGTLSSLSATELGSIAIKSALERANVDPSLVQEVFFGNVLSA  65

Query  516  NLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMS  695
            NLGQAPARQAALGAGIP +V+C+T+NKVCASGMKAT+LAA +IQ G+NDVVVAGGMESMS
Sbjct  66   NLGQAPARQAALGAGIPTSVICTTINKVCASGMKATMLAALTIQFGLNDVVVAGGMESMS  125

Query  696  NVHKYFAEAR  725
            N  KY AEAR
Sbjct  126  NAPKYLAEAR  135



>gb|EYU27653.1| hypothetical protein MIMGU_mgv1a007243mg [Erythranthe guttata]
Length=414

 Score =   255 bits (652),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MA    + IN +DVCIVGVARTPMGGFLGSLSSLPATKLGSIAI  ALKR  VDPSLV+E
Sbjct  1     MASLADDPINPQDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIACALKRAGVDPSLVQE  60

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPN+V+C+TVNKVC+SGMKATM+AAQ+I+LG+NDVV
Sbjct  61    VFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCSSGMKATMIAAQTIKLGVNDVV  120

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             V+GGMESMSN PKY    R GSRLGHD++VDGML
Sbjct  121   VSGGMESMSNAPKYINTGRTGSRLGHDTIVDGML  154


 Score =   223 bits (567),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MA    + IN +DVCIVGVARTPMGGFLGSLSSLPATKLGS+AI  ALKRA VDPSLV+E
Sbjct  1    MASLADDPINPQDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIACALKRAGVDPSLVQE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPN+V+C+TVNKVC+SGMKAT++AAQ+I+LG+NDVV
Sbjct  61   VFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCSSGMKATMIAAQTIKLGVNDVV  120

Query  669  VAGGMESMSNVHKYFAEARS  728
            V+GGMESMSN  KY    R+
Sbjct  121  VSGGMESMSNAPKYINTGRT  140



>ref|XP_006398473.1| hypothetical protein EUTSA_v10000897mg [Eutrema salsugineum]
 gb|ESQ39926.1| hypothetical protein EUTSA_v10000897mg [Eutrema salsugineum]
Length=405

 Score =   255 bits (651),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 142/154 (92%), Gaps = 1/154 (1%)
 Frame = +2

Query  1178  MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             MAP+ ++ +I  RDVC+VGVARTPMGGFLGSLSS+ AT+LGSIAIE+AL+R  VDP LVE
Sbjct  1     MAPSVSDGSIQPRDVCVVGVARTPMGGFLGSLSSMTATRLGSIAIEAALRRAKVDPRLVE  60

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EVFFGNVL+ANLGQAPARQAALGAGIP +V+C+TVNKVCA+GMK+ MLAAQSIQLG+NDV
Sbjct  61    EVFFGNVLTANLGQAPARQAALGAGIPYSVICTTVNKVCAAGMKSAMLAAQSIQLGLNDV  120

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGM  1636
             VVAGGMESMSNVPKY  +AR+GSRLGHD++VDGM
Sbjct  121   VVAGGMESMSNVPKYLPDARRGSRLGHDTVVDGM  154


 Score =   223 bits (569),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 127/140 (91%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            MAP+ ++ +I  RDVC+VGVARTPMGGFLGSLSS+ AT+LGS+AIE+AL+RA VDP LVE
Sbjct  1    MAPSVSDGSIQPRDVCVVGVARTPMGGFLGSLSSMTATRLGSIAIEAALRRAKVDPRLVE  60

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EVFFGNVL ANLGQAPARQAALGAGIP +V+C+TVNKVCA+GMK+ +LAAQSIQLG+NDV
Sbjct  61   EVFFGNVLTANLGQAPARQAALGAGIPYSVICTTVNKVCAAGMKSAMLAAQSIQLGLNDV  120

Query  666  VVAGGMESMSNVHKYFAEAR  725
            VVAGGMESMSNV KY  +AR
Sbjct  121  VVAGGMESMSNVPKYLPDAR  140



>ref|XP_010647165.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X4 [Vitis vinifera]
Length=401

 Score =   254 bits (650),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 137/154 (89%), Gaps = 2/154 (1%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAP   ++I  RDVCIVGVARTPMGGFLG LSSL ATKLGSIAI  AL+R ++DPSLV+E
Sbjct  1     MAPH--DSIKPRDVCIVGVARTPMGGFLGFLSSLSATKLGSIAIRGALRRANIDPSLVQE  58

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKA M AAQSIQLG+NDVV
Sbjct  59    VFFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKAIMFAAQSIQLGVNDVV  118

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSN PKY   AR GSRLGHD++VDGM+
Sbjct  119   VAGGMESMSNAPKYLVYARNGSRLGHDTIVDGMI  152


 Score =   223 bits (567),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 123/140 (88%), Gaps = 2/140 (1%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAP   ++I  RDVCIVGVARTPMGGFLG LSSL ATKLGS+AI  AL+RA++DPSLV+E
Sbjct  1    MAPH--DSIKPRDVCIVGVARTPMGGFLGFLSSLSATKLGSIAIRGALRRANIDPSLVQE  58

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKA + AAQSIQLG+NDVV
Sbjct  59   VFFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKAIMFAAQSIQLGVNDVV  118

Query  669  VAGGMESMSNVHKYFAEARS  728
            VAGGMESMSN  KY   AR+
Sbjct  119  VAGGMESMSNAPKYLVYARN  138



>gb|KEH32696.1| peroxisomal acetoacetyl-coenzyme A thiolase [Medicago truncatula]
Length=298

 Score =   251 bits (642),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +2

Query  1205  NARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSA  1384
              +RDVCIVGV RTPMGGFLGSLSSL AT LGS+AI++ALKR +VDPSLV+EVFFGNVLSA
Sbjct  4     KSRDVCIVGVGRTPMGGFLGSLSSLSATHLGSLAIKAALKRANVDPSLVQEVFFGNVLSA  63

Query  1385  NLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMS  1564
             NLGQAPARQAALGAGIP +V+C+T+NKVC+SGMKATMLAAQ+IQLG NDVVV GGMESMS
Sbjct  64    NLGQAPARQAALGAGIPTSVICTTINKVCSSGMKATMLAAQTIQLGSNDVVVVGGMESMS  123

Query  1565  NVPKYFAEARKGSRLGHDSLVDGML  1639
             N PKY AEARKGSRLGHD+++DGML
Sbjct  124   NAPKYIAEARKGSRLGHDTIIDGML  148


 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  336  NARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGA  515
             +RDVCIVGV RTPMGGFLGSLSSL AT LGSLAI++ALKRA+VDPSLV+EVFFGNVL A
Sbjct  4    KSRDVCIVGVGRTPMGGFLGSLSSLSATHLGSLAIKAALKRANVDPSLVQEVFFGNVLSA  63

Query  516  NLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMS  695
            NLGQAPARQAALGAGIP +V+C+T+NKVC+SGMKAT+LAAQ+IQLG NDVVV GGMESMS
Sbjct  64   NLGQAPARQAALGAGIPTSVICTTINKVCSSGMKATMLAAQTIQLGSNDVVVVGGMESMS  123

Query  696  NVHKYFAEAR  725
            N  KY AEAR
Sbjct  124  NAPKYIAEAR  133



>ref|XP_010647164.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X3 [Vitis vinifera]
Length=404

 Score =   254 bits (650),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 137/154 (89%), Gaps = 2/154 (1%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAP   ++I  RDVCIVGVARTPMGGFLG LSSL ATKLGSIAI  AL+R ++DPSLV+E
Sbjct  1     MAPH--DSIKPRDVCIVGVARTPMGGFLGFLSSLSATKLGSIAIRGALRRANIDPSLVQE  58

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKA M AAQSIQLG+NDVV
Sbjct  59    VFFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKAIMFAAQSIQLGVNDVV  118

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSN PKY   AR GSRLGHD++VDGM+
Sbjct  119   VAGGMESMSNAPKYLVYARNGSRLGHDTIVDGMI  152


 Score =   223 bits (567),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 123/140 (88%), Gaps = 2/140 (1%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAP   ++I  RDVCIVGVARTPMGGFLG LSSL ATKLGS+AI  AL+RA++DPSLV+E
Sbjct  1    MAPH--DSIKPRDVCIVGVARTPMGGFLGFLSSLSATKLGSIAIRGALRRANIDPSLVQE  58

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKA + AAQSIQLG+NDVV
Sbjct  59   VFFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKAIMFAAQSIQLGVNDVV  118

Query  669  VAGGMESMSNVHKYFAEARS  728
            VAGGMESMSN  KY   AR+
Sbjct  119  VAGGMESMSNAPKYLVYARN  138



>ref|XP_010647163.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X2 [Vitis vinifera]
Length=404

 Score =   254 bits (650),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 137/154 (89%), Gaps = 2/154 (1%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAP   ++I  RDVCIVGVARTPMGGFLG LSSL ATKLGSIAI  AL+R ++DPSLV+E
Sbjct  1     MAPH--DSIKPRDVCIVGVARTPMGGFLGFLSSLSATKLGSIAIRGALRRANIDPSLVQE  58

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKA M AAQSIQLG+NDVV
Sbjct  59    VFFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKAIMFAAQSIQLGVNDVV  118

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSN PKY   AR GSRLGHD++VDGM+
Sbjct  119   VAGGMESMSNAPKYLVYARNGSRLGHDTIVDGMI  152


 Score =   223 bits (567),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 123/140 (88%), Gaps = 2/140 (1%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAP   ++I  RDVCIVGVARTPMGGFLG LSSL ATKLGS+AI  AL+RA++DPSLV+E
Sbjct  1    MAPH--DSIKPRDVCIVGVARTPMGGFLGFLSSLSATKLGSIAIRGALRRANIDPSLVQE  58

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKA + AAQSIQLG+NDVV
Sbjct  59   VFFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKAIMFAAQSIQLGVNDVV  118

Query  669  VAGGMESMSNVHKYFAEARS  728
            VAGGMESMSN  KY   AR+
Sbjct  119  VAGGMESMSNAPKYLVYARN  138



>ref|XP_009787709.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Nicotiana 
sylvestris]
Length=414

 Score =   255 bits (651),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MA    ++I  RDVCIVGVARTPMGGFLGSLSSL AT+LGS+AI +ALKR +VDPSLV+E
Sbjct  1     MAKMVNDSIKPRDVCIVGVARTPMGGFLGSLSSLSATELGSVAIRAALKRANVDPSLVQE  60

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPN+V+C+T+NKVC+SG+KATM+AAQ+IQ G ND+V
Sbjct  61    VFFGNVLSANLGQAPARQAALGAGIPNSVICTTINKVCSSGLKATMIAAQTIQSGSNDIV  120

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             V GGMESMSNVPKY  +ARKGSRLGHD++VDGML
Sbjct  121   VTGGMESMSNVPKYLPQARKGSRLGHDTIVDGML  154


 Score =   219 bits (558),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MA    ++I  RDVCIVGVARTPMGGFLGSLSSL AT+LGS+AI +ALKRA+VDPSLV+E
Sbjct  1    MAKMVNDSIKPRDVCIVGVARTPMGGFLGSLSSLSATELGSVAIRAALKRANVDPSLVQE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPN+V+C+T+NKVC+SG+KAT++AAQ+IQ G ND+V
Sbjct  61   VFFGNVLSANLGQAPARQAALGAGIPNSVICTTINKVCSSGLKATMIAAQTIQSGSNDIV  120

Query  669  VAGGMESMSNVHKYFAEAR  725
            V GGMESMSNV KY  +AR
Sbjct  121  VTGGMESMSNVPKYLPQAR  139



>ref|XP_003635396.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Vitis vinifera]
 emb|CBI33249.3| unnamed protein product [Vitis vinifera]
Length=411

 Score =   254 bits (650),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 137/154 (89%), Gaps = 2/154 (1%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAP   ++I  RDVCIVGVARTPMGGFLG LSSL ATKLGSIAI  AL+R ++DPSLV+E
Sbjct  1     MAPH--DSIKPRDVCIVGVARTPMGGFLGFLSSLSATKLGSIAIRGALRRANIDPSLVQE  58

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKA M AAQSIQLG+NDVV
Sbjct  59    VFFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKAIMFAAQSIQLGVNDVV  118

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSN PKY   AR GSRLGHD++VDGM+
Sbjct  119   VAGGMESMSNAPKYLVYARNGSRLGHDTIVDGMI  152


 Score =   223 bits (567),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 123/140 (88%), Gaps = 2/140 (1%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAP   ++I  RDVCIVGVARTPMGGFLG LSSL ATKLGS+AI  AL+RA++DPSLV+E
Sbjct  1    MAPH--DSIKPRDVCIVGVARTPMGGFLGFLSSLSATKLGSIAIRGALRRANIDPSLVQE  58

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKA + AAQSIQLG+NDVV
Sbjct  59   VFFGNVLSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKAIMFAAQSIQLGVNDVV  118

Query  669  VAGGMESMSNVHKYFAEARS  728
            VAGGMESMSN  KY   AR+
Sbjct  119  VAGGMESMSNAPKYLVYARN  138



>gb|AEI27246.1| putative acetyl-CoA-C-acetyltransferase [Vanda hybrid cultivar]
Length=376

 Score =   253 bits (647),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +2

Query  1187  ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFF  1366
             A  + +  RDVCIVGVARTP+G FLGSLSSLPATKLGSI IESAL+R +VDP+LV+EV+F
Sbjct  5     AVHDELKPRDVCIVGVARTPIGAFLGSLSSLPATKLGSIVIESALRRANVDPTLVQEVYF  64

Query  1367  GNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAG  1546
             GNVLSANLGQAPARQAALGAGIPN VVC+T+NKVC+SGMKATM+AAQSIQLGIND+VV+G
Sbjct  65    GNVLSANLGQAPARQAALGAGIPNNVVCTTINKVCSSGMKATMIAAQSIQLGINDIVVSG  124

Query  1547  GMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             GMESMSN PKY  +ARKGSR G+D+++DGM+
Sbjct  125   GMESMSNAPKYLVDARKGSRFGNDTIIDGMV  155


 Score =   224 bits (571),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = +3

Query  318  ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFF  497
            A  + +  RDVCIVGVARTP+G FLGSLSSLPATKLGS+ IESAL+RA+VDP+LV+EV+F
Sbjct  5    AVHDELKPRDVCIVGVARTPIGAFLGSLSSLPATKLGSIVIESALRRANVDPTLVQEVYF  64

Query  498  GNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAG  677
            GNVL ANLGQAPARQAALGAGIPN VVC+T+NKVC+SGMKAT++AAQSIQLGIND+VV+G
Sbjct  65   GNVLSANLGQAPARQAALGAGIPNNVVCTTINKVCSSGMKATMIAAQSIQLGINDIVVSG  124

Query  678  GMESMSNVHKYFAEAR  725
            GMESMSN  KY  +AR
Sbjct  125  GMESMSNAPKYLVDAR  140



>ref|XP_011628272.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Amborella trichopoda]
Length=404

 Score =   254 bits (648),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = +2

Query  1178  MAPA-TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             MAPA  ++++  RDVCIVGVARTPMGG  GSLSSLPATKLGSIAIE ALKR +VDP+ V+
Sbjct  1     MAPAAVSDSLKPRDVCIVGVARTPMGGLCGSLSSLPATKLGSIAIECALKRANVDPAHVQ  60

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EVFFGNVLSANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKATMLAAQSIQLG+NDV
Sbjct  61    EVFFGNVLSANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMLAAQSIQLGVNDV  120

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VVAGGMESMSN P Y  E RKG+RLGH ++VDGML
Sbjct  121   VVAGGMESMSNAPFYLPELRKGNRLGHGTVVDGML  155


 Score =   224 bits (570),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 137/168 (82%), Gaps = 5/168 (3%)
 Frame = +3

Query  309  MAPA-TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            MAPA  ++++  RDVCIVGVARTPMGG  GSLSSLPATKLGS+AIE ALKRA+VDP+ V+
Sbjct  1    MAPAAVSDSLKPRDVCIVGVARTPMGGLCGSLSSLPATKLGSIAIECALKRANVDPAHVQ  60

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EVFFGNVL ANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKAT+LAAQSIQLG+NDV
Sbjct  61   EVFFGNVLSANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMLAAQSIQLGVNDV  120

Query  666  VVAGGMESMSNVHKYFAEARSISNNIW*ISTAVVSLISDKV--VQNSF  803
            VVAGGMESMSN   Y  E R    N     T V  +++D +  V N+F
Sbjct  121  VVAGGMESMSNAPFYLPELR--KGNRLGHGTVVDGMLTDGLWDVYNNF  166



>ref|XP_010675964.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Beta 
vulgaris subsp. vulgaris]
Length=417

 Score =   254 bits (649),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +2

Query  1196  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  1375
             ++I  RDVCIVGVARTPMGG LGSLS+L ATKLGS+AIE AL+R  VDPSLV+EVFFGNV
Sbjct  10    QSIKPRDVCIVGVARTPMGGLLGSLSTLSATKLGSVAIECALRRARVDPSLVQEVFFGNV  69

Query  1376  LSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGME  1555
             LSANLGQAPARQAALGAGIPN+VVC+T+NKVC+SGMKATMLAAQSIQLG ND+VVAGGME
Sbjct  70    LSANLGQAPARQAALGAGIPNSVVCTTINKVCSSGMKATMLAAQSIQLGANDIVVAGGME  129

Query  1556  SMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             SMSN PKY A AR GSRLGHD+++DGML
Sbjct  130   SMSNAPKYLALARTGSRLGHDTIIDGML  157


 Score =   222 bits (566),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +3

Query  327  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNV  506
            ++I  RDVCIVGVARTPMGG LGSLS+L ATKLGS+AIE AL+RA VDPSLV+EVFFGNV
Sbjct  10   QSIKPRDVCIVGVARTPMGGLLGSLSTLSATKLGSVAIECALRRARVDPSLVQEVFFGNV  69

Query  507  LGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGME  686
            L ANLGQAPARQAALGAGIPN+VVC+T+NKVC+SGMKAT+LAAQSIQLG ND+VVAGGME
Sbjct  70   LSANLGQAPARQAALGAGIPNSVVCTTINKVCSSGMKATMLAAQSIQLGANDIVVAGGME  129

Query  687  SMSNVHKYFAEARS  728
            SMSN  KY A AR+
Sbjct  130  SMSNAPKYLALART  143



>ref|XP_004507588.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2-like 
isoform X2 [Cicer arietinum]
Length=408

 Score =   254 bits (648),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +2

Query  1205  NARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSA  1384
              +RDVCIVGVARTPMGGFLGSLSSL AT+LGSIAI SALKR +VDPSLV+EVFFGNVLSA
Sbjct  4     QSRDVCIVGVARTPMGGFLGSLSSLSATQLGSIAINSALKRANVDPSLVQEVFFGNVLSA  63

Query  1385  NLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMS  1564
             NLGQAPARQAALGAGIP +V+C+T+NKVC+SGMKATM+AAQ+IQLG NDVVV GGMESMS
Sbjct  64    NLGQAPARQAALGAGIPTSVICTTINKVCSSGMKATMIAAQTIQLGSNDVVVVGGMESMS  123

Query  1565  NVPKYFAEARKGSRLGHDSLVDGML  1639
             N PKY  EARKGSRLGHD+++DGML
Sbjct  124   NAPKYIVEARKGSRLGHDTIIDGML  148


 Score =   218 bits (556),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  336  NARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGA  515
             +RDVCIVGVARTPMGGFLGSLSSL AT+LGS+AI SALKRA+VDPSLV+EVFFGNVL A
Sbjct  4    QSRDVCIVGVARTPMGGFLGSLSSLSATQLGSIAINSALKRANVDPSLVQEVFFGNVLSA  63

Query  516  NLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMS  695
            NLGQAPARQAALGAGIP +V+C+T+NKVC+SGMKAT++AAQ+IQLG NDVVV GGMESMS
Sbjct  64   NLGQAPARQAALGAGIPTSVICTTINKVCSSGMKATMIAAQTIQLGSNDVVVVGGMESMS  123

Query  696  NVHKYFAEAR  725
            N  KY  EAR
Sbjct  124  NAPKYIVEAR  133



>ref|XP_011628271.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Amborella trichopoda]
Length=414

 Score =   254 bits (649),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = +2

Query  1178  MAPA-TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             MAPA  ++++  RDVCIVGVARTPMGG  GSLSSLPATKLGSIAIE ALKR +VDP+ V+
Sbjct  1     MAPAAVSDSLKPRDVCIVGVARTPMGGLCGSLSSLPATKLGSIAIECALKRANVDPAHVQ  60

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EVFFGNVLSANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKATMLAAQSIQLG+NDV
Sbjct  61    EVFFGNVLSANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMLAAQSIQLGVNDV  120

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VVAGGMESMSN P Y  E RKG+RLGH ++VDGML
Sbjct  121   VVAGGMESMSNAPFYLPELRKGNRLGHGTVVDGML  155


 Score =   223 bits (569),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 137/168 (82%), Gaps = 5/168 (3%)
 Frame = +3

Query  309  MAPA-TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            MAPA  ++++  RDVCIVGVARTPMGG  GSLSSLPATKLGS+AIE ALKRA+VDP+ V+
Sbjct  1    MAPAAVSDSLKPRDVCIVGVARTPMGGLCGSLSSLPATKLGSIAIECALKRANVDPAHVQ  60

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EVFFGNVL ANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKAT+LAAQSIQLG+NDV
Sbjct  61   EVFFGNVLSANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMLAAQSIQLGVNDV  120

Query  666  VVAGGMESMSNVHKYFAEARSISNNIW*ISTAVVSLISDKV--VQNSF  803
            VVAGGMESMSN   Y  E R    N     T V  +++D +  V N+F
Sbjct  121  VVAGGMESMSNAPFYLPELR--KGNRLGHGTVVDGMLTDGLWDVYNNF  166



>gb|ERN19239.1| hypothetical protein AMTR_s00061p00203040 [Amborella trichopoda]
Length=459

 Score =   255 bits (652),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 152/197 (77%), Gaps = 8/197 (4%)
 Frame = +2

Query  1055  PSQYI*PPLFPIQLASFHSF-SLPRNQHYNQHRSSICIH*LAMAPA-TAETINARDVCIV  1228
             P  ++ P L  I   S   F  L     +  H   I      MAPA  ++++  RDVCIV
Sbjct  20    PLAFVAPSLNIIDGESSSLFGKLKHKLFFYWHYHYI------MAPAAVSDSLKPRDVCIV  73

Query  1229  GVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLGQAPAR  1408
             GVARTPMGG  GSLSSLPATKLGSIAIE ALKR +VDP+ V+EVFFGNVLSANLGQAPAR
Sbjct  74    GVARTPMGGLCGSLSSLPATKLGSIAIECALKRANVDPAHVQEVFFGNVLSANLGQAPAR  133

Query  1409  QAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNVPKYFAE  1588
             QAALGAGIPN+V+C+T+NKVCASGMKATMLAAQSIQLG+NDVVVAGGMESMSN P Y  E
Sbjct  134   QAALGAGIPNSVICTTINKVCASGMKATMLAAQSIQLGVNDVVVAGGMESMSNAPFYLPE  193

Query  1589  ARKGSRLGHDSLVDGML  1639
              RKG+RLGH ++VDGML
Sbjct  194   LRKGNRLGHGTVVDGML  210


 Score =   225 bits (574),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 137/182 (75%), Gaps = 8/182 (4%)
 Frame = +3

Query  186  PSQYI*PPLXPIQFASYHSF-SLPRNQHYNQHRSSICIH*LAMAPA-TAETINARDVCIV  359
            P  ++ P L  I   S   F  L     +  H   I      MAPA  ++++  RDVCIV
Sbjct  20   PLAFVAPSLNIIDGESSSLFGKLKHKLFFYWHYHYI------MAPAAVSDSLKPRDVCIV  73

Query  360  GVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGANLGQAPAR  539
            GVARTPMGG  GSLSSLPATKLGS+AIE ALKRA+VDP+ V+EVFFGNVL ANLGQAPAR
Sbjct  74   GVARTPMGGLCGSLSSLPATKLGSIAIECALKRANVDPAHVQEVFFGNVLSANLGQAPAR  133

Query  540  QAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNVHKYFAE  719
            QAALGAGIPN+V+C+T+NKVCASGMKAT+LAAQSIQLG+NDVVVAGGMESMSN   Y  E
Sbjct  134  QAALGAGIPNSVICTTINKVCASGMKATMLAAQSIQLGVNDVVVAGGMESMSNAPFYLPE  193

Query  720  AR  725
             R
Sbjct  194  LR  195



>ref|XP_006350251.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2-like 
[Solanum tuberosum]
Length=414

 Score =   254 bits (648),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MA    ++I  +DVCIVGVARTPMGGFLGSLSSL AT+LGS AI +ALKR +VDPSLV+E
Sbjct  1     MAKMVQDSIKLQDVCIVGVARTPMGGFLGSLSSLSATELGSAAIRAALKRANVDPSLVQE  60

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPN+V+C+T+NKVC+SG+KATM+AAQ+IQ G ND+V
Sbjct  61    VFFGNVLSANLGQAPARQAALGAGIPNSVICTTINKVCSSGLKATMIAAQTIQSGANDIV  120

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             V GGMESMSNVPKY A+ARKGSRLGHD++VDGML
Sbjct  121   VTGGMESMSNVPKYLAQARKGSRLGHDTVVDGML  154


 Score =   219 bits (558),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MA    ++I  +DVCIVGVARTPMGGFLGSLSSL AT+LGS AI +ALKRA+VDPSLV+E
Sbjct  1    MAKMVQDSIKLQDVCIVGVARTPMGGFLGSLSSLSATELGSAAIRAALKRANVDPSLVQE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPN+V+C+T+NKVC+SG+KAT++AAQ+IQ G ND+V
Sbjct  61   VFFGNVLSANLGQAPARQAALGAGIPNSVICTTINKVCSSGLKATMIAAQTIQSGANDIV  120

Query  669  VAGGMESMSNVHKYFAEAR  725
            V GGMESMSNV KY A+AR
Sbjct  121  VTGGMESMSNVPKYLAQAR  139



>gb|AHZ96597.1| acetyl-CoA C-acetyl transferase [Aquilaria sinensis]
Length=411

 Score =   253 bits (647),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = +2

Query  1193  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  1372
             +++I  RDVCIVGVARTP+G FLG+LSSL AT LGS+AI +ALKR +VDPSLV+EVFFGN
Sbjct  3     SDSIRPRDVCIVGVARTPVGSFLGALSSLSATFLGSVAIRAALKRANVDPSLVQEVFFGN  62

Query  1373  VLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGM  1552
             VLSANLGQAPARQAALGAGIPN+VVC+T+NKVC+SGMKA MLA+QSI+LGINDVVVAGGM
Sbjct  63    VLSANLGQAPARQAALGAGIPNSVVCTTINKVCSSGMKAVMLASQSIELGINDVVVAGGM  122

Query  1553  ESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             ESMSN PKY AEARKGSRLGHD++VDGML
Sbjct  123   ESMSNAPKYLAEARKGSRLGHDTIVDGML  151


 Score =   218 bits (555),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +3

Query  324  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGN  503
            +++I  RDVCIVGVARTP+G FLG+LSSL AT LGS+AI +ALKRA+VDPSLV+EVFFGN
Sbjct  3    SDSIRPRDVCIVGVARTPVGSFLGALSSLSATFLGSVAIRAALKRANVDPSLVQEVFFGN  62

Query  504  VLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGM  683
            VL ANLGQAPARQAALGAGIPN+VVC+T+NKVC+SGMKA +LA+QSI+LGINDVVVAGGM
Sbjct  63   VLSANLGQAPARQAALGAGIPNSVVCTTINKVCSSGMKAVMLASQSIELGINDVVVAGGM  122

Query  684  ESMSNVHKYFAEAR  725
            ESMSN  KY AEAR
Sbjct  123  ESMSNAPKYLAEAR  136



>ref|XP_002865105.1| hypothetical protein ARALYDRAFT_494196 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41364.1| hypothetical protein ARALYDRAFT_494196 [Arabidopsis lyrata subsp. 
lyrata]
Length=415

 Score =   253 bits (647),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 143/155 (92%), Gaps = 1/155 (1%)
 Frame = +2

Query  1178  MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             MAP  ++ ++  RDVC+VGVARTP+GGFLGSLSSL AT+LGSIAI++ALKR  VDP+LVE
Sbjct  1     MAPHVSDDSLQPRDVCVVGVARTPIGGFLGSLSSLTATRLGSIAIQAALKRAHVDPALVE  60

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EVFFGNVL+ANLGQAPARQAALGAGIP +V+C+T+NKVCA+GMK+ MLA+QSIQLG+NDV
Sbjct  61    EVFFGNVLTANLGQAPARQAALGAGIPYSVICTTINKVCAAGMKSVMLASQSIQLGLNDV  120

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VVAGGMESMSNVPKY  +AR+GSRLGHDS+VDGM+
Sbjct  121   VVAGGMESMSNVPKYLPDARRGSRLGHDSVVDGMM  155


 Score =   219 bits (559),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 127/140 (91%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            MAP  ++ ++  RDVC+VGVARTP+GGFLGSLSSL AT+LGS+AI++ALKRA VDP+LVE
Sbjct  1    MAPHVSDDSLQPRDVCVVGVARTPIGGFLGSLSSLTATRLGSIAIQAALKRAHVDPALVE  60

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EVFFGNVL ANLGQAPARQAALGAGIP +V+C+T+NKVCA+GMK+ +LA+QSIQLG+NDV
Sbjct  61   EVFFGNVLTANLGQAPARQAALGAGIPYSVICTTINKVCAAGMKSVMLASQSIQLGLNDV  120

Query  666  VVAGGMESMSNVHKYFAEAR  725
            VVAGGMESMSNV KY  +AR
Sbjct  121  VVAGGMESMSNVPKYLPDAR  140



>ref|XP_004507587.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2-like 
isoform X1 [Cicer arietinum]
Length=433

 Score =   254 bits (648),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +2

Query  1205  NARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSA  1384
              +RDVCIVGVARTPMGGFLGSLSSL AT+LGSIAI SALKR +VDPSLV+EVFFGNVLSA
Sbjct  4     QSRDVCIVGVARTPMGGFLGSLSSLSATQLGSIAINSALKRANVDPSLVQEVFFGNVLSA  63

Query  1385  NLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMS  1564
             NLGQAPARQAALGAGIP +V+C+T+NKVC+SGMKATM+AAQ+IQLG NDVVV GGMESMS
Sbjct  64    NLGQAPARQAALGAGIPTSVICTTINKVCSSGMKATMIAAQTIQLGSNDVVVVGGMESMS  123

Query  1565  NVPKYFAEARKGSRLGHDSLVDGML  1639
             N PKY  EARKGSRLGHD+++DGML
Sbjct  124   NAPKYIVEARKGSRLGHDTIIDGML  148


 Score =   218 bits (555),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  336  NARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGA  515
             +RDVCIVGVARTPMGGFLGSLSSL AT+LGS+AI SALKRA+VDPSLV+EVFFGNVL A
Sbjct  4    QSRDVCIVGVARTPMGGFLGSLSSLSATQLGSIAINSALKRANVDPSLVQEVFFGNVLSA  63

Query  516  NLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMS  695
            NLGQAPARQAALGAGIP +V+C+T+NKVC+SGMKAT++AAQ+IQLG NDVVV GGMESMS
Sbjct  64   NLGQAPARQAALGAGIPTSVICTTINKVCSSGMKATMIAAQTIQLGSNDVVVVGGMESMS  123

Query  696  NVHKYFAEAR  725
            N  KY  EAR
Sbjct  124  NAPKYIVEAR  133



>ref|XP_010538441.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Tarenaya hassleriana]
Length=404

 Score =   253 bits (646),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MA + ++++  RDVC+VG++RTPMGGFLGSLSSL A KLGSIAIE AL+R +VDPSLVEE
Sbjct  1     MALSVSDSVQPRDVCVVGMSRTPMGGFLGSLSSLTAIKLGSIAIECALRRANVDPSLVEE  60

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGA IP++V+C+TVNKVCASGMKA M+AAQSIQLG+NDVV
Sbjct  61    VFFGNVLSANLGQAPARQAALGARIPHSVICTTVNKVCASGMKAVMIAAQSIQLGLNDVV  120

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSN PKY  EARKG RLGHD++VDG+L
Sbjct  121   VAGGMESMSNAPKYLTEARKGLRLGHDTIVDGLL  154


 Score =   221 bits (563),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MA + ++++  RDVC+VG++RTPMGGFLGSLSSL A KLGS+AIE AL+RA+VDPSLVEE
Sbjct  1    MALSVSDSVQPRDVCVVGMSRTPMGGFLGSLSSLTAIKLGSIAIECALRRANVDPSLVEE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGA IP++V+C+TVNKVCASGMKA ++AAQSIQLG+NDVV
Sbjct  61   VFFGNVLSANLGQAPARQAALGARIPHSVICTTVNKVCASGMKAVMIAAQSIQLGLNDVV  120

Query  669  VAGGMESMSNVHKYFAEAR  725
            VAGGMESMSN  KY  EAR
Sbjct  121  VAGGMESMSNAPKYLTEAR  139



>ref|XP_010538440.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X1 [Tarenaya hassleriana]
Length=414

 Score =   253 bits (646),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MA + ++++  RDVC+VG++RTPMGGFLGSLSSL A KLGSIAIE AL+R +VDPSLVEE
Sbjct  1     MALSVSDSVQPRDVCVVGMSRTPMGGFLGSLSSLTAIKLGSIAIECALRRANVDPSLVEE  60

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGA IP++V+C+TVNKVCASGMKA M+AAQSIQLG+NDVV
Sbjct  61    VFFGNVLSANLGQAPARQAALGARIPHSVICTTVNKVCASGMKAVMIAAQSIQLGLNDVV  120

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSN PKY  EARKG RLGHD++VDG+L
Sbjct  121   VAGGMESMSNAPKYLTEARKGLRLGHDTIVDGLL  154


 Score =   221 bits (563),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MA + ++++  RDVC+VG++RTPMGGFLGSLSSL A KLGS+AIE AL+RA+VDPSLVEE
Sbjct  1    MALSVSDSVQPRDVCVVGMSRTPMGGFLGSLSSLTAIKLGSIAIECALRRANVDPSLVEE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGA IP++V+C+TVNKVCASGMKA ++AAQSIQLG+NDVV
Sbjct  61   VFFGNVLSANLGQAPARQAALGARIPHSVICTTVNKVCASGMKAVMIAAQSIQLGLNDVV  120

Query  669  VAGGMESMSNVHKYFAEAR  725
            VAGGMESMSN  KY  EAR
Sbjct  121  VAGGMESMSNAPKYLTEAR  139



>ref|XP_003637597.1| Acetyl-CoA acetyltransferase cytosolic [Medicago truncatula]
 gb|KEH32694.1| peroxisomal acetoacetyl-coenzyme A thiolase [Medicago truncatula]
Length=408

 Score =   252 bits (644),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +2

Query  1205  NARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSA  1384
              +RDVCIVGV RTPMGGFLGSLSSL AT LGS+AI++ALKR +VDPSLV+EVFFGNVLSA
Sbjct  4     KSRDVCIVGVGRTPMGGFLGSLSSLSATHLGSLAIKAALKRANVDPSLVQEVFFGNVLSA  63

Query  1385  NLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMS  1564
             NLGQAPARQAALGAGIP +V+C+T+NKVC+SGMKATMLAAQ+IQLG NDVVV GGMESMS
Sbjct  64    NLGQAPARQAALGAGIPTSVICTTINKVCSSGMKATMLAAQTIQLGSNDVVVVGGMESMS  123

Query  1565  NVPKYFAEARKGSRLGHDSLVDGML  1639
             N PKY AEARKGSRLGHD+++DGML
Sbjct  124   NAPKYIAEARKGSRLGHDTIIDGML  148


 Score =   219 bits (558),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  336  NARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGA  515
             +RDVCIVGV RTPMGGFLGSLSSL AT LGSLAI++ALKRA+VDPSLV+EVFFGNVL A
Sbjct  4    KSRDVCIVGVGRTPMGGFLGSLSSLSATHLGSLAIKAALKRANVDPSLVQEVFFGNVLSA  63

Query  516  NLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMS  695
            NLGQAPARQAALGAGIP +V+C+T+NKVC+SGMKAT+LAAQ+IQLG NDVVV GGMESMS
Sbjct  64   NLGQAPARQAALGAGIPTSVICTTINKVCSSGMKATMLAAQTIQLGSNDVVVVGGMESMS  123

Query  696  NVHKYFAEAR  725
            N  KY AEAR
Sbjct  124  NAPKYIAEAR  133



>ref|XP_011095902.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Sesamum indicum]
Length=428

 Score =   253 bits (646),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 141/165 (85%), Gaps = 3/165 (2%)
 Frame = +2

Query  1145  HRSSICIH*LAMAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALK  1324
             HR S  I    MA    ++I  RDVCIVGVARTPMG FLGSLSSLPATKLGSIAIE AL+
Sbjct  4     HRHSAII---LMASVADDSIKDRDVCIVGVARTPMGSFLGSLSSLPATKLGSIAIECALR  60

Query  1325  RGSVDPSLVEEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAA  1504
             R  V PS+V+EVFFGNVL+ANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKATM+AA
Sbjct  61    RAGVHPSMVQEVFFGNVLTANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMIAA  120

Query  1505  QSIQLGINDVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             Q+I+LG+NDVVVAGGMESMSN PKY    R G+RLGHD+++DGML
Sbjct  121   QTIKLGVNDVVVAGGMESMSNAPKYIPTGRTGTRLGHDTIIDGML  165


 Score =   223 bits (567),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 127/151 (84%), Gaps = 3/151 (2%)
 Frame = +3

Query  276  HRSSICIH*LAMAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALK  455
            HR S  I    MA    ++I  RDVCIVGVARTPMG FLGSLSSLPATKLGS+AIE AL+
Sbjct  4    HRHSAII---LMASVADDSIKDRDVCIVGVARTPMGSFLGSLSSLPATKLGSIAIECALR  60

Query  456  RASVDPSLVEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAA  635
            RA V PS+V+EVFFGNVL ANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKAT++AA
Sbjct  61   RAGVHPSMVQEVFFGNVLTANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMIAA  120

Query  636  QSIQLGINDVVVAGGMESMSNVHKYFAEARS  728
            Q+I+LG+NDVVVAGGMESMSN  KY    R+
Sbjct  121  QTIKLGVNDVVVAGGMESMSNAPKYIPTGRT  151



>gb|EMS66391.1| putative acetyl-CoA acetyltransferase, cytosolic 2 [Triticum 
urartu]
Length=523

 Score =   256 bits (653),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 139/161 (86%), Gaps = 12/161 (7%)
 Frame = +2

Query  1193  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIE------------SALKRGSV  1336
             ++ I  RDVC+VGVARTPMGGFLG+LSSL ATKLGS+AIE            +ALKR +V
Sbjct  96    SDNIGPRDVCVVGVARTPMGGFLGALSSLSATKLGSVAIEGEISIFSICPREAALKRANV  155

Query  1337  DPSLVEEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQ  1516
             DPSLV+EVFFGNVLSANLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKATM AAQSIQ
Sbjct  156   DPSLVQEVFFGNVLSANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMFAAQSIQ  215

Query  1517  LGINDVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             LG ND+VVAGGMESMSN PKY AEARKGSR GHDSLVDGML
Sbjct  216   LGSNDIVVAGGMESMSNAPKYIAEARKGSRFGHDSLVDGML  256


 Score =   220 bits (560),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 124/146 (85%), Gaps = 12/146 (8%)
 Frame = +3

Query  324  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIE------------SALKRASV  467
            ++ I  RDVC+VGVARTPMGGFLG+LSSL ATKLGS+AIE            +ALKRA+V
Sbjct  96   SDNIGPRDVCVVGVARTPMGGFLGALSSLSATKLGSVAIEGEISIFSICPREAALKRANV  155

Query  468  DPSLVEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQ  647
            DPSLV+EVFFGNVL ANLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKAT+ AAQSIQ
Sbjct  156  DPSLVQEVFFGNVLSANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMFAAQSIQ  215

Query  648  LGINDVVVAGGMESMSNVHKYFAEAR  725
            LG ND+VVAGGMESMSN  KY AEAR
Sbjct  216  LGSNDIVVAGGMESMSNAPKYIAEAR  241



>ref|XP_006600286.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X3 [Glycine max]
Length=423

 Score =   253 bits (645),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  1175  AMAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             A +P+ +  + +RDVCIVGVARTP+GG LG+LSSL AT+LGSIAI++ALKR +VDPSLV+
Sbjct  19    ARSPSMSTCVKSRDVCIVGVARTPIGGLLGTLSSLSATELGSIAIKTALKRANVDPSLVQ  78

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EVFFGNVLSANLGQAPARQAALGAGIP +V+C+T+NKVCASGMKATMLAA +IQ G+NDV
Sbjct  79    EVFFGNVLSANLGQAPARQAALGAGIPTSVICTTINKVCASGMKATMLAALTIQFGLNDV  138

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VVAGGMESMSN PKY AEARKGSR GHD+++DGM+
Sbjct  139   VVAGGMESMSNAPKYIAEARKGSRYGHDTIIDGMV  173


 Score =   220 bits (561),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 138/168 (82%), Gaps = 4/168 (2%)
 Frame = +3

Query  306  AMAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            A +P+ +  + +RDVCIVGVARTP+GG LG+LSSL AT+LGS+AI++ALKRA+VDPSLV+
Sbjct  19   ARSPSMSTCVKSRDVCIVGVARTPIGGLLGTLSSLSATELGSIAIKTALKRANVDPSLVQ  78

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EVFFGNVL ANLGQAPARQAALGAGIP +V+C+T+NKVCASGMKAT+LAA +IQ G+NDV
Sbjct  79   EVFFGNVLSANLGQAPARQAALGAGIPTSVICTTINKVCASGMKATMLAALTIQFGLNDV  138

Query  666  VVAGGMESMSNVHKYFAEARSISNNIW*ISTAVVSLISDKV--VQNSF  803
            VVAGGMESMSN  KY AEAR  S   +   T +  ++ D +  V N+F
Sbjct  139  VVAGGMESMSNAPKYIAEARKGSR--YGHDTIIDGMVKDGLWDVYNNF  184



>ref|XP_003565785.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like [Brachypodium 
distachyon]
Length=417

 Score =   253 bits (645),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 139/158 (88%), Gaps = 4/158 (3%)
 Frame = +2

Query  1178  MAPATA----ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPS  1345
             MAP +     E +N RDVC+VGVARTP+G  LGSLSSLPATKLGS+AI+ AL+R SVDP+
Sbjct  1     MAPPSTSGGHEGLNPRDVCVVGVARTPIGALLGSLSSLPATKLGSVAIQGALRRASVDPA  60

Query  1346  LVEEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGI  1525
             LV+EVF GNVLSANLGQAPARQAALGAG+PNTV C+T+NKVC+SGMKA MLAAQSIQLGI
Sbjct  61    LVQEVFMGNVLSANLGQAPARQAALGAGLPNTVPCTTINKVCSSGMKAIMLAAQSIQLGI  120

Query  1526  NDVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             NDVVVAGGMESMSN PKY AE+R+GSR GHD L+DGML
Sbjct  121   NDVVVAGGMESMSNAPKYLAESRRGSRFGHDVLIDGML  158


 Score =   221 bits (563),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 125/143 (87%), Gaps = 4/143 (3%)
 Frame = +3

Query  309  MAPATA----ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPS  476
            MAP +     E +N RDVC+VGVARTP+G  LGSLSSLPATKLGS+AI+ AL+RASVDP+
Sbjct  1    MAPPSTSGGHEGLNPRDVCVVGVARTPIGALLGSLSSLPATKLGSVAIQGALRRASVDPA  60

Query  477  LVEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGI  656
            LV+EVF GNVL ANLGQAPARQAALGAG+PNTV C+T+NKVC+SGMKA +LAAQSIQLGI
Sbjct  61   LVQEVFMGNVLSANLGQAPARQAALGAGLPNTVPCTTINKVCSSGMKAIMLAAQSIQLGI  120

Query  657  NDVVVAGGMESMSNVHKYFAEAR  725
            NDVVVAGGMESMSN  KY AE+R
Sbjct  121  NDVVVAGGMESMSNAPKYLAESR  143



>emb|CDP04540.1| unnamed protein product [Coffea canephora]
Length=415

 Score =   252 bits (644),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = +2

Query  1178  MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             MA AT + +I  RDVCIVGVARTPMGGFLGSLSSL ATKLGSIAI+SALKR +VDPSLV+
Sbjct  1     MAYATTDNSIQPRDVCIVGVARTPMGGFLGSLSSLSATKLGSIAIQSALKRANVDPSLVQ  60

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EVFFGNVL ANLGQAPARQAALGAG+P +V+C+T+NKVCASGMKATMLAA+SIQ G NDV
Sbjct  61    EVFFGNVLCANLGQAPARQAALGAGLPYSVICTTINKVCASGMKATMLAAESIQSGTNDV  120

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VVAGGMESMSN PKY  +AR GSR+GHD++VDGML
Sbjct  121   VVAGGMESMSNAPKYLPQARLGSRIGHDTIVDGML  155


 Score =   222 bits (565),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 126/140 (90%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            MA AT + +I  RDVCIVGVARTPMGGFLGSLSSL ATKLGS+AI+SALKRA+VDPSLV+
Sbjct  1    MAYATTDNSIQPRDVCIVGVARTPMGGFLGSLSSLSATKLGSIAIQSALKRANVDPSLVQ  60

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EVFFGNVL ANLGQAPARQAALGAG+P +V+C+T+NKVCASGMKAT+LAA+SIQ G NDV
Sbjct  61   EVFFGNVLCANLGQAPARQAALGAGLPYSVICTTINKVCASGMKATMLAAESIQSGTNDV  120

Query  666  VVAGGMESMSNVHKYFAEAR  725
            VVAGGMESMSN  KY  +AR
Sbjct  121  VVAGGMESMSNAPKYLPQAR  140



>ref|XP_011095903.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X2 [Sesamum indicum]
 ref|XP_011095904.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X2 [Sesamum indicum]
 ref|XP_011095905.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X2 [Sesamum indicum]
 ref|XP_011095906.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X2 [Sesamum indicum]
Length=417

 Score =   252 bits (644),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MA    ++I  RDVCIVGVARTPMG FLGSLSSLPATKLGSIAIE AL+R  V PS+V+E
Sbjct  1     MASVADDSIKDRDVCIVGVARTPMGSFLGSLSSLPATKLGSIAIECALRRAGVHPSMVQE  60

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVL+ANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKATM+AAQ+I+LG+NDVV
Sbjct  61    VFFGNVLTANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMIAAQTIKLGVNDVV  120

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSN PKY    R G+RLGHD+++DGML
Sbjct  121   VAGGMESMSNAPKYIPTGRTGTRLGHDTIIDGML  154


 Score =   221 bits (564),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MA    ++I  RDVCIVGVARTPMG FLGSLSSLPATKLGS+AIE AL+RA V PS+V+E
Sbjct  1    MASVADDSIKDRDVCIVGVARTPMGSFLGSLSSLPATKLGSIAIECALRRAGVHPSMVQE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPN+V+C+T+NKVCASGMKAT++AAQ+I+LG+NDVV
Sbjct  61   VFFGNVLTANLGQAPARQAALGAGIPNSVICTTINKVCASGMKATMIAAQTIKLGVNDVV  120

Query  669  VAGGMESMSNVHKYFAEARS  728
            VAGGMESMSN  KY    R+
Sbjct  121  VAGGMESMSNAPKYIPTGRT  140



>ref|XP_006600285.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Glycine max]
Length=432

 Score =   253 bits (645),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  1175  AMAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             A +P+ +  + +RDVCIVGVARTP+GG LG+LSSL AT+LGSIAI++ALKR +VDPSLV+
Sbjct  19    ARSPSMSTCVKSRDVCIVGVARTPIGGLLGTLSSLSATELGSIAIKTALKRANVDPSLVQ  78

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EVFFGNVLSANLGQAPARQAALGAGIP +V+C+T+NKVCASGMKATMLAA +IQ G+NDV
Sbjct  79    EVFFGNVLSANLGQAPARQAALGAGIPTSVICTTINKVCASGMKATMLAALTIQFGLNDV  138

Query  1535  VVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VVAGGMESMSN PKY AEARKGSR GHD+++DGM+
Sbjct  139   VVAGGMESMSNAPKYIAEARKGSRYGHDTIIDGMV  173


 Score =   220 bits (561),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 138/168 (82%), Gaps = 4/168 (2%)
 Frame = +3

Query  306  AMAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            A +P+ +  + +RDVCIVGVARTP+GG LG+LSSL AT+LGS+AI++ALKRA+VDPSLV+
Sbjct  19   ARSPSMSTCVKSRDVCIVGVARTPIGGLLGTLSSLSATELGSIAIKTALKRANVDPSLVQ  78

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EVFFGNVL ANLGQAPARQAALGAGIP +V+C+T+NKVCASGMKAT+LAA +IQ G+NDV
Sbjct  79   EVFFGNVLSANLGQAPARQAALGAGIPTSVICTTINKVCASGMKATMLAALTIQFGLNDV  138

Query  666  VVAGGMESMSNVHKYFAEARSISNNIW*ISTAVVSLISDKV--VQNSF  803
            VVAGGMESMSN  KY AEAR  S   +   T +  ++ D +  V N+F
Sbjct  139  VVAGGMESMSNAPKYIAEARKGSR--YGHDTIIDGMVKDGLWDVYNNF  184



>gb|AEZ55671.1| acetyl-CoA C-acetyltransferase 2 [Salvia miltiorrhiza]
Length=403

 Score =   251 bits (641),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +2

Query  1214  DVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLG  1393
             DVCIVGVARTP+GGFLGSLSSLPATKLGSIAI  ALKR  VDPSLV+EVFFGNVLSANLG
Sbjct  9     DVCIVGVARTPIGGFLGSLSSLPATKLGSIAIACALKRAGVDPSLVQEVFFGNVLSANLG  68

Query  1394  QAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNVP  1573
             QAPARQAALGAGIPN+VVC+T+NKVCASGMKATMLAAQ+I+LG+NDVVVAGGMESMSN P
Sbjct  69    QAPARQAALGAGIPNSVVCTTINKVCASGMKATMLAAQTIKLGVNDVVVAGGMESMSNAP  128

Query  1574  KYFAEARKGSRLGHDSLVDGML  1639
             KY    R GSRLGHD++VDGML
Sbjct  129   KYITTGRIGSRLGHDTIVDGML  150


 Score =   218 bits (555),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +3

Query  345  DVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGANLG  524
            DVCIVGVARTP+GGFLGSLSSLPATKLGS+AI  ALKRA VDPSLV+EVFFGNVL ANLG
Sbjct  9    DVCIVGVARTPIGGFLGSLSSLPATKLGSIAIACALKRAGVDPSLVQEVFFGNVLSANLG  68

Query  525  QAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNVH  704
            QAPARQAALGAGIPN+VVC+T+NKVCASGMKAT+LAAQ+I+LG+NDVVVAGGMESMSN  
Sbjct  69   QAPARQAALGAGIPNSVVCTTINKVCASGMKATMLAAQTIKLGVNDVVVAGGMESMSNAP  128

Query  705  KYFAEAR  725
            KY    R
Sbjct  129  KYITTGR  135



>ref|XP_004236650.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
[Solanum lycopersicum]
Length=414

 Score =   251 bits (640),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MA    ++I  +DVCIVGVARTPMGGFLGSLSSL AT+LGS AI +ALKR +VDPSLV+E
Sbjct  1     MAKMVQDSIKPQDVCIVGVARTPMGGFLGSLSSLSATELGSAAIRAALKRANVDPSLVQE  60

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIP +V+C+T+NKVC+SG+KATM+AAQ+IQ G ND+V
Sbjct  61    VFFGNVLSANLGQAPARQAALGAGIPYSVICTTINKVCSSGLKATMIAAQTIQSGANDIV  120

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             V GGMESMSNVPKY A+ARKGSRLGHD++VDGML
Sbjct  121   VTGGMESMSNVPKYLAQARKGSRLGHDTVVDGML  154


 Score =   216 bits (550),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MA    ++I  +DVCIVGVARTPMGGFLGSLSSL AT+LGS AI +ALKRA+VDPSLV+E
Sbjct  1    MAKMVQDSIKPQDVCIVGVARTPMGGFLGSLSSLSATELGSAAIRAALKRANVDPSLVQE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIP +V+C+T+NKVC+SG+KAT++AAQ+IQ G ND+V
Sbjct  61   VFFGNVLSANLGQAPARQAALGAGIPYSVICTTINKVCSSGLKATMIAAQTIQSGANDIV  120

Query  669  VAGGMESMSNVHKYFAEAR  725
            V GGMESMSNV KY A+AR
Sbjct  121  VTGGMESMSNVPKYLAQAR  139



>ref|XP_004967970.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X1 [Setaria italica]
Length=421

 Score =   250 bits (639),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +2

Query  1202  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  1381
             + ARDVCIVGVARTP+G  LGSLSSLPATKLGSIAI+ AL+R +VDP+LV+EVF GNVLS
Sbjct  17    LKARDVCIVGVARTPIGALLGSLSSLPATKLGSIAIQGALRRANVDPALVQEVFMGNVLS  76

Query  1382  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESM  1561
             ANLGQAPARQAALGAG+PNTV C+TVNKVC+SGMKA M AAQSIQLGINDVVVAGGMESM
Sbjct  77    ANLGQAPARQAALGAGLPNTVPCTTVNKVCSSGMKAVMFAAQSIQLGINDVVVAGGMESM  136

Query  1562  SNVPKYFAEARKGSRLGHDSLVDGML  1639
             SN PKY AEAR+GSR GHD LVDGML
Sbjct  137   SNAPKYVAEARRGSRFGHDVLVDGML  162


 Score =   218 bits (554),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +3

Query  333  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLG  512
            + ARDVCIVGVARTP+G  LGSLSSLPATKLGS+AI+ AL+RA+VDP+LV+EVF GNVL 
Sbjct  17   LKARDVCIVGVARTPIGALLGSLSSLPATKLGSIAIQGALRRANVDPALVQEVFMGNVLS  76

Query  513  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESM  692
            ANLGQAPARQAALGAG+PNTV C+TVNKVC+SGMKA + AAQSIQLGINDVVVAGGMESM
Sbjct  77   ANLGQAPARQAALGAGLPNTVPCTTVNKVCSSGMKAVMFAAQSIQLGINDVVVAGGMESM  136

Query  693  SNVHKYFAEAR  725
            SN  KY AEAR
Sbjct  137  SNAPKYVAEAR  147



>ref|NP_851150.1| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
 ref|NP_974900.1| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
 gb|AED95558.1| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
 gb|AED95561.1| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=405

 Score =   250 bits (638),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = +2

Query  1184  PATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVF  1363
             P + +++  RDVC+VGVARTP+G FLGSLSSL AT+LGSIAI++ALKR  VDP+LVEEVF
Sbjct  4     PVSDDSLQPRDVCVVGVARTPIGDFLGSLSSLTATRLGSIAIQAALKRAHVDPALVEEVF  63

Query  1364  FGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVA  1543
             FGNVL+ANLGQAPARQAALGAGIP +V+C+T+NKVCA+GMK+ MLA+QSIQLG+ND+VVA
Sbjct  64    FGNVLTANLGQAPARQAALGAGIPYSVICTTINKVCAAGMKSVMLASQSIQLGLNDIVVA  123

Query  1544  GGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             GGMESMSNVPKY  +AR+GSRLGHD++VDGM+
Sbjct  124   GGMESMSNVPKYLPDARRGSRLGHDTVVDGMM  155


 Score =   217 bits (553),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  315  PATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVF  494
            P + +++  RDVC+VGVARTP+G FLGSLSSL AT+LGS+AI++ALKRA VDP+LVEEVF
Sbjct  4    PVSDDSLQPRDVCVVGVARTPIGDFLGSLSSLTATRLGSIAIQAALKRAHVDPALVEEVF  63

Query  495  FGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVA  674
            FGNVL ANLGQAPARQAALGAGIP +V+C+T+NKVCA+GMK+ +LA+QSIQLG+ND+VVA
Sbjct  64   FGNVLTANLGQAPARQAALGAGIPYSVICTTINKVCAAGMKSVMLASQSIQLGLNDIVVA  123

Query  675  GGMESMSNVHKYFAEAR  725
            GGMESMSNV KY  +AR
Sbjct  124  GGMESMSNVPKYLPDAR  140



>ref|XP_004967971.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Setaria italica]
Length=413

 Score =   250 bits (638),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 122/146 (84%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +2

Query  1202  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  1381
             + ARDVCIVGVARTP+G  LGSLSSLPATKLGSIAI+ AL+R +VDP+LV+EVF GNVLS
Sbjct  17    LKARDVCIVGVARTPIGALLGSLSSLPATKLGSIAIQGALRRANVDPALVQEVFMGNVLS  76

Query  1382  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESM  1561
             ANLGQAPARQAALGAG+PNTV C+TVNKVC+SGMKA M AAQSIQLGINDVVVAGGMESM
Sbjct  77    ANLGQAPARQAALGAGLPNTVPCTTVNKVCSSGMKAVMFAAQSIQLGINDVVVAGGMESM  136

Query  1562  SNVPKYFAEARKGSRLGHDSLVDGML  1639
             SN PKY AEAR+GSR GHD LVDGML
Sbjct  137   SNAPKYVAEARRGSRFGHDVLVDGML  162


 Score =   217 bits (553),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/131 (82%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +3

Query  333  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLG  512
            + ARDVCIVGVARTP+G  LGSLSSLPATKLGS+AI+ AL+RA+VDP+LV+EVF GNVL 
Sbjct  17   LKARDVCIVGVARTPIGALLGSLSSLPATKLGSIAIQGALRRANVDPALVQEVFMGNVLS  76

Query  513  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESM  692
            ANLGQAPARQAALGAG+PNTV C+TVNKVC+SGMKA + AAQSIQLGINDVVVAGGMESM
Sbjct  77   ANLGQAPARQAALGAGLPNTVPCTTVNKVCSSGMKAVMFAAQSIQLGINDVVVAGGMESM  136

Query  693  SNVHKYFAEAR  725
            SN  KY AEAR
Sbjct  137  SNAPKYVAEAR  147



>ref|NP_199583.1| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
 ref|NP_974901.2| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
 sp|Q9FIK7.1|THIC2_ARATH RecName: Full=Probable acetyl-CoA acetyltransferase, cytosolic 
2; AltName: Full=Cytosolic acetoacetyl-CoA thiolase 2; Short=Thiolase 
2 [Arabidopsis thaliana]
 dbj|BAB11319.1| acetoacyl-CoA-thiolase [Arabidopsis thaliana]
 gb|AAM67058.1| acetoacyl-CoA-thiolase [Arabidopsis thaliana]
 gb|ABM06028.1| At5g47720 [Arabidopsis thaliana]
 dbj|BAH19561.1| AT5G47720 [Arabidopsis thaliana]
 gb|AED95559.1| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
 gb|AED95560.1| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=415

 Score =   250 bits (638),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = +2

Query  1184  PATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVF  1363
             P + +++  RDVC+VGVARTP+G FLGSLSSL AT+LGSIAI++ALKR  VDP+LVEEVF
Sbjct  4     PVSDDSLQPRDVCVVGVARTPIGDFLGSLSSLTATRLGSIAIQAALKRAHVDPALVEEVF  63

Query  1364  FGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVA  1543
             FGNVL+ANLGQAPARQAALGAGIP +V+C+T+NKVCA+GMK+ MLA+QSIQLG+ND+VVA
Sbjct  64    FGNVLTANLGQAPARQAALGAGIPYSVICTTINKVCAAGMKSVMLASQSIQLGLNDIVVA  123

Query  1544  GGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             GGMESMSNVPKY  +AR+GSRLGHD++VDGM+
Sbjct  124   GGMESMSNVPKYLPDARRGSRLGHDTVVDGMM  155


 Score =   217 bits (553),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  315  PATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVF  494
            P + +++  RDVC+VGVARTP+G FLGSLSSL AT+LGS+AI++ALKRA VDP+LVEEVF
Sbjct  4    PVSDDSLQPRDVCVVGVARTPIGDFLGSLSSLTATRLGSIAIQAALKRAHVDPALVEEVF  63

Query  495  FGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVA  674
            FGNVL ANLGQAPARQAALGAGIP +V+C+T+NKVCA+GMK+ +LA+QSIQLG+ND+VVA
Sbjct  64   FGNVLTANLGQAPARQAALGAGIPYSVICTTINKVCAAGMKSVMLASQSIQLGLNDIVVA  123

Query  675  GGMESMSNVHKYFAEAR  725
            GGMESMSNV KY  +AR
Sbjct  124  GGMESMSNVPKYLPDAR  140



>ref|NP_001141874.1| acetyl-CoA acetyltransferase, cytosolic 2 isoform 1 [Zea mays]
 ref|XP_008654617.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 2 isoform 
1 isoform X1 [Zea mays]
 gb|ACF87213.1| unknown [Zea mays]
 gb|ACG39847.1| acetyl-CoA acetyltransferase, cytosolic 2 [Zea mays]
 gb|ACR34643.1| unknown [Zea mays]
 gb|AFW79796.1| acetyl-CoA acetyltransferase, cytosolic 2 isoform 1 [Zea mays]
 gb|AFW79797.1| acetyl-CoA acetyltransferase, cytosolic 2 isoform 2 [Zea mays]
Length=421

 Score =   249 bits (636),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = +2

Query  1193  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  1372
             ++ + ARD CIVGVARTP+G  LGSLSSLPATKLGSIAI+ ALKR  VDP+LV+EVF GN
Sbjct  14    SQGLKARDACIVGVARTPIGALLGSLSSLPATKLGSIAIQGALKRAKVDPALVQEVFMGN  73

Query  1373  VLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGM  1552
             VLSANLGQAPARQAALGAG+PN+V C+TVNKVC+SGMKA M AAQSIQLGINDVVVAGGM
Sbjct  74    VLSANLGQAPARQAALGAGLPNSVPCTTVNKVCSSGMKAVMFAAQSIQLGINDVVVAGGM  133

Query  1553  ESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             ESMSN PKY AEAR+GSR GHD LVDGML
Sbjct  134   ESMSNAPKYVAEARRGSRFGHDVLVDGML  162


 Score =   216 bits (550),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +3

Query  324  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGN  503
            ++ + ARD CIVGVARTP+G  LGSLSSLPATKLGS+AI+ ALKRA VDP+LV+EVF GN
Sbjct  14   SQGLKARDACIVGVARTPIGALLGSLSSLPATKLGSIAIQGALKRAKVDPALVQEVFMGN  73

Query  504  VLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGM  683
            VL ANLGQAPARQAALGAG+PN+V C+TVNKVC+SGMKA + AAQSIQLGINDVVVAGGM
Sbjct  74   VLSANLGQAPARQAALGAGLPNSVPCTTVNKVCSSGMKAVMFAAQSIQLGINDVVVAGGM  133

Query  684  ESMSNVHKYFAEAR  725
            ESMSN  KY AEAR
Sbjct  134  ESMSNAPKYVAEAR  147



>ref|XP_003551110.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X1 [Glycine max]
Length=409

 Score =   249 bits (635),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +2

Query  1202  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  1381
             + +RDVCIVGVARTP+GG LG+LSSL AT+LGSIAI++ALKR +VDPSLV+EVFFGNVLS
Sbjct  5     VKSRDVCIVGVARTPIGGLLGTLSSLSATELGSIAIKTALKRANVDPSLVQEVFFGNVLS  64

Query  1382  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESM  1561
             ANLGQAPARQAALGAGIP +V+C+T+NKVCASGMKATMLAA +IQ G+NDVVVAGGMESM
Sbjct  65    ANLGQAPARQAALGAGIPTSVICTTINKVCASGMKATMLAALTIQFGLNDVVVAGGMESM  124

Query  1562  SNVPKYFAEARKGSRLGHDSLVDGML  1639
             SN PKY AEARKGSR GHD+++DGM+
Sbjct  125   SNAPKYIAEARKGSRYGHDTIIDGMV  150


 Score =   216 bits (551),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 133/159 (84%), Gaps = 4/159 (3%)
 Frame = +3

Query  333  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLG  512
            + +RDVCIVGVARTP+GG LG+LSSL AT+LGS+AI++ALKRA+VDPSLV+EVFFGNVL 
Sbjct  5    VKSRDVCIVGVARTPIGGLLGTLSSLSATELGSIAIKTALKRANVDPSLVQEVFFGNVLS  64

Query  513  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESM  692
            ANLGQAPARQAALGAGIP +V+C+T+NKVCASGMKAT+LAA +IQ G+NDVVVAGGMESM
Sbjct  65   ANLGQAPARQAALGAGIPTSVICTTINKVCASGMKATMLAALTIQFGLNDVVVAGGMESM  124

Query  693  SNVHKYFAEARSISNNIW*ISTAVVSLISDKV--VQNSF  803
            SN  KY AEAR  S   +   T +  ++ D +  V N+F
Sbjct  125  SNAPKYIAEARKGSR--YGHDTIIDGMVKDGLWDVYNNF  161



>gb|KEH32695.1| peroxisomal acetoacetyl-coenzyme A thiolase [Medicago truncatula]
Length=415

 Score =   248 bits (634),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  1214  DVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLG  1393
             DVCIVGV RTPMGGFLGSLSSL AT LGS+AI++ALKR +VDPSLV+EVFFGNVLSANLG
Sbjct  14    DVCIVGVGRTPMGGFLGSLSSLSATHLGSLAIKAALKRANVDPSLVQEVFFGNVLSANLG  73

Query  1394  QAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNVP  1573
             QAPARQAALGAGIP +V+C+T+NKVC+SGMKATMLAAQ+IQLG NDVVV GGMESMSN P
Sbjct  74    QAPARQAALGAGIPTSVICTTINKVCSSGMKATMLAAQTIQLGSNDVVVVGGMESMSNAP  133

Query  1574  KYFAEARKGSRLGHDSLVDGML  1639
             KY AEARKGSRLGHD+++DGML
Sbjct  134   KYIAEARKGSRLGHDTIIDGML  155


 Score =   215 bits (547),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +3

Query  345  DVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGANLG  524
            DVCIVGV RTPMGGFLGSLSSL AT LGSLAI++ALKRA+VDPSLV+EVFFGNVL ANLG
Sbjct  14   DVCIVGVGRTPMGGFLGSLSSLSATHLGSLAIKAALKRANVDPSLVQEVFFGNVLSANLG  73

Query  525  QAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNVH  704
            QAPARQAALGAGIP +V+C+T+NKVC+SGMKAT+LAAQ+IQLG NDVVV GGMESMSN  
Sbjct  74   QAPARQAALGAGIPTSVICTTINKVCSSGMKATMLAAQTIQLGSNDVVVVGGMESMSNAP  133

Query  705  KYFAEAR  725
            KY AEAR
Sbjct  134  KYIAEAR  140



>ref|XP_003529679.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X1 [Glycine max]
Length=400

 Score =   248 bits (632),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +2

Query  1205  NARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSA  1384
              +RDVCIVGVARTP+GG LG+LSSL AT+LGSIAI+SAL+R +VDPSLV+EVFFGNVLSA
Sbjct  6     KSRDVCIVGVARTPIGGLLGTLSSLSATELGSIAIKSALERANVDPSLVQEVFFGNVLSA  65

Query  1385  NLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMS  1564
             NLGQAPARQAALGAGIP +V+C+T+NKVCASGMKATMLAA +IQ G+NDVVVAGGMESMS
Sbjct  66    NLGQAPARQAALGAGIPTSVICTTINKVCASGMKATMLAALTIQFGLNDVVVAGGMESMS  125

Query  1565  NVPKYFAEARKGSRLGHDSLVDGML  1639
             N PKY AEARKGSR GHD+++DGM+
Sbjct  126   NAPKYLAEARKGSRYGHDTIIDGMV  150


 Score =   215 bits (548),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 132/158 (84%), Gaps = 4/158 (3%)
 Frame = +3

Query  336  NARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGA  515
             +RDVCIVGVARTP+GG LG+LSSL AT+LGS+AI+SAL+RA+VDPSLV+EVFFGNVL A
Sbjct  6    KSRDVCIVGVARTPIGGLLGTLSSLSATELGSIAIKSALERANVDPSLVQEVFFGNVLSA  65

Query  516  NLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMS  695
            NLGQAPARQAALGAGIP +V+C+T+NKVCASGMKAT+LAA +IQ G+NDVVVAGGMESMS
Sbjct  66   NLGQAPARQAALGAGIPTSVICTTINKVCASGMKATMLAALTIQFGLNDVVVAGGMESMS  125

Query  696  NVHKYFAEARSISNNIW*ISTAVVSLISDKV--VQNSF  803
            N  KY AEAR  S   +   T +  ++ D +  V N+F
Sbjct  126  NAPKYLAEARKGSR--YGHDTIIDGMVKDGLWDVYNNF  161



>ref|XP_006584106.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Glycine max]
Length=409

 Score =   248 bits (633),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +2

Query  1205  NARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSA  1384
              +RDVCIVGVARTP+GG LG+LSSL AT+LGSIAI+SAL+R +VDPSLV+EVFFGNVLSA
Sbjct  6     KSRDVCIVGVARTPIGGLLGTLSSLSATELGSIAIKSALERANVDPSLVQEVFFGNVLSA  65

Query  1385  NLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMS  1564
             NLGQAPARQAALGAGIP +V+C+T+NKVCASGMKATMLAA +IQ G+NDVVVAGGMESMS
Sbjct  66    NLGQAPARQAALGAGIPTSVICTTINKVCASGMKATMLAALTIQFGLNDVVVAGGMESMS  125

Query  1565  NVPKYFAEARKGSRLGHDSLVDGML  1639
             N PKY AEARKGSR GHD+++DGM+
Sbjct  126   NAPKYLAEARKGSRYGHDTIIDGMV  150


 Score =   215 bits (548),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 132/158 (84%), Gaps = 4/158 (3%)
 Frame = +3

Query  336  NARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGA  515
             +RDVCIVGVARTP+GG LG+LSSL AT+LGS+AI+SAL+RA+VDPSLV+EVFFGNVL A
Sbjct  6    KSRDVCIVGVARTPIGGLLGTLSSLSATELGSIAIKSALERANVDPSLVQEVFFGNVLSA  65

Query  516  NLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMS  695
            NLGQAPARQAALGAGIP +V+C+T+NKVCASGMKAT+LAA +IQ G+NDVVVAGGMESMS
Sbjct  66   NLGQAPARQAALGAGIPTSVICTTINKVCASGMKATMLAALTIQFGLNDVVVAGGMESMS  125

Query  696  NVHKYFAEARSISNNIW*ISTAVVSLISDKV--VQNSF  803
            N  KY AEAR  S   +   T +  ++ D +  V N+F
Sbjct  126  NAPKYLAEARKGSR--YGHDTIIDGMVKDGLWDVYNNF  161



>emb|CAA55006.1| Acetoacetyl-coenzyme A thiolase [Raphanus sativus]
Length=406

 Score =   247 bits (631),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MA +   + N RDVCIVGVARTPMGGFLGSLSSLPATKLGS+AI +ALKR  +     +E
Sbjct  1     MAHSADSSDNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSLAITAALKREMLTRLWSKE  60

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             V FGNVLSANLGQAPARQAALGAGI N+V+C+TVNKVCASGMKA M+AAQSIQLGINDVV
Sbjct  61    VVFGNVLSANLGQAPARQAALGAGISNSVICTTVNKVCASGMKAVMIAAQSIQLGINDVV  120

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSN PKY AEARKGSR GHDSLVDGML
Sbjct  121   VAGGMESMSNTPKYLAEARKGSRFGHDSLVDGML  154


 Score =   211 bits (538),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MA +   + N RDVCIVGVARTPMGGFLGSLSSLPATKLGSLAI +ALKR  +     +E
Sbjct  1    MAHSADSSDNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSLAITAALKREMLTRLWSKE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            V FGNVL ANLGQAPARQAALGAGI N+V+C+TVNKVCASGMKA ++AAQSIQLGINDVV
Sbjct  61   VVFGNVLSANLGQAPARQAALGAGISNSVICTTVNKVCASGMKAVMIAAQSIQLGINDVV  120

Query  669  VAGGMESMSNVHKYFAEAR  725
            VAGGMESMSN  KY AEAR
Sbjct  121  VAGGMESMSNTPKYLAEAR  139



>ref|XP_008654615.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 2 isoform 
1 isoform X2 [Zea mays]
Length=467

 Score =   249 bits (636),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = +2

Query  1193  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  1372
             ++ + ARD CIVGVARTP+G  LGSLSSLPATKLGSIAI+ ALKR  VDP+LV+EVF GN
Sbjct  14    SQGLKARDACIVGVARTPIGALLGSLSSLPATKLGSIAIQGALKRAKVDPALVQEVFMGN  73

Query  1373  VLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGM  1552
             VLSANLGQAPARQAALGAG+PN+V C+TVNKVC+SGMKA M AAQSIQLGINDVVVAGGM
Sbjct  74    VLSANLGQAPARQAALGAGLPNSVPCTTVNKVCSSGMKAVMFAAQSIQLGINDVVVAGGM  133

Query  1553  ESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             ESMSN PKY AEAR+GSR GHD LVDGML
Sbjct  134   ESMSNAPKYVAEARRGSRFGHDVLVDGML  162


 Score =   216 bits (550),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +3

Query  324  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGN  503
            ++ + ARD CIVGVARTP+G  LGSLSSLPATKLGS+AI+ ALKRA VDP+LV+EVF GN
Sbjct  14   SQGLKARDACIVGVARTPIGALLGSLSSLPATKLGSIAIQGALKRAKVDPALVQEVFMGN  73

Query  504  VLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGM  683
            VL ANLGQAPARQAALGAG+PN+V C+TVNKVC+SGMKA + AAQSIQLGINDVVVAGGM
Sbjct  74   VLSANLGQAPARQAALGAGLPNSVPCTTVNKVCSSGMKAVMFAAQSIQLGINDVVVAGGM  133

Query  684  ESMSNVHKYFAEAR  725
            ESMSN  KY AEAR
Sbjct  134  ESMSNAPKYVAEAR  147



>gb|KHN42262.1| Putative acetyl-CoA acetyltransferase, cytosolic 2 [Glycine soja]
Length=419

 Score =   248 bits (632),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 117/145 (81%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = +2

Query  1205  NARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSA  1384
              +RDVCIVGVARTP+GG LG+LSSL AT+LGSIAI+SAL+R +VDPSLV+EVFFGNVLSA
Sbjct  6     KSRDVCIVGVARTPIGGLLGTLSSLSATELGSIAIKSALERANVDPSLVQEVFFGNVLSA  65

Query  1385  NLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMS  1564
             NLGQAPARQAALGAGIP +V+C+T+NKVCASGMKATMLAA +IQ G+NDVVVAGGMESMS
Sbjct  66    NLGQAPARQAALGAGIPTSVICTTINKVCASGMKATMLAALTIQFGLNDVVVAGGMESMS  125

Query  1565  NVPKYFAEARKGSRLGHDSLVDGML  1639
             N PKY AEARKGSR GHD+++DGM+
Sbjct  126   NAPKYLAEARKGSRYGHDTIIDGMV  150


 Score =   215 bits (547),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 132/158 (84%), Gaps = 4/158 (3%)
 Frame = +3

Query  336  NARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGA  515
             +RDVCIVGVARTP+GG LG+LSSL AT+LGS+AI+SAL+RA+VDPSLV+EVFFGNVL A
Sbjct  6    KSRDVCIVGVARTPIGGLLGTLSSLSATELGSIAIKSALERANVDPSLVQEVFFGNVLSA  65

Query  516  NLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMS  695
            NLGQAPARQAALGAGIP +V+C+T+NKVCASGMKAT+LAA +IQ G+NDVVVAGGMESMS
Sbjct  66   NLGQAPARQAALGAGIPTSVICTTINKVCASGMKATMLAALTIQFGLNDVVVAGGMESMS  125

Query  696  NVHKYFAEARSISNNIW*ISTAVVSLISDKV--VQNSF  803
            N  KY AEAR  S   +   T +  ++ D +  V N+F
Sbjct  126  NAPKYLAEARKGSR--YGHDTIIDGMVKDGLWDVYNNF  161



>ref|XP_008654616.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 2 isoform 
1 isoform X3 [Zea mays]
Length=451

 Score =   248 bits (634),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = +2

Query  1193  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGN  1372
             ++ + ARD CIVGVARTP+G  LGSLSSLPATKLGSIAI+ ALKR  VDP+LV+EVF GN
Sbjct  14    SQGLKARDACIVGVARTPIGALLGSLSSLPATKLGSIAIQGALKRAKVDPALVQEVFMGN  73

Query  1373  VLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGM  1552
             VLSANLGQAPARQAALGAG+PN+V C+TVNKVC+SGMKA M AAQSIQLGINDVVVAGGM
Sbjct  74    VLSANLGQAPARQAALGAGLPNSVPCTTVNKVCSSGMKAVMFAAQSIQLGINDVVVAGGM  133

Query  1553  ESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             ESMSN PKY AEAR+GSR GHD LVDGML
Sbjct  134   ESMSNAPKYVAEARRGSRFGHDVLVDGML  162


 Score =   215 bits (548),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +3

Query  324  AETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGN  503
            ++ + ARD CIVGVARTP+G  LGSLSSLPATKLGS+AI+ ALKRA VDP+LV+EVF GN
Sbjct  14   SQGLKARDACIVGVARTPIGALLGSLSSLPATKLGSIAIQGALKRAKVDPALVQEVFMGN  73

Query  504  VLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGM  683
            VL ANLGQAPARQAALGAG+PN+V C+TVNKVC+SGMKA + AAQSIQLGINDVVVAGGM
Sbjct  74   VLSANLGQAPARQAALGAGLPNSVPCTTVNKVCSSGMKAVMFAAQSIQLGINDVVVAGGM  133

Query  684  ESMSNVHKYFAEAR  725
            ESMSN  KY AEAR
Sbjct  134  ESMSNAPKYVAEAR  147



>emb|CDY25950.1| BnaC09g20370D [Brassica napus]
Length=415

 Score =   246 bits (627),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = +2

Query  1196  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  1375
             +++  +DVC+VGVARTPMG FLGSLSS+ A +LGSIAIE+ALKR +V+P+LVEEVFFGNV
Sbjct  8     QSVQPQDVCVVGVARTPMGDFLGSLSSITAPRLGSIAIEAALKRANVEPALVEEVFFGNV  67

Query  1376  LSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGME  1555
             L+ANLGQAPARQAALGAGIP +V+C+TVNKVCA+GMKA MLAAQSIQLG+NDVVVAGGME
Sbjct  68    LTANLGQAPARQAALGAGIPYSVICTTVNKVCAAGMKAVMLAAQSIQLGLNDVVVAGGME  127

Query  1556  SMSNVPKYFAEARKGSRLGHDSLVDGM  1636
             SMSNVPKY   AR+GSRLGHD++VDGM
Sbjct  128   SMSNVPKYLPNARRGSRLGHDTVVDGM  154


 Score =   213 bits (543),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +3

Query  327  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNV  506
            +++  +DVC+VGVARTPMG FLGSLSS+ A +LGS+AIE+ALKRA+V+P+LVEEVFFGNV
Sbjct  8    QSVQPQDVCVVGVARTPMGDFLGSLSSITAPRLGSIAIEAALKRANVEPALVEEVFFGNV  67

Query  507  LGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGME  686
            L ANLGQAPARQAALGAGIP +V+C+TVNKVCA+GMKA +LAAQSIQLG+NDVVVAGGME
Sbjct  68   LTANLGQAPARQAALGAGIPYSVICTTVNKVCAAGMKAVMLAAQSIQLGLNDVVVAGGME  127

Query  687  SMSNVHKYFAEAR  725
            SMSNV KY   AR
Sbjct  128  SMSNVPKYLPNAR  140



>emb|CDM80037.1| unnamed protein product [Triticum aestivum]
 emb|CDM80063.1| unnamed protein product [Triticum aestivum]
Length=418

 Score =   246 bits (627),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +2

Query  1202  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  1381
             ++ RDVC+VGVARTP+G  LGSLSSLPAT+LGS+AI+ AL+R SVDP+LV+EVF GNVLS
Sbjct  14    LDPRDVCVVGVARTPIGALLGSLSSLPATRLGSVAIQGALRRASVDPALVQEVFMGNVLS  73

Query  1382  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESM  1561
             ANLGQAPARQAALGAG+PNTV C+T+NKVC+SGMKA MLAAQSIQLGINDVVVAGGMESM
Sbjct  74    ANLGQAPARQAALGAGLPNTVPCTTINKVCSSGMKAVMLAAQSIQLGINDVVVAGGMESM  133

Query  1562  SNVPKYFAEARKGSRLGHDSLVDGML  1639
             SN PKY A AR+GSR GHD L+DGML
Sbjct  134   SNAPKYAATARRGSRFGHDVLIDGML  159


 Score =   213 bits (543),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +3

Query  333  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLG  512
            ++ RDVC+VGVARTP+G  LGSLSSLPAT+LGS+AI+ AL+RASVDP+LV+EVF GNVL 
Sbjct  14   LDPRDVCVVGVARTPIGALLGSLSSLPATRLGSVAIQGALRRASVDPALVQEVFMGNVLS  73

Query  513  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESM  692
            ANLGQAPARQAALGAG+PNTV C+T+NKVC+SGMKA +LAAQSIQLGINDVVVAGGMESM
Sbjct  74   ANLGQAPARQAALGAGLPNTVPCTTINKVCSSGMKAVMLAAQSIQLGINDVVVAGGMESM  133

Query  693  SNVHKYFAEAR  725
            SN  KY A AR
Sbjct  134  SNAPKYAATAR  144



>gb|KHN03551.1| Putative acetyl-CoA acetyltransferase, cytosolic 2 [Glycine soja]
Length=422

 Score =   245 bits (625),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  1214  DVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLG  1393
             DVCIVGVARTP+GG LG+LSSL AT+LGSIAI++ALKR +VDPSLV+EVFFGNVLSANLG
Sbjct  22    DVCIVGVARTPIGGLLGTLSSLSATELGSIAIKTALKRANVDPSLVQEVFFGNVLSANLG  81

Query  1394  QAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNVP  1573
             QAPARQAALGAGIP +V+C+T+NKVCASGMKATMLAA +IQ G+NDVVVAGGMESMSN P
Sbjct  82    QAPARQAALGAGIPTSVICTTINKVCASGMKATMLAALTIQFGLNDVVVAGGMESMSNAP  141

Query  1574  KYFAEARKGSRLGHDSLVDGML  1639
             KY AEARKGSR GHD+++DGM+
Sbjct  142   KYIAEARKGSRYGHDTIIDGMV  163


 Score =   212 bits (540),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +3

Query  345  DVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGANLG  524
            DVCIVGVARTP+GG LG+LSSL AT+LGS+AI++ALKRA+VDPSLV+EVFFGNVL ANLG
Sbjct  22   DVCIVGVARTPIGGLLGTLSSLSATELGSIAIKTALKRANVDPSLVQEVFFGNVLSANLG  81

Query  525  QAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNVH  704
            QAPARQAALGAGIP +V+C+T+NKVCASGMKAT+LAA +IQ G+NDVVVAGGMESMSN  
Sbjct  82   QAPARQAALGAGIPTSVICTTINKVCASGMKATMLAALTIQFGLNDVVVAGGMESMSNAP  141

Query  705  KYFAEAR  725
            KY AEAR
Sbjct  142  KYIAEAR  148



>ref|NP_001032028.1| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
 gb|AED95562.1| acetoacetyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=412

 Score =   244 bits (622),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 141/160 (88%), Gaps = 4/160 (3%)
 Frame = +2

Query  1172  LAMAPATAETINA----RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVD  1339
             L+  PA   T ++     DVC+VGVARTP+G FLGSLSSL AT+LGSIAI++ALKR  VD
Sbjct  3     LSFDPAVMATYSSVPVCADVCVVGVARTPIGDFLGSLSSLTATRLGSIAIQAALKRAHVD  62

Query  1340  PSLVEEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQL  1519
             P+LVEEVFFGNVL+ANLGQAPARQAALGAGIP +V+C+T+NKVCA+GMK+ MLA+QSIQL
Sbjct  63    PALVEEVFFGNVLTANLGQAPARQAALGAGIPYSVICTTINKVCAAGMKSVMLASQSIQL  122

Query  1520  GINDVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             G+ND+VVAGGMESMSNVPKY  +AR+GSRLGHD++VDGM+
Sbjct  123   GLNDIVVAGGMESMSNVPKYLPDARRGSRLGHDTVVDGMM  162


 Score =   211 bits (536),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 125/145 (86%), Gaps = 4/145 (3%)
 Frame = +3

Query  303  LAMAPATAETINA----RDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVD  470
            L+  PA   T ++     DVC+VGVARTP+G FLGSLSSL AT+LGS+AI++ALKRA VD
Sbjct  3    LSFDPAVMATYSSVPVCADVCVVGVARTPIGDFLGSLSSLTATRLGSIAIQAALKRAHVD  62

Query  471  PSLVEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQL  650
            P+LVEEVFFGNVL ANLGQAPARQAALGAGIP +V+C+T+NKVCA+GMK+ +LA+QSIQL
Sbjct  63   PALVEEVFFGNVLTANLGQAPARQAALGAGIPYSVICTTINKVCAAGMKSVMLASQSIQL  122

Query  651  GINDVVVAGGMESMSNVHKYFAEAR  725
            G+ND+VVAGGMESMSNV KY  +AR
Sbjct  123  GLNDIVVAGGMESMSNVPKYLPDAR  147



>gb|EMT15552.1| Putative acetyl-CoA acetyltransferase, cytosolic 2 [Aegilops 
tauschii]
Length=452

 Score =   245 bits (625),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +2

Query  1202  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  1381
             ++ RDVC+VGVARTP+G  LGSLSSLPAT+LGS+AI+ AL+R SVDP+LV+EVF GNVLS
Sbjct  14    LDPRDVCVVGVARTPIGALLGSLSSLPATRLGSVAIQGALRRASVDPALVQEVFMGNVLS  73

Query  1382  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESM  1561
             ANLGQAPARQAALGAG+PNTV C+TVNKVC+SGMKA MLAAQSIQLGINDVVVAGGMESM
Sbjct  74    ANLGQAPARQAALGAGLPNTVPCTTVNKVCSSGMKAVMLAAQSIQLGINDVVVAGGMESM  133

Query  1562  SNVPKYFAEARKGSRLGHDSLVDGML  1639
             SN PKY A AR+GSR GHD L+DGML
Sbjct  134   SNAPKYAATARRGSRFGHDVLIDGML  159


 Score =   213 bits (543),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +3

Query  333  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLG  512
            ++ RDVC+VGVARTP+G  LGSLSSLPAT+LGS+AI+ AL+RASVDP+LV+EVF GNVL 
Sbjct  14   LDPRDVCVVGVARTPIGALLGSLSSLPATRLGSVAIQGALRRASVDPALVQEVFMGNVLS  73

Query  513  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESM  692
            ANLGQAPARQAALGAG+PNTV C+TVNKVC+SGMKA +LAAQSIQLGINDVVVAGGMESM
Sbjct  74   ANLGQAPARQAALGAGLPNTVPCTTVNKVCSSGMKAVMLAAQSIQLGINDVVVAGGMESM  133

Query  693  SNVHKYFAEAR  725
            SN  KY A AR
Sbjct  134  SNAPKYAATAR  144



>ref|XP_009114255.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Brassica rapa]
Length=405

 Score =   243 bits (619),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = +2

Query  1196  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  1375
             +++  +DVC+VGVARTPMG FLGSLSS+ A +LGSIAIE+ALK  +V+P+LVEEVFFGNV
Sbjct  8     QSVQPQDVCVVGVARTPMGDFLGSLSSITAPRLGSIAIEAALKSANVEPALVEEVFFGNV  67

Query  1376  LSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGME  1555
             L+ANLGQAPARQAALGAGIP +V+C+TVNKVCA+GMKA MLAAQSIQLG+NDVVVAGGME
Sbjct  68    LTANLGQAPARQAALGAGIPYSVICTTVNKVCAAGMKAVMLAAQSIQLGLNDVVVAGGME  127

Query  1556  SMSNVPKYFAEARKGSRLGHDSLVDGM  1636
             SMSNVPKY   AR+GSRLGHD++VDGM
Sbjct  128   SMSNVPKYLPNARRGSRLGHDTVVDGM  154


 Score =   211 bits (536),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +3

Query  327  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNV  506
            +++  +DVC+VGVARTPMG FLGSLSS+ A +LGS+AIE+ALK A+V+P+LVEEVFFGNV
Sbjct  8    QSVQPQDVCVVGVARTPMGDFLGSLSSITAPRLGSIAIEAALKSANVEPALVEEVFFGNV  67

Query  507  LGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGME  686
            L ANLGQAPARQAALGAGIP +V+C+TVNKVCA+GMKA +LAAQSIQLG+NDVVVAGGME
Sbjct  68   LTANLGQAPARQAALGAGIPYSVICTTVNKVCAAGMKAVMLAAQSIQLGLNDVVVAGGME  127

Query  687  SMSNVHKYFAEAR  725
            SMSNV KY   AR
Sbjct  128  SMSNVPKYLPNAR  140



>ref|XP_009114253.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X1 [Brassica rapa]
 ref|XP_009114254.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X1 [Brassica rapa]
 emb|CDY41065.1| BnaA09g18440D [Brassica napus]
Length=415

 Score =   243 bits (619),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = +2

Query  1196  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  1375
             +++  +DVC+VGVARTPMG FLGSLSS+ A +LGSIAIE+ALK  +V+P+LVEEVFFGNV
Sbjct  8     QSVQPQDVCVVGVARTPMGDFLGSLSSITAPRLGSIAIEAALKSANVEPALVEEVFFGNV  67

Query  1376  LSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGME  1555
             L+ANLGQAPARQAALGAGIP +V+C+TVNKVCA+GMKA MLAAQSIQLG+NDVVVAGGME
Sbjct  68    LTANLGQAPARQAALGAGIPYSVICTTVNKVCAAGMKAVMLAAQSIQLGLNDVVVAGGME  127

Query  1556  SMSNVPKYFAEARKGSRLGHDSLVDGM  1636
             SMSNVPKY   AR+GSRLGHD++VDGM
Sbjct  128   SMSNVPKYLPNARRGSRLGHDTVVDGM  154


 Score =   211 bits (536),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +3

Query  327  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNV  506
            +++  +DVC+VGVARTPMG FLGSLSS+ A +LGS+AIE+ALK A+V+P+LVEEVFFGNV
Sbjct  8    QSVQPQDVCVVGVARTPMGDFLGSLSSITAPRLGSIAIEAALKSANVEPALVEEVFFGNV  67

Query  507  LGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGME  686
            L ANLGQAPARQAALGAGIP +V+C+TVNKVCA+GMKA +LAAQSIQLG+NDVVVAGGME
Sbjct  68   LTANLGQAPARQAALGAGIPYSVICTTVNKVCAAGMKAVMLAAQSIQLGLNDVVVAGGME  127

Query  687  SMSNVHKYFAEAR  725
            SMSNV KY   AR
Sbjct  128  SMSNVPKYLPNAR  140



>gb|EEC69797.1| hypothetical protein OsI_00091 [Oryza sativa Indica Group]
Length=416

 Score =   241 bits (615),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 139/157 (89%), Gaps = 3/157 (2%)
 Frame = +2

Query  1178  MAP---ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSL  1348
             MAP   + ++ +  RDVCIVGVARTP+G  LGSLSSLPATKLGS+AI++AL+R +V+P+L
Sbjct  1     MAPPPHSDSDLLKPRDVCIVGVARTPIGALLGSLSSLPATKLGSVAIQAALRRANVEPAL  60

Query  1349  VEEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGIN  1528
             V+EVF GNVLSANLGQAPARQAALGAG+P+TV C+TVNKVC+SGMKA MLAAQ+IQLG++
Sbjct  61    VQEVFMGNVLSANLGQAPARQAALGAGLPDTVPCTTVNKVCSSGMKAVMLAAQTIQLGMH  120

Query  1529  DVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             DVVVAGGMESMSN PKY A AR+GSR GHD L+DGML
Sbjct  121   DVVVAGGMESMSNAPKYVAAARRGSRFGHDVLIDGML  157


 Score =   209 bits (532),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 125/142 (88%), Gaps = 3/142 (2%)
 Frame = +3

Query  309  MAP---ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSL  479
            MAP   + ++ +  RDVCIVGVARTP+G  LGSLSSLPATKLGS+AI++AL+RA+V+P+L
Sbjct  1    MAPPPHSDSDLLKPRDVCIVGVARTPIGALLGSLSSLPATKLGSVAIQAALRRANVEPAL  60

Query  480  VEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGIN  659
            V+EVF GNVL ANLGQAPARQAALGAG+P+TV C+TVNKVC+SGMKA +LAAQ+IQLG++
Sbjct  61   VQEVFMGNVLSANLGQAPARQAALGAGLPDTVPCTTVNKVCSSGMKAVMLAAQTIQLGMH  120

Query  660  DVVVAGGMESMSNVHKYFAEAR  725
            DVVVAGGMESMSN  KY A AR
Sbjct  121  DVVVAGGMESMSNAPKYVAAAR  142



>ref|NP_001041797.1| Os01g0110400 [Oryza sativa Japonica Group]
 dbj|BAB39872.1| putative acetoacetyl-coenzyme A thiolase [Oryza sativa Japonica 
Group]
 dbj|BAF03711.1| Os01g0110400 [Oryza sativa Japonica Group]
 dbj|BAG95946.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE53732.1| hypothetical protein OsJ_00082 [Oryza sativa Japonica Group]
Length=416

 Score =   241 bits (615),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 139/157 (89%), Gaps = 3/157 (2%)
 Frame = +2

Query  1178  MAP---ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSL  1348
             MAP   + ++ +  RDVCIVGVARTP+G  LGSLSSLPATKLGS+AI++AL+R +V+P+L
Sbjct  1     MAPPPHSDSDLLKPRDVCIVGVARTPIGALLGSLSSLPATKLGSVAIQAALRRANVEPAL  60

Query  1349  VEEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGIN  1528
             V+EVF GNVLSANLGQAPARQAALGAG+P+TV C+TVNKVC+SGMKA MLAAQ+IQLG++
Sbjct  61    VQEVFMGNVLSANLGQAPARQAALGAGLPDTVPCTTVNKVCSSGMKAVMLAAQTIQLGMH  120

Query  1529  DVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             DVVVAGGMESMSN PKY A AR+GSR GHD L+DGML
Sbjct  121   DVVVAGGMESMSNAPKYVAAARRGSRFGHDVLIDGML  157


 Score =   209 bits (533),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 125/142 (88%), Gaps = 3/142 (2%)
 Frame = +3

Query  309  MAP---ATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSL  479
            MAP   + ++ +  RDVCIVGVARTP+G  LGSLSSLPATKLGS+AI++AL+RA+V+P+L
Sbjct  1    MAPPPHSDSDLLKPRDVCIVGVARTPIGALLGSLSSLPATKLGSVAIQAALRRANVEPAL  60

Query  480  VEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGIN  659
            V+EVF GNVL ANLGQAPARQAALGAG+P+TV C+TVNKVC+SGMKA +LAAQ+IQLG++
Sbjct  61   VQEVFMGNVLSANLGQAPARQAALGAGLPDTVPCTTVNKVCSSGMKAVMLAAQTIQLGMH  120

Query  660  DVVVAGGMESMSNVHKYFAEAR  725
            DVVVAGGMESMSN  KY A AR
Sbjct  121  DVVVAGGMESMSNAPKYVAAAR  142



>gb|KGN43403.1| hypothetical protein Csa_7G031640 [Cucumis sativus]
Length=360

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +2

Query  1247  MGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLGQAPARQAALGA  1426
             MGGFLG+LSSL ATKLGS+AIE+ALKR  VDP+LV+EV FGNVLSANLGQAPARQAALGA
Sbjct  1     MGGFLGTLSSLSATKLGSLAIEAALKRAKVDPALVQEVIFGNVLSANLGQAPARQAALGA  60

Query  1427  GIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNVPKYFAEARKGSR  1606
             GIPN+VVC+TVNKVCASGMKATMLAAQSIQLG+NDVVV+GGMESMSNVPKY AEARKGSR
Sbjct  61    GIPNSVVCTTVNKVCASGMKATMLAAQSIQLGLNDVVVSGGMESMSNVPKYLAEARKGSR  120

Query  1607  LGHDSLVDGML  1639
             LGHDSLVDGML
Sbjct  121   LGHDSLVDGML  131


 Score =   203 bits (517),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = +3

Query  378  MGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGANLGQAPARQAALGA  557
            MGGFLG+LSSL ATKLGSLAIE+ALKRA VDP+LV+EV FGNVL ANLGQAPARQAALGA
Sbjct  1    MGGFLGTLSSLSATKLGSLAIEAALKRAKVDPALVQEVIFGNVLSANLGQAPARQAALGA  60

Query  558  GIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNVHKYFAEAR  725
            GIPN+VVC+TVNKVCASGMKAT+LAAQSIQLG+NDVVV+GGMESMSNV KY AEAR
Sbjct  61   GIPNSVVCTTVNKVCASGMKATMLAAQSIQLGLNDVVVSGGMESMSNVPKYLAEAR  116



>ref|XP_010087672.1| putative acetyl-CoA acetyltransferase, cytosolic 2 [Morus notabilis]
 gb|EXB29565.1| putative acetyl-CoA acetyltransferase, cytosolic 2 [Morus notabilis]
Length=434

 Score =   240 bits (612),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +2

Query  1202  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  1381
             I  RDVCIVGVARTP+GGFLGSLSSL AT+LGS+AI++AL+R  V+PSLV+EVFFGNVLS
Sbjct  12    IKPRDVCIVGVARTPIGGFLGSLSSLSATQLGSVAIKAALRRAGVEPSLVQEVFFGNVLS  71

Query  1382  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESM  1561
             ANLGQAPARQAALGAGIPN+ +C+T+NKVC+SGMKA M+A+QSI+LG ND+VVAGGMESM
Sbjct  72    ANLGQAPARQAALGAGIPNSGICTTINKVCSSGMKAIMIASQSIELGTNDIVVAGGMESM  131

Query  1562  SNVPKYFAEARKGSRLGHDSLVDGML  1639
             SN PKY  + R GSRLGHD++VDGM+
Sbjct  132   SNTPKYLTDVRNGSRLGHDTIVDGMV  157


 Score =   208 bits (529),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +3

Query  333  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLG  512
            I  RDVCIVGVARTP+GGFLGSLSSL AT+LGS+AI++AL+RA V+PSLV+EVFFGNVL 
Sbjct  12   IKPRDVCIVGVARTPIGGFLGSLSSLSATQLGSVAIKAALRRAGVEPSLVQEVFFGNVLS  71

Query  513  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESM  692
            ANLGQAPARQAALGAGIPN+ +C+T+NKVC+SGMKA ++A+QSI+LG ND+VVAGGMESM
Sbjct  72   ANLGQAPARQAALGAGIPNSGICTTINKVCSSGMKAIMIASQSIELGTNDIVVAGGMESM  131

Query  693  SNVHKYFAEARS  728
            SN  KY  + R+
Sbjct  132  SNTPKYLTDVRN  143



>ref|XP_010497269.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2, 
partial [Camelina sativa]
Length=160

 Score =   231 bits (588),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 130/140 (93%), Gaps = 1/140 (1%)
 Frame = +2

Query  1178  MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVE  1354
             MAP+ ++ ++  RDVC+VGVARTPMGGFLGSLSSL AT+LGSIAIE+AL+R +VDP+LVE
Sbjct  1     MAPSVSDDSVKPRDVCVVGVARTPMGGFLGSLSSLTATRLGSIAIEAALRRANVDPALVE  60

Query  1355  EVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDV  1534
             EVFFGNVL+ANLGQAPARQAALGAGIP +V+C+TVNKVCA+GMKA MLAAQSIQLG+NDV
Sbjct  61    EVFFGNVLTANLGQAPARQAALGAGIPYSVICTTVNKVCAAGMKAVMLAAQSIQLGLNDV  120

Query  1535  VVAGGMESMSNVPKYFAEAR  1594
             VVAGGMESMSNVPKY  +AR
Sbjct  121   VVAGGMESMSNVPKYLPDAR  140


 Score =   225 bits (574),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 129/140 (92%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPATAE-TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVE  485
            MAP+ ++ ++  RDVC+VGVARTPMGGFLGSLSSL AT+LGS+AIE+AL+RA+VDP+LVE
Sbjct  1    MAPSVSDDSVKPRDVCVVGVARTPMGGFLGSLSSLTATRLGSIAIEAALRRANVDPALVE  60

Query  486  EVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDV  665
            EVFFGNVL ANLGQAPARQAALGAGIP +V+C+TVNKVCA+GMKA +LAAQSIQLG+NDV
Sbjct  61   EVFFGNVLTANLGQAPARQAALGAGIPYSVICTTVNKVCAAGMKAVMLAAQSIQLGLNDV  120

Query  666  VVAGGMESMSNVHKYFAEAR  725
            VVAGGMESMSNV KY  +AR
Sbjct  121  VVAGGMESMSNVPKYLPDAR  140



>ref|XP_008384190.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Malus domestica]
Length=405

 Score =   238 bits (608),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +2

Query  1181  APATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEV  1360
             +P++++ I+ RDVCIVGVARTPMGGFLGSLSS  AT LGS+AI+ ALKR +VDPSLV+EV
Sbjct  3     SPSSSDPIHPRDVCIVGVARTPMGGFLGSLSSFSATHLGSLAIQCALKRANVDPSLVQEV  62

Query  1361  FFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVV  1540
             FFGNVLSANLGQAPARQAAL AGIPN+V+C+T+NKVCASGMKATMLAAQ+IQLG+NDVVV
Sbjct  63    FFGNVLSANLGQAPARQAALAAGIPNSVICTTINKVCASGMKATMLAAQTIQLGLNDVVV  122

Query  1541  AGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             AGGMESMSN PKY   AR+GSRLGHD++VDGML
Sbjct  123   AGGMESMSNAPKYLPAARQGSRLGHDTIVDGML  155


 Score =   206 bits (524),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  312  APATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEV  491
            +P++++ I+ RDVCIVGVARTPMGGFLGSLSS  AT LGSLAI+ ALKRA+VDPSLV+EV
Sbjct  3    SPSSSDPIHPRDVCIVGVARTPMGGFLGSLSSFSATHLGSLAIQCALKRANVDPSLVQEV  62

Query  492  FFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVV  671
            FFGNVL ANLGQAPARQAAL AGIPN+V+C+T+NKVCASGMKAT+LAAQ+IQLG+NDVVV
Sbjct  63   FFGNVLSANLGQAPARQAALAAGIPNSVICTTINKVCASGMKATMLAAQTIQLGLNDVVV  122

Query  672  AGGMESMSNVHKYFAEAR  725
            AGGMESMSN  KY   AR
Sbjct  123  AGGMESMSNAPKYLPAAR  140



>ref|XP_008384188.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Malus domestica]
 ref|XP_008384189.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Malus domestica]
Length=416

 Score =   238 bits (608),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = +2

Query  1181  APATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEV  1360
             +P++++ I+ RDVCIVGVARTPMGGFLGSLSS  AT LGS+AI+ ALKR +VDPSLV+EV
Sbjct  3     SPSSSDPIHPRDVCIVGVARTPMGGFLGSLSSFSATHLGSLAIQCALKRANVDPSLVQEV  62

Query  1361  FFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVV  1540
             FFGNVLSANLGQAPARQAAL AGIPN+V+C+T+NKVCASGMKATMLAAQ+IQLG+NDVVV
Sbjct  63    FFGNVLSANLGQAPARQAALAAGIPNSVICTTINKVCASGMKATMLAAQTIQLGLNDVVV  122

Query  1541  AGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             AGGMESMSN PKY   AR+GSRLGHD++VDGML
Sbjct  123   AGGMESMSNAPKYLPAARQGSRLGHDTIVDGML  155


 Score =   206 bits (525),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  312  APATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEV  491
            +P++++ I+ RDVCIVGVARTPMGGFLGSLSS  AT LGSLAI+ ALKRA+VDPSLV+EV
Sbjct  3    SPSSSDPIHPRDVCIVGVARTPMGGFLGSLSSFSATHLGSLAIQCALKRANVDPSLVQEV  62

Query  492  FFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVV  671
            FFGNVL ANLGQAPARQAAL AGIPN+V+C+T+NKVCASGMKAT+LAAQ+IQLG+NDVVV
Sbjct  63   FFGNVLSANLGQAPARQAALAAGIPNSVICTTINKVCASGMKATMLAAQTIQLGLNDVVV  122

Query  672  AGGMESMSNVHKYFAEAR  725
            AGGMESMSN  KY   AR
Sbjct  123  AGGMESMSNAPKYLPAAR  140



>gb|ACN40771.1| unknown [Picea sitchensis]
Length=404

 Score =   237 bits (605),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +2

Query  1196  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  1375
             +++  RDVCIVGVARTP+GG  GSLS+LPATKLGSI I +ALKR  V+  +V+EVFFGNV
Sbjct  8     DSLKPRDVCIVGVARTPLGGLSGSLSTLPATKLGSITIAAALKRAGVESGMVQEVFFGNV  67

Query  1376  LSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGME  1555
             LSANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKAT LAAQSIQLG ND+VVAGGME
Sbjct  68    LSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKATTLAAQSIQLGNNDIVVAGGME  127

Query  1556  SMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             SMSN P Y  +ARKG RLGH SLVDGM+
Sbjct  128   SMSNAPYYLPDARKGYRLGHGSLVDGMM  155


 Score =   207 bits (528),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +3

Query  327  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNV  506
            +++  RDVCIVGVARTP+GG  GSLS+LPATKLGS+ I +ALKRA V+  +V+EVFFGNV
Sbjct  8    DSLKPRDVCIVGVARTPLGGLSGSLSTLPATKLGSITIAAALKRAGVESGMVQEVFFGNV  67

Query  507  LGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGME  686
            L ANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKAT LAAQSIQLG ND+VVAGGME
Sbjct  68   LSANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKATTLAAQSIQLGNNDIVVAGGME  127

Query  687  SMSNVHKYFAEAR  725
            SMSN   Y  +AR
Sbjct  128  SMSNAPYYLPDAR  140



>ref|XP_003618040.1| Acetyl-CoA acetyltransferase, cytosolic [Medicago truncatula]
Length=381

 Score =   236 bits (602),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +2

Query  1247  MGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLGQAPARQAALGA  1426
             MG FLG+LSS+PATKLGSIAIE+ALKR +VDP++VEEVFFGNVLSANLGQAPARQAALGA
Sbjct  1     MGAFLGTLSSVPATKLGSIAIEAALKRANVDPAIVEEVFFGNVLSANLGQAPARQAALGA  60

Query  1427  GIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNVPKYFAEARKGSR  1606
             G+  +VVC+TVNKVCASGMKATMLAAQSIQLGINDVVVAGGME+MS+VPKY AEARKGSR
Sbjct  61    GLSKSVVCTTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMENMSSVPKYLAEARKGSR  120

Query  1607  LGHDSLVDGML  1639
             LGHDSLVDGML
Sbjct  121   LGHDSLVDGML  131


 Score =   197 bits (502),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/116 (84%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = +3

Query  378  MGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGANLGQAPARQAALGA  557
            MG FLG+LSS+PATKLGS+AIE+ALKRA+VDP++VEEVFFGNVL ANLGQAPARQAALGA
Sbjct  1    MGAFLGTLSSVPATKLGSIAIEAALKRANVDPAIVEEVFFGNVLSANLGQAPARQAALGA  60

Query  558  GIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNVHKYFAEAR  725
            G+  +VVC+TVNKVCASGMKAT+LAAQSIQLGINDVVVAGGME+MS+V KY AEAR
Sbjct  61   GLSKSVVCTTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMENMSSVPKYLAEAR  116



>ref|XP_010092017.1| putative acetyl-CoA acetyltransferase, cytosolic 2 [Morus notabilis]
 gb|EXB49753.1| putative acetyl-CoA acetyltransferase, cytosolic 2 [Morus notabilis]
Length=407

 Score =   236 bits (603),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +2

Query  1211  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANL  1390
             RDVCIVGVARTP+GGFLGSLSSL AT+LGS+AI++AL+R  V+PSLV+EVFFGNVLSANL
Sbjct  15    RDVCIVGVARTPIGGFLGSLSSLSATQLGSVAIKAALRRAGVEPSLVQEVFFGNVLSANL  74

Query  1391  GQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNV  1570
             GQAPARQAALGAGIPN+ +C+T+NKVC+S MKA M+A+QSI+LG ND+VVAGGMESMSN 
Sbjct  75    GQAPARQAALGAGIPNSGICTTINKVCSSAMKAIMIASQSIELGTNDIVVAGGMESMSNT  134

Query  1571  PKYFAEARKGSRLGHDSLVDGML  1639
             PKY  + R GSRLGHD++VDGM+
Sbjct  135   PKYLTDVRNGSRLGHDTIVDGMV  157


 Score =   205 bits (521),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = +3

Query  342  RDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGANL  521
            RDVCIVGVARTP+GGFLGSLSSL AT+LGS+AI++AL+RA V+PSLV+EVFFGNVL ANL
Sbjct  15   RDVCIVGVARTPIGGFLGSLSSLSATQLGSVAIKAALRRAGVEPSLVQEVFFGNVLSANL  74

Query  522  GQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNV  701
            GQAPARQAALGAGIPN+ +C+T+NKVC+S MKA ++A+QSI+LG ND+VVAGGMESMSN 
Sbjct  75   GQAPARQAALGAGIPNSGICTTINKVCSSAMKAIMIASQSIELGTNDIVVAGGMESMSNT  134

Query  702  HKYFAEARS  728
             KY  + R+
Sbjct  135  PKYLTDVRN  143



>ref|XP_009374845.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1 isoform 
X1 [Pyrus x bretschneideri]
Length=416

 Score =   237 bits (604),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = +2

Query  1184  PATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVF  1363
             P++++ I+ RDVCIVGVARTPMGGFLGSLSS  AT LGS+AI+ ALKR +VDPSLV+EVF
Sbjct  4     PSSSDPIHPRDVCIVGVARTPMGGFLGSLSSFSATHLGSLAIQCALKRANVDPSLVQEVF  63

Query  1364  FGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVA  1543
             FGNVLSANLGQAPARQAAL AGIPN+V+C+T+NKVCASGMK+TMLAAQ+IQLG+NDVVVA
Sbjct  64    FGNVLSANLGQAPARQAALAAGIPNSVICTTINKVCASGMKSTMLAAQTIQLGLNDVVVA  123

Query  1544  GGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             GGMESMSN PKY   AR+GSRLGHD++VDGML
Sbjct  124   GGMESMSNAPKYLPAARQGSRLGHDTIVDGML  155


 Score =   205 bits (521),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  315  PATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVF  494
            P++++ I+ RDVCIVGVARTPMGGFLGSLSS  AT LGSLAI+ ALKRA+VDPSLV+EVF
Sbjct  4    PSSSDPIHPRDVCIVGVARTPMGGFLGSLSSFSATHLGSLAIQCALKRANVDPSLVQEVF  63

Query  495  FGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVA  674
            FGNVL ANLGQAPARQAAL AGIPN+V+C+T+NKVCASGMK+T+LAAQ+IQLG+NDVVVA
Sbjct  64   FGNVLSANLGQAPARQAALAAGIPNSVICTTINKVCASGMKSTMLAAQTIQLGLNDVVVA  123

Query  675  GGMESMSNVHKYFAEAR  725
            GGMESMSN  KY   AR
Sbjct  124  GGMESMSNAPKYLPAAR  140



>ref|XP_009374846.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Pyrus x bretschneideri]
Length=405

 Score =   236 bits (603),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = +2

Query  1184  PATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVF  1363
             P++++ I+ RDVCIVGVARTPMGGFLGSLSS  AT LGS+AI+ ALKR +VDPSLV+EVF
Sbjct  4     PSSSDPIHPRDVCIVGVARTPMGGFLGSLSSFSATHLGSLAIQCALKRANVDPSLVQEVF  63

Query  1364  FGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVA  1543
             FGNVLSANLGQAPARQAAL AGIPN+V+C+T+NKVCASGMK+TMLAAQ+IQLG+NDVVVA
Sbjct  64    FGNVLSANLGQAPARQAALAAGIPNSVICTTINKVCASGMKSTMLAAQTIQLGLNDVVVA  123

Query  1544  GGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             GGMESMSN PKY   AR+GSRLGHD++VDGML
Sbjct  124   GGMESMSNAPKYLPAARQGSRLGHDTIVDGML  155


 Score =   205 bits (521),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  315  PATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVF  494
            P++++ I+ RDVCIVGVARTPMGGFLGSLSS  AT LGSLAI+ ALKRA+VDPSLV+EVF
Sbjct  4    PSSSDPIHPRDVCIVGVARTPMGGFLGSLSSFSATHLGSLAIQCALKRANVDPSLVQEVF  63

Query  495  FGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVA  674
            FGNVL ANLGQAPARQAAL AGIPN+V+C+T+NKVCASGMK+T+LAAQ+IQLG+NDVVVA
Sbjct  64   FGNVLSANLGQAPARQAALAAGIPNSVICTTINKVCASGMKSTMLAAQTIQLGLNDVVVA  123

Query  675  GGMESMSNVHKYFAEAR  725
            GGMESMSN  KY   AR
Sbjct  124  GGMESMSNAPKYLPAAR  140



>ref|XP_008811278.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Phoenix dactylifera]
 ref|XP_008811280.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X2 [Phoenix dactylifera]
Length=381

 Score =   236 bits (601),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 124/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  1247  MGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLGQAPARQAALGA  1426
             MGGFLG+LS+L ATKLGSI IESALKR +V P+LV+EVFFGNVLSANLGQAPARQAALGA
Sbjct  1     MGGFLGALSTLSATKLGSIVIESALKRANVAPALVQEVFFGNVLSANLGQAPARQAALGA  60

Query  1427  GIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNVPKYFAEARKGSR  1606
             GIPNTVVC+T+NKVCASG+KATMLAAQSIQLGINDVVVAGGMESMSN PKY AEARKGSR
Sbjct  61    GIPNTVVCTTINKVCASGLKATMLAAQSIQLGINDVVVAGGMESMSNAPKYIAEARKGSR  120

Query  1607  LGHDSLVDGML  1639
              GHD+LVDGML
Sbjct  121   FGHDTLVDGML  131


 Score =   199 bits (506),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +3

Query  378  MGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGANLGQAPARQAALGA  557
            MGGFLG+LS+L ATKLGS+ IESALKRA+V P+LV+EVFFGNVL ANLGQAPARQAALGA
Sbjct  1    MGGFLGALSTLSATKLGSIVIESALKRANVAPALVQEVFFGNVLSANLGQAPARQAALGA  60

Query  558  GIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNVHKYFAEAR  725
            GIPNTVVC+T+NKVCASG+KAT+LAAQSIQLGINDVVVAGGMESMSN  KY AEAR
Sbjct  61   GIPNTVVCTTINKVCASGLKATMLAAQSIQLGINDVVVAGGMESMSNAPKYIAEAR  116



>ref|XP_009412135.1| PREDICTED: acetyl-CoA acetyltransferase, cytosolic 1-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=391

 Score =   231 bits (590),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 123/131 (94%), Gaps = 0/131 (0%)
 Frame = +2

Query  1247  MGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLGQAPARQAALGA  1426
             MGGFLG+LSSL AT+LGSIAI+ AL R ++DP+LV+EVFFGNVLSANLGQAPARQAALGA
Sbjct  1     MGGFLGALSSLSATQLGSIAIKHALARANLDPALVQEVFFGNVLSANLGQAPARQAALGA  60

Query  1427  GIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNVPKYFAEARKGSR  1606
             GIPNTVVC+T+NKVCASGMKA MLAAQSIQLGIND+VVAGGMESMSN PKY AEARKGSR
Sbjct  61    GIPNTVVCTTINKVCASGMKAAMLAAQSIQLGINDIVVAGGMESMSNAPKYIAEARKGSR  120

Query  1607  LGHDSLVDGML  1639
              GHD++VDGML
Sbjct  121   FGHDTIVDGML  131


 Score =   196 bits (499),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = +3

Query  378  MGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGANLGQAPARQAALGA  557
            MGGFLG+LSSL AT+LGS+AI+ AL RA++DP+LV+EVFFGNVL ANLGQAPARQAALGA
Sbjct  1    MGGFLGALSSLSATQLGSIAIKHALARANLDPALVQEVFFGNVLSANLGQAPARQAALGA  60

Query  558  GIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNVHKYFAEAR  725
            GIPNTVVC+T+NKVCASGMKA +LAAQSIQLGIND+VVAGGMESMSN  KY AEAR
Sbjct  61   GIPNTVVCTTINKVCASGMKAAMLAAQSIQLGINDIVVAGGMESMSNAPKYIAEAR  116



>gb|ACN41149.1| unknown [Picea sitchensis]
Length=404

 Score =   232 bits (591),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = +2

Query  1199  TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVL  1378
             ++  RDVCIVGVARTP+GG  GSLS+L ATKLGSIAI +ALKR  V+  +V+EVFFGNVL
Sbjct  9     SLKPRDVCIVGVARTPLGGLSGSLSTLSATKLGSIAIVAALKRAGVESGMVQEVFFGNVL  68

Query  1379  SANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMES  1558
             SANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKAT LAAQSIQLG ND+VVAGGMES
Sbjct  69    SANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKATTLAAQSIQLGSNDIVVAGGMES  128

Query  1559  MSNVPKYFAEARKGSRLGHDSLVDGML  1639
             MSN P Y  +ARKG RLGH +LVDG++
Sbjct  129   MSNAPYYLPDARKGYRLGHGTLVDGLM  155


 Score =   204 bits (519),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +3

Query  330  TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVL  509
            ++  RDVCIVGVARTP+GG  GSLS+L ATKLGS+AI +ALKRA V+  +V+EVFFGNVL
Sbjct  9    SLKPRDVCIVGVARTPLGGLSGSLSTLSATKLGSIAIVAALKRAGVESGMVQEVFFGNVL  68

Query  510  GANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMES  689
             ANLGQAPARQAALGAGIPN+VVC+T+NKVCASGMKAT LAAQSIQLG ND+VVAGGMES
Sbjct  69   SANLGQAPARQAALGAGIPNSVVCTTINKVCASGMKATTLAAQSIQLGSNDIVVAGGMES  128

Query  690  MSNVHKYFAEAR  725
            MSN   Y  +AR
Sbjct  129  MSNAPYYLPDAR  140



>ref|XP_010441408.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X1 [Camelina sativa]
Length=391

 Score =   231 bits (588),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  1247  MGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLGQAPARQAALGA  1426
             MGGFLGSLSSL AT+LGSIAIE+AL+R +VDP+LVEEVFFGNVL+ANLGQAPARQAALGA
Sbjct  1     MGGFLGSLSSLTATRLGSIAIEAALRRANVDPALVEEVFFGNVLTANLGQAPARQAALGA  60

Query  1427  GIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNVPKYFAEARKGSR  1606
             GIP +V+C+TVNKVCA+GMKA MLAAQSIQLG+NDVVVAGGMESMSNVPKY  +AR+GSR
Sbjct  61    GIPYSVICTTVNKVCAAGMKAVMLAAQSIQLGLNDVVVAGGMESMSNVPKYLPDARRGSR  120

Query  1607  LGHDSLVDGML  1639
             LGHD+LVDGM+
Sbjct  121   LGHDTLVDGMM  131


 Score =   196 bits (498),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +3

Query  378  MGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGANLGQAPARQAALGA  557
            MGGFLGSLSSL AT+LGS+AIE+AL+RA+VDP+LVEEVFFGNVL ANLGQAPARQAALGA
Sbjct  1    MGGFLGSLSSLTATRLGSIAIEAALRRANVDPALVEEVFFGNVLTANLGQAPARQAALGA  60

Query  558  GIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNVHKYFAEAR  725
            GIP +V+C+TVNKVCA+GMKA +LAAQSIQLG+NDVVVAGGMESMSNV KY  +AR
Sbjct  61   GIPYSVICTTVNKVCAAGMKAVMLAAQSIQLGLNDVVVAGGMESMSNVPKYLPDAR  116



>ref|XP_010441409.1| PREDICTED: probable acetyl-CoA acetyltransferase, cytosolic 2 
isoform X2 [Camelina sativa]
Length=381

 Score =   230 bits (586),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  1247  MGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLGQAPARQAALGA  1426
             MGGFLGSLSSL AT+LGSIAIE+AL+R +VDP+LVEEVFFGNVL+ANLGQAPARQAALGA
Sbjct  1     MGGFLGSLSSLTATRLGSIAIEAALRRANVDPALVEEVFFGNVLTANLGQAPARQAALGA  60

Query  1427  GIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNVPKYFAEARKGSR  1606
             GIP +V+C+TVNKVCA+GMKA MLAAQSIQLG+NDVVVAGGMESMSNVPKY  +AR+GSR
Sbjct  61    GIPYSVICTTVNKVCAAGMKAVMLAAQSIQLGLNDVVVAGGMESMSNVPKYLPDARRGSR  120

Query  1607  LGHDSLVDGML  1639
             LGHD+LVDGM+
Sbjct  121   LGHDTLVDGMM  131


 Score =   196 bits (497),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +3

Query  378  MGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGANLGQAPARQAALGA  557
            MGGFLGSLSSL AT+LGS+AIE+AL+RA+VDP+LVEEVFFGNVL ANLGQAPARQAALGA
Sbjct  1    MGGFLGSLSSLTATRLGSIAIEAALRRANVDPALVEEVFFGNVLTANLGQAPARQAALGA  60

Query  558  GIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNVHKYFAEAR  725
            GIP +V+C+TVNKVCA+GMKA +LAAQSIQLG+NDVVVAGGMESMSNV KY  +AR
Sbjct  61   GIPYSVICTTVNKVCAAGMKAVMLAAQSIQLGLNDVVVAGGMESMSNVPKYLPDAR  116



>ref|XP_002968816.1| hypothetical protein SELMODRAFT_146037 [Selaginella moellendorffii]
 gb|EFJ29932.1| hypothetical protein SELMODRAFT_146037 [Selaginella moellendorffii]
Length=419

 Score =   231 bits (588),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = +2

Query  1181  APATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEV  1360
             AP+ +  I  RD CIVGVARTPMGG  GSLS+L ATKLGSIAI+ A+ R  +DP+LV+EV
Sbjct  7     APSESSPIGPRDACIVGVARTPMGGLSGSLSALAATKLGSIAIQGAIARAGIDPALVQEV  66

Query  1361  FFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVV  1540
             FFGNVLSANLGQAPARQAA+GAG+P + VC+T+NKVCASG+KAT+LAAQSIQLG+NDVVV
Sbjct  67    FFGNVLSANLGQAPARQAAMGAGLPPSAVCTTINKVCASGLKATVLAAQSIQLGLNDVVV  126

Query  1541  AGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             AGGMESMSN P Y  +AR+G R+GH  ++DGM+
Sbjct  127   AGGMESMSNTPYYLPKARQGYRMGHGEVIDGMM  159


 Score =   207 bits (527),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = +3

Query  312  APATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEV  491
            AP+ +  I  RD CIVGVARTPMGG  GSLS+L ATKLGS+AI+ A+ RA +DP+LV+EV
Sbjct  7    APSESSPIGPRDACIVGVARTPMGGLSGSLSALAATKLGSIAIQGAIARAGIDPALVQEV  66

Query  492  FFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVV  671
            FFGNVL ANLGQAPARQAA+GAG+P + VC+T+NKVCASG+KAT+LAAQSIQLG+NDVVV
Sbjct  67   FFGNVLSANLGQAPARQAAMGAGLPPSAVCTTINKVCASGLKATVLAAQSIQLGLNDVVV  126

Query  672  AGGMESMSNVHKYFAEAR  725
            AGGMESMSN   Y  +AR
Sbjct  127  AGGMESMSNTPYYLPKAR  144



>ref|XP_002974156.1| hypothetical protein SELMODRAFT_173909 [Selaginella moellendorffii]
 gb|EFJ25111.1| hypothetical protein SELMODRAFT_173909 [Selaginella moellendorffii]
Length=409

 Score =   230 bits (587),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = +2

Query  1181  APATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEV  1360
             AP+ +  I  RD CIVGVARTPMGG  GSLS+L ATKLGSIAI+ A+ R  +DP+LV+EV
Sbjct  7     APSESSPIGPRDACIVGVARTPMGGLSGSLSALAATKLGSIAIQGAIARAGIDPALVQEV  66

Query  1361  FFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVV  1540
             FFGNVLSANLGQAPARQAA+GAG+P + VC+T+NKVCASG+KAT+LAAQSIQLG+NDVVV
Sbjct  67    FFGNVLSANLGQAPARQAAMGAGLPPSAVCTTINKVCASGLKATVLAAQSIQLGLNDVVV  126

Query  1541  AGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             AGGMESMSN P Y  +AR+G R+GH  ++DGM+
Sbjct  127   AGGMESMSNTPYYLPKARQGYRMGHGEVIDGMM  159


 Score =   207 bits (527),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = +3

Query  312  APATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEV  491
            AP+ +  I  RD CIVGVARTPMGG  GSLS+L ATKLGS+AI+ A+ RA +DP+LV+EV
Sbjct  7    APSESSPIGPRDACIVGVARTPMGGLSGSLSALAATKLGSIAIQGAIARAGIDPALVQEV  66

Query  492  FFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVV  671
            FFGNVL ANLGQAPARQAA+GAG+P + VC+T+NKVCASG+KAT+LAAQSIQLG+NDVVV
Sbjct  67   FFGNVLSANLGQAPARQAAMGAGLPPSAVCTTINKVCASGLKATVLAAQSIQLGLNDVVV  126

Query  672  AGGMESMSNVHKYFAEAR  725
            AGGMESMSN   Y  +AR
Sbjct  127  AGGMESMSNTPYYLPKAR  144



>gb|EMT07958.1| Putative acetyl-CoA acetyltransferase, cytosolic 2 [Aegilops 
tauschii]
Length=424

 Score =   229 bits (584),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 124/143 (87%), Gaps = 12/143 (8%)
 Frame = +2

Query  1247  MGGFLGSLSSLPATKLGSIAIE------------SALKRGSVDPSLVEEVFFGNVLSANL  1390
             MGGFLG+LSSL ATKLGS+AIE            +ALKR +VDPSLV+EVFFGNVLSANL
Sbjct  1     MGGFLGALSSLSATKLGSVAIEGEISIFSVCPPEAALKRANVDPSLVQEVFFGNVLSANL  60

Query  1391  GQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNV  1570
             GQAPARQAALGAGIPNTVVC+TVNKVCASGMKATM AAQSIQLG ND+VVAGGMESMSN 
Sbjct  61    GQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMFAAQSIQLGSNDIVVAGGMESMSNA  120

Query  1571  PKYFAEARKGSRLGHDSLVDGML  1639
             PKY AEARKGSR GHDSLVDGML
Sbjct  121   PKYIAEARKGSRFGHDSLVDGML  143


 Score =   192 bits (489),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 109/128 (85%), Gaps = 12/128 (9%)
 Frame = +3

Query  378  MGGFLGSLSSLPATKLGSLAIE------------SALKRASVDPSLVEEVFFGNVLGANL  521
            MGGFLG+LSSL ATKLGS+AIE            +ALKRA+VDPSLV+EVFFGNVL ANL
Sbjct  1    MGGFLGALSSLSATKLGSVAIEGEISIFSVCPPEAALKRANVDPSLVQEVFFGNVLSANL  60

Query  522  GQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNV  701
            GQAPARQAALGAGIPNTVVC+TVNKVCASGMKAT+ AAQSIQLG ND+VVAGGMESMSN 
Sbjct  61   GQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMFAAQSIQLGSNDIVVAGGMESMSNA  120

Query  702  HKYFAEAR  725
             KY AEAR
Sbjct  121  PKYIAEAR  128



>gb|KJB68525.1| hypothetical protein B456_010G248300 [Gossypium raimondii]
Length=375

 Score =   227 bits (579),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 139/154 (90%), Gaps = 1/154 (1%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAP  +  I  RD CIVGVARTPMGGFLGSLSS  AT LGS+AI++AL+R ++DPSLV+E
Sbjct  1     MAPPDS-MIKPRDACIVGVARTPMGGFLGSLSSSSATHLGSLAIKAALQRANLDPSLVQE  59

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPN+V+C+TVNKVC+SGMKA MLA+Q+I+LGINDVV
Sbjct  60    VFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCSSGMKAVMLASQTIELGINDVV  119

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSN PKY A+AR GSR+GHD+++DGML
Sbjct  120   VAGGMESMSNAPKYLAQARNGSRMGHDTVIDGML  153


 Score =   197 bits (501),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 125/140 (89%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAP  +  I  RD CIVGVARTPMGGFLGSLSS  AT LGSLAI++AL+RA++DPSLV+E
Sbjct  1    MAPPDS-MIKPRDACIVGVARTPMGGFLGSLSSSSATHLGSLAIKAALQRANLDPSLVQE  59

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPN+V+C+TVNKVC+SGMKA +LA+Q+I+LGINDVV
Sbjct  60   VFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCSSGMKAVMLASQTIELGINDVV  119

Query  669  VAGGMESMSNVHKYFAEARS  728
            VAGGMESMSN  KY A+AR+
Sbjct  120  VAGGMESMSNAPKYLAQARN  139



>gb|KJB68526.1| hypothetical protein B456_010G248300 [Gossypium raimondii]
Length=379

 Score =   227 bits (579),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 139/154 (90%), Gaps = 1/154 (1%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAP  +  I  RD CIVGVARTPMGGFLGSLSS  AT LGS+AI++AL+R ++DPSLV+E
Sbjct  1     MAPPDS-MIKPRDACIVGVARTPMGGFLGSLSSSSATHLGSLAIKAALQRANLDPSLVQE  59

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPN+V+C+TVNKVC+SGMKA MLA+Q+I+LGINDVV
Sbjct  60    VFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCSSGMKAVMLASQTIELGINDVV  119

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSN PKY A+AR GSR+GHD+++DGML
Sbjct  120   VAGGMESMSNAPKYLAQARNGSRMGHDTVIDGML  153


 Score =   197 bits (501),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 125/140 (89%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAP  +  I  RD CIVGVARTPMGGFLGSLSS  AT LGSLAI++AL+RA++DPSLV+E
Sbjct  1    MAPPDS-MIKPRDACIVGVARTPMGGFLGSLSSSSATHLGSLAIKAALQRANLDPSLVQE  59

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPN+V+C+TVNKVC+SGMKA +LA+Q+I+LGINDVV
Sbjct  60   VFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCSSGMKAVMLASQTIELGINDVV  119

Query  669  VAGGMESMSNVHKYFAEARS  728
            VAGGMESMSN  KY A+AR+
Sbjct  120  VAGGMESMSNAPKYLAQARN  139



>gb|AID51434.1| acetoacetyl-coenzyme A thiolase [Astragalus membranaceus]
Length=384

 Score =   227 bits (578),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +2

Query  1268  LSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLGQAPARQAALGAGIPNTVV  1447
              SS+PATKLGS AIE+ALKR +VDPSLVEEVFFGNVLSANLGQAPARQAALGAG+P +VV
Sbjct  11    FSSVPATKLGSTAIEAALKRANVDPSLVEEVFFGNVLSANLGQAPARQAALGAGLPKSVV  70

Query  1448  CSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNVPKYFAEARKGSRLGHDSLV  1627
             C+TVNKVCASGMKATMLAAQSIQLGINDVV+AGGME+MS+VPKY AEARKGSRLGHDSLV
Sbjct  71    CTTVNKVCASGMKATMLAAQSIQLGINDVVIAGGMENMSSVPKYLAEARKGSRLGHDSLV  130

Query  1628  DGML  1639
             DGML
Sbjct  131   DGML  134


 Score =   189 bits (480),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = +3

Query  399  LSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGANLGQAPARQAALGAGIPNTVV  578
             SS+PATKLGS AIE+ALKRA+VDPSLVEEVFFGNVL ANLGQAPARQAALGAG+P +VV
Sbjct  11   FSSVPATKLGSTAIEAALKRANVDPSLVEEVFFGNVLSANLGQAPARQAALGAGLPKSVV  70

Query  579  CSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNVHKYFAEAR  725
            C+TVNKVCASGMKAT+LAAQSIQLGINDVV+AGGME+MS+V KY AEAR
Sbjct  71   CTTVNKVCASGMKATMLAAQSIQLGINDVVIAGGMENMSSVPKYLAEAR  119



>dbj|BAH57117.1| AT5G47720 [Arabidopsis thaliana]
Length=396

 Score =   227 bits (578),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/196 (60%), Positives = 141/196 (72%), Gaps = 40/196 (20%)
 Frame = +2

Query  1172  LAMAPATAETINA----RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVD  1339
             L+  PA   T ++     DVC+VGVARTP+G FLGSLSSL AT+LGSIAI++ALKR  VD
Sbjct  3     LSFDPAVMATYSSVPVCADVCVVGVARTPIGDFLGSLSSLTATRLGSIAIQAALKRAHVD  62

Query  1340  PSLVEEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQL  1519
             P+LVEEVFFGNVL+ANLGQAPARQAALGAGIP +V+C+T+NKVCA+GMK+ MLA+QSIQL
Sbjct  63    PALVEEVFFGNVLTANLGQAPARQAALGAGIPYSVICTTINKVCAAGMKSVMLASQSIQL  122

Query  1520  GINDVVVAGGMESMSNVPKYFAEA------------------------------------  1591
             G+ND+VVAGGMESMSNVPKY  +A                                    
Sbjct  123   GLNDIVVAGGMESMSNVPKYLPDARCFLSFLTQTCRNKPKRGIFHLFLSSRLFFTLISVS  182

Query  1592  RKGSRLGHDSLVDGML  1639
             R+GSRLGHD++VDGM+
Sbjct  183   RRGSRLGHDTVVDGMM  198


 Score =   212 bits (539),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 125/145 (86%), Gaps = 4/145 (3%)
 Frame = +3

Query  303  LAMAPATAETINA----RDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVD  470
            L+  PA   T ++     DVC+VGVARTP+G FLGSLSSL AT+LGS+AI++ALKRA VD
Sbjct  3    LSFDPAVMATYSSVPVCADVCVVGVARTPIGDFLGSLSSLTATRLGSIAIQAALKRAHVD  62

Query  471  PSLVEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQL  650
            P+LVEEVFFGNVL ANLGQAPARQAALGAGIP +V+C+T+NKVCA+GMK+ +LA+QSIQL
Sbjct  63   PALVEEVFFGNVLTANLGQAPARQAALGAGIPYSVICTTINKVCAAGMKSVMLASQSIQL  122

Query  651  GINDVVVAGGMESMSNVHKYFAEAR  725
            G+ND+VVAGGMESMSNV KY  +AR
Sbjct  123  GLNDIVVAGGMESMSNVPKYLPDAR  147



>gb|KJB68524.1| hypothetical protein B456_010G248300 [Gossypium raimondii]
Length=403

 Score =   227 bits (579),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 139/154 (90%), Gaps = 1/154 (1%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAP  +  I  RD CIVGVARTPMGGFLGSLSS  AT LGS+AI++AL+R ++DPSLV+E
Sbjct  1     MAPPDS-MIKPRDACIVGVARTPMGGFLGSLSSSSATHLGSLAIKAALQRANLDPSLVQE  59

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPN+V+C+TVNKVC+SGMKA MLA+Q+I+LGINDVV
Sbjct  60    VFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCSSGMKAVMLASQTIELGINDVV  119

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSN PKY A+AR GSR+GHD+++DGML
Sbjct  120   VAGGMESMSNAPKYLAQARNGSRMGHDTVIDGML  153


 Score =   197 bits (502),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 125/140 (89%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAP  +  I  RD CIVGVARTPMGGFLGSLSS  AT LGSLAI++AL+RA++DPSLV+E
Sbjct  1    MAPPDS-MIKPRDACIVGVARTPMGGFLGSLSSSSATHLGSLAIKAALQRANLDPSLVQE  59

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPN+V+C+TVNKVC+SGMKA +LA+Q+I+LGINDVV
Sbjct  60   VFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCSSGMKAVMLASQTIELGINDVV  119

Query  669  VAGGMESMSNVHKYFAEARS  728
            VAGGMESMSN  KY A+AR+
Sbjct  120  VAGGMESMSNAPKYLAQARN  139



>gb|KJB68523.1| hypothetical protein B456_010G248300 [Gossypium raimondii]
Length=415

 Score =   227 bits (579),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 139/154 (90%), Gaps = 1/154 (1%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAP  +  I  RD CIVGVARTPMGGFLGSLSS  AT LGS+AI++AL+R ++DPSLV+E
Sbjct  1     MAPPDS-MIKPRDACIVGVARTPMGGFLGSLSSSSATHLGSLAIKAALQRANLDPSLVQE  59

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPN+V+C+TVNKVC+SGMKA MLA+Q+I+LGINDVV
Sbjct  60    VFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCSSGMKAVMLASQTIELGINDVV  119

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSN PKY A+AR GSR+GHD+++DGML
Sbjct  120   VAGGMESMSNAPKYLAQARNGSRMGHDTVIDGML  153


 Score =   198 bits (503),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 125/140 (89%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAP  +  I  RD CIVGVARTPMGGFLGSLSS  AT LGSLAI++AL+RA++DPSLV+E
Sbjct  1    MAPPDS-MIKPRDACIVGVARTPMGGFLGSLSSSSATHLGSLAIKAALQRANLDPSLVQE  59

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPN+V+C+TVNKVC+SGMKA +LA+Q+I+LGINDVV
Sbjct  60   VFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCSSGMKAVMLASQTIELGINDVV  119

Query  669  VAGGMESMSNVHKYFAEARS  728
            VAGGMESMSN  KY A+AR+
Sbjct  120  VAGGMESMSNAPKYLAQARN  139



>gb|KHG07894.1| hypothetical protein F383_03812 [Gossypium arboreum]
Length=415

 Score =   227 bits (579),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 140/154 (91%), Gaps = 1/154 (1%)
 Frame = +2

Query  1178  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEE  1357
             MAP  +  I  +DVCIVGVARTPMGGFLGSLSS  AT LGS+AI++AL+R ++DPSLV+E
Sbjct  1     MAPPDS-MIKPKDVCIVGVARTPMGGFLGSLSSSSATHLGSLAIKAALQRANLDPSLVQE  59

Query  1358  VFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVV  1537
             VFFGNVLSANLGQAPARQAALGAGIPN+V+C+TVNKVC+SGMKA MLA+Q+I+LGINDVV
Sbjct  60    VFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCSSGMKAVMLASQTIELGINDVV  119

Query  1538  VAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VAGGMESMSN PKY A+AR GSR+GHD+++DGML
Sbjct  120   VAGGMESMSNAPKYLAQARNGSRMGHDTVIDGML  153


 Score =   198 bits (503),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 126/140 (90%), Gaps = 1/140 (1%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            MAP  +  I  +DVCIVGVARTPMGGFLGSLSS  AT LGSLAI++AL+RA++DPSLV+E
Sbjct  1    MAPPDS-MIKPKDVCIVGVARTPMGGFLGSLSSSSATHLGSLAIKAALQRANLDPSLVQE  59

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQAALGAGIPN+V+C+TVNKVC+SGMKA +LA+Q+I+LGINDVV
Sbjct  60   VFFGNVLSANLGQAPARQAALGAGIPNSVICTTVNKVCSSGMKAVMLASQTIELGINDVV  119

Query  669  VAGGMESMSNVHKYFAEARS  728
            VAGGMESMSN  KY A+AR+
Sbjct  120  VAGGMESMSNAPKYLAQARN  139



>ref|XP_007154060.1| hypothetical protein PHAVU_003G087600g [Phaseolus vulgaris]
 ref|XP_007154061.1| hypothetical protein PHAVU_003G087600g [Phaseolus vulgaris]
 gb|ESW26054.1| hypothetical protein PHAVU_003G087600g [Phaseolus vulgaris]
 gb|ESW26055.1| hypothetical protein PHAVU_003G087600g [Phaseolus vulgaris]
Length=409

 Score =   225 bits (573),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = +2

Query  1199  TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVL  1378
             ++ +RDVCIVGVARTP+GG LGSLSSL AT+LGSI I++ALKR +VDPSLV+EVFFGNVL
Sbjct  4     SVKSRDVCIVGVARTPIGGLLGSLSSLSATELGSIVIKNALKRANVDPSLVQEVFFGNVL  63

Query  1379  SANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMES  1558
             SANLGQAPARQAALGAGIP +V+C+T+NKVCASGMKATMLAA +IQ G+ND+VV GGMES
Sbjct  64    SANLGQAPARQAALGAGIPTSVICTTINKVCASGMKATMLAALTIQFGLNDIVVVGGMES  123

Query  1559  MSNVPKYFAEARKGSRLGHDSLVDGML  1639
             MSN PKY AEARKGSR GHD+++DGM+
Sbjct  124   MSNSPKYLAEARKGSRYGHDTIIDGMV  150


 Score =   192 bits (488),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 131/160 (82%), Gaps = 4/160 (3%)
 Frame = +3

Query  330  TINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVL  509
            ++ +RDVCIVGVARTP+GG LGSLSSL AT+LGS+ I++ALKRA+VDPSLV+EVFFGNVL
Sbjct  4    SVKSRDVCIVGVARTPIGGLLGSLSSLSATELGSIVIKNALKRANVDPSLVQEVFFGNVL  63

Query  510  GANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMES  689
             ANLGQAPARQAALGAGIP +V+C+T+NKVCASGMKAT+LAA +IQ G+ND+VV GGMES
Sbjct  64   SANLGQAPARQAALGAGIPTSVICTTINKVCASGMKATMLAALTIQFGLNDIVVVGGMES  123

Query  690  MSNVHKYFAEARSISNNIW*ISTAVVSLISDKV--VQNSF  803
            MSN  KY AEAR  S   +   T +  ++ D +  V N F
Sbjct  124  MSNSPKYLAEARKGSR--YGHDTIIDGMVKDGLWDVYNDF  161



>gb|EPS62555.1| hypothetical protein M569_12233, partial [Genlisea aurea]
Length=348

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  1172  LAMAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLV  1351
             + MA    +++ A+DVCIVGVARTP+G FLGSLSSL ATKLGS+AIE ALKR  VDPS+V
Sbjct  2     ITMASGAHDSVRAQDVCIVGVARTPLGSFLGSLSSLSATKLGSVAIECALKRAGVDPSMV  61

Query  1352  EEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGIND  1531
             +EVFFGNVLSANLGQAPARQAALGAGIP++V C+T+NKVC+SGMKATM+AAQ+I+LG ND
Sbjct  62    QEVFFGNVLSANLGQAPARQAALGAGIPDSVPCTTINKVCSSGMKATMIAAQTIRLGTND  121

Query  1532  VVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             VVVAGGMESMSN PKY +  R GSRLG+D+++DGM+
Sbjct  122   VVVAGGMESMSNAPKYISTGRAGSRLGNDTIIDGMI  157


 Score =   194 bits (492),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +3

Query  303  LAMAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLV  482
            + MA    +++ A+DVCIVGVARTP+G FLGSLSSL ATKLGS+AIE ALKRA VDPS+V
Sbjct  2    ITMASGAHDSVRAQDVCIVGVARTPLGSFLGSLSSLSATKLGSVAIECALKRAGVDPSMV  61

Query  483  EEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGIND  662
            +EVFFGNVL ANLGQAPARQAALGAGIP++V C+T+NKVC+SGMKAT++AAQ+I+LG ND
Sbjct  62   QEVFFGNVLSANLGQAPARQAALGAGIPDSVPCTTINKVCSSGMKATMIAAQTIRLGTND  121

Query  663  VVVAGGMESMSNVHKYFAEARS  728
            VVVAGGMESMSN  KY +  R+
Sbjct  122  VVVAGGMESMSNAPKYISTGRA  143



>ref|XP_001773218.1| predicted protein [Physcomitrella patens]
 gb|EDQ61908.1| predicted protein [Physcomitrella patens]
Length=404

 Score =   216 bits (549),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = +2

Query  1196  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  1375
             ++I  RDVCIVGVARTPMGG  GSLSSL ATKLGS AI++A+KR  VDPSLVEEVFFGNV
Sbjct  7     DSIAPRDVCIVGVARTPMGGLSGSLSSLSATKLGSTAIQAAVKRSGVDPSLVEEVFFGNV  66

Query  1376  LSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGME  1555
             LSANLGQAPARQA++GAG+PNT  C+TVNKVCASGMKA MLAAQSIQLG NDVVVAGGME
Sbjct  67    LSANLGQAPARQASIGAGLPNTAPCTTVNKVCASGMKAVMLAAQSIQLGQNDVVVAGGME  126

Query  1556  SMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             SMSN P Y  +AR G R GH  +VDGML
Sbjct  127   SMSNAPYYLPKARGGLRFGHGEVVDGML  154


 Score =   191 bits (484),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +3

Query  309  MAPATAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEE  488
            M     ++I  RDVCIVGVARTPMGG  GSLSSL ATKLGS AI++A+KR+ VDPSLVEE
Sbjct  1    MGSDAPDSIAPRDVCIVGVARTPMGGLSGSLSSLSATKLGSTAIQAAVKRSGVDPSLVEE  60

Query  489  VFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVV  668
            VFFGNVL ANLGQAPARQA++GAG+PNT  C+TVNKVCASGMKA +LAAQSIQLG NDVV
Sbjct  61   VFFGNVLSANLGQAPARQASIGAGLPNTAPCTTVNKVCASGMKAVMLAAQSIQLGQNDVV  120

Query  669  VAGGMESMSNVHKYFAEAR  725
            VAGGMESMSN   Y  +AR
Sbjct  121  VAGGMESMSNAPYYLPKAR  139



>gb|AFQ62006.1| acetyl-CoA acetyltransferase, partial [Euphorbia lathyris]
Length=365

 Score =   213 bits (541),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  1295  GSIAIESALKRGSVDPSLVEEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCA  1474
             GSIAI +AL+R ++DPSLV+EVFFGNVLSANLGQAPARQAALGAG+PN+VVC+TVNKVCA
Sbjct  1     GSIAIGAALRRANIDPSLVQEVFFGNVLSANLGQAPARQAALGAGLPNSVVCTTVNKVCA  60

Query  1475  SGMKATMLAAQSIQLGINDVVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             SGMKATMLAAQSIQLGINDVVV+GGMESMSNVPKY AEARKGSRLGHDSLVDGML
Sbjct  61    SGMKATMLAAQSIQLGINDVVVSGGMESMSNVPKYLAEARKGSRLGHDSLVDGML  115


 Score =   175 bits (443),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 96/100 (96%), Gaps = 0/100 (0%)
 Frame = +3

Query  426  GSLAIESALKRASVDPSLVEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCA  605
            GS+AI +AL+RA++DPSLV+EVFFGNVL ANLGQAPARQAALGAG+PN+VVC+TVNKVCA
Sbjct  1    GSIAIGAALRRANIDPSLVQEVFFGNVLSANLGQAPARQAALGAGLPNSVVCTTVNKVCA  60

Query  606  SGMKATILAAQSIQLGINDVVVAGGMESMSNVHKYFAEAR  725
            SGMKAT+LAAQSIQLGINDVVV+GGMESMSNV KY AEAR
Sbjct  61   SGMKATMLAAQSIQLGINDVVVSGGMESMSNVPKYLAEAR  100



>emb|CDY05692.1| BnaC02g38450D [Brassica napus]
Length=219

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/150 (66%), Positives = 112/150 (75%), Gaps = 16/150 (11%)
 Frame = +2

Query  1190  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFG  1369
             +A+++N RDVCIVGVARTPMGGFLGSLSSLPATKLGS+A  +ALKR +VDPSLV+EV FG
Sbjct  4     SADSVNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSVATAAALKRANVDPSLVQEVVFG  63

Query  1370  NVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGG  1549
             NVLSANLGQAPARQAALGAGI N+V+C+TV +             +S      D      
Sbjct  64    NVLSANLGQAPARQAALGAGISNSVICTTVKQ-------GLCFRHESGDACCPD------  110

Query  1550  MESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
                MSN PKY AEARKGSR GHDSLVDGML
Sbjct  111   ---MSNTPKYLAEARKGSRFGHDSLVDGML  137


 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 97/135 (72%), Gaps = 16/135 (12%)
 Frame = +3

Query  321  TAETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFG  500
            +A+++N RDVCIVGVARTPMGGFLGSLSSLPATKLGS+A  +ALKRA+VDPSLV+EV FG
Sbjct  4    SADSVNPRDVCIVGVARTPMGGFLGSLSSLPATKLGSVATAAALKRANVDPSLVQEVVFG  63

Query  501  NVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGG  680
            NVL ANLGQAPARQAALGAGI N+V+C+TV        +      +S      D      
Sbjct  64   NVLSANLGQAPARQAALGAGISNSVICTTVK-------QGLCFRHESGDACCPD------  110

Query  681  MESMSNVHKYFAEAR  725
               MSN  KY AEAR
Sbjct  111  ---MSNTPKYLAEAR  122



>ref|WP_020082106.1| acetyl-CoA acetyltransferase [Flavobacterium sp. SCGC AAA160-P02]
Length=393

 Score =   191 bits (485),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 119/145 (82%), Gaps = 1/145 (1%)
 Frame = +2

Query  1202  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLS  1381
             +N RDV IV VARTP+G F+GSLSS+PA KLG+IAI+ AL++  +DP+LV+EVF GNV+S
Sbjct  1     MNTRDVVIVAVARTPIGSFMGSLSSIPAPKLGAIAIKGALEKIKLDPNLVDEVFMGNVVS  60

Query  1382  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESM  1561
             A LGQAPARQAA+ AGI +TV C+T+NKVCASGMK+ MLAAQSI LG  D+VVAGGME+M
Sbjct  61    AGLGQAPARQAAIFAGISDTVPCTTINKVCASGMKSVMLAAQSIALGDADIVVAGGMENM  120

Query  1562  SNVPKYFAEARKGSRLGHDSLVDGM  1636
             S++P Y    R+G++ G  +L DGM
Sbjct  121   SSIPHYL-HGRQGTKFGPTTLEDGM  144


 Score =   172 bits (436),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +3

Query  333  INARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLG  512
            +N RDV IV VARTP+G F+GSLSS+PA KLG++AI+ AL++  +DP+LV+EVF GNV+ 
Sbjct  1    MNTRDVVIVAVARTPIGSFMGSLSSIPAPKLGAIAIKGALEKIKLDPNLVDEVFMGNVVS  60

Query  513  ANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESM  692
            A LGQAPARQAA+ AGI +TV C+T+NKVCASGMK+ +LAAQSI LG  D+VVAGGME+M
Sbjct  61   AGLGQAPARQAAIFAGISDTVPCTTINKVCASGMKSVMLAAQSIALGDADIVVAGGMENM  120

Query  693  SNVHKYF  713
            S++  Y 
Sbjct  121  SSIPHYL  127



>gb|EMS56611.1| putative acetyl-CoA acetyltransferase, cytosolic 2 [Triticum 
urartu]
Length=367

 Score =   188 bits (478),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +2

Query  1352  EEVFFGNVLSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGIND  1531
             EEVFFGNVLSANLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKATM AAQSIQLGIND
Sbjct  22    EEVFFGNVLSANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATMFAAQSIQLGIND  81

Query  1532  VVVAGGMESMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             +VVAGGMESMSN PKY AEARKGSR GHDSLVDGML
Sbjct  82    IVVAGGMESMSNAPKYIAEARKGSRFGHDSLVDGML  117


 Score =   151 bits (381),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 81/93 (87%), Gaps = 2/93 (2%)
 Frame = +3

Query  447  ALKRASVDPSLVEEVFFGNVLGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATI  626
            AL+R  V     EEVFFGNVL ANLGQAPARQAALGAGIPNTVVC+TVNKVCASGMKAT+
Sbjct  12   ALERPWVQTP--EEVFFGNVLSANLGQAPARQAALGAGIPNTVVCTTVNKVCASGMKATM  69

Query  627  LAAQSIQLGINDVVVAGGMESMSNVHKYFAEAR  725
             AAQSIQLGIND+VVAGGMESMSN  KY AEAR
Sbjct  70   FAAQSIQLGINDIVVAGGMESMSNAPKYIAEAR  102



>gb|ESA20734.1| hypothetical protein GLOINDRAFT_43599, partial [Rhizophagus irregularis 
DAOM 181602]
Length=257

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = +2

Query  1214  DVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLG  1393
             DV I  +ARTP+GGF GSL+SL A KLGSIA+E+ALK+  ++P+ V+EVFFGNVLSA LG
Sbjct  1     DVYIAAIARTPLGGFNGSLASLSAVKLGSIAVEAALKKAKIEPNNVQEVFFGNVLSAGLG  60

Query  1394  QAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNVP  1573
             Q PARQ ALGAGIP+ V+ +TVNKVCASGMKA +L  Q+I  G  D+VVAGG ESM+N P
Sbjct  61    QNPARQVALGAGIPDNVIATTVNKVCASGMKAVILGTQTIITGNADIVVAGGTESMTNTP  120

Query  1574  KYFAEARKGSRLGHDSLVDGML  1639
              Y   AR GS+ G  +LVDG++
Sbjct  121   YYVPSARFGSKYGDQTLVDGIV  142


 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +3

Query  345  DVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGANLG  524
            DV I  +ARTP+GGF GSL+SL A KLGS+A+E+ALK+A ++P+ V+EVFFGNVL A LG
Sbjct  1    DVYIAAIARTPLGGFNGSLASLSAVKLGSIAVEAALKKAKIEPNNVQEVFFGNVLSAGLG  60

Query  525  QAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNVH  704
            Q PARQ ALGAGIP+ V+ +TVNKVCASGMKA IL  Q+I  G  D+VVAGG ESM+N  
Sbjct  61   QNPARQVALGAGIPDNVIATTVNKVCASGMKAVILGTQTIITGNADIVVAGGTESMTNTP  120

Query  705  KYFAEAR  725
             Y   AR
Sbjct  121  YYVPSAR  127



>ref|WP_036784849.1| acetyl-CoA acetyltransferase [Polaribacter sp. Hel1_33_49]
 gb|KGL60258.1| acetyl-CoA acetyltransferase [Polaribacter sp. Hel1_33_49]
Length=391

 Score =   187 bits (474),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  1211  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANL  1390
             +DV IV VARTP+G F+GSLSS+PA KLG+IAI+ AL + ++D  LVEEVF GNV+SA L
Sbjct  2     KDVVIVSVARTPLGSFMGSLSSIPAPKLGAIAIKGALGKINLDAKLVEEVFMGNVVSAGL  61

Query  1391  GQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNV  1570
             GQAPARQAA+ AGIPNTV C+TVNKVCASGMKA MLAAQ+I +G  D+VVAGGME+MS++
Sbjct  62    GQAPARQAAIHAGIPNTVPCTTVNKVCASGMKAIMLAAQTIAIGDADIVVAGGMENMSSI  121

Query  1571  PKYFAEARKGSRLGHDSLVDGM  1636
             P Y  +AR G++ G  ++ DG+
Sbjct  122   PHY-QQARNGTKFGPITMEDGL  142


 Score =   169 bits (429),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 103/123 (84%), Gaps = 0/123 (0%)
 Frame = +3

Query  342  RDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGANL  521
            +DV IV VARTP+G F+GSLSS+PA KLG++AI+ AL + ++D  LVEEVF GNV+ A L
Sbjct  2    KDVVIVSVARTPLGSFMGSLSSIPAPKLGAIAIKGALGKINLDAKLVEEVFMGNVVSAGL  61

Query  522  GQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNV  701
            GQAPARQAA+ AGIPNTV C+TVNKVCASGMKA +LAAQ+I +G  D+VVAGGME+MS++
Sbjct  62   GQAPARQAAIHAGIPNTVPCTTVNKVCASGMKAIMLAAQTIAIGDADIVVAGGMENMSSI  121

Query  702  HKY  710
              Y
Sbjct  122  PHY  124



>ref|WP_026777333.1| acetyl-CoA acetyltransferase [Polaribacter sp. Hel_I_88]
Length=391

 Score =   186 bits (471),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  1211  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANL  1390
             +DV IV VARTP+G F+GSLS++PAT LG+ AI+ AL + ++DPSLV+EVF GNV+SA L
Sbjct  2     KDVVIVSVARTPIGSFMGSLSTIPATILGATAIKGALNKINLDPSLVQEVFMGNVVSAGL  61

Query  1391  GQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNV  1570
             GQAPARQAA+ AGIP+TV C+TVNKVCASGMK+ MLAAQ+I LG  D+VVAGGME+MS +
Sbjct  62    GQAPARQAAIHAGIPDTVPCTTVNKVCASGMKSIMLAAQTIALGDADIVVAGGMENMSLI  121

Query  1571  PKYFAEARKGSRLGHDSLVDGM  1636
             P Y  +AR GS+ G  ++ DGM
Sbjct  122   PHY-QQARTGSKFGPITMEDGM  142


 Score =   167 bits (424),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 107/129 (83%), Gaps = 1/129 (1%)
 Frame = +3

Query  342  RDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGANL  521
            +DV IV VARTP+G F+GSLS++PAT LG+ AI+ AL + ++DPSLV+EVF GNV+ A L
Sbjct  2    KDVVIVSVARTPIGSFMGSLSTIPATILGATAIKGALNKINLDPSLVQEVFMGNVVSAGL  61

Query  522  GQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNV  701
            GQAPARQAA+ AGIP+TV C+TVNKVCASGMK+ +LAAQ+I LG  D+VVAGGME+MS +
Sbjct  62   GQAPARQAAIHAGIPDTVPCTTVNKVCASGMKSIMLAAQTIALGDADIVVAGGMENMSLI  121

Query  702  HKYFAEARS  728
              Y  +AR+
Sbjct  122  PHY-QQART  129



>ref|WP_036822109.1| acetyl-CoA acetyltransferase [Polaribacter sp. Hel1_85]
 gb|KGL64065.1| acetyl-CoA acetyltransferase [Polaribacter sp. Hel1_85]
Length=391

 Score =   185 bits (470),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 119/142 (84%), Gaps = 1/142 (1%)
 Frame = +2

Query  1211  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANL  1390
             ++V IV VARTP+G F+GSLS++PA KLG+IAI+ AL++ ++ P+LVEEVF GNV+SA L
Sbjct  2     KEVVIVSVARTPIGSFMGSLSTIPAPKLGAIAIKGALEKINLAPNLVEEVFMGNVVSAGL  61

Query  1391  GQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNV  1570
             GQAPARQAA+ AGIP+TV C+TVNKVCASGMK+ MLAAQ+I LG  D++VAGGME+MS++
Sbjct  62    GQAPARQAAIFAGIPDTVPCTTVNKVCASGMKSIMLAAQTIALGDADIIVAGGMENMSSI  121

Query  1571  PKYFAEARKGSRLGHDSLVDGM  1636
             P Y   ARKGS+ G  ++ DGM
Sbjct  122   PHY-QNARKGSKFGPITMEDGM  142


 Score =   165 bits (417),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +3

Query  342  RDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGANL  521
            ++V IV VARTP+G F+GSLS++PA KLG++AI+ AL++ ++ P+LVEEVF GNV+ A L
Sbjct  2    KEVVIVSVARTPIGSFMGSLSTIPAPKLGAIAIKGALEKINLAPNLVEEVFMGNVVSAGL  61

Query  522  GQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNV  701
            GQAPARQAA+ AGIP+TV C+TVNKVCASGMK+ +LAAQ+I LG  D++VAGGME+MS++
Sbjct  62   GQAPARQAAIFAGIPDTVPCTTVNKVCASGMKSIMLAAQTIALGDADIIVAGGMENMSSI  121

Query  702  HKY  710
              Y
Sbjct  122  PHY  124



>gb|EXX68470.1| acetyl-CoA C-acetyltransferase [Rhizophagus irregularis DAOM 
197198w]
Length=396

 Score =   185 bits (469),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = +2

Query  1211  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANL  1390
             +DV I  +ARTP+GGF GSL+SL A KLGSIA+E+ALK+  ++P+ V+EVFFGNVLSA L
Sbjct  4     KDVYIAAIARTPLGGFNGSLASLSAVKLGSIAVEAALKKAKIEPNNVQEVFFGNVLSAGL  63

Query  1391  GQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNV  1570
             GQ PARQ ALGAGIP+ V+ +TVNKVCASGMKA +L  Q+I  G  D+VVAGG ESM+N 
Sbjct  64    GQNPARQVALGAGIPDNVIATTVNKVCASGMKAVILGTQTIITGNADIVVAGGTESMTNT  123

Query  1571  PKYFAEARKGSRLGHDSLVDGML  1639
             P Y   AR GS+ G  +LVDG++
Sbjct  124   PYYVPSARFGSKYGDQTLVDGIV  146


 Score =   166 bits (421),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 100/128 (78%), Gaps = 0/128 (0%)
 Frame = +3

Query  342  RDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGANL  521
            +DV I  +ARTP+GGF GSL+SL A KLGS+A+E+ALK+A ++P+ V+EVFFGNVL A L
Sbjct  4    KDVYIAAIARTPLGGFNGSLASLSAVKLGSIAVEAALKKAKIEPNNVQEVFFGNVLSAGL  63

Query  522  GQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNV  701
            GQ PARQ ALGAGIP+ V+ +TVNKVCASGMKA IL  Q+I  G  D+VVAGG ESM+N 
Sbjct  64   GQNPARQVALGAGIPDNVIATTVNKVCASGMKAVILGTQTIITGNADIVVAGGTESMTNT  123

Query  702  HKYFAEAR  725
              Y   AR
Sbjct  124  PYYVPSAR  131



>ref|WP_034258137.1| acetyl-CoA acetyltransferase [Altibacter lentus]
Length=392

 Score =   185 bits (469),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 114/143 (80%), Gaps = 1/143 (1%)
 Frame = +2

Query  1208  ARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSAN  1387
             +++V IV  ARTP+G F+GSLSSL AT+LGS AI+ AL +  +DPSLV+EV+ GNV+ A 
Sbjct  2     SKEVVIVAAARTPIGSFMGSLSSLTATQLGSAAIKGALDKIQLDPSLVQEVYMGNVVQAG  61

Query  1388  LGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSN  1567
             +GQAPARQAALGAGIP+TV C+TVNKVCASGMKA M AAQ+I LG  D++VAGGMESMSN
Sbjct  62    VGQAPARQAALGAGIPDTVPCTTVNKVCASGMKAVMNAAQAIALGDADIIVAGGMESMSN  121

Query  1568  VPKYFAEARKGSRLGHDSLVDGM  1636
             +P Y    R G + G  SLVDGM
Sbjct  122   IPHYV-HMRNGVKFGPASLVDGM  143


 Score =   168 bits (425),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +3

Query  339  ARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGAN  518
            +++V IV  ARTP+G F+GSLSSL AT+LGS AI+ AL +  +DPSLV+EV+ GNV+ A 
Sbjct  2    SKEVVIVAAARTPIGSFMGSLSSLTATQLGSAAIKGALDKIQLDPSLVQEVYMGNVVQAG  61

Query  519  LGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSN  698
            +GQAPARQAALGAGIP+TV C+TVNKVCASGMKA + AAQ+I LG  D++VAGGMESMSN
Sbjct  62   VGQAPARQAALGAGIPDTVPCTTVNKVCASGMKAVMNAAQAIALGDADIIVAGGMESMSN  121

Query  699  VHKY  710
            +  Y
Sbjct  122  IPHY  125



>ref|WP_028980206.1| acetyl-CoA acetyltransferase [Sporocytophaga myxococcoides]
Length=392

 Score =   185 bits (469),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 113/143 (79%), Gaps = 0/143 (0%)
 Frame = +2

Query  1211  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANL  1390
             ++V I+   RTP+G F GSL++  AT+LGSIAI+  L++  + PS VEEV  GNVL+ANL
Sbjct  2     KEVYIISAVRTPIGSFGGSLANFSATQLGSIAIKGVLEKSKIKPSDVEEVIMGNVLTANL  61

Query  1391  GQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNV  1570
             GQAPARQAA+ AG+P +VVC+T+NKVCASGMKA ML AQSI LG  D+V+AGGMESMSNV
Sbjct  62    GQAPARQAAIFAGLPTSVVCTTINKVCASGMKAVMLGAQSIMLGNADIVIAGGMESMSNV  121

Query  1571  PKYFAEARKGSRLGHDSLVDGML  1639
             P Y   AR G RLGH +++DG++
Sbjct  122   PYYADRARFGLRLGHGTMIDGII  144


 Score =   160 bits (405),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 100/128 (78%), Gaps = 0/128 (0%)
 Frame = +3

Query  342  RDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGANL  521
            ++V I+   RTP+G F GSL++  AT+LGS+AI+  L+++ + PS VEEV  GNVL ANL
Sbjct  2    KEVYIISAVRTPIGSFGGSLANFSATQLGSIAIKGVLEKSKIKPSDVEEVIMGNVLTANL  61

Query  522  GQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNV  701
            GQAPARQAA+ AG+P +VVC+T+NKVCASGMKA +L AQSI LG  D+V+AGGMESMSNV
Sbjct  62   GQAPARQAAIFAGLPTSVVCTTINKVCASGMKAVMLGAQSIMLGNADIVIAGGMESMSNV  121

Query  702  HKYFAEAR  725
              Y   AR
Sbjct  122  PYYADRAR  129



>ref|WP_004570201.1| acetyl-CoA acetyltransferase [Polaribacter irgensii]
 gb|EAR12533.1| acetyl-CoA acetyltransferase [Polaribacter irgensii 23-P]
Length=391

 Score =   184 bits (468),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +2

Query  1211  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANL  1390
             ++V IV VARTP+G F+GSL+++PATKLG+IAI+ AL++ ++ PS+VEEVF GNV+SA L
Sbjct  2     KEVVIVAVARTPIGSFMGSLATIPATKLGAIAIKGALEKINLAPSMVEEVFMGNVVSAGL  61

Query  1391  GQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNV  1570
             GQAPARQAA+ AGIP+TV C+TVNKVCASGMKA MLAAQ+I LG  ++VVAGGME+MS++
Sbjct  62    GQAPARQAAIYAGIPDTVPCTTVNKVCASGMKAIMLAAQTIALGDAEIVVAGGMENMSSI  121

Query  1571  PKYFAEARKGSRLGHDSLVDGM  1636
             P Y   AR G + G  +L DGM
Sbjct  122   PHY-QHARNGIKFGGITLEDGM  142


 Score =   167 bits (423),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +3

Query  342  RDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGANL  521
            ++V IV VARTP+G F+GSL+++PATKLG++AI+ AL++ ++ PS+VEEVF GNV+ A L
Sbjct  2    KEVVIVAVARTPIGSFMGSLATIPATKLGAIAIKGALEKINLAPSMVEEVFMGNVVSAGL  61

Query  522  GQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNV  701
            GQAPARQAA+ AGIP+TV C+TVNKVCASGMKA +LAAQ+I LG  ++VVAGGME+MS++
Sbjct  62   GQAPARQAAIYAGIPDTVPCTTVNKVCASGMKAIMLAAQTIALGDAEIVVAGGMENMSSI  121

Query  702  HKY  710
              Y
Sbjct  122  PHY  124



>ref|XP_001619139.1| hypothetical protein NEMVEDRAFT_v1g46486 [Nematostella vectensis]
 gb|EDO27039.1| predicted protein, partial [Nematostella vectensis]
Length=184

 Score =   177 bits (450),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 115/142 (81%), Gaps = 1/142 (1%)
 Frame = +2

Query  1211  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANL  1390
             ++V IV VARTP+G F+GSLSS+PA KLG+IAI+ AL + ++ P++V+EVF GNV+SA L
Sbjct  2     KEVVIVSVARTPIGSFMGSLSSIPAPKLGAIAIKGALDKINLQPNMVQEVFMGNVVSAGL  61

Query  1391  GQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNV  1570
             GQAPARQAA+ AGIP+TV C+TVNKVC+SGMK+ MLAAQ+I LG  ++VVAGGME+MS +
Sbjct  62    GQAPARQAAIFAGIPDTVPCTTVNKVCSSGMKSIMLAAQTIALGDAEIVVAGGMENMSMI  121

Query  1571  PKYFAEARKGSRLGHDSLVDGM  1636
             P Y   AR GS+ G   + DGM
Sbjct  122   PHY-QHARSGSKFGPIKMEDGM  142


 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 106/129 (82%), Gaps = 1/129 (1%)
 Frame = +3

Query  342  RDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGANL  521
            ++V IV VARTP+G F+GSLSS+PA KLG++AI+ AL + ++ P++V+EVF GNV+ A L
Sbjct  2    KEVVIVSVARTPIGSFMGSLSSIPAPKLGAIAIKGALDKINLQPNMVQEVFMGNVVSAGL  61

Query  522  GQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNV  701
            GQAPARQAA+ AGIP+TV C+TVNKVC+SGMK+ +LAAQ+I LG  ++VVAGGME+MS +
Sbjct  62   GQAPARQAAIFAGIPDTVPCTTVNKVCSSGMKSIMLAAQTIALGDAEIVVAGGMENMSMI  121

Query  702  HKYFAEARS  728
              Y   ARS
Sbjct  122  PHY-QHARS  129



>ref|WP_013688178.1| acetyl-CoA acetyltransferase [Fluviicola taffensis]
 gb|AEA45411.1| acetyl-CoA acetyltransferase [Fluviicola taffensis DSM 16823]
Length=392

 Score =   184 bits (466),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 114/143 (80%), Gaps = 1/143 (1%)
 Frame = +2

Query  1208  ARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSAN  1387
             +++V I+   RTPMG F+G LSS+PAT+LGS+AI+ AL +  V+PSL++EVF GNVL A 
Sbjct  2     SKEVYIIAAVRTPMGSFMGGLSSIPATQLGSVAIKGALDKSGVNPSLIDEVFMGNVLQAG  61

Query  1388  LGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSN  1567
             +GQAPARQAALGAG+PNTV C+TVNKVCASGMKA ML AQ+I  G N+++VAGGME+MS 
Sbjct  62    VGQAPARQAALGAGLPNTVPCTTVNKVCASGMKAIMLGAQTILAGDNEIIVAGGMENMSQ  121

Query  1568  VPKYFAEARKGSRLGHDSLVDGM  1636
              P Y  + R G + G+ S++DG+
Sbjct  122   APHYL-DGRNGMKFGNISMLDGI  143


 Score =   167 bits (424),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = +3

Query  339  ARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGAN  518
            +++V I+   RTPMG F+G LSS+PAT+LGS+AI+ AL ++ V+PSL++EVF GNVL A 
Sbjct  2    SKEVYIIAAVRTPMGSFMGGLSSIPATQLGSVAIKGALDKSGVNPSLIDEVFMGNVLQAG  61

Query  519  LGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSN  698
            +GQAPARQAALGAG+PNTV C+TVNKVCASGMKA +L AQ+I  G N+++VAGGME+MS 
Sbjct  62   VGQAPARQAALGAGLPNTVPCTTVNKVCASGMKAIMLGAQTILAGDNEIIVAGGMENMSQ  121

Query  699  VHKYF  713
               Y 
Sbjct  122  APHYL  126



>ref|WP_019987186.1| acetyl-CoA acetyltransferase [Rudanella lutea]
Length=391

 Score =   184 bits (466),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 111/141 (79%), Gaps = 0/141 (0%)
 Frame = +2

Query  1214  DVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANLG  1393
             DV IV   RTP+G F G LS+L AT+LG+ AI+ AL R  V P LVEEV+ GNV+SAN+G
Sbjct  3     DVVIVSAVRTPIGSFGGVLSALSATELGAAAIKGALSRAGVAPELVEEVYMGNVVSANVG  62

Query  1394  QAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNVP  1573
             QAPA+QAAL AG+P TV C+TVNKVCASG KA MLAAQSIQLG+ +VVVAGGMESMSNVP
Sbjct  63    QAPAKQAALKAGLPATVPCTTVNKVCASGTKAIMLAAQSIQLGLAEVVVAGGMESMSNVP  122

Query  1574  KYFAEARKGSRLGHDSLVDGM  1636
              Y  +AR G + G+  LVDG+
Sbjct  123   YYVPKARFGYKYGNAELVDGL  143


 Score =   165 bits (418),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  345  DVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGANLG  524
            DV IV   RTP+G F G LS+L AT+LG+ AI+ AL RA V P LVEEV+ GNV+ AN+G
Sbjct  3    DVVIVSAVRTPIGSFGGVLSALSATELGAAAIKGALSRAGVAPELVEEVYMGNVVSANVG  62

Query  525  QAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNVH  704
            QAPA+QAAL AG+P TV C+TVNKVCASG KA +LAAQSIQLG+ +VVVAGGMESMSNV 
Sbjct  63   QAPAKQAALKAGLPATVPCTTVNKVCASGTKAIMLAAQSIQLGLAEVVVAGGMESMSNVP  122

Query  705  KYFAEAR  725
             Y  +AR
Sbjct  123  YYVPKAR  129



>ref|WP_045469619.1| acetyl-CoA acetyltransferase [Sporocytophaga myxococcoides]
 dbj|GAL87682.1| acetyl-CoA acetyltransferase [Sporocytophaga myxococcoides]
Length=392

 Score =   183 bits (465),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = +2

Query  1211  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANL  1390
             ++V I+   RTP+G F GSL++  AT+LGSIAI+  L +  V PS VEEV  GNVL+ANL
Sbjct  2     KEVYIISAVRTPIGSFGGSLANFSATQLGSIAIKGVLDKSKVKPSDVEEVIMGNVLTANL  61

Query  1391  GQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNV  1570
             GQAPARQAA+ AG+P +VVC+T+NKVCASGMKA ML AQSI LG  D+V+AGGMESMSNV
Sbjct  62    GQAPARQAAIFAGLPTSVVCTTINKVCASGMKAVMLGAQSIMLGNADIVIAGGMESMSNV  121

Query  1571  PKYFAEARKGSRLGHDSLVDGML  1639
             P Y   AR G RLGH ++ DG++
Sbjct  122   PYYADRARFGLRLGHGTMTDGII  144


 Score =   160 bits (404),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 99/128 (77%), Gaps = 0/128 (0%)
 Frame = +3

Query  342  RDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGANL  521
            ++V I+   RTP+G F GSL++  AT+LGS+AI+  L ++ V PS VEEV  GNVL ANL
Sbjct  2    KEVYIISAVRTPIGSFGGSLANFSATQLGSIAIKGVLDKSKVKPSDVEEVIMGNVLTANL  61

Query  522  GQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNV  701
            GQAPARQAA+ AG+P +VVC+T+NKVCASGMKA +L AQSI LG  D+V+AGGMESMSNV
Sbjct  62   GQAPARQAAIFAGLPTSVVCTTINKVCASGMKAVMLGAQSIMLGNADIVIAGGMESMSNV  121

Query  702  HKYFAEAR  725
              Y   AR
Sbjct  122  PYYADRAR  129



>ref|WP_041383877.1| acetyl-CoA acetyltransferase [Polaribacter sp. MED152]
Length=391

 Score =   183 bits (465),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  1211  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANL  1390
             ++V IV VARTP+G F+GSLSS+PATKLG+IAI+ AL + ++D +LV+EVF GNV+SA L
Sbjct  2     KEVVIVSVARTPIGSFMGSLSSIPATKLGAIAIKGALDKINLDANLVQEVFMGNVVSAGL  61

Query  1391  GQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNV  1570
             GQAPARQAA+ AGIP++V C+TVNKVCASGMK+ MLAAQ+I LG  D+ VAGGME+MS++
Sbjct  62    GQAPARQAAIHAGIPDSVPCTTVNKVCASGMKSIMLAAQTIALGDADIAVAGGMENMSSI  121

Query  1571  PKYFAEARKGSRLGHDSLVDGM  1636
             P Y   AR GS+ G  ++ DGM
Sbjct  122   PHY-QHARNGSKFGPITMEDGM  142


 Score =   164 bits (415),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +3

Query  342  RDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGANL  521
            ++V IV VARTP+G F+GSLSS+PATKLG++AI+ AL + ++D +LV+EVF GNV+ A L
Sbjct  2    KEVVIVSVARTPIGSFMGSLSSIPATKLGAIAIKGALDKINLDANLVQEVFMGNVVSAGL  61

Query  522  GQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNV  701
            GQAPARQAA+ AGIP++V C+TVNKVCASGMK+ +LAAQ+I LG  D+ VAGGME+MS++
Sbjct  62   GQAPARQAAIHAGIPDSVPCTTVNKVCASGMKSIMLAAQTIALGDADIAVAGGMENMSSI  121

Query  702  HKY  710
              Y
Sbjct  122  PHY  124



>ref|WP_035077204.1| acetyl-CoA acetyltransferase [Anditalea andensis]
 gb|KEO72562.1| acetyl-CoA acetyltransferase [Anditalea andensis]
Length=392

 Score =   183 bits (464),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = +2

Query  1211  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANL  1390
             ++V I+  ARTP+G F G LSSL A +LGSIAI+ AL +  VD   V+EV  GNVLSANL
Sbjct  2     KEVYIIAAARTPIGSFGGKLSSLTAVELGSIAIKGALAKAQVDAKHVQEVIMGNVLSANL  61

Query  1391  GQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNV  1570
             GQAPARQA++GAGI   V C+TVNKVCASGMKA M AAQSI +G NDVVVAGGMESMSNV
Sbjct  62    GQAPARQASIGAGIGYNVPCTTVNKVCASGMKAVMFAAQSIMIGQNDVVVAGGMESMSNV  121

Query  1571  PKYFAEARKGSRLGHDSLVDGM  1636
             P Y  +AR G + G+ SL+DG+
Sbjct  122   PYYVPKARFGYKYGNASLIDGL  143


 Score =   163 bits (412),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 99/128 (77%), Gaps = 0/128 (0%)
 Frame = +3

Query  342  RDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGANL  521
            ++V I+  ARTP+G F G LSSL A +LGS+AI+ AL +A VD   V+EV  GNVL ANL
Sbjct  2    KEVYIIAAARTPIGSFGGKLSSLTAVELGSIAIKGALAKAQVDAKHVQEVIMGNVLSANL  61

Query  522  GQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNV  701
            GQAPARQA++GAGI   V C+TVNKVCASGMKA + AAQSI +G NDVVVAGGMESMSNV
Sbjct  62   GQAPARQASIGAGIGYNVPCTTVNKVCASGMKAVMFAAQSIMIGQNDVVVAGGMESMSNV  121

Query  702  HKYFAEAR  725
              Y  +AR
Sbjct  122  PYYVPKAR  129



>ref|XP_011401582.1| putative acetyl-CoA acetyltransferase, cytosolic 2 [Auxenochlorella 
protothecoides]
 gb|KFM28548.1| putative acetyl-CoA acetyltransferase, cytosolic 2 [Auxenochlorella 
protothecoides]
Length=454

 Score =   184 bits (468),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 113/148 (76%), Gaps = 0/148 (0%)
 Frame = +2

Query  1196  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNV  1375
             + ++   V IVGVARTP+G F G LSSL AT LG IAI +AL+R  V P+ V+EV+ GNV
Sbjct  50    DALDDTAVYIVGVARTPLGSFQGGLSSLSATDLGGIAIRAALERAGVSPNDVDEVYMGNV  109

Query  1376  LSANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGME  1555
              SANLGQAPARQAAL AG+P +  C+TVNKVC+SGMKA  +AA S+QLG+  V VAGGME
Sbjct  110   CSANLGQAPARQAALKAGLPFSADCTTVNKVCSSGMKALTIAAASLQLGVAQVAVAGGME  169

Query  1556  SMSNVPKYFAEARKGSRLGHDSLVDGML  1639
             SMSN+P Y   AR G+RLGH  LVDGM+
Sbjct  170   SMSNIPYYVPSARGGARLGHAQLVDGMV  197


 Score =   159 bits (402),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 100/133 (75%), Gaps = 0/133 (0%)
 Frame = +3

Query  327  ETINARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNV  506
            + ++   V IVGVARTP+G F G LSSL AT LG +AI +AL+RA V P+ V+EV+ GNV
Sbjct  50   DALDDTAVYIVGVARTPLGSFQGGLSSLSATDLGGIAIRAALERAGVSPNDVDEVYMGNV  109

Query  507  LGANLGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGME  686
              ANLGQAPARQAAL AG+P +  C+TVNKVC+SGMKA  +AA S+QLG+  V VAGGME
Sbjct  110  CSANLGQAPARQAALKAGLPFSADCTTVNKVCSSGMKALTIAAASLQLGVAQVAVAGGME  169

Query  687  SMSNVHKYFAEAR  725
            SMSN+  Y   AR
Sbjct  170  SMSNIPYYVPSAR  182



>gb|EAQ42003.1| acetyl-CoA acetyltransferase [Polaribacter sp. MED152]
Length=408

 Score =   183 bits (465),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  1211  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANL  1390
             ++V IV VARTP+G F+GSLSS+PATKLG+IAI+ AL + ++D +LV+EVF GNV+SA L
Sbjct  19    KEVVIVSVARTPIGSFMGSLSSIPATKLGAIAIKGALDKINLDANLVQEVFMGNVVSAGL  78

Query  1391  GQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNV  1570
             GQAPARQAA+ AGIP++V C+TVNKVCASGMK+ MLAAQ+I LG  D+ VAGGME+MS++
Sbjct  79    GQAPARQAAIHAGIPDSVPCTTVNKVCASGMKSIMLAAQTIALGDADIAVAGGMENMSSI  138

Query  1571  PKYFAEARKGSRLGHDSLVDGM  1636
             P Y   AR GS+ G  ++ DGM
Sbjct  139   PHY-QHARNGSKFGPITMEDGM  159


 Score =   164 bits (416),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +3

Query  342  RDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGANL  521
            ++V IV VARTP+G F+GSLSS+PATKLG++AI+ AL + ++D +LV+EVF GNV+ A L
Sbjct  19   KEVVIVSVARTPIGSFMGSLSSIPATKLGAIAIKGALDKINLDANLVQEVFMGNVVSAGL  78

Query  522  GQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNV  701
            GQAPARQAA+ AGIP++V C+TVNKVCASGMK+ +LAAQ+I LG  D+ VAGGME+MS++
Sbjct  79   GQAPARQAAIHAGIPDSVPCTTVNKVCASGMKSIMLAAQTIALGDADIAVAGGMENMSSI  138

Query  702  HKY  710
              Y
Sbjct  139  PHY  141



>ref|WP_026812948.1| acetyl-CoA acetyltransferase [Arenibacter certesii]
Length=391

 Score =   182 bits (462),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 112/142 (79%), Gaps = 1/142 (1%)
 Frame = +2

Query  1211  RDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSANL  1390
             +DV IV +ARTP+G F+GSLSS+PA KLG++AI+ AL +  +DPSLVEEV  GNV+ A +
Sbjct  2     KDVVIVSLARTPIGSFMGSLSSIPAPKLGAVAIKGALDKIKLDPSLVEEVIMGNVVQAGV  61

Query  1391  GQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSNV  1570
             GQAPARQAAL AGIP+TV C+TVNKVCASGMKA M AAQSI LG N++VVAGGME+MS V
Sbjct  62    GQAPARQAALFAGIPDTVPCTTVNKVCASGMKAVMQAAQSIALGDNEIVVAGGMENMSMV  121

Query  1571  PKYFAEARKGSRLGHDSLVDGM  1636
             P Y    R G + G  SL DG+
Sbjct  122   PHYI-HLRNGQKFGSASLEDGL  142


 Score =   167 bits (422),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +3

Query  342  RDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGANL  521
            +DV IV +ARTP+G F+GSLSS+PA KLG++AI+ AL +  +DPSLVEEV  GNV+ A +
Sbjct  2    KDVVIVSLARTPIGSFMGSLSSIPAPKLGAVAIKGALDKIKLDPSLVEEVIMGNVVQAGV  61

Query  522  GQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSNV  701
            GQAPARQAAL AGIP+TV C+TVNKVCASGMKA + AAQSI LG N++VVAGGME+MS V
Sbjct  62   GQAPARQAALFAGIPDTVPCTTVNKVCASGMKAVMQAAQSIALGDNEIVVAGGMENMSMV  121

Query  702  HKY  710
              Y
Sbjct  122  PHY  124



>ref|WP_027003578.1| acetyl-CoA acetyltransferase [Flexibacter roseolus]
Length=394

 Score =   182 bits (462),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 115/145 (79%), Gaps = 1/145 (1%)
 Frame = +2

Query  1208  ARDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIESALKRGSVDPSLVEEVFFGNVLSAN  1387
             ++ V +V   RTP+G F GSL+++ AT+LG+ AI+ AL++  + P +V EVF GNV+SAN
Sbjct  2     SKTVYLVSAVRTPLGSFNGSLAAVSATQLGAAAIKGALEKAGISPDMVNEVFMGNVISAN  61

Query  1388  LGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATMLAAQSIQLGINDVVVAGGMESMSN  1567
             LGQAPARQAA+ AGIPN+V C+TVNKVCASGMKA M AAQSI LG ND+VVAGGMESMSN
Sbjct  62    LGQAPARQAAMYAGIPNSVPCTTVNKVCASGMKAIMFAAQSIMLGHNDIVVAGGMESMSN  121

Query  1568  VPKYFAEAR-KGSRLGHDSLVDGML  1639
             +P Y  +AR +G   GH +L+DG++
Sbjct  122   IPFYLDKARFQGYGYGHGTLIDGLV  146


 Score =   166 bits (419),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +3

Query  339  ARDVCIVGVARTPMGGFLGSLSSLPATKLGSLAIESALKRASVDPSLVEEVFFGNVLGAN  518
            ++ V +V   RTP+G F GSL+++ AT+LG+ AI+ AL++A + P +V EVF GNV+ AN
Sbjct  2    SKTVYLVSAVRTPLGSFNGSLAAVSATQLGAAAIKGALEKAGISPDMVNEVFMGNVISAN  61

Query  519  LGQAPARQAALGAGIPNTVVCSTVNKVCASGMKATILAAQSIQLGINDVVVAGGMESMSN  698
            LGQAPARQAA+ AGIPN+V C+TVNKVCASGMKA + AAQSI LG ND+VVAGGMESMSN
Sbjct  62   LGQAPARQAAMYAGIPNSVPCTTVNKVCASGMKAIMFAAQSIMLGHNDIVVAGGMESMSN  121

Query  699  VHKYFAEAR  725
            +  Y  +AR
Sbjct  122  IPFYLDKAR  130



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5190304099076