BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig14041

Length=1000
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011081571.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    512   3e-179   
ref|XP_011070543.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    511   9e-179   Sesamum indicum [beniseed]
gb|KHG04361.1|  DEAD-box ATP-dependent RNA helicase 56                  509   6e-178   Gossypium arboreum [tree cotton]
ref|XP_012076586.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    512   6e-178   Jatropha curcas
emb|CDP13502.1|  unnamed protein product                                510   7e-178   Coffea canephora [robusta coffee]
ref|XP_011081570.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    512   9e-178   Sesamum indicum [beniseed]
gb|KJB54997.1|  hypothetical protein B456_009G057600                    508   1e-177   Gossypium raimondii
ref|XP_008806610.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    508   1e-177   Phoenix dactylifera
ref|XP_010324988.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    508   2e-177   Solanum lycopersicum
ref|NP_850807.2|  DEAD-box ATP-dependent RNA helicase 15                508   2e-177   
ref|XP_012073201.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    508   2e-177   Jatropha curcas
ref|XP_010519945.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    507   3e-177   
ref|XP_011070464.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    510   4e-177   Sesamum indicum [beniseed]
gb|KJB54998.1|  hypothetical protein B456_009G057600                    508   5e-177   Gossypium raimondii
gb|KJB27349.1|  hypothetical protein B456_004G292500                    506   5e-177   Gossypium raimondii
gb|KHG15649.1|  DEAD-box ATP-dependent RNA helicase 56 -like protein    508   9e-177   Gossypium arboreum [tree cotton]
ref|XP_008797872.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    506   9e-177   Phoenix dactylifera
ref|XP_002309623.1|  hypothetical protein POPTR_0006s26940g             509   1e-176   Populus trichocarpa [western balsam poplar]
ref|XP_008806594.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    509   1e-176   Phoenix dactylifera
ref|XP_007011879.1|  DEAD/DEAH box RNA helicase family protein is...    509   1e-176   Theobroma cacao [chocolate]
ref|XP_010555770.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    503   1e-176   Tarenaya hassleriana [spider flower]
gb|KJB65811.1|  hypothetical protein B456_010G114300                    509   2e-176   Gossypium raimondii
gb|KJB70604.1|  hypothetical protein B456_011G082500                    505   2e-176   Gossypium raimondii
ref|XP_012073200.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    508   2e-176   Jatropha curcas
ref|XP_010250100.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    508   2e-176   
ref|XP_009783372.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    508   2e-176   Nicotiana sylvestris
ref|XP_010924921.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    508   3e-176   Elaeis guineensis
gb|KJB54999.1|  hypothetical protein B456_009G057600                    508   3e-176   Gossypium raimondii
gb|KDO61716.1|  hypothetical protein CISIN_1g014314mg                   505   4e-176   Citrus sinensis [apfelsine]
ref|XP_010267037.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    508   4e-176   Nelumbo nucifera [Indian lotus]
gb|EYU32343.1|  hypothetical protein MIMGU_mgv1a006879mg                508   4e-176   Erythranthe guttata [common monkey flower]
gb|KJB82814.1|  hypothetical protein B456_013G215200                    508   5e-176   Gossypium raimondii
ref|XP_006361727.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    507   5e-176   Solanum tuberosum [potatoes]
ref|XP_008654597.1|  PREDICTED: uncharacterized protein LOC100273...    504   5e-176   Zea mays [maize]
ref|XP_002324856.1|  hypothetical protein POPTR_0018s01620g             507   6e-176   Populus trichocarpa [western balsam poplar]
ref|XP_004245029.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    507   6e-176   Solanum lycopersicum
ref|XP_007011878.1|  DEAD/DEAH box RNA helicase family protein is...    509   7e-176   
ref|XP_010519944.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    507   7e-176   Tarenaya hassleriana [spider flower]
ref|XP_009412247.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    504   7e-176   
ref|NP_568245.1|  DEAD-box ATP-dependent RNA helicase 56                507   8e-176   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010254382.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    507   9e-176   Nelumbo nucifera [Indian lotus]
ref|XP_009606367.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    503   1e-175   
ref|XP_010912069.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    506   1e-175   Elaeis guineensis
ref|XP_002285072.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    506   1e-175   Vitis vinifera
ref|XP_006287808.1|  hypothetical protein CARUB_v10001023mg             506   1e-175   Capsella rubella
ref|XP_008797870.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    506   2e-175   Phoenix dactylifera
ref|XP_004960988.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    506   2e-175   
gb|KJB27350.1|  hypothetical protein B456_004G292500                    506   2e-175   Gossypium raimondii
ref|XP_007023163.1|  DEAD/DEAH box RNA helicase family protein is...    506   2e-175   Theobroma cacao [chocolate]
ref|XP_009595644.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    505   3e-175   Nicotiana tomentosiformis
ref|XP_009392979.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    502   3e-175   
gb|KJB70602.1|  hypothetical protein B456_011G082500                    505   4e-175   Gossypium raimondii
ref|XP_002871462.1|  hypothetical protein ARALYDRAFT_487950             505   4e-175   Arabidopsis lyrata subsp. lyrata
gb|KDO61715.1|  hypothetical protein CISIN_1g014314mg                   504   4e-175   Citrus sinensis [apfelsine]
ref|XP_006450448.1|  hypothetical protein CICLE_v10008383mg             505   4e-175   Citrus clementina [clementine]
ref|XP_006483351.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    504   6e-175   Citrus sinensis [apfelsine]
ref|XP_007011880.1|  DEAD/DEAH box RNA helicase family protein is...    504   7e-175   
ref|XP_006346267.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    501   7e-175   Solanum tuberosum [potatoes]
gb|ABK93079.1|  unknown                                                 504   1e-174   Populus trichocarpa [western balsam poplar]
ref|XP_008445205.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    504   1e-174   Cucumis melo [Oriental melon]
ref|XP_010696055.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    500   1e-174   
ref|XP_002873498.1|  hypothetical protein ARALYDRAFT_909079             503   2e-174   Arabidopsis lyrata subsp. lyrata
gb|AFW81342.1|  spliceosome RNA helicase BAT1 isoform 1                 503   2e-174   
ref|XP_010419674.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    503   2e-174   Camelina sativa [gold-of-pleasure]
ref|XP_009412246.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    503   2e-174   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010419673.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    500   2e-174   Camelina sativa [gold-of-pleasure]
ref|XP_010491834.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    503   2e-174   Camelina sativa [gold-of-pleasure]
gb|ADE76139.1|  unknown                                                 503   2e-174   Picea sitchensis
ref|XP_009624283.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    503   2e-174   Nicotiana tomentosiformis
ref|XP_009606356.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    503   2e-174   Nicotiana tomentosiformis
ref|XP_010453161.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    503   2e-174   Camelina sativa [gold-of-pleasure]
ref|XP_009771911.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    503   3e-174   Nicotiana sylvestris
gb|KJB70605.1|  hypothetical protein B456_011G082500                    500   4e-174   Gossypium raimondii
ref|XP_004960989.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    500   4e-174   
gb|EYU24648.1|  hypothetical protein MIMGU_mgv1a006871mg                502   5e-174   Erythranthe guttata [common monkey flower]
dbj|BAJ53224.1|  JHL06P13.3                                             503   6e-174   Jatropha curcas
ref|XP_009758663.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    502   6e-174   Nicotiana sylvestris
ref|XP_009392978.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    501   1e-173   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001141599.1|  uncharacterized protein LOC100273717               501   1e-173   
ref|XP_006346265.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    501   1e-173   Solanum tuberosum [potatoes]
ref|XP_004968948.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    501   2e-173   
ref|XP_010231905.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    499   2e-173   Brachypodium distachyon [annual false brome]
ref|XP_002268833.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    501   2e-173   Vitis vinifera
ref|XP_010231902.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    497   2e-173   Brachypodium distachyon [annual false brome]
gb|EEC70860.1|  hypothetical protein OsI_02372                          497   2e-173   Oryza sativa Indica Group [Indian rice]
ref|XP_010696045.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    501   2e-173   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006853982.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    500   3e-173   Amborella trichopoda
ref|XP_010231903.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    497   3e-173   Brachypodium distachyon [annual false brome]
ref|XP_010048210.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    497   4e-173   Eucalyptus grandis [rose gum]
emb|CAB96655.1|  DEAD BOX RNA helicase RH15                             500   4e-173   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010453157.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    499   5e-173   Camelina sativa [gold-of-pleasure]
ref|XP_006409182.1|  hypothetical protein EUTSA_v10022698mg             499   7e-173   Eutrema salsugineum [saltwater cress]
ref|XP_010419672.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    499   8e-173   Camelina sativa [gold-of-pleasure]
ref|XP_006353691.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    499   9e-173   Solanum tuberosum [potatoes]
ref|XP_006399618.1|  hypothetical protein EUTSA_v10013628mg             499   1e-172   Eutrema salsugineum [saltwater cress]
ref|XP_001770294.1|  predicted protein                                  498   2e-172   
ref|XP_002517619.1|  dead box ATP-dependent RNA helicase, putative      498   2e-172   Ricinus communis
ref|XP_004960987.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    499   2e-172   
emb|CAA09205.1|  RNA helicase                                           499   3e-172   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003569186.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    498   3e-172   Brachypodium distachyon [annual false brome]
ref|XP_007222437.1|  hypothetical protein PRUPE_ppa006122mg             497   4e-172   Prunus persica
emb|CAB96652.1|  DEAD BOX RNA helicase RH15-like protein                498   4e-172   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006644282.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    497   5e-172   Oryza brachyantha
ref|XP_002969825.1|  hypothetical protein SELMODRAFT_146823             497   8e-172   Selaginella moellendorffii
ref|XP_010231899.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    496   1e-171   Brachypodium distachyon [annual false brome]
ref|XP_003569187.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    496   1e-171   Brachypodium distachyon [annual false brome]
emb|CDX70383.1|  BnaC03g04670D                                          497   1e-171   
ref|NP_001043298.1|  Os01g0550000                                       496   1e-171   
ref|XP_010048208.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    496   1e-171   Eucalyptus grandis [rose gum]
sp|Q0JM17.2|RH56_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA ...    496   1e-171   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004241774.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    496   2e-171   Solanum lycopersicum
gb|EEE54779.1|  hypothetical protein OsJ_02176                          495   3e-171   Oryza sativa Japonica Group [Japonica rice]
emb|CBI21031.3|  unnamed protein product                                499   3e-171   Vitis vinifera
ref|XP_006644281.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    495   3e-171   Oryza brachyantha
ref|XP_010048977.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    495   4e-171   Eucalyptus grandis [rose gum]
ref|XP_011459186.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    494   5e-171   Fragaria vesca subsp. vesca
ref|XP_008394071.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    494   6e-171   Malus domestica [apple tree]
ref|NP_001043297.1|  Os01g0549700                                       497   8e-171   
ref|XP_008378410.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    491   1e-170   
ref|XP_009125794.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    494   1e-170   Brassica rapa
ref|NP_001170610.1|  uncharacterized protein LOC100384654               493   1e-170   Zea mays [maize]
ref|XP_006583127.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    490   2e-170   
ref|XP_003588758.1|  DEAD-box ATP-dependent RNA helicase                489   3e-170   
gb|AFW82994.1|  hypothetical protein ZEAMMB73_566534                    493   3e-170   
ref|XP_009376926.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    492   4e-170   Pyrus x bretschneideri [bai li]
ref|XP_007135742.1|  hypothetical protein PHAVU_010G154700g             492   5e-170   Phaseolus vulgaris [French bean]
gb|KHG21287.1|  DEAD-box ATP-dependent RNA helicase 56 -like protein    493   1e-169   Gossypium arboreum [tree cotton]
gb|KCW81407.1|  hypothetical protein EUGRSUZ_C02784                     495   2e-169   Eucalyptus grandis [rose gum]
emb|CDY51112.1|  BnaCnng20150D                                          491   2e-169   Brassica napus [oilseed rape]
ref|XP_009131197.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    491   3e-169   Brassica rapa
emb|CDX85725.1|  BnaA02g00880D                                          491   3e-169   
ref|XP_003528338.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    490   4e-169   Glycine max [soybeans]
ref|XP_003531708.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    490   4e-169   Glycine max [soybeans]
ref|XP_001781775.1|  predicted protein                                  490   4e-169   
ref|XP_006578149.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    486   4e-169   
gb|KCW80390.1|  hypothetical protein EUGRSUZ_C01749                     489   6e-169   Eucalyptus grandis [rose gum]
ref|XP_003588757.1|  DEAD-box ATP-dependent RNA helicase                489   8e-169   Medicago truncatula
ref|XP_002985161.1|  hypothetical protein SELMODRAFT_446187             490   1e-168   
ref|XP_004498731.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    488   2e-168   Cicer arietinum [garbanzo]
gb|KHN01339.1|  DEAD-box ATP-dependent RNA helicase 56                  489   3e-168   Glycine soja [wild soybean]
ref|XP_003603412.1|  DEAD-box ATP-dependent RNA helicase                487   4e-168   Medicago truncatula
ref|XP_009125790.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    486   8e-168   Brassica rapa
ref|XP_003522620.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    486   8e-168   Glycine max [soybeans]
ref|XP_003526412.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    486   8e-168   Glycine max [soybeans]
ref|XP_007137031.1|  hypothetical protein PHAVU_009G093800g             486   9e-168   Phaseolus vulgaris [French bean]
gb|KEH28678.1|  DEAD-box ATP-dependent RNA helicase-like protein        489   1e-167   Medicago truncatula
gb|AFV30230.1|  ATP-dependent RNA helicase                              486   2e-167   Medicago sativa [alfalfa]
gb|AFK41905.1|  unknown                                                 486   2e-167   Medicago truncatula
ref|XP_004968947.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    486   3e-167   
ref|NP_001154707.1|  DEAD-box ATP-dependent RNA helicase 56             486   4e-167   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006585632.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    485   5e-167   
ref|XP_004506913.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    481   1e-166   
gb|KHN47769.1|  DEAD-box ATP-dependent RNA helicase 56                  484   1e-166   Glycine soja [wild soybean]
ref|XP_009121981.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    483   2e-166   Brassica rapa
ref|XP_009334643.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    480   2e-166   Pyrus x bretschneideri [bai li]
ref|XP_004498732.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    481   4e-166   
ref|XP_008362058.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    478   1e-165   
gb|AGV54745.1|  DEAD-box ATP-dependent RNA helicase 56-like protein     481   1e-165   Phaseolus vulgaris [French bean]
ref|XP_004506912.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    481   1e-165   
ref|XP_008243728.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    481   2e-165   Prunus mume [ume]
ref|XP_007215422.1|  hypothetical protein PRUPE_ppa006077mg             480   2e-165   Prunus persica
ref|XP_009334641.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    479   6e-165   Pyrus x bretschneideri [bai li]
ref|XP_004498730.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    481   7e-165   
ref|XP_009121985.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    479   1e-164   Brassica rapa
ref|XP_009365409.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    478   1e-164   Pyrus x bretschneideri [bai li]
ref|XP_004501320.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    478   1e-164   
ref|XP_007161216.1|  hypothetical protein PHAVU_001G051700g             478   1e-164   Phaseolus vulgaris [French bean]
ref|XP_008362046.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    477   3e-164   Malus domestica [apple tree]
ref|XP_004303319.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    476   9e-164   Fragaria vesca subsp. vesca
emb|CDY71952.1|  BnaAnng39360D                                          476   1e-163   Brassica napus [oilseed rape]
emb|CDX69778.1|  BnaA10g21270D                                          477   3e-163   
ref|XP_011459188.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    476   3e-163   Fragaria vesca subsp. vesca
ref|XP_004501319.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    474   1e-162   Cicer arietinum [garbanzo]
ref|XP_010097240.1|  DEAD-box ATP-dependent RNA helicase 56             476   2e-162   
ref|XP_004501321.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    468   3e-161   
emb|CDX78412.1|  BnaA03g03240D                                          472   3e-161   
ref|XP_010519138.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    468   1e-160   
gb|AGV54235.1|  DEAD-box ATP-dependent RNA helicase 56                  466   7e-160   Phaseolus vulgaris [French bean]
ref|XP_004501318.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    466   1e-159   
gb|EMS64048.1|  DEAD-box ATP-dependent RNA helicase 56                  466   3e-159   Triticum urartu
emb|CDX85726.1|  BnaA02g00870D                                          465   1e-158   
ref|XP_010101269.1|  DEAD-box ATP-dependent RNA helicase 56             466   2e-158   
ref|XP_006450446.1|  hypothetical protein CICLE_v10008383mg             459   4e-157   
gb|EPS66777.1|  hypothetical protein M569_07999                         450   9e-157   Genlisea aurea
ref|XP_003063800.1|  predicted protein                                  449   5e-153   Micromonas pusilla CCMP1545
gb|ACU23716.1|  unknown                                                 441   8e-153   Glycine max [soybeans]
ref|XP_009121980.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    446   2e-152   Brassica rapa
ref|XP_009121984.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    442   6e-152   
ref|XP_009121982.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    442   1e-150   Brassica rapa
gb|EMT19211.1|  DEAD-box ATP-dependent RNA helicase 56                  441   3e-148   
ref|NP_001149406.1|  spliceosome RNA helicase BAT1                      434   1e-147   
ref|XP_002505759.1|  predicted protein                                  435   1e-147   Micromonas commoda
gb|EMS68248.1|  DEAD-box ATP-dependent RNA helicase 56                  439   4e-146   Triticum urartu
ref|NP_001154706.1|  DEAD-box ATP-dependent RNA helicase 56             428   6e-144   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005643776.1|  nuclear RNA helicase-like protein Bat1             422   1e-142   Coccomyxa subellipsoidea C-169
ref|XP_001422523.1|  predicted protein                                  418   7e-142   Ostreococcus lucimarinus CCE9901
ref|XP_007509762.1|  ATP-dependent RNA helicase DDX39                   413   4e-139   Bathycoccus prasinos
dbj|GAN02806.1|  ATP-dependent RNA helicase Uap56                       411   6e-138   Mucor ambiguus
gb|EPB87931.1|  ATP-dependent RNA helicase uap56                        410   1e-137   Mucor circinelloides f. circinelloides 1006PhL
emb|CEP12723.1|  hypothetical protein                                   409   3e-137   Parasitella parasitica
gb|EIE84435.1|  ATP-dependent RNA helicase uap56                        409   4e-137   Rhizopus delemar RA 99-880
gb|EIE91029.1|  ATP-dependent RNA helicase uap56                        408   8e-137   Rhizopus delemar RA 99-880
emb|CEG73345.1|  Putative ATP-dependent RNA helicase SUB2               404   9e-137   Rhizopus microsporus
gb|KJB54996.1|  hypothetical protein B456_009G057600                    405   1e-136   Gossypium raimondii
dbj|BAA13931.1|  unnamed protein product                                404   1e-136   Schizosaccharomyces pombe
emb|CEI88988.1|  Putative ATP-dependent RNA helicase                    407   1e-136   Rhizopus microsporus
gb|KJB70603.1|  hypothetical protein B456_011G082500                    402   1e-136   Gossypium raimondii
gb|EIE79315.1|  ATP-dependent RNA helicase uap56                        406   4e-136   Rhizopus delemar RA 99-880
emb|CEI95093.1|  Putative ATP dependent RNA helicase                    406   4e-136   Rhizopus microsporus
gb|EJK56348.1|  hypothetical protein THAOC_23784                        405   5e-136   Thalassiosira oceanica
emb|CEG02049.1|  Helicase, C-terminal                                   407   6e-136   Ostreococcus tauri
ref|XP_002949774.1|  hypothetical protein VOLCADRAFT_80795              405   1e-135   Volvox carteri f. nagariensis
ref|XP_007023164.1|  DEAD/DEAH box RNA helicase family protein is...    404   1e-135   
ref|XP_005107606.1|  PREDICTED: spliceosome RNA helicase Ddx39b-like    400   1e-135   
emb|CDS12473.1|  Putative ATP-dependent RNA helicase uap56              405   1e-135   Lichtheimia ramosa
gb|EXX60912.1|  Sub2p                                                   404   2e-135   Rhizophagus irregularis DAOM 197198w
emb|CEI95092.1|  Putative ATP-dependent RNA helicase SUB2               406   2e-135   Rhizopus microsporus
emb|CEG73344.1|  Putative ATP dependent RNA helicase                    404   2e-135   Rhizopus microsporus
ref|XP_002600114.1|  hypothetical protein BRAFLDRAFT_118235             398   2e-135   Branchiostoma floridae
ref|XP_002185552.1|  predicted protein                                  404   3e-135   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002296387.1|  dead box family RNA helicase                       404   3e-135   Thalassiosira pseudonana CCMP1335
ref|XP_008102811.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    400   5e-135   Anolis carolinensis [Carolina anole]
gb|EPY52787.1|  ATP-dependent RNA helicase Uap56                        403   7e-135   Schizosaccharomyces cryophilus OY26
gb|ACO10850.1|  ATP-dependent RNA helicase DDX39                        402   8e-135   Caligus rogercresseyi
gb|EPX72634.1|  ATP-dependent RNA helicase Uap56                        403   8e-135   Schizosaccharomyces octosporus yFS286
emb|CEG73343.1|  Putative ATP-dependent RNA helicase SUB2               405   9e-135   Rhizopus microsporus
emb|CDS11016.1|  Putative ATP-dependent RNA helicase uap56              402   1e-134   Lichtheimia ramosa
emb|CDH51210.1|  atp-dependent rna helicase uap56                       402   2e-134   Lichtheimia corymbifera JMRC:FSU:9682
gb|ADD24298.1|  Spliceosome RNA helicase BAT1                           401   3e-134   Lepeophtheirus salmonis
ref|XP_008903595.1|  ATP-dependent RNA helicase uap56, variant          398   3e-134   Phytophthora parasitica INRA-310
emb|CDH58367.1|  atp-dependent rna helicase uap56                       402   3e-134   Lichtheimia corymbifera JMRC:FSU:9682
ref|NP_594261.1|  ATP-dependent RNA helicase Uap56                      401   3e-134   Schizosaccharomyces pombe
ref|XP_001703776.1|  subunit of exon junction complex                   400   5e-134   Chlamydomonas reinhardtii
ref|XP_006956118.1|  P-loop containing nucleoside triphosphate hy...    400   5e-134   Wallemia mellicola CBS 633.66
gb|AAB94615.1|  BAT1                                                    395   6e-134   Homo sapiens [man]
gb|ESA07313.1|  hypothetical protein GLOINDRAFT_349525                  400   7e-134   
gb|KFH69832.1|  ATP-dependent RNA helicase SUB2                         400   8e-134   Mortierella verticillata NRRL 6337
ref|XP_004390787.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    397   8e-134   
ref|NP_956015.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 39Aa           397   8e-134   
ref|XP_004043684.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    396   1e-133   
ref|XP_007949570.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    397   1e-133   Orycteropus afer afer
ref|XP_006104711.1|  PREDICTED: spliceosome RNA helicase Ddx39b         395   1e-133   
ref|XP_002175680.1|  ATP-dependent RNA helicase Uap56                   399   1e-133   Schizosaccharomyces japonicus yFS275
ref|XP_004286666.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    396   2e-133   Orcinus orca [Orca]
ref|XP_004424437.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    396   2e-133   
emb|CCI50269.1|  unnamed protein product                                395   2e-133   Albugo candida
gb|EAX03405.1|  hCG2005638, isoform CRA_b                               395   2e-133   Homo sapiens [man]
ref|XP_003217350.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    399   2e-133   Anolis carolinensis [Carolina anole]
ref|XP_004621321.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    396   2e-133   Sorex araneus [Eurasian shrew]
ref|XP_006675142.1|  hypothetical protein BATDEDRAFT_15696              399   2e-133   Batrachochytrium dendrobatidis JAM81
ref|XP_007872375.1|  hypothetical protein PNEG_00489                    399   3e-133   Pneumocystis murina B123
ref|XP_007436162.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       398   4e-133   
ref|XP_005995920.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    395   4e-133   Latimeria chalumnae
ref|XP_005904234.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    397   5e-133   Bos mutus
gb|AAM18861.1|AF391287_2  unknown                                       398   5e-133   Branchiostoma floridae
ref|XP_004673033.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       398   6e-133   Jaculus jaculus
gb|ETM48634.1|  ATP-dependent RNA helicase uap56                        398   6e-133   Phytophthora parasitica
ref|XP_008903594.1|  ATP-dependent RNA helicase uap56                   397   6e-133   Phytophthora parasitica INRA-310
ref|XP_009033759.1|  hypothetical protein AURANDRAFT_52520              399   6e-133   Aureococcus anophagefferens
ref|XP_005289374.1|  PREDICTED: spliceosome RNA helicase DDX39B         393   6e-133   Chrysemys picta bellii
ref|XP_006918833.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       397   7e-133   Pteropus alecto
ref|XP_006100393.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    397   7e-133   Myotis lucifugus
ref|XP_006173093.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       397   8e-133   Camelus ferus
ref|XP_011378204.1|  PREDICTED: spliceosome RNA helicase DDX39B         395   8e-133   Pteropus vampyrus
ref|XP_008853627.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       397   1e-132   Nannospalax galili
ref|XP_004442630.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       397   1e-132   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_006100392.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    398   1e-132   Myotis lucifugus
emb|CEL52175.1|  ATP-dependent RNA helicase UAP56/SUB2                  397   1e-132   Rhizoctonia solani AG-1 IB
dbj|BAE37719.1|  unnamed protein product                                397   1e-132   Mus musculus [mouse]
gb|AAC16391.1|  nuclear RNA helicase                                    397   1e-132   Rattus norvegicus [brown rat]
dbj|BAE39902.1|  unnamed protein product                                397   1e-132   Mus musculus [mouse]
ref|NP_446015.2|  ATP-dependent RNA helicase DDX39A                     397   1e-132   Rattus norvegicus [brown rat]
ref|NP_932099.2|  ATP-dependent RNA helicase DDX39A                     397   1e-132   Mus musculus [mouse]
gb|AAC63046.1|  DEAD-box protein                                        392   1e-132   Homo sapiens [man]
ref|XP_006993135.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    397   1e-132   Peromyscus maniculatus bairdii
dbj|BAE43010.1|  unnamed protein product                                397   1e-132   Mus musculus [mouse]
ref|NP_001029924.1|  ATP-dependent RNA helicase DDX39A                  397   1e-132   Bos taurus [bovine]
ref|XP_003272140.2|  PREDICTED: spliceosome RNA helicase DDX39B         394   2e-132   
ref|XP_005661286.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    397   2e-132   
ref|XP_006161075.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       396   2e-132   
ref|XP_003760703.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       396   2e-132   
emb|CCI50270.1|  unnamed protein product                                395   2e-132   
ref|XP_005865907.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    396   2e-132   
ref|XP_004688293.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       396   2e-132   
ref|XP_002921018.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       396   2e-132   
ref|XP_007182118.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    396   2e-132   
ref|XP_004748290.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    396   2e-132   
ref|XP_004277466.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       396   2e-132   
ref|XP_001366378.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    396   2e-132   
ref|XP_003501931.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       396   2e-132   
ref|XP_007336576.1|  P-loop containing nucleoside triphosphate hy...    397   2e-132   
ref|XP_005632846.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    396   2e-132   
ref|XP_005160298.1|  PREDICTED: DEAD (Asp-Glu-Ala-Asp) box polype...    396   2e-132   
ref|XP_005661287.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    396   2e-132   
ref|XP_533895.2|  PREDICTED: ATP-dependent RNA helicase DDX39A is...    396   2e-132   
ref|XP_007952615.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       396   3e-132   
ref|XP_002906628.1|  DEAD/DEAH box RNA helicase, putative               397   3e-132   
ref|XP_005463664.1|  PREDICTED: spliceosome RNA helicase DDX39B-l...    394   3e-132   
ref|NP_001270891.1|  uncharacterized protein LOC101865332               396   3e-132   
ref|XP_008508631.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    395   3e-132   
ref|XP_008054817.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       396   3e-132   
ref|XP_010611745.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    396   3e-132   
ref|XP_008314982.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       395   3e-132   
ref|XP_005086851.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    396   3e-132   
ref|XP_003218034.1|  PREDICTED: spliceosome RNA helicase DDX39B         395   3e-132   
ref|XP_005381156.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    395   4e-132   
gb|EFB28644.1|  hypothetical protein PANDA_009904                       395   4e-132   
gb|EHB14439.1|  ATP-dependent RNA helicase DDX39                        395   4e-132   
dbj|BAE23239.1|  unnamed protein product                                395   4e-132   
ref|XP_010611744.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    397   4e-132   
ref|XP_008508630.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    395   4e-132   
gb|EGW00654.1|  ATP-dependent RNA helicase DDX39                        395   4e-132   
ref|XP_010611743.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    397   4e-132   
pdb|1XTI|A  Chain A, Structure Of Wildtype Human Uap56                  394   4e-132   
ref|XP_004008522.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    395   4e-132   
ref|XP_010853738.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    397   5e-132   
ref|XP_008709919.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       397   5e-132   
ref|XP_008508629.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    395   5e-132   
pdb|1XTJ|A  Chain A, Structure Of Human Uap56 In Complex With Adp       394   5e-132   
ref|XP_003941746.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    395   5e-132   
gb|ADB44901.1|  DEAD(Asp-Glu-Ala-Asp) box polypeptide 39                395   6e-132   
ref|XP_004539320.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    395   6e-132   
gb|ELK06762.1|  ATP-dependent RNA helicase DDX39                        397   6e-132   
ref|XP_004616874.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       395   7e-132   
gb|ERE79092.1|  ATP-dependent RNA helicase DDX39A                       395   7e-132   
ref|XP_003123418.3|  PREDICTED: ATP-dependent RNA helicase DDX39A...    397   7e-132   
gb|AAY86975.1|  DEAD box protein                                        388   7e-132   
ref|XP_005995919.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    395   7e-132   
ref|XP_005865906.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    397   7e-132   
gb|EUC67291.1|  ATP-dependent RNA helicase uap56/SUB2                   397   8e-132   
ref|XP_006631613.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    395   8e-132   
ref|XP_002109407.1|  conserved hypothetical protein                     395   8e-132   
ref|NP_001014399.1|  spliceosome RNA helicase DDX39B                    395   8e-132   
ref|XP_006995295.1|  PREDICTED: spliceosome RNA helicase Ddx39b         395   1e-131   
ref|XP_006052355.1|  PREDICTED: spliceosome RNA helicase DDX39B-like    394   1e-131   
ref|XP_006904735.1|  PREDICTED: spliceosome RNA helicase DDX39B         394   1e-131   
ref|NP_062667.1|  spliceosome RNA helicase Ddx39b                       394   1e-131   
ref|NP_001028801.1|  spliceosome RNA helicase DDX39B                    394   1e-131   
ref|XP_006738543.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    394   1e-131   
ref|XP_004621320.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    394   1e-131   
ref|XP_004389822.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       394   1e-131   
ref|XP_007229864.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    394   1e-131   
ref|XP_003985959.1|  PREDICTED: spliceosome RNA helicase DDX39B         394   1e-131   
ref|XP_009515690.1|  hypothetical protein PHYSODRAFT_309277             394   1e-131   
ref|XP_005370902.1|  PREDICTED: spliceosome RNA helicase DDX39B         394   1e-131   
ref|XP_003413378.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       394   1e-131   
gb|AAP36788.1|  Homo sapiens HLA-B associated transcript 1              394   1e-131   
ref|XP_007129491.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    394   1e-131   
ref|XP_004872547.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    396   1e-131   
sp|Q5ZHZ0.1|DX39B_CHICK  RecName: Full=Spliceosome RNA helicase D...    394   1e-131   
gb|ACO09904.1|  ATP-dependent RNA helicase DDX39                        394   1e-131   
ref|XP_004415272.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    394   1e-131   
gb|ACO11252.1|  ATP-dependent RNA helicase DDX39                        394   1e-131   
ref|XP_004902967.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       396   1e-131   
ref|XP_009449127.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    394   1e-131   
ref|XP_006013279.1|  PREDICTED: spliceosome RNA helicase DDX39B         393   1e-131   
ref|XP_007907581.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       394   1e-131   
ref|XP_010744287.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    394   1e-131   
ref|XP_008260767.1|  PREDICTED: LOW QUALITY PROTEIN: spliceosome ...    394   1e-131   
ref|NP_004631.1|  spliceosome RNA helicase DDX39B                       394   1e-131   
dbj|BAE31182.1|  unnamed protein product                                394   1e-131   
gb|ELK18937.1|  Spliceosome RNA helicase BAT1                           394   1e-131   
ref|XP_006738542.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    394   1e-131   
ref|XP_006036655.1|  PREDICTED: spliceosome RNA helicase DDX39B-like    394   1e-131   
gb|EHH52904.1|  hypothetical protein EGM_13439                          394   2e-131   
ref|XP_008613771.1|  DEAD-box ATP-dependent RNA helicase 15             394   2e-131   
ref|XP_010350778.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    396   2e-131   
ref|XP_010350775.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    396   2e-131   
ref|NP_998142.1|  ATP-dependent RNA helicase DDX39                      394   2e-131   
ref|XP_006066605.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    395   2e-131   
ref|XP_004872545.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    397   2e-131   
ref|XP_008868859.1|  DEAD-box ATP-dependent RNA helicase 56             394   2e-131   
gb|ELR50186.1|  Spliceosome RNA helicase BAT1                           394   2e-131   
ref|XP_005534575.1|  PREDICTED: spliceosome RNA helicase DDX39B-like    393   2e-131   
emb|CCG84331.1|  protein of unknown function                            394   2e-131   
ref|XP_004999904.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    394   2e-131   
gb|AAH71505.1|  Ddx39a protein                                          394   2e-131   
ref|XP_006085397.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    394   2e-131   
gb|EFB18180.1|  hypothetical protein PANDA_020423                       394   2e-131   
ref|XP_004748288.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    396   2e-131   
ref|XP_004748289.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    396   2e-131   
emb|CCA18117.1|  predicted protein putative                             394   2e-131   
ref|XP_005463662.1|  PREDICTED: spliceosome RNA helicase DDX39B-l...    392   2e-131   
ref|NP_005795.2|  ATP-dependent RNA helicase DDX39A                     394   2e-131   
ref|XP_003461865.2|  PREDICTED: ATP-dependent RNA helicase DDX39A...    394   3e-131   
dbj|BAF31287.1|  BAT1 protein                                           394   3e-131   
ref|XP_005627100.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    394   3e-131   
ref|XP_011808596.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    394   3e-131   
ref|XP_006874383.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       393   3e-131   
ref|XP_009239916.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    394   3e-131   
ref|XP_009449126.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    394   3e-131   
ref|XP_004872546.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    396   3e-131   
gb|ABU86917.1|  Bat1                                                    394   3e-131   
ref|XP_004872541.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    397   3e-131   
gb|KDD77120.1|  DEAD/DEAH box helicase                                  393   4e-131   
gb|EHH29721.1|  ATP-dependent RNA helicase DDX39                        395   4e-131   
ref|XP_005086850.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    395   4e-131   
ref|XP_009239915.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    394   4e-131   
ref|XP_005665849.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    394   4e-131   
gb|ACO09679.1|  ATP-dependent RNA helicase DDX39                        393   4e-131   
ref|XP_007489116.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    397   4e-131   
ref|XP_009827129.1|  DEAD-box ATP-dependent RNA helicase 15             392   4e-131   
ref|XP_006154309.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    393   4e-131   
ref|XP_008955196.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    394   5e-131   
ref|XP_004624380.1|  PREDICTED: spliceosome RNA helicase DDX39B         393   5e-131   
ref|XP_005463661.1|  PREDICTED: spliceosome RNA helicase DDX39B-l...    393   5e-131   
ref|XP_006779616.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD (Asp-Gl...    394   5e-131   
ref|XP_009449125.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    394   5e-131   
ref|XP_006896266.1|  PREDICTED: spliceosome RNA helicase DDX39B         392   6e-131   
ref|XP_006875676.1|  PREDICTED: spliceosome RNA helicase DDX39B         392   6e-131   
gb|EHH18152.1|  hypothetical protein EGK_14701                          392   6e-131   
gb|ACN58701.1|  ATP-dependent RNA helicase DDX39                        392   6e-131   
gb|ELK23366.1|  Spliceosome RNA helicase DDX39B                         394   6e-131   
dbj|BAB15509.1|  unnamed protein product                                394   6e-131   
ref|NP_001080733.1|  nuclear RNA helicase                               392   7e-131   
ref|XP_003474035.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    392   7e-131   
ref|XP_008564250.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       392   7e-131   
gb|AIC55357.1|  hypothetical protein                                    392   7e-131   
emb|CDQ82873.1|  unnamed protein product                                392   8e-131   
ref|XP_005661285.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    395   8e-131   
ref|XP_002164853.1|  PREDICTED: spliceosome RNA helicase DDX39B-like    392   8e-131   
emb|CDQ66513.1|  unnamed protein product                                392   8e-131   
gb|ACM09195.1|  ATP-dependent RNA helicase DDX39                        392   8e-131   
emb|CDQ90161.1|  unnamed protein product                                392   9e-131   
gb|KIJ45095.1|  hypothetical protein M422DRAFT_59910                    393   9e-131   
ref|NP_001133080.1|  ATP-dependent RNA helicase DDX39                   392   9e-131   
ref|XP_001968815.1|  GG24297                                            392   1e-130   
dbj|BAD96632.1|  HLA-B associated transcript 1 variant                  392   1e-130   
pdb|1XTK|A  Chain A, Structure Of Decd To Dead Mutation Of Human ...    390   1e-130   
ref|XP_010899336.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    392   1e-130   
ref|XP_003275725.2|  PREDICTED: ATP-dependent RNA helicase DDX39A       392   1e-130   
ref|NP_001134851.1|  ATP-dependent RNA helicase DDX39                   392   1e-130   
ref|XP_007532506.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       392   1e-130   
ref|XP_001961799.1|  GF14747                                            392   1e-130   
ref|XP_008328948.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       392   1e-130   
ref|XP_004595622.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    392   1e-130   
gb|EHB16049.1|  Spliceosome RNA helicase Bat1                           392   1e-130   
ref|XP_007231785.1|  PREDICTED: spliceosome RNA helicase DDX39B-like    392   2e-130   
ref|XP_007390175.1|  hypothetical protein PHACADRAFT_246819             392   2e-130   
ref|XP_003443119.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    391   2e-130   
dbj|GAC95940.1|  hypothetical protein PHSY_003518                       388   2e-130   
ref|XP_008992391.1|  PREDICTED: LOW QUALITY PROTEIN: spliceosome ...    391   2e-130   
gb|KIM21098.1|  hypothetical protein M408DRAFT_29817                    391   2e-130   
gb|ETE73559.1|  ATP-dependent RNA helicase DDX39A                       391   2e-130   
ref|NP_001133398.1|  Spliceosome RNA helicase BAT1                      391   2e-130   
ref|XP_008412609.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       391   2e-130   
gb|EJU00944.1|  ATP-dependent RNA helicase SUB2                         392   2e-130   
ref|XP_007098876.1|  PREDICTED: spliceosome RNA helicase DDX39B         391   2e-130   
ref|XP_005339077.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    391   2e-130   
gb|AAL98920.1|  Bat1                                                    391   2e-130   
emb|CAA84355.1|  BAT1                                                   391   2e-130   
ref|XP_004073639.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       391   2e-130   
ref|XP_010871251.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       391   2e-130   
ref|XP_008303441.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       391   3e-130   
ref|XP_007569619.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    391   3e-130   
ref|XP_005797553.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    391   3e-130   
gb|EHH59286.1|  ATP-dependent RNA helicase DDX39                        392   3e-130   
ref|XP_006096516.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    391   3e-130   
ref|XP_004573690.1|  PREDICTED: spliceosome RNA helicase DDX39B-l...    391   3e-130   
ref|XP_004711745.1|  PREDICTED: spliceosome RNA helicase DDX39B         391   3e-130   
ref|XP_010599849.1|  PREDICTED: spliceosome RNA helicase DDX39B         391   3e-130   
ref|XP_004065549.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       390   3e-130   
ref|XP_004671945.1|  PREDICTED: spliceosome RNA helicase DDX39B         390   3e-130   
ref|NP_001079623.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 39A         390   3e-130   
ref|XP_004286664.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    394   3e-130   
ref|XP_668053.1|  helicase                                              390   3e-130   
ref|XP_007129490.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    393   3e-130   
ref|XP_004781072.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    393   3e-130   
ref|XP_002003577.1|  GI21901                                            390   3e-130   
gb|KIM47933.1|  hypothetical protein M413DRAFT_439630                   391   4e-130   
ref|XP_010768566.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       387   4e-130   
gb|KIY67510.1|  P-loop containing nucleoside triphosphate hydrola...    391   4e-130   
ref|XP_007459648.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    394   4e-130   
gb|EST09229.1|  putative ATP-dependent RNA helicase                     390   4e-130   
ref|XP_011399824.1|  DEAD-box ATP-dependent RNA helicase 56             390   4e-130   
ref|NP_957237.1|  HLA-B associated transcript 1                         390   4e-130   
ref|XP_627282.1|  Sub2p like superfamily II helicase involved in ...    390   5e-130   
gb|KIK47876.1|  hypothetical protein CY34DRAFT_146598                   390   5e-130   
ref|XP_005696667.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    390   5e-130   
ref|XP_002127634.2|  PREDICTED: spliceosome RNA helicase DDX39B         390   5e-130   
ref|XP_002619114.1|  conserved hypothetical protein                     385   5e-130   
ref|XP_007129489.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    394   5e-130   
ref|XP_009020730.1|  hypothetical protein HELRODRAFT_112849             390   6e-130   
ref|XP_008289807.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       390   7e-130   
ref|XP_006178881.1|  PREDICTED: spliceosome RNA helicase DDX39B         390   7e-130   
ref|XP_007537232.1|  PREDICTED: spliceosome RNA helicase DDX39B         390   7e-130   
ref|NP_001016000.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 39A         390   8e-130   
ref|XP_004905482.1|  PREDICTED: spliceosome RNA helicase Ddx39b i...    392   9e-130   
ref|XP_001828976.1|  ATP-dependent RNA helicase SUB2                    390   9e-130   
dbj|BAG63290.1|  unnamed protein product                                391   1e-129   
ref|XP_007253188.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    390   1e-129   
ref|XP_003787566.1|  PREDICTED: spliceosome RNA helicase DDX39B-l...    389   1e-129   
ref|XP_003787565.1|  PREDICTED: spliceosome RNA helicase DDX39B-l...    389   1e-129   
ref|XP_004467949.1|  PREDICTED: spliceosome RNA helicase DDX39B         393   1e-129   
ref|XP_008065870.1|  PREDICTED: spliceosome RNA helicase DDX39B         394   1e-129   
ref|XP_005696668.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    389   1e-129   
ref|XP_004628303.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    389   1e-129   
ref|XP_001988957.1|  GH11448                                            389   1e-129   
gb|AAB50231.1|  nuclear RNA helicase                                    389   2e-129   
ref|XP_005389371.1|  PREDICTED: spliceosome RNA helicase DDX39B         393   2e-129   



>ref|XP_011081571.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Sesamum indicum]
Length=344

 Score =   512 bits (1319),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 247/253 (98%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  92   GRILALARDKDLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTE+EKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTELEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  212  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  272  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  331

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  332  LPEQIDTSTYMPS  344



>ref|XP_011070543.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 
[Sesamum indicum]
Length=344

 Score =   511 bits (1316),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 246/253 (97%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  92   GRILALARDKDLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  212  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  272  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  331

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  332  LPEQIDTSTYMPS  344



>gb|KHG04361.1| DEAD-box ATP-dependent RNA helicase 56 [Gossypium arboreum]
 gb|KJB65813.1| hypothetical protein B456_010G114300 [Gossypium raimondii]
Length=344

 Score =   509 bits (1311),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 245/253 (97%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  92   GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  212  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  272  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  331

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  332  LPEQIDTSTYMPS  344



>ref|XP_012076586.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Jatropha curcas]
 ref|XP_012076588.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 
[Jatropha curcas]
 ref|XP_012076589.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 
[Jatropha curcas]
 gb|KDP33603.1| hypothetical protein JCGZ_07174 [Jatropha curcas]
Length=428

 Score =   512 bits (1319),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 247/253 (98%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALARE +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALAREKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTE+EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTELEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>emb|CDP13502.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   510 bits (1313),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 245/253 (97%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  124  GRILALARDRDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  183

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  184  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  243

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  244  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  303

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  304  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  363

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  364  LPEQIDTSTYMPS  376



>ref|XP_011081570.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Sesamum indicum]
Length=428

 Score =   512 bits (1318),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 247/253 (98%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTE+EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTELEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>gb|KJB54997.1| hypothetical protein B456_009G057600 [Gossypium raimondii]
Length=344

 Score =   508 bits (1309),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 245/253 (97%), Positives = 250/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL R+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  92   GRILALTRDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+EMEKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEMEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  212  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  272  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  331

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  332  LPEQIDTSTYMPS  344



>ref|XP_008806610.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15 isoform X2 
[Phoenix dactylifera]
Length=344

 Score =   508 bits (1308),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 244/253 (96%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  92   GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCK+FMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPVCKRFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  212  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  272  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  331

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  332  LPEQIDTSTYMPS  344



>ref|XP_010324988.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 
[Solanum lycopersicum]
Length=344

 Score =   508 bits (1308),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 244/253 (96%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  92   GRILALARDKDLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSETEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL+ECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  212  VKSVSRAAELNKLLMECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDS+VLNQVQERFEVDIKE
Sbjct  272  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSEVLNQVQERFEVDIKE  331

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  332  LPEQIDTSTYMPS  344



>ref|NP_850807.2| DEAD-box ATP-dependent RNA helicase 15 [Arabidopsis thaliana]
 gb|AED91641.1| DEAD-box ATP-dependent RNA helicase 15 [Arabidopsis thaliana]
Length=344

 Score =   508 bits (1308),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 243/253 (96%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALARE +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  92   GRVLALAREKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+EMEKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEMEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  212  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQERFEVDIKE
Sbjct  272  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQERFEVDIKE  331

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  332  LPEQIDTSTYMPS  344



>ref|XP_012073201.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Jatropha curcas]
Length=344

 Score =   508 bits (1308),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 244/253 (96%), Positives = 249/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +L L+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  92   GRILALARDKDLGLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  212  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIV+NYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQ RFEVDIKE
Sbjct  272  ERVNIVVNYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQARFEVDIKE  331

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  332  LPEQIDTSTYMPS  344



>ref|XP_010519945.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 
[Tarenaya hassleriana]
Length=344

 Score =   507 bits (1306),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 242/253 (96%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  92   GRVLALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+EMEKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEMEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RA ELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  212  VKSVSRAGELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIV+NYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DSDVLNQVQERFEVDIKE
Sbjct  272  ERVNIVVNYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNQVQERFEVDIKE  331

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  332  LPEQIDTSTYMPS  344



>ref|XP_011070464.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Sesamum indicum]
Length=428

 Score =   510 bits (1314),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 246/253 (97%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>gb|KJB54998.1| hypothetical protein B456_009G057600 [Gossypium raimondii]
Length=379

 Score =   508 bits (1308),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 245/253 (97%), Positives = 250/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL R+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  127  GRILALTRDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  186

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+EMEKNRKLNDLLDALDFNQVVIF
Sbjct  187  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEMEKNRKLNDLLDALDFNQVVIF  246

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  247  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  306

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  307  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  366

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  367  LPEQIDTSTYMPS  379



>gb|KJB27349.1| hypothetical protein B456_004G292500 [Gossypium raimondii]
Length=344

 Score =   506 bits (1304),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 243/253 (96%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL R+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  92   GRILALTRDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL+ECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  212  VKSVSRAAELNKLLMECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  272  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  331

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  332  LPEQIDTSTYMPS  344



>gb|KHG15649.1| DEAD-box ATP-dependent RNA helicase 56 -like protein [Gossypium 
arboreum]
Length=401

 Score =   508 bits (1309),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 244/253 (96%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL R+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  149  GRILALTRDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  208

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  209  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  268

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  269  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  328

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  329  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  388

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  389  LPEQIDTSTYMPS  401



>ref|XP_008797872.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Phoenix dactylifera]
Length=344

 Score =   506 bits (1303),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 243/253 (96%), Positives = 250/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  92   GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCK+FMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPVCKRFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERL RYKGFKEGHKRILVATDLVGRGIDI
Sbjct  212  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLMRYKGFKEGHKRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  272  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  331

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  332  LPEQIDTSTYMPS  344



>ref|XP_002309623.1| hypothetical protein POPTR_0006s26940g [Populus trichocarpa]
 ref|XP_011039701.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Populus euphratica]
 gb|EEE93146.1| hypothetical protein POPTR_0006s26940g [Populus trichocarpa]
Length=428

 Score =   509 bits (1310),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 245/253 (97%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTE+EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTELEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERL RYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLMRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>ref|XP_008806594.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Phoenix dactylifera]
 ref|XP_008806602.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Phoenix dactylifera]
Length=428

 Score =   509 bits (1310),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 244/253 (96%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCK+FMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKRFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>ref|XP_007011879.1| DEAD/DEAH box RNA helicase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY29498.1| DEAD/DEAH box RNA helicase family protein isoform 2 [Theobroma 
cacao]
Length=428

 Score =   509 bits (1310),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 245/253 (97%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>ref|XP_010555770.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like, partial 
[Tarenaya hassleriana]
Length=292

 Score =   503 bits (1296),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 241/253 (95%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  40   GRVLALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  99

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL++MEKNRKLNDLLDALDFNQVVIF
Sbjct  100  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSDMEKNRKLNDLLDALDFNQVVIF  159

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  160  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  219

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DSDVLNQ+ ERFEVDIKE
Sbjct  220  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNQLYERFEVDIKE  279

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  280  LPEQIDTSTYMPS  292



>gb|KJB65811.1| hypothetical protein B456_010G114300 [Gossypium raimondii]
Length=428

 Score =   509 bits (1310),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 245/253 (97%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>gb|KJB70604.1| hypothetical protein B456_011G082500 [Gossypium raimondii]
Length=344

 Score =   505 bits (1301),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 243/253 (96%), Positives = 249/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL R+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  92   GRILALTRDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  212  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKNFKEGHKRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  272  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSTSDSDVLNQVQERFEVDIKE  331

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  332  LPEQIDTSTYMPS  344



>ref|XP_012073200.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Jatropha curcas]
 gb|KDP37097.1| hypothetical protein JCGZ_06153 [Jatropha curcas]
Length=428

 Score =   508 bits (1309),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 244/253 (96%), Positives = 249/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +L L+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLGLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIV+NYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQ RFEVDIKE
Sbjct  356  ERVNIVVNYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQARFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>ref|XP_010250100.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nelumbo 
nucifera]
 ref|XP_010250101.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nelumbo 
nucifera]
Length=428

 Score =   508 bits (1308),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 243/253 (96%), Positives = 252/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +L+L+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLALKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCK+FMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKRFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>ref|XP_009783372.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Nicotiana 
sylvestris]
 ref|XP_009783373.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Nicotiana 
sylvestris]
Length=428

 Score =   508 bits (1308),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 244/253 (96%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+ +LSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRVLALARDKDLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSETEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGM+QEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVSRAAELNKLLVECNFPSICIHSGMTQEERLTRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>ref|XP_010924921.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Elaeis guineensis]
 ref|XP_010924922.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Elaeis guineensis]
Length=428

 Score =   508 bits (1308),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 244/253 (96%), Positives = 250/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCK+FMQDPMEIYVDDEAKLTLHGLVQHYIKL E+EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKRFMQDPMEIYVDDEAKLTLHGLVQHYIKLNELEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>gb|KJB54999.1| hypothetical protein B456_009G057600 [Gossypium raimondii]
Length=428

 Score =   508 bits (1308),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 245/253 (97%), Positives = 250/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL R+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALTRDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+EMEKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEMEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>gb|KDO61716.1| hypothetical protein CISIN_1g014314mg [Citrus sinensis]
Length=356

 Score =   505 bits (1300),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 242/253 (96%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  104  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  163

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  164  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  223

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEG+KRILVATDLVGRGIDI
Sbjct  224  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGNKRILVATDLVGRGIDI  283

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSD+LNQVQ RFEVDIKE
Sbjct  284  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDILNQVQARFEVDIKE  343

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  344  LPEQIDTSTYMPS  356



>ref|XP_010267037.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nelumbo 
nucifera]
Length=428

 Score =   508 bits (1307),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 244/253 (96%), Positives = 250/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +L+L+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLALKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTE EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTESEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>gb|EYU32343.1| hypothetical protein MIMGU_mgv1a006879mg [Erythranthe guttata]
Length=428

 Score =   508 bits (1307),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 243/253 (96%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALARE +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALAREKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRP+CKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPICKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLV+CNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVSRAAELNKLLVDCNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>gb|KJB82814.1| hypothetical protein B456_013G215200 [Gossypium raimondii]
Length=428

 Score =   508 bits (1307),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 244/253 (96%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL R+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALTRDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>ref|XP_006361727.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006361728.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X2 [Solanum tuberosum]
Length=427

 Score =   507 bits (1306),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 244/253 (96%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRILALARDKDLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSETEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL+ECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELNKLLMECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDS+VLNQVQERFEVDIKE
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSEVLNQVQERFEVDIKE  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>ref|XP_008654597.1| PREDICTED: uncharacterized protein LOC100273717 isoform X1 [Zea 
mays]
 gb|AFW81346.1| hypothetical protein ZEAMMB73_015937 [Zea mays]
Length=344

 Score =   504 bits (1298),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 242/253 (96%), Positives = 249/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  92   GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL ECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  212  VKSVSRAAELNKLLCECNFPSICIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  272  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  331

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  332  LPEQIDTSTYMPS  344



>ref|XP_002324856.1| hypothetical protein POPTR_0018s01620g [Populus trichocarpa]
 gb|EEF03421.1| hypothetical protein POPTR_0018s01620g [Populus trichocarpa]
Length=428

 Score =   507 bits (1306),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 244/253 (96%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFK+TPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKLTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTE+EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTELEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERL RYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLMRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>ref|XP_004245029.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Solanum lycopersicum]
 ref|XP_010324987.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Solanum lycopersicum]
Length=427

 Score =   507 bits (1306),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 244/253 (96%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRILALARDKDLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSETEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL+ECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELNKLLMECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDS+VLNQVQERFEVDIKE
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSEVLNQVQERFEVDIKE  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>ref|XP_007011878.1| DEAD/DEAH box RNA helicase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY29497.1| DEAD/DEAH box RNA helicase family protein isoform 1 [Theobroma 
cacao]
Length=485

 Score =   509 bits (1311),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 245/253 (97%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  233  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  292

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  293  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  352

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  353  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  412

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  413  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  472

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  473  LPEQIDTSTYMPS  485



>ref|XP_010519944.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Tarenaya hassleriana]
Length=428

 Score =   507 bits (1306),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 242/253 (96%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRVLALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+EMEKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEMEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RA ELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVSRAGELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIV+NYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVVNYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>ref|XP_009412247.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15 isoform X2 
[Musa acuminata subsp. malaccensis]
Length=344

 Score =   504 bits (1297),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 243/253 (96%), Positives = 250/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  92   GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCK+FMQDPMEIYVDDEAKLTLHGLVQHYIKLTE+EKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPVCKRFMQDPMEIYVDDEAKLTLHGLVQHYIKLTELEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEG KRILVATDLVGRGIDI
Sbjct  212  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKNFKEGLKRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  272  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  331

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  332  LPEQIDTSTYMPS  344



>ref|NP_568245.1| DEAD-box ATP-dependent RNA helicase 56 [Arabidopsis thaliana]
 ref|NP_568244.2| DEAD-box ATP-dependent RNA helicase 15 [Arabidopsis thaliana]
 sp|Q9LFN6.2|RH56_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 56; AltName: 
Full=UAP56 homolog B [Arabidopsis thaliana]
 sp|Q56XG6.3|RH15_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 15; AltName: 
Full=UAP56 homolog A [Arabidopsis thaliana]
 gb|AAK55671.1|AF378868_1 AT5g11200/F2I11_90 [Arabidopsis thaliana]
 gb|AAK96496.1| AT5g11170/F2I11_60 [Arabidopsis thaliana]
 gb|AAL15393.1| AT5g11200/F2I11_90 [Arabidopsis thaliana]
 gb|AAN46806.1| At5g11170/F2I11_60 [Arabidopsis thaliana]
 dbj|BAE98572.1| DEAD BOX RNA helicase RH15 - like protein [Arabidopsis thaliana]
 gb|AED91642.1| DEAD-box ATP-dependent RNA helicase 15 [Arabidopsis thaliana]
 gb|AED91645.1| DEAD-box ATP-dependent RNA helicase 56 [Arabidopsis thaliana]
Length=427

 Score =   507 bits (1305),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 243/253 (96%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALARE +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRVLALAREKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+EMEKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEMEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQERFEVDIKE
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQERFEVDIKE  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>ref|XP_010254382.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Nelumbo nucifera]
Length=428

 Score =   507 bits (1305),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 242/253 (96%), Positives = 252/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +L+L+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLALKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCK+FMQDPMEIYVDDEAKLTLHGLVQHYIKL+++EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKRFMQDPMEIYVDDEAKLTLHGLVQHYIKLSDLEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>ref|XP_009606367.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 
[Nicotiana tomentosiformis]
Length=344

 Score =   503 bits (1296),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 241/253 (95%), Positives = 249/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSLRNVRHFILDECDKMLESLDMRRDVQ IFKMTPHDKQVMMFSATLSK
Sbjct  92   GRILALARDKDLSLRNVRHFILDECDKMLESLDMRRDVQTIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSETEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAA+LNKLLVECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  212  VKSVSRAAQLNKLLVECNFPSICIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIV+NYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  272  ERVNIVVNYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  331

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  332  LPEQIDTSTYMPS  344



>ref|XP_010912069.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Elaeis 
guineensis]
 ref|XP_010912075.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Elaeis 
guineensis]
Length=428

 Score =   506 bits (1304),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 243/253 (96%), Positives = 250/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCK+FMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKRFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERL RYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLMRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>ref|XP_002285072.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Vitis vinifera]
Length=428

 Score =   506 bits (1303),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 243/253 (96%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +L+L+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLALKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGM QEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVSRAAELNKLLVECNFPSICIHSGMPQEERLTRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>ref|XP_006287808.1| hypothetical protein CARUB_v10001023mg [Capsella rubella]
 ref|XP_006289730.1| hypothetical protein CARUB_v10003298mg [Capsella rubella]
 gb|EOA20706.1| hypothetical protein CARUB_v10001023mg [Capsella rubella]
 gb|EOA22628.1| hypothetical protein CARUB_v10003298mg [Capsella rubella]
Length=427

 Score =   506 bits (1303),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 243/253 (96%), Positives = 250/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRVLALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL EMEKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLNEMEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDSDVLNQVQERFEVDIKE
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSDVLNQVQERFEVDIKE  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>ref|XP_008797870.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008797871.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Phoenix dactylifera]
Length=428

 Score =   506 bits (1303),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 243/253 (96%), Positives = 250/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCK+FMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKRFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERL RYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLMRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>ref|XP_004960988.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Setaria italica]
Length=429

 Score =   506 bits (1303),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 244/253 (96%), Positives = 249/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALARE +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  177  GRILALAREKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  236

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTE EKNRKLNDLLDALDFNQVVIF
Sbjct  237  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEAEKNRKLNDLLDALDFNQVVIF  296

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL ECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  297  VKSVSRAAELNKLLCECNFPSICIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDI  356

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  357  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  416

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  417  LPEQIDTSTYMPS  429



>gb|KJB27350.1| hypothetical protein B456_004G292500 [Gossypium raimondii]
Length=428

 Score =   506 bits (1303),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 243/253 (96%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL R+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALTRDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL+ECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVSRAAELNKLLMECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>ref|XP_007023163.1| DEAD/DEAH box RNA helicase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY25785.1| DEAD/DEAH box RNA helicase family protein isoform 1 [Theobroma 
cacao]
Length=427

 Score =   506 bits (1302),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 244/253 (96%), Positives = 249/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E+EKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLGELEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQ RFEVDIKE
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQARFEVDIKE  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>ref|XP_009595644.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nicotiana 
tomentosiformis]
 ref|XP_009595645.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nicotiana 
tomentosiformis]
Length=428

 Score =   505 bits (1301),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 242/253 (96%), Positives = 250/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+ +LSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRVLALARDKDLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSETEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFP+ICIHSGM+QEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVSRAAELNKLLVECNFPAICIHSGMTQEERLTRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSD LNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDFLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>ref|XP_009392979.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=344

 Score =   502 bits (1293),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 242/253 (96%), Positives = 249/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  92   GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCK+FMQDPMEIYVDDEAKLTLHGLVQHYIKLTE+EKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPVCKRFMQDPMEIYVDDEAKLTLHGLVQHYIKLTELEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEG KRILVATDLVGRGIDI
Sbjct  212  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKNFKEGLKRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIV+NYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  272  ERVNIVVNYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  331

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  332  LPEQIDTSTYMPS  344



>gb|KJB70602.1| hypothetical protein B456_011G082500 [Gossypium raimondii]
Length=427

 Score =   505 bits (1300),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 243/253 (96%), Positives = 249/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL R+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRILALTRDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  295  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKNFKEGHKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSTSDSDVLNQVQERFEVDIKE  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>ref|XP_002871462.1| hypothetical protein ARALYDRAFT_487950 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47721.1| hypothetical protein ARALYDRAFT_487950 [Arabidopsis lyrata subsp. 
lyrata]
Length=427

 Score =   505 bits (1300),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 242/253 (96%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRVLALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+EMEKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEMEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQERFEVDIKE
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQERFEVDIKE  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>gb|KDO61715.1| hypothetical protein CISIN_1g014314mg [Citrus sinensis]
Length=418

 Score =   504 bits (1299),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 242/253 (96%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  166  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  225

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  226  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  285

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEG+KRILVATDLVGRGIDI
Sbjct  286  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGNKRILVATDLVGRGIDI  345

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSD+LNQVQ RFEVDIKE
Sbjct  346  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDILNQVQARFEVDIKE  405

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  406  LPEQIDTSTYMPS  418



>ref|XP_006450448.1| hypothetical protein CICLE_v10008383mg [Citrus clementina]
 gb|ESR63688.1| hypothetical protein CICLE_v10008383mg [Citrus clementina]
 gb|KDO61714.1| hypothetical protein CISIN_1g014314mg [Citrus sinensis]
Length=427

 Score =   505 bits (1300),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 242/253 (96%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEG+KRILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGNKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSD+LNQVQ RFEVDIKE
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDILNQVQARFEVDIKE  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>ref|XP_006483351.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Citrus 
sinensis]
Length=427

 Score =   504 bits (1299),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 242/253 (96%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEG+KRILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGNKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSD+LNQVQ RFEVDIKE
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDILNQVQARFEVDIKE  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>ref|XP_007011880.1| DEAD/DEAH box RNA helicase family protein isoform 3 [Theobroma 
cacao]
 gb|EOY29499.1| DEAD/DEAH box RNA helicase family protein isoform 3 [Theobroma 
cacao]
Length=429

 Score =   504 bits (1299),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 245/254 (96%), Positives = 251/254 (99%), Gaps = 1/254 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLN-QVQERFEVDIK  284
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLN QVQERFEVDIK
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQQVQERFEVDIK  415

Query  283  ELPEQIDTSTYMPS  242
            ELPEQIDTSTYMPS
Sbjct  416  ELPEQIDTSTYMPS  429



>ref|XP_006346267.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X3 [Solanum tuberosum]
Length=344

 Score =   501 bits (1290),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 239/253 (94%), Positives = 250/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSLRNVRHFILDECDKMLESLDMRRDVQ IFK TPHDKQVMMFSATLSK
Sbjct  92   GRILALARDKDLSLRNVRHFILDECDKMLESLDMRRDVQAIFKTTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRP+CKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPICKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLV+CNFPSICIHSGM+QEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  212  VKSVSRAAELNKLLVDCNFPSICIHSGMTQEERLTRYKGFKEGHKRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVIN+DMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQ+RFEVDIKE
Sbjct  272  ERVNIVINFDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQQRFEVDIKE  331

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  332  LPEQIDTSTYMPS  344



>gb|ABK93079.1| unknown [Populus trichocarpa]
Length=428

 Score =   504 bits (1298),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 243/253 (96%), Positives = 250/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTE+EKNRKLNDLL ALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTELEKNRKLNDLLGALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERL RYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLMRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERV+IVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVDIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>ref|XP_008445205.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Cucumis melo]
 ref|XP_008445206.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Cucumis melo]
 ref|XP_004138728.2| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Cucumis sativus]
 ref|XP_011649821.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Cucumis sativus]
 gb|KGN62946.1| hypothetical protein Csa_2G381720 [Cucumis sativus]
Length=427

 Score =   504 bits (1297),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 242/253 (96%), Positives = 250/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL+R+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRILALSRDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+EMEKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEMEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAEL+KLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  295  VKSVNRAAELDKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DSDVLN VQERFEVDIKE
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNNVQERFEVDIKE  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>ref|XP_010696055.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=344

 Score =   500 bits (1288),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 240/253 (95%), Positives = 249/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  92   GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
             IRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  152  AIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERL RYKGFK+G +RILVATDLVGRGIDI
Sbjct  212  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLARYKGFKDGKQRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  272  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  331

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  332  LPEQIDTSTYMPS  344



>ref|XP_002873498.1| hypothetical protein ARALYDRAFT_909079 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49757.1| hypothetical protein ARALYDRAFT_909079 [Arabidopsis lyrata subsp. 
lyrata]
Length=427

 Score =   503 bits (1296),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 242/253 (96%), Positives = 249/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRVLALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL EMEKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLNEMEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS VLNQVQERFEVDIKE
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSTVLNQVQERFEVDIKE  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>gb|AFW81342.1| spliceosome RNA helicase BAT1 isoform 1 [Zea mays]
 gb|AFW81343.1| spliceosome RNA helicase BAT1 isoform 2 [Zea mays]
 gb|AFW81344.1| spliceosome RNA helicase BAT1 isoform 3 [Zea mays]
Length=429

 Score =   503 bits (1296),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 242/253 (96%), Positives = 249/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  177  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  236

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  237  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQVVIF  296

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL ECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  297  VKSVSRAAELNKLLCECNFPSICIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDI  356

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  357  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  416

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  417  LPEQIDTSTYMPS  429



>ref|XP_010419674.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Camelina 
sativa]
Length=427

 Score =   503 bits (1296),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 241/253 (95%), Positives = 250/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+ +LSL+N RHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRVLALARDKDLSLKNARHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+EMEKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEMEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+SSSDS+VLNQVQ+RFEVDIKE
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASSSDSEVLNQVQDRFEVDIKE  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>ref|XP_009412246.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Musa acuminata subsp. malaccensis]
Length=428

 Score =   503 bits (1296),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 243/253 (96%), Positives = 250/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCK+FMQDPMEIYVDDEAKLTLHGLVQHYIKLTE+EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKRFMQDPMEIYVDDEAKLTLHGLVQHYIKLTELEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEG KRILVATDLVGRGIDI
Sbjct  296  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKNFKEGLKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>ref|XP_010419673.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Camelina sativa]
Length=344

 Score =   500 bits (1287),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 240/253 (95%), Positives = 248/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  92   GRVLALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+EMEKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEMEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  212  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+ +SDS VL QVQERFEVDIKE
Sbjct  272  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVALASDSGVLKQVQERFEVDIKE  331

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  332  LPEQIDTSTYMPS  344



>ref|XP_010491834.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Camelina sativa]
 ref|XP_010491835.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Camelina sativa]
Length=427

 Score =   503 bits (1296),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 241/253 (95%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRVLALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL++MEKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSDMEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+SSSDS+VLNQVQ+RFEVDIKE
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASSSDSEVLNQVQDRFEVDIKE  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>gb|ADE76139.1| unknown [Picea sitchensis]
Length=427

 Score =   503 bits (1295),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 239/253 (94%), Positives = 250/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALARE +L+L+NVRHFILDECD+MLESLDMR+DVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRILALAREKDLNLKNVRHFILDECDRMLESLDMRKDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCK+FMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKRFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGM+QEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  295  VKSVNRAAELNKLLVECNFPSICIHSGMTQEERLTRYKGFKEGHKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIV+NYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  355  ERVNIVVNYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  414

Query  280  LPEQIDTSTYMPS  242
            LP QIDTSTYMPS
Sbjct  415  LPAQIDTSTYMPS  427



>ref|XP_009624283.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nicotiana 
tomentosiformis]
Length=428

 Score =   503 bits (1296),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 240/253 (95%), Positives = 251/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+L+LAR+ +LSLRNVRHF+LDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRVLSLARDKDLSLRNVRHFVLDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSETEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAA+L+KLLVECNFPSICIHSGM+QEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVSRAAQLDKLLVECNFPSICIHSGMTQEERLTRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>ref|XP_009606356.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009606362.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Nicotiana tomentosiformis]
Length=428

 Score =   503 bits (1295),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 241/253 (95%), Positives = 249/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSLRNVRHFILDECDKMLESLDMRRDVQ IFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLSLRNVRHFILDECDKMLESLDMRRDVQTIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSETEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAA+LNKLLVECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVSRAAQLNKLLVECNFPSICIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIV+NYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVVNYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>ref|XP_010453161.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Camelina sativa]
Length=427

 Score =   503 bits (1295),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 241/253 (95%), Positives = 250/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+ +LSL+N RHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRVLALARDKDLSLKNARHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+EMEKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEMEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+SSSDS+VLNQVQ+RFEVDIKE
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASSSDSEVLNQVQDRFEVDIKE  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>ref|XP_009771911.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nicotiana 
sylvestris]
 ref|XP_009771912.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nicotiana 
sylvestris]
Length=428

 Score =   503 bits (1295),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 240/253 (95%), Positives = 250/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+L+LAR+ +LSLRNVRHF+LDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRVLSLARDKDLSLRNVRHFVLDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSETEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAA+L+KLLVECNFPSICIHSGM+QEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVNRAAQLDKLLVECNFPSICIHSGMTQEERLTRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>gb|KJB70605.1| hypothetical protein B456_011G082500 [Gossypium raimondii]
Length=363

 Score =   500 bits (1287),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 241/264 (91%), Positives = 253/264 (96%), Gaps = 3/264 (1%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL R+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  92   GRILALTRDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  212  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKNFKEGHKRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  272  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSTSDSDVLNQVQERFEVDIKE  331

Query  280  LPEQIDTSTY---MPS*RSWLASS  218
            LPEQIDTSTY   +P+ + ++  +
Sbjct  332  LPEQIDTSTYSKKLPTMQCYMTEA  355



>ref|XP_004960989.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X3 [Setaria italica]
Length=371

 Score =   500 bits (1288),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 241/250 (96%), Positives = 246/250 (98%), Gaps = 0/250 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALARE +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  92   GRILALAREKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTE EKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEAEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL ECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  212  VKSVSRAAELNKLLCECNFPSICIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  272  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  331

Query  280  LPEQIDTSTY  251
            LPEQIDTSTY
Sbjct  332  LPEQIDTSTY  341



>gb|EYU24648.1| hypothetical protein MIMGU_mgv1a006871mg [Erythranthe guttata]
 gb|EYU24649.1| hypothetical protein MIMGU_mgv1a006871mg [Erythranthe guttata]
Length=428

 Score =   502 bits (1293),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 241/253 (95%), Positives = 250/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +L L+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLGLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLT++EKNRKLNDLLDALDFNQ+VIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTDLEKNRKLNDLLDALDFNQIVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEG KRILVATDLVGRGIDI
Sbjct  296  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGLKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDT+TYMPS
Sbjct  416  LPEQIDTATYMPS  428



>dbj|BAJ53224.1| JHL06P13.3 [Jatropha curcas]
Length=455

 Score =   503 bits (1295),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 244/255 (96%), Positives = 249/255 (98%), Gaps = 2/255 (1%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +L L+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLGLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIV+NYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQ RFEVDIKE
Sbjct  356  ERVNIVVNYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQARFEVDIKE  415

Query  280  LPEQIDTSTY--MPS  242
            LPEQIDTSTY  MPS
Sbjct  416  LPEQIDTSTYSKMPS  430



>ref|XP_009758663.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X3 [Nicotiana sylvestris]
Length=428

 Score =   502 bits (1292),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 241/253 (95%), Positives = 249/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+ +LSLRNVRHFILDECDKMLESLDMRRDVQ IFKMTPHDKQVMMFSATLSK
Sbjct  176  GRMLALARDKDLSLRNVRHFILDECDKMLESLDMRRDVQTIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSETEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAA+LNKLLVECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVSRAAQLNKLLVECNFPSICIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>ref|XP_009392978.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=428

 Score =   501 bits (1291),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 242/253 (96%), Positives = 249/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCK+FMQDPMEIYVDDEAKLTLHGLVQHYIKLTE+EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKRFMQDPMEIYVDDEAKLTLHGLVQHYIKLTELEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEG KRILVATDLVGRGIDI
Sbjct  296  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKNFKEGLKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIV+NYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVVNYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>ref|NP_001141599.1| uncharacterized protein LOC100273717 [Zea mays]
 gb|ACN35192.1| unknown [Zea mays]
Length=429

 Score =   501 bits (1291),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 241/253 (95%), Positives = 248/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  177  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  236

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  237  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQVVIF  296

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL ECNFPSICIHSGM+QEERLT YK FKEGHKRILVATDLVGRGIDI
Sbjct  297  VKSVSRAAELNKLLCECNFPSICIHSGMTQEERLTSYKNFKEGHKRILVATDLVGRGIDI  356

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  357  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  416

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  417  LPEQIDTSTYMPS  429



>ref|XP_006346265.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006346266.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X2 [Solanum tuberosum]
Length=428

 Score =   501 bits (1290),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 239/253 (94%), Positives = 250/253 (99%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSLRNVRHFILDECDKMLESLDMRRDVQ IFK TPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLSLRNVRHFILDECDKMLESLDMRRDVQAIFKTTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRP+CKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPICKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLV+CNFPSICIHSGM+QEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVSRAAELNKLLVDCNFPSICIHSGMTQEERLTRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVIN+DMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQ+RFEVDIKE
Sbjct  356  ERVNIVINFDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQQRFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>ref|XP_004968948.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X2 [Setaria italica]
Length=429

 Score =   501 bits (1289),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 240/253 (95%), Positives = 248/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +L L+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  177  GRILALARDKDLPLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  236

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  237  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQVVIF  296

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL ECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  297  VKSVSRAAELNKLLCECNFPSICIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDI  356

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIV+NYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  357  ERVNIVVNYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  416

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  417  LPEQIDTSTYMPS  429



>ref|XP_010231905.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15 isoform X2 
[Brachypodium distachyon]
Length=377

 Score =   499 bits (1284),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 237/253 (94%), Positives = 248/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKML+SLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  125  GRILALARDKDLSLKNVRHFILDECDKMLDSLDMRRDVQEIFKMTPHDKQVMMFSATLSK  184

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRP+CKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQ+VIF
Sbjct  185  EIRPICKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQIVIF  244

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RA+ELNKLL ECNFP+ICIHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  245  VKSVGRASELNKLLCECNFPAICIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDI  304

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  305  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  364

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  365  LPEQIDTSTYMPS  377



>ref|XP_002268833.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Vitis vinifera]
 emb|CBI36308.3| unnamed protein product [Vitis vinifera]
Length=428

 Score =   501 bits (1289),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 240/253 (95%), Positives = 249/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +L L++VRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLGLKHVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL+ECNFPSICIHSGM QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVSRAAELNKLLMECNFPSICIHSGMPQEERLTRYKNFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>ref|XP_010231902.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X2 [Brachypodium distachyon]
Length=344

 Score =   497 bits (1280),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 237/253 (94%), Positives = 248/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKML+SLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  92   GRILALARDKDLSLKNVRHFILDECDKMLDSLDMRRDVQEIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQ+VIF
Sbjct  152  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQIVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RA+ELN+LL ECNFP+ICIHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  212  VKSVGRASELNRLLCECNFPAICIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  272  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  331

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  332  LPEQIDTSTYMPS  344



>gb|EEC70860.1| hypothetical protein OsI_02372 [Oryza sativa Indica Group]
 gb|EEE54782.1| hypothetical protein OsJ_02179 [Oryza sativa Japonica Group]
Length=344

 Score =   497 bits (1280),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 239/253 (94%), Positives = 248/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALARE +LSL+NVRHFILDECDKML+SLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  92   GRILALAREKDLSLKNVRHFILDECDKMLDSLDMRRDVQEIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL ECNFP+I IHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  212  VKSVSRAAELNKLLCECNFPAISIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSAD+YLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  272  ERVNIVINYDMPDSADSYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  331

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  332  LPEQIDTSTYMPS  344



>ref|XP_010696045.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=428

 Score =   501 bits (1289),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 240/253 (95%), Positives = 249/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
             IRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  236  AIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERL RYKGFK+G +RILVATDLVGRGIDI
Sbjct  296  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLARYKGFKDGKQRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>ref|XP_006853982.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Amborella 
trichopoda]
 gb|ERN15449.1| hypothetical protein AMTR_s00036p00225190 [Amborella trichopoda]
Length=428

 Score =   500 bits (1288),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 239/253 (94%), Positives = 249/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALA + +L+L+NVRHFILDECDKMLESLDMR+DVQ IFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALANDKDLNLKNVRHFILDECDKMLESLDMRKDVQSIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMP+SADTYLHRVGRAGRFGTKGLAITFV+S+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPESADTYLHRVGRAGRFGTKGLAITFVASASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>ref|XP_010231903.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X2 [Brachypodium distachyon]
Length=344

 Score =   497 bits (1279),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 236/253 (93%), Positives = 248/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKML+SLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  92   GRILALARDKDLSLKNVRHFILDECDKMLDSLDMRRDVQEIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRP+CKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQ+VIF
Sbjct  152  EIRPICKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQIVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RA+ELN+LL ECNFP+ICIHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  212  VKSVGRASELNRLLCECNFPAICIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  272  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  331

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  332  LPEQIDTSTYMPS  344



>ref|XP_010048210.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 
[Eucalyptus grandis]
Length=343

 Score =   497 bits (1279),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 241/253 (95%), Positives = 248/253 (98%), Gaps = 1/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  92   GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVD EAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPVCKKFMQDPMEIYVD-EAKLTLHGLVQHYIKLSEGEKNRKLNDLLDALDFNQVVIF  210

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLV+CNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  211  VKSVNRAAELNKLLVDCNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  270

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSD+LNQVQ RFEVDIKE
Sbjct  271  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDILNQVQARFEVDIKE  330

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  331  LPEQIDTSTYMPS  343



>emb|CAB96655.1| DEAD BOX RNA helicase RH15 [Arabidopsis thaliana]
Length=427

 Score =   500 bits (1287),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 240/250 (96%), Positives = 248/250 (99%), Gaps = 0/250 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALARE +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRVLALAREKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+EMEKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEMEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQERFEVDIKE
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQERFEVDIKE  414

Query  280  LPEQIDTSTY  251
            LPEQIDTSTY
Sbjct  415  LPEQIDTSTY  424



>ref|XP_010453157.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Camelina 
sativa]
Length=427

 Score =   499 bits (1286),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 239/253 (94%), Positives = 249/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRVLALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQH+IKL EMEKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHFIKLAEMEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS VL+QVQERFE+DIKE
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASTSDSGVLDQVQERFEIDIKE  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>ref|XP_006409182.1| hypothetical protein EUTSA_v10022698mg [Eutrema salsugineum]
 gb|ESQ50635.1| hypothetical protein EUTSA_v10022698mg [Eutrema salsugineum]
Length=427

 Score =   499 bits (1285),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 240/253 (95%), Positives = 246/253 (97%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALARE  LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRVLALAREKYLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E+EKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLNELEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RA ELNKLLVECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDLVGRGIDI
Sbjct  295  VKSVNRAKELNKLLVECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDSDVLNQVQERFEVDIKE
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASTSDSDVLNQVQERFEVDIKE  414

Query  280  LPEQIDTSTYMPS  242
            LPEQ+DTSTYMPS
Sbjct  415  LPEQLDTSTYMPS  427



>ref|XP_010419672.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Camelina sativa]
Length=427

 Score =   499 bits (1285),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 240/253 (95%), Positives = 248/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRVLALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+EMEKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEMEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+ +SDS VL QVQERFEVDIKE
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVALASDSGVLKQVQERFEVDIKE  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>ref|XP_006353691.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like [Solanum 
tuberosum]
Length=428

 Score =   499 bits (1285),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 239/253 (94%), Positives = 247/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALARE +LSL+NVRHFILDECDKML+SLDMRRDVQ IFKMTPHDKQVMMFSATLSK
Sbjct  176  GRVLALAREKDLSLKNVRHFILDECDKMLDSLDMRRDVQAIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSETEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLL ECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVNRAAELNKLLAECNFPSICIHSGMTQEERLTRYKSFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDS+VLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSEVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>ref|XP_006399618.1| hypothetical protein EUTSA_v10013628mg [Eutrema salsugineum]
 gb|ESQ41071.1| hypothetical protein EUTSA_v10013628mg [Eutrema salsugineum]
Length=427

 Score =   499 bits (1284),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 240/253 (95%), Positives = 246/253 (97%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALARE +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRVLALAREKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E+EKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLNELEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RA ELNKLLVECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDLVGRGIDI
Sbjct  295  VKSVNRAKELNKLLVECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS VLNQVQERFEVDIKE
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASTSDSGVLNQVQERFEVDIKE  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>ref|XP_001770294.1| predicted protein [Physcomitrella patens]
 gb|EDQ64969.1| predicted protein [Physcomitrella patens]
Length=425

 Score =   498 bits (1283),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 239/253 (94%), Positives = 249/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRIL LAR+ +LSL++VRHFILDECDKMLESLDMRRDVQEIFK+TPHDKQVMMFSATLSK
Sbjct  173  GRILGLARDKDLSLKSVRHFILDECDKMLESLDMRRDVQEIFKLTPHDKQVMMFSATLSK  232

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCK+FMQDPMEIYVDDEAKLTLHGLVQHYIKL E+EKNRKLNDLLDALDFNQVVIF
Sbjct  233  EIRPVCKRFMQDPMEIYVDDEAKLTLHGLVQHYIKLGEVEKNRKLNDLLDALDFNQVVIF  292

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  293  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  352

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S SDSDVLNQVQERFEVDIKE
Sbjct  353  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASPSDSDVLNQVQERFEVDIKE  412

Query  280  LPEQIDTSTYMPS  242
            LPEQIDT+TYMPS
Sbjct  413  LPEQIDTTTYMPS  425



>ref|XP_002517619.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF44783.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=427

 Score =   498 bits (1282),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 239/253 (94%), Positives = 248/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +L L+NVRHFILDECDKMLESLDMRRDVQEIFKMTP+DKQVMMFSATLSK
Sbjct  175  GRILALARDKDLGLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPYDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQ PMEIYVDDEAKLTLHGLVQHYIKLTE+EKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQAPMEIYVDDEAKLTLHGLVQHYIKLTELEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL+ECNFPSICIHSGMSQEERLT+YK FKEGHKRILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELNKLLMECNFPSICIHSGMSQEERLTKYKNFKEGHKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQ RFEVDIKE
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQARFEVDIKE  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>ref|XP_004960987.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Setaria italica]
Length=456

 Score =   499 bits (1285),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 241/250 (96%), Positives = 246/250 (98%), Gaps = 0/250 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALARE +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  177  GRILALAREKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  236

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTE EKNRKLNDLLDALDFNQVVIF
Sbjct  237  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEAEKNRKLNDLLDALDFNQVVIF  296

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL ECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  297  VKSVSRAAELNKLLCECNFPSICIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDI  356

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  357  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  416

Query  280  LPEQIDTSTY  251
            LPEQIDTSTY
Sbjct  417  LPEQIDTSTY  426



>emb|CAA09205.1| RNA helicase [Arabidopsis thaliana]
Length=451

 Score =   499 bits (1284),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 240/253 (95%), Positives = 249/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALARE +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  199  GRVLALAREKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  258

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+EMEKNRKLNDLLDALDFNQVVIF
Sbjct  259  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEMEKNRKLNDLLDALDFNQVVIF  318

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RA ELNKLLV C+FPSICIHSGMSQEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  319  VKSVSRADELNKLLVGCHFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDLVGRGIDI  378

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQERFEVDIKE
Sbjct  379  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQERFEVDIKE  438

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  439  LPEQIDTSTYMPS  451



>ref|XP_003569186.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15 isoform X1 
[Brachypodium distachyon]
 ref|XP_010231904.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15 isoform X1 
[Brachypodium distachyon]
Length=429

 Score =   498 bits (1281),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 237/253 (94%), Positives = 248/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKML+SLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  177  GRILALARDKDLSLKNVRHFILDECDKMLDSLDMRRDVQEIFKMTPHDKQVMMFSATLSK  236

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRP+CKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQ+VIF
Sbjct  237  EIRPICKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQIVIF  296

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RA+ELNKLL ECNFP+ICIHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  297  VKSVGRASELNKLLCECNFPAICIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDI  356

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  357  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  416

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  417  LPEQIDTSTYMPS  429



>ref|XP_007222437.1| hypothetical protein PRUPE_ppa006122mg [Prunus persica]
 ref|XP_007222438.1| hypothetical protein PRUPE_ppa006122mg [Prunus persica]
 ref|XP_007222439.1| hypothetical protein PRUPE_ppa006122mg [Prunus persica]
 ref|XP_008219486.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Prunus mume]
 gb|EMJ23636.1| hypothetical protein PRUPE_ppa006122mg [Prunus persica]
 gb|EMJ23637.1| hypothetical protein PRUPE_ppa006122mg [Prunus persica]
 gb|EMJ23638.1| hypothetical protein PRUPE_ppa006122mg [Prunus persica]
Length=426

 Score =   497 bits (1280),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 239/253 (94%), Positives = 247/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  174  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  233

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTE EKNRKLNDLLDALDFNQVVIF
Sbjct  234  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEAEKNRKLNDLLDALDFNQVVIF  293

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL ECNFPSICIHSGM+QEERL RYKGFKEGH RILVATDLVGRGIDI
Sbjct  294  VKSVSRAAELNKLLSECNFPSICIHSGMNQEERLKRYKGFKEGHNRILVATDLVGRGIDI  353

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DSDVLN VQERFEVDIKE
Sbjct  354  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNDVQERFEVDIKE  413

Query  280  LPEQIDTSTYMPS  242
            LPEQIDT+TYMPS
Sbjct  414  LPEQIDTATYMPS  426



>emb|CAB96652.1| DEAD BOX RNA helicase RH15-like protein [Arabidopsis thaliana]
Length=435

 Score =   498 bits (1281),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 239/250 (96%), Positives = 247/250 (99%), Gaps = 0/250 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALARE +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRVLALAREKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+EMEK RKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEMEKTRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQERFEVDIKE
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQERFEVDIKE  414

Query  280  LPEQIDTSTY  251
            LPEQIDTSTY
Sbjct  415  LPEQIDTSTY  424



>ref|XP_006644282.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like [Oryza 
brachyantha]
Length=433

 Score =   497 bits (1280),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 239/253 (94%), Positives = 248/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALARE +LSL+NVRHFILDECDKML+SLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  181  GRILALAREKDLSLKNVRHFILDECDKMLDSLDMRRDVQEIFKMTPHDKQVMMFSATLSK  240

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  241  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQVVIF  300

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL ECNFP+I IHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  301  VKSVSRAAELNKLLCECNFPAISIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDI  360

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSAD+YLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  361  ERVNIVINYDMPDSADSYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  420

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  421  LPEQIDTSTYMPS  433



>ref|XP_002969825.1| hypothetical protein SELMODRAFT_146823 [Selaginella moellendorffii]
 gb|EFJ28949.1| hypothetical protein SELMODRAFT_146823 [Selaginella moellendorffii]
Length=428

 Score =   497 bits (1279),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 238/253 (94%), Positives = 246/253 (97%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRIL L RE  LSL+ VRHFILDECDKMLESLDMRRDVQEIFK+TPHDKQVMMFSATLSK
Sbjct  176  GRILQLTREKELSLKGVRHFILDECDKMLESLDMRRDVQEIFKLTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCK+FMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKRFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMP+SADTYLHRVGRAGRFGTKGLAITFV+SS+DS+VLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPESADTYLHRVGRAGRFGTKGLAITFVASSTDSNVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>ref|XP_010231899.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X1 [Brachypodium distachyon]
 ref|XP_010231901.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X1 [Brachypodium distachyon]
Length=428

 Score =   496 bits (1278),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 237/253 (94%), Positives = 248/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKML+SLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLSLKNVRHFILDECDKMLDSLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQ+VIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQIVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RA+ELN+LL ECNFP+ICIHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVGRASELNRLLCECNFPAICIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>ref|XP_003569187.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X1 [Brachypodium distachyon]
Length=428

 Score =   496 bits (1278),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 236/253 (93%), Positives = 248/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKML+SLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLSLKNVRHFILDECDKMLDSLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRP+CKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQ+VIF
Sbjct  236  EIRPICKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQIVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RA+ELN+LL ECNFP+ICIHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVGRASELNRLLCECNFPAICIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>emb|CDX70383.1| BnaC03g04670D [Brassica napus]
Length=447

 Score =   497 bits (1280),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 237/253 (94%), Positives = 248/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+L LAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  195  GRVLGLARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  254

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+EMEKNRKLNDLLDALDFNQVVIF
Sbjct  255  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEMEKNRKLNDLLDALDFNQVVIF  314

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RA ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDLVGRGIDI
Sbjct  315  VKSVSRAGELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDLVGRGIDI  374

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ+RFEVDIKE
Sbjct  375  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQDRFEVDIKE  434

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  435  LPEQIDTSTYMPS  447



>ref|NP_001043298.1| Os01g0550000 [Oryza sativa Japonica Group]
 sp|Q5JK84.1|RH15_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 15 [Oryza sativa 
Japonica Group]
 dbj|BAD88055.1| putative HLA-B associated transcript 1 [Oryza sativa Japonica 
Group]
 dbj|BAD88115.1| putative HLA-B associated transcript 1 [Oryza sativa Japonica 
Group]
 dbj|BAF05212.1| Os01g0550000 [Oryza sativa Japonica Group]
 dbj|BAH00768.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70861.1| hypothetical protein OsI_02373 [Oryza sativa Indica Group]
Length=432

 Score =   496 bits (1278),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 239/253 (94%), Positives = 248/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALARE +LSL+NVRHFILDECDKML+SLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  180  GRILALAREKDLSLKNVRHFILDECDKMLDSLDMRRDVQEIFKMTPHDKQVMMFSATLSK  239

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  240  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQVVIF  299

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL ECNFP+I IHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  300  VKSVSRAAELNKLLCECNFPAISIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDI  359

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSAD+YLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  360  ERVNIVINYDMPDSADSYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  419

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  420  LPEQIDTSTYMPS  432



>ref|XP_010048208.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Eucalyptus grandis]
 ref|XP_010048209.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Eucalyptus grandis]
 gb|KCW80388.1| hypothetical protein EUGRSUZ_C01749 [Eucalyptus grandis]
 gb|KCW80389.1| hypothetical protein EUGRSUZ_C01749 [Eucalyptus grandis]
Length=427

 Score =   496 bits (1277),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 241/253 (95%), Positives = 248/253 (98%), Gaps = 1/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVD EAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVD-EAKLTLHGLVQHYIKLSEGEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLV+CNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  295  VKSVNRAAELNKLLVDCNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSD+LNQVQ RFEVDIKE
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDILNQVQARFEVDIKE  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>sp|Q0JM17.2|RH56_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 56 [Oryza sativa 
Japonica Group]
 dbj|BAD88053.1| putative HLA-B associated transcript 1 [Oryza sativa Japonica 
Group]
 dbj|BAG90417.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ACV83946.1| DExD box helicase protein HLA-B associated transcript 1 [Oryza 
sativa Japonica Group]
Length=432

 Score =   496 bits (1278),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 239/253 (94%), Positives = 248/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALARE +LSL+NVRHFILDECDKML+SLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  180  GRILALAREKDLSLKNVRHFILDECDKMLDSLDMRRDVQEIFKMTPHDKQVMMFSATLSK  239

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  240  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQVVIF  299

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL ECNFP+I IHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  300  VKSVSRAAELNKLLCECNFPAISIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDI  359

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSAD+YLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  360  ERVNIVINYDMPDSADSYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  419

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  420  LPEQIDTSTYMPS  432



>ref|XP_004241774.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Solanum lycopersicum]
Length=428

 Score =   496 bits (1276),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 237/253 (94%), Positives = 246/253 (97%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+ +L L+NVRHFILDECDKML+SLDMRRDVQ IFKMTPHDKQVMMFSATLSK
Sbjct  176  GRVLALARDKDLPLKNVRHFILDECDKMLDSLDMRRDVQAIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSETEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLL ECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVNRAAELNKLLAECNFPSICIHSGMTQEERLTRYKAFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDS+VLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSEVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  416  LPEQIDTSTYMPS  428



>gb|EEE54779.1| hypothetical protein OsJ_02176 [Oryza sativa Japonica Group]
Length=429

 Score =   495 bits (1275),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 239/253 (94%), Positives = 248/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALARE +LSL+NVRHFILDECDKML+SLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  177  GRILALAREKDLSLKNVRHFILDECDKMLDSLDMRRDVQEIFKMTPHDKQVMMFSATLSK  236

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  237  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQVVIF  296

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL ECNFP+I IHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  297  VKSVSRAAELNKLLCECNFPAISIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDI  356

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSAD+YLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  357  ERVNIVINYDMPDSADSYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  416

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  417  LPEQIDTSTYMPS  429



>emb|CBI21031.3| unnamed protein product [Vitis vinifera]
Length=521

 Score =   499 bits (1284),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 240/250 (96%), Positives = 248/250 (99%), Gaps = 0/250 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +L+L+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  240  GRILALARDKDLALKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  299

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  300  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  359

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGM QEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  360  VKSVSRAAELNKLLVECNFPSICIHSGMPQEERLTRYKGFKEGHKRILVATDLVGRGIDI  419

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  420  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  479

Query  280  LPEQIDTSTY  251
            LPEQIDTSTY
Sbjct  480  LPEQIDTSTY  489



>ref|XP_006644281.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like [Oryza 
brachyantha]
Length=433

 Score =   495 bits (1275),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 238/253 (94%), Positives = 247/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL RE +LSL+NVRHFILDECDKML+SLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  181  GRILALVREKDLSLKNVRHFILDECDKMLDSLDMRRDVQEIFKMTPHDKQVMMFSATLSK  240

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  241  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQVVIF  300

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL ECNFP+I IHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  301  VKSVSRAAELNKLLCECNFPAISIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDI  360

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSAD+YLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  361  ERVNIVINYDMPDSADSYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  420

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  421  LPEQIDTSTYMPS  433



>ref|XP_010048977.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Eucalyptus 
grandis]
Length=427

 Score =   495 bits (1274),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 240/253 (95%), Positives = 247/253 (98%), Gaps = 1/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVC KFMQDPMEIYVD EAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCHKFMQDPMEIYVD-EAKLTLHGLVQHYIKLSEGEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLV+CNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELNKLLVDCNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSD LNQVQ RFEVDIKE
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDTLNQVQARFEVDIKE  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>ref|XP_011459186.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Fragaria vesca subsp. vesca]
 ref|XP_011459187.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Fragaria vesca subsp. vesca]
Length=426

 Score =   494 bits (1273),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 238/253 (94%), Positives = 246/253 (97%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  174  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  233

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            +IRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTE EKNRKLNDLLDALDFNQVVIF
Sbjct  234  DIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEAEKNRKLNDLLDALDFNQVVIF  293

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL ECNFPSICIHSGM+QEERL RYKGFKEG  RILVATDLVGRGIDI
Sbjct  294  VKSVSRAAELNKLLSECNFPSICIHSGMNQEERLKRYKGFKEGQNRILVATDLVGRGIDI  353

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLN VQERFEVDIKE
Sbjct  354  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNDVQERFEVDIKE  413

Query  280  LPEQIDTSTYMPS  242
            LPEQIDT+TYMPS
Sbjct  414  LPEQIDTATYMPS  426



>ref|XP_008394071.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Malus domestica]
 ref|XP_008394072.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Malus domestica]
 ref|XP_009355726.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Pyrus x bretschneideri]
 ref|XP_009355727.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Pyrus x bretschneideri]
 ref|XP_009355728.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Pyrus x bretschneideri]
Length=426

 Score =   494 bits (1273),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 238/253 (94%), Positives = 246/253 (97%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  174  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  233

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            +IRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTE EKNRKLNDLLDALDFNQVVIF
Sbjct  234  DIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEAEKNRKLNDLLDALDFNQVVIF  293

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL ECNFPSICIHSGMSQEERL RYKGFKEG  RILVATDLVGRGIDI
Sbjct  294  VKSVSRAAELNKLLSECNFPSICIHSGMSQEERLKRYKGFKEGQNRILVATDLVGRGIDI  353

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DSDVLN VQERFEVDIKE
Sbjct  354  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNDVQERFEVDIKE  413

Query  280  LPEQIDTSTYMPS  242
            LPEQIDT+TYMPS
Sbjct  414  LPEQIDTATYMPS  426



>ref|NP_001043297.1| Os01g0549700 [Oryza sativa Japonica Group]
 dbj|BAF05211.1| Os01g0549700, partial [Oryza sativa Japonica Group]
Length=495

 Score =   497 bits (1279),  Expect = 8e-171, Method: Compositional matrix adjust.
 Identities = 239/253 (94%), Positives = 248/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALARE +LSL+NVRHFILDECDKML+SLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  243  GRILALAREKDLSLKNVRHFILDECDKMLDSLDMRRDVQEIFKMTPHDKQVMMFSATLSK  302

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  303  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQVVIF  362

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL ECNFP+I IHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  363  VKSVSRAAELNKLLCECNFPAISIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDI  422

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSAD+YLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  423  ERVNIVINYDMPDSADSYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  482

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  483  LPEQIDTSTYMPS  495



>ref|XP_008378410.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Malus 
domestica]
Length=344

 Score =   491 bits (1263),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 236/253 (93%), Positives = 245/253 (97%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  92   GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            +IRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTE EKN KLNDLLDALDFNQVVIF
Sbjct  152  DIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEAEKNCKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL ECNFPSICIHSGM+QEERL RYKGFKEG  RILVATDLVGRGIDI
Sbjct  212  VKSVSRAAELNKLLSECNFPSICIHSGMNQEERLKRYKGFKEGQNRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DSDVLN VQERFEVDIKE
Sbjct  272  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNDVQERFEVDIKE  331

Query  280  LPEQIDTSTYMPS  242
            LPEQIDT+TYMPS
Sbjct  332  LPEQIDTATYMPS  344



>ref|XP_009125794.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Brassica 
rapa]
Length=427

 Score =   494 bits (1271),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 235/253 (93%), Positives = 247/253 (98%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+L L+R+ +LSL NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRVLGLSRDKDLSLNNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+EMEKNRKLNDLLDALDFN+VVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEMEKNRKLNDLLDALDFNKVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RA ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDLVGRGIDI
Sbjct  295  VKSVSRAGELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ+RFEVDIKE
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQDRFEVDIKE  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>ref|NP_001170610.1| uncharacterized protein LOC100384654 [Zea mays]
 ref|XP_008655336.1| PREDICTED: uncharacterized protein LOC100384654 isoform X1 [Zea 
mays]
 gb|ACR34212.1| unknown [Zea mays]
 gb|AFW82992.1| hypothetical protein ZEAMMB73_566534 [Zea mays]
 gb|AFW82993.1| hypothetical protein ZEAMMB73_566534 [Zea mays]
Length=427

 Score =   493 bits (1270),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 239/253 (94%), Positives = 247/253 (98%), Gaps = 1/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +L L+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLPLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCK+FMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKRFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL ECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVSRAAELNKLLCECNFPSICIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIV+NYDMPDSADTYLHRVGRAGRFGTKGLAITFV SSSDSDVLNQVQERFEVDIKE
Sbjct  356  ERVNIVVNYDMPDSADTYLHRVGRAGRFGTKGLAITFV-SSSDSDVLNQVQERFEVDIKE  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>ref|XP_006583127.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Glycine max]
Length=344

 Score =   490 bits (1261),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 235/253 (93%), Positives = 245/253 (97%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +L L+NVRHFILDECDKMLESLDMRRDVQEIFK+TPHDKQVMMFSATLSK
Sbjct  92   GRILALARDKDLGLKNVRHFILDECDKMLESLDMRRDVQEIFKLTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLQETEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHS MSQEERL RYKGFKEG +RILVATDLVGRGIDI
Sbjct  212  VKSVSRAAELNKLLVECNFPSICIHSAMSQEERLKRYKGFKEGKQRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DS+VLNQVQ RFEVDIKE
Sbjct  272  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSTADSEVLNQVQSRFEVDIKE  331

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMP+
Sbjct  332  LPEQIDTSTYMPN  344



>ref|XP_003588758.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=344

 Score =   489 bits (1260),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 236/253 (93%), Positives = 244/253 (96%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMR+DVQ+IFKMTPHDKQVMMFSATLSK
Sbjct  92   GRILALARDKDLSLKNVRHFILDECDKMLESLDMRKDVQDIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLKEEEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDLVGRGIDI
Sbjct  212  VKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS SSD DVLN VQ RFEVDIK+
Sbjct  272  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSSDVDVLNNVQSRFEVDIKQ  331

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  332  LPEQIDTSTYMPS  344



>gb|AFW82994.1| hypothetical protein ZEAMMB73_566534 [Zea mays]
Length=446

 Score =   493 bits (1270),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 239/253 (94%), Positives = 247/253 (98%), Gaps = 1/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +L L+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  195  GRILALARDKDLPLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  254

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCK+FMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  255  EIRPVCKRFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQVVIF  314

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL ECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  315  VKSVSRAAELNKLLCECNFPSICIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDI  374

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIV+NYDMPDSADTYLHRVGRAGRFGTKGLAITFV SSSDSDVLNQVQERFEVDIKE
Sbjct  375  ERVNIVVNYDMPDSADTYLHRVGRAGRFGTKGLAITFV-SSSDSDVLNQVQERFEVDIKE  433

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  434  LPEQIDTSTYMPS  446



>ref|XP_009376926.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Pyrus 
x bretschneideri]
 ref|XP_009376927.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Pyrus 
x bretschneideri]
Length=426

 Score =   492 bits (1267),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 237/253 (94%), Positives = 246/253 (97%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  174  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  233

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            +IRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTE EKNRKLNDLLDALDFNQVVIF
Sbjct  234  DIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTESEKNRKLNDLLDALDFNQVVIF  293

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL ECNFPSICIHSGM+QEERL RYKGFKEG  RILVATDLVGRGIDI
Sbjct  294  VKSVSRAAELNKLLSECNFPSICIHSGMNQEERLKRYKGFKEGQNRILVATDLVGRGIDI  353

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DSDVLN VQERFEVDIKE
Sbjct  354  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNDVQERFEVDIKE  413

Query  280  LPEQIDTSTYMPS  242
            LPEQIDT+TYMPS
Sbjct  414  LPEQIDTATYMPS  426



>ref|XP_007135742.1| hypothetical protein PHAVU_010G154700g [Phaseolus vulgaris]
 gb|ESW07736.1| hypothetical protein PHAVU_010G154700g [Phaseolus vulgaris]
Length=425

 Score =   492 bits (1266),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 236/253 (93%), Positives = 246/253 (97%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +L L+NVRHFILDECDKMLESLDMRRDVQEIFK+TPHDKQVMMFSATLSK
Sbjct  173  GRILALARDKDLGLKNVRHFILDECDKMLESLDMRRDVQEIFKLTPHDKQVMMFSATLSK  232

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKLNDLLDALDFNQVVIF
Sbjct  233  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLQETEKNRKLNDLLDALDFNQVVIF  292

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERL RYKGFKEG +RILVATDLVGRGIDI
Sbjct  293  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLKRYKGFKEGKQRILVATDLVGRGIDI  352

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DS+VLNQVQ RFEVDIKE
Sbjct  353  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSTADSEVLNQVQSRFEVDIKE  412

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMP+
Sbjct  413  LPEQIDTSTYMPN  425



>gb|KHG21287.1| DEAD-box ATP-dependent RNA helicase 56 -like protein [Gossypium 
arboreum]
Length=461

 Score =   493 bits (1268),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 240/262 (92%), Positives = 248/262 (95%), Gaps = 12/262 (5%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL R+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  110  GRILALTRDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  169

Query  820  EIRPVCKKFMQD------------PMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDL  677
            EIRPVCKKFMQD            PMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDL
Sbjct  170  EIRPVCKKFMQDVMFRGQYYLNLEPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDL  229

Query  676  LDALDFNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRIL  497
            LDALDFNQVVIFVKSV+RAAELNKLL+ECNFPSICIHSGMSQEERLTRYKGFKEGHKRIL
Sbjct  230  LDALDFNQVVIFVKSVSRAAELNKLLMECNFPSICIHSGMSQEERLTRYKGFKEGHKRIL  289

Query  496  VATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLN  317
            VATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLN
Sbjct  290  VATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLN  349

Query  316  QVQERFEVDIKELPEQIDTSTY  251
            QVQERFEVDIKELPEQIDTSTY
Sbjct  350  QVQERFEVDIKELPEQIDTSTY  371



>gb|KCW81407.1| hypothetical protein EUGRSUZ_C02784 [Eucalyptus grandis]
Length=543

 Score =   495 bits (1274),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 240/253 (95%), Positives = 247/253 (98%), Gaps = 1/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  292  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  351

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVC KFMQDPMEIYVD EAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  352  EIRPVCHKFMQDPMEIYVD-EAKLTLHGLVQHYIKLSEGEKNRKLNDLLDALDFNQVVIF  410

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLV+CNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  411  VKSVSRAAELNKLLVDCNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  470

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSD LNQVQ RFEVDIKE
Sbjct  471  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDTLNQVQARFEVDIKE  530

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  531  LPEQIDTSTYMPS  543



>emb|CDY51112.1| BnaCnng20150D [Brassica napus]
Length=440

 Score =   491 bits (1264),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 234/250 (94%), Positives = 245/250 (98%), Gaps = 0/250 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+L LAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  181  GRVLGLARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  240

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+EMEKNRKLNDLLDALDFNQVVIF
Sbjct  241  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEMEKNRKLNDLLDALDFNQVVIF  300

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RA ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDLVGRGIDI
Sbjct  301  VKSVSRAGELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDLVGRGIDI  360

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ+RFEVDIKE
Sbjct  361  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQDRFEVDIKE  420

Query  280  LPEQIDTSTY  251
            LPEQIDTSTY
Sbjct  421  LPEQIDTSTY  430



>ref|XP_009131197.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
56-like [Brassica rapa]
Length=458

 Score =   491 bits (1265),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 235/253 (93%), Positives = 246/253 (97%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+L LAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDK VMMFSATLSK
Sbjct  206  GRVLGLARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKXVMMFSATLSK  265

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  266  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEREKNRKLNDLLDALDFNQVVIF  325

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RA ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDLVGRGIDI
Sbjct  326  VKSVSRAGELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDLVGRGIDI  385

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ+RFEVDIKE
Sbjct  386  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQDRFEVDIKE  445

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  446  LPEQIDTSTYMPS  458



>emb|CDX85725.1| BnaA02g00880D [Brassica napus]
Length=442

 Score =   491 bits (1263),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 234/250 (94%), Positives = 245/250 (98%), Gaps = 0/250 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+L LAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  179  GRVLGLARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  238

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+EMEKNRKLNDLLDALDFNQVVIF
Sbjct  239  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEMEKNRKLNDLLDALDFNQVVIF  298

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RA ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDLVGRGIDI
Sbjct  299  VKSVSRAGELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDLVGRGIDI  358

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ+RFEVDIKE
Sbjct  359  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQDRFEVDIKE  418

Query  280  LPEQIDTSTY  251
            LPEQIDTSTY
Sbjct  419  LPEQIDTSTY  428



>ref|XP_003528338.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Glycine max]
Length=426

 Score =   490 bits (1261),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 235/253 (93%), Positives = 245/253 (97%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +L L+NVRHFILDECDKMLESLDMRRDVQEIFK+TPHDKQVMMFSATLSK
Sbjct  174  GRILALARDKDLGLKNVRHFILDECDKMLESLDMRRDVQEIFKLTPHDKQVMMFSATLSK  233

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKLNDLLDALDFNQVVIF
Sbjct  234  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLQETEKNRKLNDLLDALDFNQVVIF  293

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHS MSQEERL RYKGFKEG +RILVATDLVGRGIDI
Sbjct  294  VKSVSRAAELNKLLVECNFPSICIHSAMSQEERLKRYKGFKEGKQRILVATDLVGRGIDI  353

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DS+VLNQVQ RFEVDIKE
Sbjct  354  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSTADSEVLNQVQSRFEVDIKE  413

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMP+
Sbjct  414  LPEQIDTSTYMPN  426



>ref|XP_003531708.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Glycine max]
Length=426

 Score =   490 bits (1261),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 235/253 (93%), Positives = 245/253 (97%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +L L+NVRHFILDECDKMLESLDMRRDVQEIFK+TPHDKQVMMFSATLSK
Sbjct  174  GRILALARDKDLGLKNVRHFILDECDKMLESLDMRRDVQEIFKLTPHDKQVMMFSATLSK  233

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKLNDLLDALDFNQVVIF
Sbjct  234  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLQETEKNRKLNDLLDALDFNQVVIF  293

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHS MSQEERL RYKGFKEG +RILVATDLVGRGIDI
Sbjct  294  VKSVSRAAELNKLLVECNFPSICIHSAMSQEERLKRYKGFKEGKQRILVATDLVGRGIDI  353

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DS+VLNQVQ RFEVDIKE
Sbjct  354  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSTADSEVLNQVQSRFEVDIKE  413

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMP+
Sbjct  414  LPEQIDTSTYMPN  426



>ref|XP_001781775.1| predicted protein [Physcomitrella patens]
 gb|EDQ53423.1| predicted protein [Physcomitrella patens]
Length=432

 Score =   490 bits (1261),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 234/250 (94%), Positives = 247/250 (99%), Gaps = 0/250 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRIL LAR+ +LSL++VRHFILDECDKMLESLDMRRDVQEIFK+TPHDKQVMMFSATLSK
Sbjct  173  GRILGLARDKDLSLKSVRHFILDECDKMLESLDMRRDVQEIFKLTPHDKQVMMFSATLSK  232

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCK+FMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  233  EIRPVCKRFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEVEKNRKLNDLLDALDFNQVVIF  292

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  293  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  352

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+ DS+VLNQVQERFEVDIKE
Sbjct  353  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASAPDSNVLNQVQERFEVDIKE  412

Query  280  LPEQIDTSTY  251
            LPEQIDT+TY
Sbjct  413  LPEQIDTTTY  422



>ref|XP_006578149.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Glycine max]
Length=344

 Score =   486 bits (1252),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 234/253 (92%), Positives = 243/253 (96%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL R+ +LSL+NVRHFILDECDKMLESLDMR+DVQ+IFKMTPHDKQVMMFSATLSK
Sbjct  92   GRILALTRDKDLSLKNVRHFILDECDKMLESLDMRKDVQDIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLKEEEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDLVGRGIDI
Sbjct  212  VKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS S+D DVLN VQ RFEVDIK+
Sbjct  272  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSTDVDVLNNVQSRFEVDIKQ  331

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  332  LPEQIDTSTYMPS  344



>gb|KCW80390.1| hypothetical protein EUGRSUZ_C01749 [Eucalyptus grandis]
Length=430

 Score =   489 bits (1260),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 238/250 (95%), Positives = 245/250 (98%), Gaps = 1/250 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVD EAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVD-EAKLTLHGLVQHYIKLSEGEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLV+CNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  295  VKSVNRAAELNKLLVDCNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSD+LNQVQ RFEVDIKE
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDILNQVQARFEVDIKE  414

Query  280  LPEQIDTSTY  251
            LPEQIDTSTY
Sbjct  415  LPEQIDTSTY  424



>ref|XP_003588757.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|AES59008.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=427

 Score =   489 bits (1259),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 236/253 (93%), Positives = 244/253 (96%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMR+DVQ+IFKMTPHDKQVMMFSATLSK
Sbjct  175  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRKDVQDIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLKEEEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS SSD DVLN VQ RFEVDIK+
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSSDVDVLNNVQSRFEVDIKQ  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>ref|XP_002985161.1| hypothetical protein SELMODRAFT_446187 [Selaginella moellendorffii]
 gb|EFJ13655.1| hypothetical protein SELMODRAFT_446187 [Selaginella moellendorffii]
Length=473

 Score =   490 bits (1262),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 235/250 (94%), Positives = 243/250 (97%), Gaps = 0/250 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRIL L RE  LSL+ VRHFILDECDKMLESLDMRRDVQEIFK+TPHDKQVMMFSATLSK
Sbjct  176  GRILQLTREKELSLKGVRHFILDECDKMLESLDMRRDVQEIFKLTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCK+FMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKRFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMP+SADTYLHRVGRAGRFGTKGLAITFV+SS+DS+VLNQVQERFEVDIKE
Sbjct  356  ERVNIVINYDMPESADTYLHRVGRAGRFGTKGLAITFVASSTDSNVLNQVQERFEVDIKE  415

Query  280  LPEQIDTSTY  251
            LPEQIDTSTY
Sbjct  416  LPEQIDTSTY  425



>ref|XP_004498731.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Cicer arietinum]
Length=427

 Score =   488 bits (1256),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 235/253 (93%), Positives = 243/253 (96%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMR+DVQ+IFKMTPHDKQVMMFSATLSK
Sbjct  175  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRKDVQDIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLKEEEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPD ADTYLHRVGRAGRFGTKGLAITFVS SSD DVLN VQ RFEVDIK+
Sbjct  355  ERVNIVINYDMPDGADTYLHRVGRAGRFGTKGLAITFVSCSSDVDVLNNVQSRFEVDIKQ  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>gb|KHN01339.1| DEAD-box ATP-dependent RNA helicase 56 [Glycine soja]
Length=473

 Score =   489 bits (1259),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 235/253 (93%), Positives = 245/253 (97%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +L L+NVRHFILDECDKMLESLDMRRDVQEIFK+TPHDKQVMMFSATLSK
Sbjct  221  GRILALARDKDLGLKNVRHFILDECDKMLESLDMRRDVQEIFKLTPHDKQVMMFSATLSK  280

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKLNDLLDALDFNQVVIF
Sbjct  281  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLQETEKNRKLNDLLDALDFNQVVIF  340

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHS MSQEERL RYKGFKEG +RILVATDLVGRGIDI
Sbjct  341  VKSVSRAAELNKLLVECNFPSICIHSAMSQEERLKRYKGFKEGKQRILVATDLVGRGIDI  400

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DS+VLNQVQ RFEVDIKE
Sbjct  401  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSTADSEVLNQVQSRFEVDIKE  460

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMP+
Sbjct  461  LPEQIDTSTYMPN  473



>ref|XP_003603412.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|AES73663.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=427

 Score =   487 bits (1254),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 232/253 (92%), Positives = 244/253 (96%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALARE NLSL+NVRHF+LDECDKMLESLDMR+DVQ+IFK+TPHDKQVMMFSATLSK
Sbjct  175  GRILALAREKNLSLKNVRHFVLDECDKMLESLDMRKDVQDIFKLTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLKEEEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAEL++LL+ECNFPSICIHSGMSQEERL RY+GFKEGH RILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELDRLLIECNFPSICIHSGMSQEERLKRYRGFKEGHSRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS SSD DVLN VQ RFE+DIK+
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSSDVDVLNNVQSRFEIDIKQ  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>ref|XP_009125790.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Brassica 
rapa]
 ref|XP_009125791.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Brassica 
rapa]
Length=427

 Score =   486 bits (1252),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 233/253 (92%), Positives = 244/253 (96%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+L LAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPH+KQVMMFSATLSK
Sbjct  175  GRVLGLARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHEKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL EMEKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLGEMEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RA ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEG KRILVATDLVGRGIDI
Sbjct  295  VKSVSRARELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGQKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ RFEVDIK+
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQARFEVDIKQ  414

Query  280  LPEQIDTSTYMPS  242
            LPE IDTSTYMPS
Sbjct  415  LPENIDTSTYMPS  427



>ref|XP_003522620.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Glycine max]
 gb|KHN08125.1| DEAD-box ATP-dependent RNA helicase 56 [Glycine soja]
Length=427

 Score =   486 bits (1252),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 234/253 (92%), Positives = 243/253 (96%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL R+ +LSL+NVRHFILDECDKMLESLDMR+DVQ+IFKMTPHDKQVMMFSATLSK
Sbjct  175  GRILALTRDKDLSLKNVRHFILDECDKMLESLDMRKDVQDIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLKEEEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS S+D DVLN VQ RFEVDIK+
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSTDVDVLNNVQSRFEVDIKQ  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>ref|XP_003526412.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoformX1 [Glycine 
max]
 ref|XP_003526413.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoformX2 [Glycine 
max]
 ref|XP_006581360.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X3 
[Glycine max]
 gb|KHN07085.1| DEAD-box ATP-dependent RNA helicase 56 [Glycine soja]
Length=427

 Score =   486 bits (1252),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 234/253 (92%), Positives = 243/253 (96%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL R+ +LSL+NVRHFILDECDKMLESLDMR+DVQ+IFKMTPHDKQVMMFSATLSK
Sbjct  175  GRILALTRDKDLSLKNVRHFILDECDKMLESLDMRKDVQDIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLKEEEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS S+D DVLN VQ RFEVDIK+
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSTDVDVLNNVQSRFEVDIKQ  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>ref|XP_007137031.1| hypothetical protein PHAVU_009G093800g [Phaseolus vulgaris]
 gb|ESW09025.1| hypothetical protein PHAVU_009G093800g [Phaseolus vulgaris]
Length=427

 Score =   486 bits (1252),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 234/253 (92%), Positives = 243/253 (96%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL R+ +LSL+NVRHFILDECDKMLESLDMR+DVQ+IFKMTPHDKQVMMFSATLSK
Sbjct  175  GRILALTRDKDLSLKNVRHFILDECDKMLESLDMRKDVQDIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLKEEEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS S+D DVLN VQ RFEVDIK+
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSTDVDVLNNVQSRFEVDIKQ  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>gb|KEH28678.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=504

 Score =   489 bits (1258),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 234/253 (92%), Positives = 244/253 (96%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL R+ +L L+NVRHFILDECDKMLESLDMR+DVQEIFK+TPHDKQVMMFSATLSK
Sbjct  252  GRILALTRDKDLGLKNVRHFILDECDKMLESLDMRKDVQEIFKLTPHDKQVMMFSATLSK  311

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKLNDLLDALDFNQVVIF
Sbjct  312  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLQEPEKNRKLNDLLDALDFNQVVIF  371

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERL RYKGFKEG +RILVATDLVGRGIDI
Sbjct  372  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLKRYKGFKEGKQRILVATDLVGRGIDI  431

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+ DS+VLNQVQ RFEVDIKE
Sbjct  432  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAGDSEVLNQVQSRFEVDIKE  491

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMP+
Sbjct  492  LPEQIDTSTYMPN  504



>gb|AFV30230.1| ATP-dependent RNA helicase [Medicago sativa]
Length=427

 Score =   486 bits (1250),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 235/253 (93%), Positives = 243/253 (96%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMR+DVQ+IFKMTPHDKQVMMFSATLSK
Sbjct  175  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRKDVQDIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKL DLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLKEEEKNRKLYDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS SSD DVLN VQ RFEVDIK+
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSSDVDVLNNVQSRFEVDIKQ  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>gb|AFK41905.1| unknown [Medicago truncatula]
Length=427

 Score =   486 bits (1250),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 235/253 (93%), Positives = 243/253 (96%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMR+DVQ+IFKMTP DKQVMMFSATLSK
Sbjct  175  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRKDVQDIFKMTPRDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLKEEEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS SSD DVLN VQ RFEVDIK+
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSSDVDVLNNVQSRFEVDIKQ  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>ref|XP_004968947.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X1 [Setaria italica]
Length=457

 Score =   486 bits (1251),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 240/281 (85%), Positives = 248/281 (88%), Gaps = 28/281 (10%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +L L+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  177  GRILALARDKDLPLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  236

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  237  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQVVIF  296

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL ECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  297  VKSVSRAAELNKLLCECNFPSICIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDI  356

Query  460  ERVNIVINYDMPDSADTYLHR----------------------------VGRAGRFGTKG  365
            ERVNIV+NYDMPDSADTYLHR                            VGRAGRFGTKG
Sbjct  357  ERVNIVVNYDMPDSADTYLHRVIVAPPLLQAVGSFYLFYYLLLMHSPLQVGRAGRFGTKG  416

Query  364  LAITFVSSSSDSDVLNQVQERFEVDIKELPEQIDTSTYMPS  242
            LAITFVSS+SDSDVLNQVQERFEVDIKELPEQIDTSTYMPS
Sbjct  417  LAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS  457



>ref|NP_001154707.1| DEAD-box ATP-dependent RNA helicase 56 [Arabidopsis thaliana]
 gb|AED91647.1| DEAD-box ATP-dependent RNA helicase 56 [Arabidopsis thaliana]
Length=468

 Score =   486 bits (1251),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 243/294 (83%), Positives = 251/294 (85%), Gaps = 41/294 (14%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALARE +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRVLALAREKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQD-----------------------------------------PMEIYVD  764
            EIRPVCKKFMQD                                         PMEIYVD
Sbjct  235  EIRPVCKKFMQDGLRTLSGDSVALWWVGFGSGYCVFPRFHRARMGLNVPSNIDPMEIYVD  294

Query  763  DEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIFVKSVTRAAELNKLLVECNF  584
            DEAKLTLHGLVQHYIKL+EMEKNRKLNDLLDALDFNQVVIFVKSV+RAAELNKLLVECNF
Sbjct  295  DEAKLTLHGLVQHYIKLSEMEKNRKLNDLLDALDFNQVVIFVKSVSRAAELNKLLVECNF  354

Query  583  PSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADTYL  404
            PSICIHSGMSQEERLTRYK FKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADTYL
Sbjct  355  PSICIHSGMSQEERLTRYKSFKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADTYL  414

Query  403  HRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKELPEQIDTSTYMPS  242
            HRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQERFEVDIKELPEQIDTSTYMPS
Sbjct  415  HRVGRAGRFGTKGLAITFVASASDSEVLNQVQERFEVDIKELPEQIDTSTYMPS  468



>ref|XP_006585632.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 
[Glycine max]
Length=440

 Score =   485 bits (1248),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 233/250 (93%), Positives = 242/250 (97%), Gaps = 0/250 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +L L+NVRHFILDECDKMLESLDMRRDVQEIFK+TPHDKQVMMFSATLSK
Sbjct  174  GRILALARDKDLGLKNVRHFILDECDKMLESLDMRRDVQEIFKLTPHDKQVMMFSATLSK  233

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKLNDLLDALDFNQVVIF
Sbjct  234  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLQETEKNRKLNDLLDALDFNQVVIF  293

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHS MSQEERL RYKGFKEG +RILVATDLVGRGIDI
Sbjct  294  VKSVSRAAELNKLLVECNFPSICIHSAMSQEERLKRYKGFKEGKQRILVATDLVGRGIDI  353

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DS+VLNQVQ RFEVDIKE
Sbjct  354  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSTADSEVLNQVQSRFEVDIKE  413

Query  280  LPEQIDTSTY  251
            LPEQIDTSTY
Sbjct  414  LPEQIDTSTY  423



>ref|XP_004506913.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Cicer arietinum]
Length=353

 Score =   481 bits (1237),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 231/250 (92%), Positives = 241/250 (96%), Gaps = 0/250 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL R+ +L L+NVRHFILDECDKMLESLDMR+DVQEIFK+TPHDKQVMMFSATLSK
Sbjct  92   GRILALTRDKDLGLKNVRHFILDECDKMLESLDMRKDVQEIFKLTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            +IRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKLNDLLDALDFNQVVIF
Sbjct  152  DIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLQEPEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERL RYKGFKEG +RILVATDLVGRGIDI
Sbjct  212  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLKRYKGFKEGKQRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+ DS+VLNQVQ RFEVDIKE
Sbjct  272  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAGDSEVLNQVQSRFEVDIKE  331

Query  280  LPEQIDTSTY  251
            LPEQIDTSTY
Sbjct  332  LPEQIDTSTY  341



>gb|KHN47769.1| DEAD-box ATP-dependent RNA helicase 56 [Glycine soja]
Length=450

 Score =   484 bits (1246),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 237/268 (88%), Positives = 247/268 (92%), Gaps = 8/268 (3%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +L L+NVRHFILDECDKMLESLDMRRDVQEIFK+TPHDKQVMMFSATLSK
Sbjct  174  GRILALARDKDLGLKNVRHFILDECDKMLESLDMRRDVQEIFKLTPHDKQVMMFSATLSK  233

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKLNDLLDALDFNQVVIF
Sbjct  234  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLQETEKNRKLNDLLDALDFNQVVIF  293

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHS MSQEERL RYKGFKEG +RILVATDLVGRGIDI
Sbjct  294  VKSVSRAAELNKLLVECNFPSICIHSAMSQEERLKRYKGFKEGKQRILVATDLVGRGIDI  353

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DS+VLNQVQ RFEVDIKE
Sbjct  354  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSTADSEVLNQVQSRFEVDIKE  413

Query  280  LPEQIDTSTYMPS*RS--------WLAS  221
            LPEQIDTSTY    R         WLA+
Sbjct  414  LPEQIDTSTYRGRSRRIFADWGMVWLAT  441



>ref|XP_009121981.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Brassica rapa]
Length=430

 Score =   483 bits (1243),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 232/256 (91%), Positives = 245/256 (96%), Gaps = 3/256 (1%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+L LAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRVLGLARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGL---VQHYIKLTEMEKNRKLNDLLDALDFNQV  650
            EIRPVCKKFMQDPMEIYVDDEAKLT H +   + HYIKL+EMEKNRKLNDLLDALDFNQV
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTFHTMYIILSHYIKLSEMEKNRKLNDLLDALDFNQV  294

Query  649  VIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRG  470
            VIFVKSV+RA ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDLVGRG
Sbjct  295  VIFVKSVSRAGELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDLVGRG  354

Query  469  IDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVD  290
            IDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ+RFEVD
Sbjct  355  IDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQDRFEVD  414

Query  289  IKELPEQIDTSTYMPS  242
            IKELPEQIDTSTYMPS
Sbjct  415  IKELPEQIDTSTYMPS  430



>ref|XP_009334643.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Pyrus x bretschneideri]
Length=344

 Score =   480 bits (1235),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 231/251 (92%), Positives = 239/251 (95%), Gaps = 0/251 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+  L L+NVRHFILDECDKMLESLDMRRDVQEIFK+TPHDKQVMMFSATLSK
Sbjct  92   GRVLALARDKELGLKNVRHFILDECDKMLESLDMRRDVQEIFKLTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKL DLLDALDFNQVVIF
Sbjct  152  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEPEKNRKLTDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL +CNFPSICIHSGM QEERL RYK FKEG  RILVATDLVGRGIDI
Sbjct  212  VKSVSRAAELNKLLADCNFPSICIHSGMPQEERLKRYKNFKEGLSRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQ RFEVDIKE
Sbjct  272  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQSRFEVDIKE  331

Query  280  LPEQIDTSTYM  248
            LPEQIDTSTYM
Sbjct  332  LPEQIDTSTYM  342



>ref|XP_004498732.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X3 [Cicer arietinum]
Length=404

 Score =   481 bits (1239),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 232/250 (93%), Positives = 240/250 (96%), Gaps = 0/250 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMR+DVQ+IFKMTPHDKQVMMFSATLSK
Sbjct  92   GRILALARDKDLSLKNVRHFILDECDKMLESLDMRKDVQDIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLKEEEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDLVGRGIDI
Sbjct  212  VKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPD ADTYLHRVGRAGRFGTKGLAITFVS SSD DVLN VQ RFEVDIK+
Sbjct  272  ERVNIVINYDMPDGADTYLHRVGRAGRFGTKGLAITFVSCSSDVDVLNNVQSRFEVDIKQ  331

Query  280  LPEQIDTSTY  251
            LPEQIDTSTY
Sbjct  332  LPEQIDTSTY  341



>ref|XP_008362058.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Malus domestica]
 ref|XP_008362062.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Malus domestica]
Length=344

 Score =   478 bits (1229),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 230/251 (92%), Positives = 238/251 (95%), Gaps = 0/251 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+  L L+NVRHFILDECDKMLESLDMRRDVQEIFK+TPHDKQVMMFSATLSK
Sbjct  92   GRVLALARDKELGLKNVRHFILDECDKMLESLDMRRDVQEIFKLTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKL DLLDALDFNQVVIF
Sbjct  152  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEPEKNRKLTDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELN LL +CNFPSICIHSGM QEERL RYK FKEG  RILVATDLVGRGIDI
Sbjct  212  VKSVSRAAELNNLLADCNFPSICIHSGMPQEERLKRYKNFKEGLSRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQ RFEVDIKE
Sbjct  272  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQSRFEVDIKE  331

Query  280  LPEQIDTSTYM  248
            LPEQIDTSTYM
Sbjct  332  LPEQIDTSTYM  342



>gb|AGV54745.1| DEAD-box ATP-dependent RNA helicase 56-like protein [Phaseolus 
vulgaris]
Length=427

 Score =   481 bits (1237),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 232/253 (92%), Positives = 240/253 (95%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR L L R  +LSL+NVRHFILDECDKMLESLDMR+DVQ+IFKMTPHDKQVMMFSATLSK
Sbjct  175  GRQLTLTRGEDLSLKNVRHFILDECDKMLESLDMRKDVQDIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLKEEEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS S+D DVLN VQ RFEVDIK+
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSTDVDVLNNVQSRFEVDIKQ  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>ref|XP_004506912.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Cicer arietinum]
Length=435

 Score =   481 bits (1238),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 231/250 (92%), Positives = 241/250 (96%), Gaps = 0/250 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL R+ +L L+NVRHFILDECDKMLESLDMR+DVQEIFK+TPHDKQVMMFSATLSK
Sbjct  174  GRILALTRDKDLGLKNVRHFILDECDKMLESLDMRKDVQEIFKLTPHDKQVMMFSATLSK  233

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            +IRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKLNDLLDALDFNQVVIF
Sbjct  234  DIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLQEPEKNRKLNDLLDALDFNQVVIF  293

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERL RYKGFKEG +RILVATDLVGRGIDI
Sbjct  294  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLKRYKGFKEGKQRILVATDLVGRGIDI  353

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+ DS+VLNQVQ RFEVDIKE
Sbjct  354  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAGDSEVLNQVQSRFEVDIKE  413

Query  280  LPEQIDTSTY  251
            LPEQIDTSTY
Sbjct  414  LPEQIDTSTY  423



>ref|XP_008243728.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Prunus 
mume]
Length=428

 Score =   481 bits (1237),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 232/251 (92%), Positives = 239/251 (95%), Gaps = 0/251 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+  L L+NVRHFILDECDKMLESLDMRRDVQEIFK+TPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKELGLKNVRHFILDECDKMLESLDMRRDVQEIFKLTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKL DLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEPEKNRKLTDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL +CNFPSICIHSGM QEERL RYK FKEG  RILVATDLVGRGIDI
Sbjct  296  VKSVSRAAELNKLLADCNFPSICIHSGMPQEERLKRYKNFKEGLSRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQ RFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQSRFEVDIKE  415

Query  280  LPEQIDTSTYM  248
            LPEQIDTSTYM
Sbjct  416  LPEQIDTSTYM  426



>ref|XP_007215422.1| hypothetical protein PRUPE_ppa006077mg [Prunus persica]
 gb|EMJ16621.1| hypothetical protein PRUPE_ppa006077mg [Prunus persica]
Length=428

 Score =   480 bits (1236),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 232/251 (92%), Positives = 239/251 (95%), Gaps = 0/251 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+  L L+NVRHFILDECDKMLESLDMRRDVQEIFK+TPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKELGLKNVRHFILDECDKMLESLDMRRDVQEIFKLTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKL DLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEPEKNRKLTDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL +CNFPSICIHSGM QEERL RYK FKEG  RILVATDLVGRGIDI
Sbjct  296  VKSVSRAAELNKLLADCNFPSICIHSGMPQEERLKRYKNFKEGLSRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQ RFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQSRFEVDIKE  415

Query  280  LPEQIDTSTYM  248
            LPEQIDTSTYM
Sbjct  416  LPEQIDTSTYM  426



>ref|XP_009334641.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Pyrus x bretschneideri]
Length=428

 Score =   479 bits (1233),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 231/251 (92%), Positives = 239/251 (95%), Gaps = 0/251 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+  L L+NVRHFILDECDKMLESLDMRRDVQEIFK+TPHDKQVMMFSATLSK
Sbjct  176  GRVLALARDKELGLKNVRHFILDECDKMLESLDMRRDVQEIFKLTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKL DLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEPEKNRKLTDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL +CNFPSICIHSGM QEERL RYK FKEG  RILVATDLVGRGIDI
Sbjct  296  VKSVSRAAELNKLLADCNFPSICIHSGMPQEERLKRYKNFKEGLSRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQ RFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQSRFEVDIKE  415

Query  280  LPEQIDTSTYM  248
            LPEQIDTSTYM
Sbjct  416  LPEQIDTSTYM  426



>ref|XP_004498730.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Cicer arietinum]
Length=487

 Score =   481 bits (1238),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 232/250 (93%), Positives = 240/250 (96%), Gaps = 0/250 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMR+DVQ+IFKMTPHDKQVMMFSATLSK
Sbjct  175  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRKDVQDIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLKEEEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPD ADTYLHRVGRAGRFGTKGLAITFVS SSD DVLN VQ RFEVDIK+
Sbjct  355  ERVNIVINYDMPDGADTYLHRVGRAGRFGTKGLAITFVSCSSDVDVLNNVQSRFEVDIKQ  414

Query  280  LPEQIDTSTY  251
            LPEQIDTSTY
Sbjct  415  LPEQIDTSTY  424



>ref|XP_009121985.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X3 [Brassica rapa]
Length=430

 Score =   479 bits (1232),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 231/256 (90%), Positives = 241/256 (94%), Gaps = 3/256 (1%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR L LAR  +LSL+N RHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRGLGLARGKDLSLKNARHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGL---VQHYIKLTEMEKNRKLNDLLDALDFNQV  650
            EIRPVCKKFMQDPMEIYVDDEAKLT H +   + HYIKL+EMEKNRKLNDLLDALDFNQV
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTFHTMYIILSHYIKLSEMEKNRKLNDLLDALDFNQV  294

Query  649  VIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRG  470
            VIFVKSV+RA ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDLVGRG
Sbjct  295  VIFVKSVSRAGELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDLVGRG  354

Query  469  IDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVD  290
            IDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ RFEVD
Sbjct  355  IDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQARFEVD  414

Query  289  IKELPEQIDTSTYMPS  242
            IKELPEQIDTSTYMPS
Sbjct  415  IKELPEQIDTSTYMPS  430



>ref|XP_009365409.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Pyrus 
x bretschneideri]
 ref|XP_009348326.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Pyrus 
x bretschneideri]
Length=428

 Score =   478 bits (1231),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 230/251 (92%), Positives = 239/251 (95%), Gaps = 0/251 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+  L L+NVRHFILDECDKMLESLDMRRDVQEIFK+TPHDKQVMMFSATLSK
Sbjct  176  GRVLALARDKELGLKNVRHFILDECDKMLESLDMRRDVQEIFKLTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKL DLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEPEKNRKLTDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL +CNFPSICIHSGM QEERL RYK FKEG  RILVATDLVGRGIDI
Sbjct  296  VKSVSRAAELNKLLADCNFPSICIHSGMPQEERLKRYKNFKEGLSRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDS+VLNQVQ RFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSEVLNQVQSRFEVDIKE  415

Query  280  LPEQIDTSTYM  248
            LPEQIDTSTYM
Sbjct  416  LPEQIDTSTYM  426



>ref|XP_004501320.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X3 [Cicer arietinum]
Length=431

 Score =   478 bits (1231),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 229/250 (92%), Positives = 241/250 (96%), Gaps = 0/250 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+ +LSL+NVRHF+LDECDKMLESLDMR+DVQ+IFK+TPHDKQVMMFSATL+K
Sbjct  175  GRVLALARDKDLSLKNVRHFVLDECDKMLESLDMRKDVQDIFKLTPHDKQVMMFSATLNK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLKEEEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS SSD DVLN VQ RFEVDIK+
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSSDVDVLNNVQSRFEVDIKQ  414

Query  280  LPEQIDTSTY  251
            LPEQIDTSTY
Sbjct  415  LPEQIDTSTY  424



>ref|XP_007161216.1| hypothetical protein PHAVU_001G051700g [Phaseolus vulgaris]
 gb|ESW33210.1| hypothetical protein PHAVU_001G051700g [Phaseolus vulgaris]
Length=426

 Score =   478 bits (1230),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 229/253 (91%), Positives = 240/253 (95%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRIL LAR+ +LSL+NVRHFILDECDKMLESL MR+DVQ IFKMTPHDKQVMMFSATLSK
Sbjct  174  GRILGLARDKDLSLKNVRHFILDECDKMLESLGMRKDVQAIFKMTPHDKQVMMFSATLSK  233

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKLNDLLDALDFNQ+VIF
Sbjct  234  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLKEEEKNRKLNDLLDALDFNQIVIF  293

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAEL+KLL ECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDLVGRGIDI
Sbjct  294  VKSVSRAAELDKLLRECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDLVGRGIDI  353

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS S+D DVLN VQ RFEVDIK+
Sbjct  354  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSTDVDVLNNVQSRFEVDIKQ  413

Query  280  LPEQIDTSTYMPS  242
            LPEQIDT++YMPS
Sbjct  414  LPEQIDTASYMPS  426



>ref|XP_008362046.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Malus domestica]
Length=428

 Score =   477 bits (1228),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 230/251 (92%), Positives = 238/251 (95%), Gaps = 0/251 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+  L L+NVRHFILDECDKMLESLDMRRDVQEIFK+TPHDKQVMMFSATLSK
Sbjct  176  GRVLALARDKELGLKNVRHFILDECDKMLESLDMRRDVQEIFKLTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKL DLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEPEKNRKLTDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELN LL +CNFPSICIHSGM QEERL RYK FKEG  RILVATDLVGRGIDI
Sbjct  296  VKSVSRAAELNNLLADCNFPSICIHSGMPQEERLKRYKNFKEGLSRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQ RFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQSRFEVDIKE  415

Query  280  LPEQIDTSTYM  248
            LPEQIDTSTYM
Sbjct  416  LPEQIDTSTYM  426



>ref|XP_004303319.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Fragaria 
vesca subsp. vesca]
Length=428

 Score =   476 bits (1225),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 230/251 (92%), Positives = 238/251 (95%), Gaps = 0/251 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+  L L+NVRHFILDECDKMLESLDMRRDVQ IFK+TPHDKQVMMFSATLSK
Sbjct  176  GRVLALARDKELGLKNVRHFILDECDKMLESLDMRRDVQMIFKLTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKL DLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSESEKNRKLTDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL +CNFPSICIHSGM QEERL RYK FKEG  RILVATDLVGRGIDI
Sbjct  296  VKSVSRAAELNKLLADCNFPSICIHSGMPQEERLKRYKNFKEGLSRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSS+DSDVLNQVQ RFEVDIKE
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSADSDVLNQVQSRFEVDIKE  415

Query  280  LPEQIDTSTYM  248
            LPEQIDTSTYM
Sbjct  416  LPEQIDTSTYM  426



>emb|CDY71952.1| BnaAnng39360D, partial [Brassica napus]
Length=417

 Score =   476 bits (1224),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 235/289 (81%), Positives = 246/289 (85%), Gaps = 36/289 (12%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+L LAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  105  GRVLGLARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  164

Query  820  EIRPVCKKFMQD------------------------------------PMEIYVDDEAKL  749
            EIRPVCKKFMQD                                    PMEIYVDDEAKL
Sbjct  165  EIRPVCKKFMQDDSENWETLKVSLSFGVALGSICKPGGRGSLFRGSVSPMEIYVDDEAKL  224

Query  748  TLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIFVKSVTRAAELNKLLVECNFPSICI  569
            TLHGLVQHYIKL+EMEKNRKLNDLLDALDFNQVVIFVKSV+RA ELNKLL+ECNFPSICI
Sbjct  225  TLHGLVQHYIKLSEMEKNRKLNDLLDALDFNQVVIFVKSVSRAGELNKLLIECNFPSICI  284

Query  568  HSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGR  389
            HSGMSQEERLT YK FKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGR
Sbjct  285  HSGMSQEERLTHYKSFKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGR  344

Query  388  AGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKELPEQIDTSTYMPS  242
            AGRFGTKGLAITFV+S+SDS+VLNQVQ RFEVDIKELPEQIDTSTY+ S
Sbjct  345  AGRFGTKGLAITFVASASDSEVLNQVQARFEVDIKELPEQIDTSTYIAS  393



>emb|CDX69778.1| BnaA10g21270D [Brassica napus]
Length=495

 Score =   477 bits (1228),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 237/294 (81%), Positives = 247/294 (84%), Gaps = 41/294 (14%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+L LAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  202  GRVLGLARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  261

Query  820  EIRPVCKKFMQD-----------------------------------------PMEIYVD  764
            EIRPVCKKFMQD                                         PMEIYVD
Sbjct  262  EIRPVCKKFMQDDSENWEPMKVSLSFGVALGTILVFEDAKPGGRGSLFRGSVSPMEIYVD  321

Query  763  DEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIFVKSVTRAAELNKLLVECNF  584
            DEAKLTLHGLVQHYIKL+EMEKNRKLNDLLDALDFNQVVIFVKSV+RA ELNKLL+ECNF
Sbjct  322  DEAKLTLHGLVQHYIKLSEMEKNRKLNDLLDALDFNQVVIFVKSVSRAGELNKLLIECNF  381

Query  583  PSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADTYL  404
            PSICIHSGMSQEERLT YK FKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADTYL
Sbjct  382  PSICIHSGMSQEERLTHYKSFKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADTYL  441

Query  403  HRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKELPEQIDTSTYMPS  242
            HRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ RFEVDIKELPEQIDTSTYMPS
Sbjct  442  HRVGRAGRFGTKGLAITFVASASDSEVLNQVQARFEVDIKELPEQIDTSTYMPS  495



>ref|XP_011459188.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 
[Fragaria vesca subsp. vesca]
Length=462

 Score =   476 bits (1225),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 238/289 (82%), Positives = 246/289 (85%), Gaps = 36/289 (12%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  174  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  233

Query  820  EIRPVCKKFMQD------------------------------------PMEIYVDDEAKL  749
            +IRPVCKKFMQD                                    PMEIYVDDEAKL
Sbjct  234  DIRPVCKKFMQDVMSHGQYYFNFEVSFSIIPLSTRAPNMIYCDICSFQPMEIYVDDEAKL  293

Query  748  TLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIFVKSVTRAAELNKLLVECNFPSICI  569
            TLHGLVQHYIKLTE EKNRKLNDLLDALDFNQVVIFVKSV+RAAELNKLL ECNFPSICI
Sbjct  294  TLHGLVQHYIKLTEAEKNRKLNDLLDALDFNQVVIFVKSVSRAAELNKLLSECNFPSICI  353

Query  568  HSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGR  389
            HSGM+QEERL RYKGFKEG  RILVATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGR
Sbjct  354  HSGMNQEERLKRYKGFKEGQNRILVATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGR  413

Query  388  AGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKELPEQIDTSTYMPS  242
            AGRFGTKGLAITFVSS+SDSDVLN VQERFEVDIKELPEQIDT+TYMPS
Sbjct  414  AGRFGTKGLAITFVSSASDSDVLNDVQERFEVDIKELPEQIDTATYMPS  462



>ref|XP_004501319.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Cicer arietinum]
Length=451

 Score =   474 bits (1220),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 233/277 (84%), Positives = 245/277 (88%), Gaps = 24/277 (9%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+ +LSL+NVRHF+LDECDKMLESLDMR+DVQ+IFK+TPHDKQVMMFSATL+K
Sbjct  175  GRVLALARDKDLSLKNVRHFVLDECDKMLESLDMRKDVQDIFKLTPHDKQVMMFSATLNK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLKEEEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLN------------  317
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS SSD DVLN            
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSSDVDVLNNVGTYFVVLILL  414

Query  316  ------------QVQERFEVDIKELPEQIDTSTYMPS  242
                        QVQ RFEVDIK+LPEQIDTSTYMPS
Sbjct  415  SISVSNYVWCDFQVQSRFEVDIKQLPEQIDTSTYMPS  451



>ref|XP_010097240.1| DEAD-box ATP-dependent RNA helicase 56 [Morus notabilis]
 gb|EXB67307.1| DEAD-box ATP-dependent RNA helicase 56 [Morus notabilis]
Length=525

 Score =   476 bits (1225),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 230/249 (92%), Positives = 237/249 (95%), Gaps = 0/249 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+ +L L+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  210  GRVLALARDKDLGLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  269

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKL DLLDALDFNQVVIF
Sbjct  270  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLMETEKNRKLTDLLDALDFNQVVIF  329

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLL + NFPSICIHSGMSQEERL RYK FKEGH RILVATDLVGRGIDI
Sbjct  330  VKSVNRAAELNKLLADSNFPSICIHSGMSQEERLKRYKNFKEGHSRILVATDLVGRGIDI  389

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDS+VLNQVQ RFEVDIKE
Sbjct  390  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSEVLNQVQSRFEVDIKE  449

Query  280  LPEQIDTST  254
            LPEQIDTST
Sbjct  450  LPEQIDTST  458



>ref|XP_004501321.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X4 [Cicer arietinum]
Length=372

 Score =   468 bits (1203),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 230/274 (84%), Positives = 242/274 (88%), Gaps = 24/274 (9%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+ +LSL+NVRHF+LDECDKMLESLDMR+DVQ+IFK+TPHDKQVMMFSATL+K
Sbjct  92   GRVLALARDKDLSLKNVRHFVLDECDKMLESLDMRKDVQDIFKLTPHDKQVMMFSATLNK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLKEEEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDLVGRGIDI
Sbjct  212  VKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLN------------  317
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS SSD DVLN            
Sbjct  272  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSSDVDVLNNVGTYFVVLILL  331

Query  316  ------------QVQERFEVDIKELPEQIDTSTY  251
                        QVQ RFEVDIK+LPEQIDTSTY
Sbjct  332  SISVSNYVWCDFQVQSRFEVDIKQLPEQIDTSTY  365



>emb|CDX78412.1| BnaA03g03240D [Brassica napus]
Length=497

 Score =   472 bits (1215),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 237/305 (78%), Positives = 248/305 (81%), Gaps = 52/305 (17%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+L LAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  193  GRVLGLARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  252

Query  820  EIRPVCKKFMQD------------------------------------------------  785
            EIRPVCKKFMQD                                                
Sbjct  253  EIRPVCKKFMQDFCSLEPSGTRDLPFDPWKRGLNPIMTWVVSLLFRAILIIEDLNLVDED  312

Query  784  ----PMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIFVKSVTRAA  617
                PMEIYVDDEAKLTLHGLVQHYIKL+EMEKNRKLNDLLDALDFNQVVIFVKSV+RA 
Sbjct  313  LSLGPMEIYVDDEAKLTLHGLVQHYIKLSEMEKNRKLNDLLDALDFNQVVIFVKSVSRAG  372

Query  616  ELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDIERVNIVIN  437
            ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDLVGRGIDIERVNIVIN
Sbjct  373  ELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDLVGRGIDIERVNIVIN  432

Query  436  YDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKELPEQIDTS  257
            YDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ+RFEVDIKELPEQIDTS
Sbjct  433  YDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQDRFEVDIKELPEQIDTS  492

Query  256  TYMPS  242
            TYMPS
Sbjct  493  TYMPS  497



>ref|XP_010519138.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Tarenaya 
hassleriana]
Length=415

 Score =   468 bits (1203),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 224/233 (96%), Positives = 232/233 (99%), Gaps = 0/233 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRVLALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+EMEKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEMEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  302
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DSDVLNQVQER
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNQVQER  408



>gb|AGV54235.1| DEAD-box ATP-dependent RNA helicase 56 [Phaseolus vulgaris]
Length=427

 Score =   466 bits (1199),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 226/253 (89%), Positives = 235/253 (93%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL R+ +LSL+NVR FILDECDKMLESLDM+      F+M PHDKQVMMFSATLSK
Sbjct  175  GRILALTRDKDLSLKNVRTFILDECDKMLESLDMKERCSRNFQMIPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLKEEEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS S+D DVLN VQ RFEVDIK+
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSTDVDVLNNVQSRFEVDIKQ  414

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  415  LPEQIDTSTYMPS  427



>ref|XP_004501318.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Cicer arietinum]
Length=455

 Score =   466 bits (1200),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 230/274 (84%), Positives = 242/274 (88%), Gaps = 24/274 (9%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+ +LSL+NVRHF+LDECDKMLESLDMR+DVQ+IFK+TPHDKQVMMFSATL+K
Sbjct  175  GRVLALARDKDLSLKNVRHFVLDECDKMLESLDMRKDVQDIFKLTPHDKQVMMFSATLNK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E EKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLKEEEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLN------------  317
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS SSD DVLN            
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSSDVDVLNNVGTYFVVLILL  414

Query  316  ------------QVQERFEVDIKELPEQIDTSTY  251
                        QVQ RFEVDIK+LPEQIDTSTY
Sbjct  415  SISVSNYVWCDFQVQSRFEVDIKQLPEQIDTSTY  448



>gb|EMS64048.1| DEAD-box ATP-dependent RNA helicase 56 [Triticum urartu]
Length=456

 Score =   466 bits (1198),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 229/272 (84%), Positives = 244/272 (90%), Gaps = 10/272 (4%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKML+SLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  182  GRILALARDKDLSLKNVRHFILDECDKMLDSLDMRRDVQEIFKMTPHDKQVMMFSATLSK  241

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRP        PMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQ+VIF
Sbjct  242  EIRP--------PMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQIVIF  293

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RA+ELN+LL ECNFP+ICIHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  294  VKSVGRASELNRLLCECNFPAICIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDI  353

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDSDVLNQVQERFEVDIKE
Sbjct  354  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSDVLNQVQERFEVDIKE  413

Query  280  LPEQIDTSTYMPS*RSWLASSPIAPQGFLE*C  185
            LPEQIDTSTY+   R  +   P+   G    C
Sbjct  414  LPEQIDTSTYIL--RLMVVKEPVGNVGVHHVC  443



>emb|CDX85726.1| BnaA02g00870D [Brassica napus]
Length=490

 Score =   465 bits (1197),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 234/305 (77%), Positives = 245/305 (80%), Gaps = 52/305 (17%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+L LAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPH+KQVMMFSATLSK
Sbjct  186  GRVLGLARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHEKQVMMFSATLSK  245

Query  820  EIRPVCKKFMQD------------------------------------------------  785
            EIRPVCKKFMQD                                                
Sbjct  246  EIRPVCKKFMQDVMSPCHYYLAIQVMYDVFTQWDLFSSFFCPSWALIFRAIYDVSWHILE  305

Query  784  ----PMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIFVKSVTRAA  617
                PMEIYVDDEAKLTLHGLVQHYIKL EMEKNRKLNDLLDALDFNQVVIFVKSV+RA 
Sbjct  306  DANLPMEIYVDDEAKLTLHGLVQHYIKLGEMEKNRKLNDLLDALDFNQVVIFVKSVSRAR  365

Query  616  ELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDIERVNIVIN  437
            ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDLVGRGIDIERVNIVIN
Sbjct  366  ELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDLVGRGIDIERVNIVIN  425

Query  436  YDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKELPEQIDTS  257
            YDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ RFEVDIK+LPE IDTS
Sbjct  426  YDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQARFEVDIKQLPENIDTS  485

Query  256  TYMPS  242
            TYMPS
Sbjct  486  TYMPS  490



>ref|XP_010101269.1| DEAD-box ATP-dependent RNA helicase 56 [Morus notabilis]
 gb|EXB88204.1| DEAD-box ATP-dependent RNA helicase 56 [Morus notabilis]
Length=518

 Score =   466 bits (1198),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 231/260 (89%), Positives = 239/260 (92%), Gaps = 9/260 (3%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  231  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  290

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRP        PMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  291  EIRP--------PMEIYVDDEAKLTLHGLVQHYIKLSESEKNRKLNDLLDALDFNQVVIF  342

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL ECNFPSICIHSGMSQEERL RYKGFKEG  RILVATDLVGRGIDI
Sbjct  343  VKSVSRAAELNKLLAECNFPSICIHSGMSQEERLKRYKGFKEGQNRILVATDLVGRGIDI  402

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DSDVLN VQERFEVDIKE
Sbjct  403  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNDVQERFEVDIKE  462

Query  280  LPEQIDTSTYMPS*RSWLAS  221
            LPEQIDTSTY  +   W AS
Sbjct  463  LPEQIDTSTYSDA-SPWKAS  481



>ref|XP_006450446.1| hypothetical protein CICLE_v10008383mg [Citrus clementina]
 gb|ESR63686.1| hypothetical protein CICLE_v10008383mg [Citrus clementina]
 gb|KDO61717.1| hypothetical protein CISIN_1g014314mg [Citrus sinensis]
Length=423

 Score =   459 bits (1181),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 220/232 (95%), Positives = 230/232 (99%), Gaps = 0/232 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEG+KRILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGNKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQE  305
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSD+LNQV +
Sbjct  355  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDILNQVSK  406



>gb|EPS66777.1| hypothetical protein M569_07999 [Genlisea aurea]
Length=220

 Score =   450 bits (1158),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 215/220 (98%), Positives = 219/220 (99%), Gaps = 0/220 (0%)
 Frame = -1

Query  901  MRRDVQEIFKMTPHDKQVMMFSATLSKEIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHY  722
            MRRDVQEIFKMTPHDKQVMMFSATLSKEIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHY
Sbjct  1    MRRDVQEIFKMTPHDKQVMMFSATLSKEIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHY  60

Query  721  IKLTEMEKNRKLNDLLDALDFNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEER  542
            IKLTE+EKNRKLNDLLDALDFNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEER
Sbjct  61   IKLTELEKNRKLNDLLDALDFNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEER  120

Query  541  LTRYKGFKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGL  362
            LTRYKGFKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGL
Sbjct  121  LTRYKGFKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGL  180

Query  361  AITFVSSSSDSDVLNQVQERFEVDIKELPEQIDTSTYMPS  242
            AITFVSS++DSDVLNQVQERFEVDIKELPEQIDT+TYMPS
Sbjct  181  AITFVSSAADSDVLNQVQERFEVDIKELPEQIDTATYMPS  220



>ref|XP_003063800.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52173.1| predicted protein [Micromonas pusilla CCMP1545]
Length=425

 Score =   449 bits (1154),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 216/253 (85%), Positives = 226/253 (89%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+ ALA++ +LSL+   HFILDECDKMLE LDMR DVQEIFKMTPHDKQVMMFSATLSK
Sbjct  173  GRLKALAKDGSLSLKQCGHFILDECDKMLEQLDMRSDVQEIFKMTPHDKQVMMFSATLSK  232

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFM DPMEIYVDDE KLTLHGLVQHYIKL E EKNRKLNDLLDAL FNQVVIF
Sbjct  233  EIRPVCKKFMNDPMEIYVDDETKLTLHGLVQHYIKLQEGEKNRKLNDLLDALMFNQVVIF  292

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV R   L+KLL ECNFPSI IH GMSQEERL RYK FKEGHKRILVATDLV RGIDI
Sbjct  293  VKSVQRCTYLDKLLTECNFPSIAIHRGMSQEERLARYKSFKEGHKRILVATDLVARGIDI  352

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPD ADTYLHRVGRAGRFGTKGLAITF++S  DS VLNQV ERFEV+IKE
Sbjct  353  ERVNIVINYDMPDGADTYLHRVGRAGRFGTKGLAITFIASDEDSGVLNQVHERFEVEIKE  412

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMP+
Sbjct  413  LPEQIDTSTYMPA  425



>gb|ACU23716.1| unknown [Glycine max]
Length=226

 Score =   441 bits (1133),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 212/226 (94%), Positives = 218/226 (96%), Gaps = 0/226 (0%)
 Frame = -1

Query  919  MLESLDMRRDVQEIFKMTPHDKQVMMFSATLSKEIRPVCKKFMQDPMEIYVDDEAKLTLH  740
            MLESLDMR+DVQ+IFKMTPHDKQVMMFSATLSKEIRPVCKKFMQDPMEIYVDDEAKLTLH
Sbjct  1    MLESLDMRKDVQDIFKMTPHDKQVMMFSATLSKEIRPVCKKFMQDPMEIYVDDEAKLTLH  60

Query  739  GLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIFVKSVTRAAELNKLLVECNFPSICIHSG  560
            GLVQHYIKL E EKNRKLNDLLDALDFNQVVIFVKSV+RAAEL+KLLVECNFPSICIHSG
Sbjct  61   GLVQHYIKLKEEEKNRKLNDLLDALDFNQVVIFVKSVSRAAELDKLLVECNFPSICIHSG  120

Query  559  MSQEERLTRYKGFKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGR  380
            MSQEERL RYKGFKEGH RILVATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGR
Sbjct  121  MSQEERLKRYKGFKEGHTRILVATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGR  180

Query  379  FGTKGLAITFVSSSSDSDVLNQVQERFEVDIKELPEQIDTSTYMPS  242
            FGTKGLAITFVS S+D DVLN VQ RFEVDIK+LPEQIDTSTYMPS
Sbjct  181  FGTKGLAITFVSCSTDVDVLNNVQSRFEVDIKQLPEQIDTSTYMPS  226



>ref|XP_009121980.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Brassica rapa]
Length=408

 Score =   446 bits (1148),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 218/253 (86%), Positives = 229/253 (91%), Gaps = 19/253 (8%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+L LAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRVLGLARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQD                   HYIKL+EMEKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQD-------------------HYIKLSEMEKNRKLNDLLDALDFNQVVIF  275

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RA ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDLVGRGIDI
Sbjct  276  VKSVSRAGELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDLVGRGIDI  335

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ+RFEVDIKE
Sbjct  336  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQDRFEVDIKE  395

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  396  LPEQIDTSTYMPS  408



>ref|XP_009121984.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Brassica rapa]
Length=325

 Score =   442 bits (1137),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 217/253 (86%), Positives = 225/253 (89%), Gaps = 19/253 (8%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR L LAR  +LSL+N RHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  92   GRGLGLARGKDLSLKNARHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQD                   HYIKL+EMEKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPVCKKFMQD-------------------HYIKLSEMEKNRKLNDLLDALDFNQVVIF  192

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RA ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDLVGRGIDI
Sbjct  193  VKSVSRAGELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDLVGRGIDI  252

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ RFEVDIKE
Sbjct  253  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQARFEVDIKE  312

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  313  LPEQIDTSTYMPS  325



>ref|XP_009121982.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Brassica rapa]
 ref|XP_009121983.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Brassica rapa]
Length=408

 Score =   442 bits (1137),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 217/253 (86%), Positives = 225/253 (89%), Gaps = 19/253 (8%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR L LAR  +LSL+N RHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRGLGLARGKDLSLKNARHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQD                   HYIKL+EMEKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQD-------------------HYIKLSEMEKNRKLNDLLDALDFNQVVIF  275

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RA ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDLVGRGIDI
Sbjct  276  VKSVSRAGELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDLVGRGIDI  335

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ RFEVDIKE
Sbjct  336  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQARFEVDIKE  395

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMPS
Sbjct  396  LPEQIDTSTYMPS  408



>gb|EMT19211.1| DEAD-box ATP-dependent RNA helicase 56 [Aegilops tauschii]
Length=551

 Score =   441 bits (1134),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 218/250 (87%), Positives = 224/250 (90%), Gaps = 22/250 (9%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQ          
Sbjct  163  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQ----------  212

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
                        PMEIYVDDEAKLTLHGLVQHYIKLTE EKNRKLNDLLDALDFNQVVIF
Sbjct  213  ------------PMEIYVDDEAKLTLHGLVQHYIKLTESEKNRKLNDLLDALDFNQVVIF  260

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL ECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  261  VKSVSRAAELNKLLCECNFPSICIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDI  320

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKE
Sbjct  321  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKE  380

Query  280  LPEQIDTSTY  251
            LPEQIDTSTY
Sbjct  381  LPEQIDTSTY  390



>ref|NP_001149406.1| spliceosome RNA helicase BAT1 [Zea mays]
 gb|ACG35346.1| spliceosome RNA helicase BAT1 [Zea mays]
Length=399

 Score =   434 bits (1116),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 208/219 (95%), Positives = 215/219 (98%), Gaps = 0/219 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E EKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLL ECNFPSICIHSGM+QEERLTRYK FKEGHK+ILVATDLVGRGIDI
Sbjct  296  VKSVSRAAELNKLLCECNFPSICIHSGMTQEERLTRYKNFKEGHKKILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS  344
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS
Sbjct  356  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS  394



>ref|XP_002505759.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67017.1| predicted protein [Micromonas sp. RCC299]
Length=426

 Score =   435 bits (1118),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 211/253 (83%), Positives = 223/253 (88%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR  ALA++ ++SL+   HFILDECDKMLE LDMR DVQEIFKMTPHDKQVMMFSATLSK
Sbjct  174  GRCKALAKDGDISLKQCGHFILDECDKMLEQLDMRADVQEIFKMTPHDKQVMMFSATLSK  233

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPV KKFM DPMEIYVDDE KLTLHGLVQHYIKLTE EKNRKLNDLLDAL FNQVVIF
Sbjct  234  EIRPVIKKFMNDPMEIYVDDETKLTLHGLVQHYIKLTEAEKNRKLNDLLDALMFNQVVIF  293

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV R   L+KLL ECNFPSI IH GMSQEERL RYK FKEG+KRILVATDLV RGIDI
Sbjct  294  VKSVQRCTYLDKLLTECNFPSIAIHRGMSQEERLARYKSFKEGNKRILVATDLVARGIDI  353

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPD ADTYLHRVGRAGRFGTKGLAITF+SS  D+ VL+ V  RFEV+IKE
Sbjct  354  ERVNIVINYDMPDGADTYLHRVGRAGRFGTKGLAITFLSSDEDTAVLDAVHARFEVEIKE  413

Query  280  LPEQIDTSTYMPS  242
            LPEQIDTSTYMP+
Sbjct  414  LPEQIDTSTYMPA  426



>gb|EMS68248.1| DEAD-box ATP-dependent RNA helicase 56 [Triticum urartu]
Length=657

 Score =   439 bits (1129),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 223/269 (83%), Positives = 232/269 (86%), Gaps = 19/269 (7%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQ---------V  848
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQ          
Sbjct  212  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQGNTVEAIYES  271

Query  847  MMFSATLSKEIRP-VCKKFMQD---------PMEIYVDDEAKLTLHGLVQHYIKLTEMEK  698
              +   LS  +   VC   +Q          PMEIYVDDEAKLTLHGLVQHYIKLTE EK
Sbjct  272  FKWFGYLSVAVPGIVCDALLQWLMNLIGTNMPMEIYVDDEAKLTLHGLVQHYIKLTESEK  331

Query  697  NRKLNDLLDALDFNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFK  518
            NRKLNDLLDALDFNQVVIFVKSV+RAAELNKLL ECNFPSICIHSGM+QEERLTRYK FK
Sbjct  332  NRKLNDLLDALDFNQVVIFVKSVSRAAELNKLLCECNFPSICIHSGMTQEERLTRYKNFK  391

Query  517  EGHKRILVATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSS  338
            EGHKRILVATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+
Sbjct  392  EGHKRILVATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSA  451

Query  337  SDSDVLNQVQERFEVDIKELPEQIDTSTY  251
            SDSDVLNQVQERFEVDIKELPEQIDTSTY
Sbjct  452  SDSDVLNQVQERFEVDIKELPEQIDTSTY  480



>ref|NP_001154706.1| DEAD-box ATP-dependent RNA helicase 56 [Arabidopsis thaliana]
 gb|AED91646.1| DEAD-box ATP-dependent RNA helicase 56 [Arabidopsis thaliana]
Length=486

 Score =   428 bits (1100),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 223/312 (71%), Positives = 240/312 (77%), Gaps = 59/312 (19%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALARE +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRVLALAREKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPME---IYV--------DDEAKLTLHGLV-------------------  731
            EIRPVCKKFMQD +E   + V        + E +L   G +                   
Sbjct  235  EIRPVCKKFMQDFLENETVSVRLFSFGVENSEWRLCSFGFIVLVWVSMFRAILMFHSKTH  294

Query  730  ----QHYIKLTEME-------------------------KNRKLNDLLDALDFNQVVIFV  638
                + + +++ ME                         KNRKLNDLLDALDFNQVVIFV
Sbjct  295  IFEEKRWTRISPMEIYVDDEAKLTLHGLVQHYIKLSEMEKNRKLNDLLDALDFNQVVIFV  354

Query  637  KSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDIE  458
            KSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDLVGRGIDIE
Sbjct  355  KSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDLVGRGIDIE  414

Query  457  RVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKEL  278
            RVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQERFEVDIKEL
Sbjct  415  RVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQERFEVDIKEL  474

Query  277  PEQIDTSTYMPS  242
            PEQIDTSTYMPS
Sbjct  475  PEQIDTSTYMPS  486



>ref|XP_005643776.1| nuclear RNA helicase-like protein Bat1 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19232.1| nuclear RNA helicase-like protein Bat1 [Coccomyxa subellipsoidea 
C-169]
Length=435

 Score =   422 bits (1086),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 208/258 (81%), Positives = 225/258 (87%), Gaps = 8/258 (3%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+  L+R + L+L+ +RHFI+DECDK+LE++DMR DVQ+IFK TPHDKQVMMFSATLS 
Sbjct  176  GRLKQLSR-SGLNLKTIRHFIIDECDKVLENVDMRGDVQDIFKQTPHDKQVMMFSATLSA  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRP+ KKFM DPMEIYVDDEAKLTLHGLVQHYI L E EKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPIIKKFMSDPMEIYVDDEAKLTLHGLVQHYIMLNEEEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RA ELNKLLVECNFPSICIHS   QEERL  YK FKEG KRILVATDLVGRGIDI
Sbjct  295  VKSVMRAKELNKLLVECNFPSICIHSAQKQEERLKVYKAFKEGQKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDS-------ADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  302
            ERVNIVINYDMP++       ADTYLHRVGRAGRFGTKGLAITFV+S  DS VLNQVQER
Sbjct  355  ERVNIVINYDMPETDERHGNGADTYLHRVGRAGRFGTKGLAITFVASEQDSAVLNQVQER  414

Query  301  FEVDIKELPEQIDTSTYM  248
            F+VDIK LP+QIDTSTYM
Sbjct  415  FDVDIKPLPDQIDTSTYM  432



>ref|XP_001422523.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABP00840.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=358

 Score =   418 bits (1074),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 197/253 (78%), Positives = 221/253 (87%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+ ALA++  L+L+   HF+LDECDKMLE++DMR DVQEIFKMTPHDKQVMMF+ATLSK
Sbjct  106  GRLKALAQDGTLNLKKCAHFVLDECDKMLEAVDMRADVQEIFKMTPHDKQVMMFTATLSK  165

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            E+R +CKKFM DPMEI+VDDE KLTLHGLVQHY+KL E EKNRKLNDLLD+L FNQVVIF
Sbjct  166  ELRALCKKFMNDPMEIFVDDETKLTLHGLVQHYVKLEEAEKNRKLNDLLDSLMFNQVVIF  225

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            V SV R   L+KLL ECNFPSI IH  M QEERL RYK FK+G KRILVATDLV RGIDI
Sbjct  226  VSSVQRCKALDKLLQECNFPSIAIHGSMGQEERLARYKSFKDGDKRILVATDLVARGIDI  285

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMP SADTYLHRVGRAGRFGTKGLA+TFV+SS D++VL+ V ERFEV+IKE
Sbjct  286  ERVNIVINYDMPSSADTYLHRVGRAGRFGTKGLAVTFVASSEDTEVLSSVHERFEVEIKE  345

Query  280  LPEQIDTSTYMPS  242
            LP++ID STYMPS
Sbjct  346  LPDEIDQSTYMPS  358



>ref|XP_007509762.1| ATP-dependent RNA helicase DDX39 [Bathycoccus prasinos]
 emb|CCO18877.1| ATP-dependent RNA helicase DDX39 [Bathycoccus prasinos]
Length=429

 Score =   413 bits (1062),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 197/253 (78%), Positives = 217/253 (86%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+  LA+E  +SL+   HFILDECDK LE LDMR DVQEIFK+TPHDKQVMMF+ATLSK
Sbjct  177  GRLKVLAQEGTISLKKCAHFILDECDKCLEKLDMRADVQEIFKLTPHDKQVMMFTATLSK  236

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            E+RPVCKKFM DPMEI+VDDE KLTLHGLVQHY+KL E EKNRKL DLLDAL FNQVVIF
Sbjct  237  ELRPVCKKFMNDPMEIFVDDETKLTLHGLVQHYVKLEEQEKNRKLTDLLDALQFNQVVIF  296

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            V SV R   L+KL+ ECNFPSI I   MSQEERL RY+ FK+G+KRILVATDLV RGIDI
Sbjct  297  VSSVARCTALDKLMQECNFPSIAISRAMSQEERLLRYQSFKDGNKRILVATDLVARGIDI  356

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMP  ADTYLHRVGRAGRFGTKGLAI+FVSSS DSDVL++V ERFEV I  
Sbjct  357  ERVNIVINYDMPGDADTYLHRVGRAGRFGTKGLAISFVSSSEDSDVLSKVHERFEVSIDG  416

Query  280  LPEQIDTSTYMPS  242
            LP++IDTS+YMPS
Sbjct  417  LPDEIDTSSYMPS  429



>dbj|GAN02806.1| ATP-dependent RNA helicase Uap56 [Mucor ambiguus]
Length=437

 Score =   411 bits (1056),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 194/253 (77%), Positives = 220/253 (87%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LAL RE +L L NV+HF+LDECDKMLE LDMRRDVQ+IF+ TPH KQVMMFSATL+K
Sbjct  185  GRVLALVREKHLKLANVKHFVLDECDKMLEQLDMRRDVQDIFRATPHHKQVMMFSATLAK  244

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            E+RPVCKKFMQ+P+EIYVDDEAKLTLHGL Q YIK+ E EKNRKLNDLLD L+FNQV IF
Sbjct  245  EMRPVCKKFMQNPLEIYVDDEAKLTLHGLQQFYIKMEEREKNRKLNDLLDTLEFNQVCIF  304

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            V+SV+RA ELN++L +CNFPSICIHS MSQ+ER+ RYK FK+  KRI+VATD+ GRGIDI
Sbjct  305  VRSVSRANELNRILSDCNFPSICIHSQMSQDERIKRYKSFKDFEKRIMVATDIFGRGIDI  364

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGL ITFVS   D+ VLN VQ RFEV+I  
Sbjct  365  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLGITFVSDEKDTAVLNDVQSRFEVNITP  424

Query  280  LPEQIDTSTYMPS  242
            LPE +D +TYM S
Sbjct  425  LPEDVDLNTYMTS  437



>gb|EPB87931.1| ATP-dependent RNA helicase uap56 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=437

 Score =   410 bits (1054),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 193/253 (76%), Positives = 221/253 (87%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LAL R+ +L L NV+HF+LDECDKMLE LDMRRDVQ+IF+ TPH KQVMMFSATL+K
Sbjct  185  GRVLALVRDKHLKLANVKHFVLDECDKMLEQLDMRRDVQDIFRATPHHKQVMMFSATLAK  244

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            E+RPVCKKFMQ+P+EIYVDDEAKLTLHGL Q YIK+ E EKNRKLNDLLD L+FNQV IF
Sbjct  245  EMRPVCKKFMQNPLEIYVDDEAKLTLHGLQQFYIKMEEREKNRKLNDLLDTLEFNQVCIF  304

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            V+SV+RA ELN++L +CNFPSICIHS MSQ+ER+ RYK FK+  KRI+VATD+ GRGIDI
Sbjct  305  VRSVSRANELNRILSDCNFPSICIHSQMSQDERIKRYKSFKDFEKRIMVATDIFGRGIDI  364

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGL ITFVS   D+ VLN VQ RFEV+I  
Sbjct  365  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLGITFVSDEKDTAVLNDVQSRFEVNISP  424

Query  280  LPEQIDTSTYMPS  242
            LPE++D +TYM S
Sbjct  425  LPEEVDLNTYMTS  437



>emb|CEP12723.1| hypothetical protein [Parasitella parasitica]
Length=437

 Score =   409 bits (1051),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 193/253 (76%), Positives = 220/253 (87%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LAL R+  L L NV+HF+LDECDKMLE LDMRRDVQ+IF+ TPH KQVMMFSATL+K
Sbjct  185  GRVLALVRDKYLKLANVKHFVLDECDKMLEQLDMRRDVQDIFRATPHHKQVMMFSATLAK  244

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            E+RPVCKKFMQ+P+EIYVDDEAKLTLHGL Q YIK+ E EKNRKLNDLLD L+FNQV IF
Sbjct  245  EMRPVCKKFMQNPLEIYVDDEAKLTLHGLQQFYIKMEEREKNRKLNDLLDTLEFNQVCIF  304

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            V+SV+RA ELN++L +CNFPSICIHS MSQ+ER+ RYK FK+  KRI+VATD+ GRGIDI
Sbjct  305  VRSVSRANELNRILSDCNFPSICIHSQMSQDERIKRYKSFKDFEKRIMVATDIFGRGIDI  364

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGL ITFVS   D+ VLN VQ RFEV+I  
Sbjct  365  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLGITFVSDEKDTAVLNDVQSRFEVNISP  424

Query  280  LPEQIDTSTYMPS  242
            LPE++D +TYM S
Sbjct  425  LPEEVDLNTYMTS  437



>gb|EIE84435.1| ATP-dependent RNA helicase uap56 [Rhizopus delemar RA 99-880]
Length=435

 Score =   409 bits (1050),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 191/253 (75%), Positives = 222/253 (88%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LAL RE ++SL  ++HF+LDECDKMLE LDMRRDVQ+IF+ TPH KQVMMFSATL+K
Sbjct  183  GRVLALVRERHISLSTIKHFVLDECDKMLEQLDMRRDVQDIFRSTPHHKQVMMFSATLAK  242

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            E+RPVCK+FMQ+P+EIYVDDEAKLTLHGL Q YIKL E EKNRKLNDLLD+L+FNQV IF
Sbjct  243  EMRPVCKRFMQNPLEIYVDDEAKLTLHGLQQFYIKLEEKEKNRKLNDLLDSLEFNQVCIF  302

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            V+SV+RA ELN++L +CNFPSICIHS M+Q+ER+ RYK FKE  KRI+VATD+ GRGIDI
Sbjct  303  VRSVSRANELNRILSDCNFPSICIHSQMTQDERIKRYKSFKEFEKRIMVATDIFGRGIDI  362

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPD AD+YLHRVGRAGRFGTKGL ITFVS  +D++VLN VQ RFEV+I  
Sbjct  363  ERVNIVINYDMPDGADSYLHRVGRAGRFGTKGLGITFVSDENDTEVLNDVQSRFEVNISP  422

Query  280  LPEQIDTSTYMPS  242
            LPE ID +TYM S
Sbjct  423  LPEDIDINTYMTS  435



>gb|EIE91029.1| ATP-dependent RNA helicase uap56 [Rhizopus delemar RA 99-880]
Length=433

 Score =   408 bits (1048),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 191/253 (75%), Positives = 221/253 (87%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LAL R+ +L L NV+HF+LDECDKMLE LDMRRDVQ+IF+ TPH KQVMMF+ATL+K
Sbjct  181  GRVLALIRDKHLKLSNVKHFVLDECDKMLEQLDMRRDVQDIFRATPHHKQVMMFTATLAK  240

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            ++RPVCKKFMQ+P+EIYVDDEAKLTLHGL Q YIKL E EKNRKLNDLLD+L+FNQV IF
Sbjct  241  DMRPVCKKFMQNPLEIYVDDEAKLTLHGLQQFYIKLEEKEKNRKLNDLLDSLEFNQVCIF  300

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            V+SV+RA ELN++L +CNFPSICIHS M+Q+ER+ RYK FKE  KRI+VATD+ GRGIDI
Sbjct  301  VRSVSRANELNRILTDCNFPSICIHSQMTQDERIKRYKSFKEFEKRIMVATDIFGRGIDI  360

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPD AD+YLHRVGRAGRFGTKGL ITFVS  +D+ VLN VQ RFEV+I  
Sbjct  361  ERVNIVINYDMPDGADSYLHRVGRAGRFGTKGLGITFVSDENDTQVLNDVQSRFEVNISP  420

Query  280  LPEQIDTSTYMPS  242
            LPE ID +TYM S
Sbjct  421  LPEDIDINTYMTS  433



>emb|CEG73345.1| Putative ATP-dependent RNA helicase SUB2 [Rhizopus microsporus]
Length=346

 Score =   404 bits (1039),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 189/253 (75%), Positives = 218/253 (86%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LAL R+ +L L NV+HF+LDECDKMLE LDMRRDVQ+IF+ TPH KQVMMF+ATL+K
Sbjct  94   GRVLALVRDKHLKLNNVKHFVLDECDKMLEQLDMRRDVQDIFRATPHHKQVMMFTATLAK  153

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            ++RPVCKKFMQ+P+EIYVDDEAKLTLHGL Q YIKL E EKNRKLNDLLD+L+FNQV IF
Sbjct  154  DMRPVCKKFMQNPLEIYVDDEAKLTLHGLQQFYIKLEEREKNRKLNDLLDSLEFNQVCIF  213

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            V+SV RA ELN++L +CNFPSICIHS M+QEER+ RY+ FKE  KRI+VATD+ GRGIDI
Sbjct  214  VRSVARANELNRILTDCNFPSICIHSHMTQEERIKRYRSFKEFEKRIMVATDIFGRGIDI  273

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPD AD+YLHRVGRAGRFGTKGL ITFVS  +D+ VLN VQ RFEV+I  
Sbjct  274  ERVNIVINYDMPDGADSYLHRVGRAGRFGTKGLGITFVSDENDTKVLNDVQSRFEVNIAP  333

Query  280  LPEQIDTSTYMPS  242
            LPE  D + YM S
Sbjct  334  LPEDADINAYMTS  346



>gb|KJB54996.1| hypothetical protein B456_009G057600 [Gossypium raimondii]
Length=382

 Score =   405 bits (1042),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 195/202 (97%), Positives = 199/202 (99%), Gaps = 0/202 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL R+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  176  GRILALTRDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+EMEKNRKLNDLLDALDFNQVVIF
Sbjct  236  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEMEKNRKLNDLLDALDFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI
Sbjct  296  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRV  395
            ERVNIVINYDMPDSADTYLHRV
Sbjct  356  ERVNIVINYDMPDSADTYLHRV  377



>dbj|BAA13931.1| unnamed protein product [Schizosaccharomyces pombe]
Length=339

 Score =   404 bits (1038),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 186/251 (74%), Positives = 219/251 (87%), Gaps = 0/251 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+ AL RE NL + +V+HF+LDECDK+LES+DMRRD+QE+F+ TP  KQVMMFSATLS 
Sbjct  87   GRLNALVREKNLKVNSVKHFVLDECDKLLESVDMRRDIQEVFRATPPQKQVMMFSATLSN  146

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRP+CKKFMQ+P+EIYVDDE KLTLHGL QHY+KL E  KNRK+NDLLD+L+FNQVVIF
Sbjct  147  EIRPICKKFMQNPLEIYVDDETKLTLHGLQQHYVKLEEKAKNRKINDLLDSLEFNQVVIF  206

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RA EL++LL ECNFPSICIH G+ QEER+ RYK FK+  KRI VATD+ GRGIDI
Sbjct  207  VKSVSRANELDRLLRECNFPSICIHGGLPQEERIKRYKAFKDFDKRICVATDVFGRGIDI  266

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDS D+YLHRVGRAGRFGTKGLAITF SS  DS +L+++QERFEV+I E
Sbjct  267  ERVNIVINYDMPDSPDSYLHRVGRAGRFGTKGLAITFSSSEEDSQILDKIQERFEVNITE  326

Query  280  LPEQIDTSTYM  248
            LP++ID  +YM
Sbjct  327  LPDEIDVGSYM  337



>emb|CEI88988.1| Putative ATP-dependent RNA helicase [Rhizopus microsporus]
Length=435

 Score =   407 bits (1047),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 190/253 (75%), Positives = 220/253 (87%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LAL R+ +L L NV+HF+LDECDKMLE LDMRRDVQ+IF+ TPH KQVMMF+ATL+K
Sbjct  183  GRVLALVRDKHLKLNNVKHFVLDECDKMLEQLDMRRDVQDIFRATPHHKQVMMFTATLAK  242

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            ++RPVCKKFMQ+P+EIYVDDEAKLTLHGL Q YIKL E EKNRKLNDLLD+L+FNQV IF
Sbjct  243  DMRPVCKKFMQNPLEIYVDDEAKLTLHGLQQFYIKLEEREKNRKLNDLLDSLEFNQVCIF  302

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            V+SV RA ELN++L +CNFPSICIHS M+QEER+ RY+ FKE  KRI+VATD+ GRGIDI
Sbjct  303  VRSVARANELNRILTDCNFPSICIHSHMTQEERIKRYRSFKEFEKRIMVATDIFGRGIDI  362

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSAD+YLHRVGRAGRFGTKGL ITFVS  +D+ VLN VQ RFEV+I  
Sbjct  363  ERVNIVINYDMPDSADSYLHRVGRAGRFGTKGLGITFVSDENDTKVLNDVQSRFEVNIAP  422

Query  280  LPEQIDTSTYMPS  242
            LPE +D + YM S
Sbjct  423  LPEDVDINAYMTS  435



>gb|KJB70603.1| hypothetical protein B456_011G082500 [Gossypium raimondii]
Length=302

 Score =   402 bits (1034),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 193/203 (95%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL R+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  92   GRILALTRDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL+E+EKNRKLNDLLDALDFNQVVIF
Sbjct  152  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSELEKNRKLNDLLDALDFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  212  VKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKNFKEGHKRILVATDLVGRGIDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVG  392
            ERVNIVINYDMPDSADTYLHRV 
Sbjct  272  ERVNIVINYDMPDSADTYLHRVS  294



>gb|EIE79315.1| ATP-dependent RNA helicase uap56 [Rhizopus delemar RA 99-880]
Length=434

 Score =   406 bits (1043),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 191/253 (75%), Positives = 221/253 (87%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LAL R+ +L L NV+HF+LDECDKMLE LDMRRDVQ+IF+ TPH KQVMMF+ATL+K
Sbjct  182  GRVLALIRDKHLKLSNVKHFVLDECDKMLEQLDMRRDVQDIFRATPHHKQVMMFTATLAK  241

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            ++RPVCKKFMQ+P+EIYVDDEAKLTLHGL Q Y KL E EKNRKLNDLLD+L+FNQV IF
Sbjct  242  DMRPVCKKFMQNPLEIYVDDEAKLTLHGLQQFYKKLEEREKNRKLNDLLDSLEFNQVCIF  301

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            V+SV+RA ELN++L +CNFPSICIHS M+Q+ER+ RYK FKE  KRI+VATD+ GRGIDI
Sbjct  302  VRSVSRANELNRILSDCNFPSICIHSQMTQDERIKRYKSFKEFEKRIMVATDIFGRGIDI  361

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSAD+YLHRVGRAGRFGTKGL ITFVS  +D+ VLN VQ RFEV+I  
Sbjct  362  ERVNIVINYDMPDSADSYLHRVGRAGRFGTKGLGITFVSDENDTQVLNDVQSRFEVNISP  421

Query  280  LPEQIDTSTYMPS  242
            LPE ID +TYM S
Sbjct  422  LPEDIDINTYMTS  434



>emb|CEI95093.1| Putative ATP dependent RNA helicase [Rhizopus microsporus]
Length=435

 Score =   406 bits (1043),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 190/253 (75%), Positives = 219/253 (87%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LAL R+ +L L NV+HF+LDECDKMLE LDMRRDVQ+IF+ TPH KQVMMF+ATL+K
Sbjct  183  GRVLALVRDKHLKLNNVKHFVLDECDKMLEQLDMRRDVQDIFRATPHHKQVMMFTATLAK  242

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            ++RPVCKKFMQ+P+EIYVDDEAKLTLHGL Q YIKL E EKNRKLNDLLD+L+FNQV IF
Sbjct  243  DMRPVCKKFMQNPLEIYVDDEAKLTLHGLQQFYIKLEEREKNRKLNDLLDSLEFNQVCIF  302

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            V+SV RA ELN++L +CNFPSICIHS M+QEER+ RY+ FKE  KRI+VATD+ GRGIDI
Sbjct  303  VRSVARANELNRILTDCNFPSICIHSHMTQEERIKRYRSFKEFEKRIMVATDIFGRGIDI  362

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSAD+YLHRVGRAGRFGTKGL ITFVS  +D+ VLN VQ RFEV+I  
Sbjct  363  ERVNIVINYDMPDSADSYLHRVGRAGRFGTKGLGITFVSDENDTKVLNDVQSRFEVNIAP  422

Query  280  LPEQIDTSTYMPS  242
            LPE  D + YM S
Sbjct  423  LPEDADINAYMTS  435



>gb|EJK56348.1| hypothetical protein THAOC_23784 [Thalassiosira oceanica]
Length=412

 Score =   405 bits (1040),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 187/253 (74%), Positives = 218/253 (86%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRIL LARE  L L +++HF+LDECD+MLE+LDMRRDVQEIF+MTPH+KQVMMFSATL K
Sbjct  160  GRILGLAREKTLKLDHIKHFVLDECDRMLEALDMRRDVQEIFRMTPHEKQVMMFSATLGK  219

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKF QDPMEIYVDD+ KLTLHGL  +Y+KL E EKNRKLNDLLDAL+FNQVVIF
Sbjct  220  EIRPVCKKFCQDPMEIYVDDDTKLTLHGLQLYYVKLAEAEKNRKLNDLLDALEFNQVVIF  279

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            V  V RA ELN+LL ECNFPSICIH+G  QEER+ +YK FKE + RILV+TDL GRGIDI
Sbjct  280  VSKVARANELNRLLTECNFPSICIHAGQKQEERIAKYKSFKEFNARILVSTDLFGRGIDI  339

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVN+VINYD PD +D +LHRVGRAGRFGTKGLAI+F+SS  D ++L++VQ RFEV+I E
Sbjct  340  ERVNVVINYDFPDDSDQFLHRVGRAGRFGTKGLAISFISSEPDQEILDKVQSRFEVNIPE  399

Query  280  LPEQIDTSTYMPS  242
            LP++ID S YM +
Sbjct  400  LPDEIDASAYMST  412



>emb|CEG02049.1| Helicase, C-terminal [Ostreococcus tauri]
Length=486

 Score =   407 bits (1047),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 195/253 (77%), Positives = 216/253 (85%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+ ALA +  L+L+   HF+LDECDKMLE LDMR DVQEIFK TPHDKQVMMF+ATLSK
Sbjct  234  GRLKALANDGTLNLKKCAHFVLDECDKMLEELDMRSDVQEIFKATPHDKQVMMFTATLSK  293

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            E+R +CKKFM DPMEI+VDDE KLTLHGLVQHY+KL E EKNRKLNDLLD+L FNQVVIF
Sbjct  294  ELRALCKKFMNDPMEIFVDDETKLTLHGLVQHYVKLEEAEKNRKLNDLLDSLMFNQVVIF  353

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            V SV+R   L++LL ECNFPSI IH  M QEERL  YK FK+G KRILVATDLV RGIDI
Sbjct  354  VSSVSRCKALDRLLRECNFPSIGIHGDMKQEERLACYKSFKDGDKRILVATDLVARGIDI  413

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMP SADTYLHRVGRAGRFGTKGLA+TFV+SS D+DVL  V ERFEV I+E
Sbjct  414  ERVNIVINYDMPSSADTYLHRVGRAGRFGTKGLAVTFVASSEDTDVLASVHERFEVKIEE  473

Query  280  LPEQIDTSTYMPS  242
            LP++ID STYMPS
Sbjct  474  LPDEIDQSTYMPS  486



>ref|XP_002949774.1| hypothetical protein VOLCADRAFT_80795 [Volvox carteri f. nagariensis]
 gb|EFJ49326.1| hypothetical protein VOLCADRAFT_80795 [Volvox carteri f. nagariensis]
Length=435

 Score =   405 bits (1040),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 199/264 (75%), Positives = 218/264 (83%), Gaps = 13/264 (5%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRI  LA+E  L L++VR F+LDECDKMLE LDMR D QEIFKMTPH+KQVMMFSATL+ 
Sbjct  169  GRIKQLAKEGALPLKHVRFFVLDECDKMLEKLDMRADCQEIFKMTPHEKQVMMFSATLNP  228

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            E+R VCKKFM +P E+YVDDE+KLTLHGLVQHY+ L E EKNRKLNDLLDALDFNQVVIF
Sbjct  229  EMRAVCKKFMTNPQEVYVDDESKLTLHGLVQHYVMLHEEEKNRKLNDLLDALDFNQVVIF  288

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RA  LN+LL ECNFPS+CI+ GM QEER+  YK FKEG  RILVATDLVGRGIDI
Sbjct  289  VKSVARAKMLNQLLNECNFPSVCIYGGMEQEERIKVYKNFKEGKHRILVATDLVGRGIDI  348

Query  460  ERVNIVINYDMPDS-------------ADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVL  320
            ERVNIVINYDMP+S             ADTYLHRVGRAGRFGTKGLAITFVSS  DS VL
Sbjct  349  ERVNIVINYDMPESDDKAKGESKHGNGADTYLHRVGRAGRFGTKGLAITFVSSQEDSAVL  408

Query  319  NQVQERFEVDIKELPEQIDTSTYM  248
            N VQ+RF+VDIK LPE+ID STYM
Sbjct  409  NAVQDRFDVDIKPLPEKIDASTYM  432



>ref|XP_007023164.1| DEAD/DEAH box RNA helicase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY25786.1| DEAD/DEAH box RNA helicase family protein isoform 2 [Theobroma 
cacao]
Length=406

 Score =   404 bits (1037),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 194/202 (96%), Positives = 199/202 (99%), Gaps = 0/202 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR+ +LSL+NVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK
Sbjct  175  GRILALARDKDLSLKNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKL E+EKNRKLNDLLDALDFNQVVIF
Sbjct  235  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLGELEKNRKLNDLLDALDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDLVGRGIDI
Sbjct  295  VKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDLVGRGIDI  354

Query  460  ERVNIVINYDMPDSADTYLHRV  395
            ERVNIVINYDMPDSADTYLHRV
Sbjct  355  ERVNIVINYDMPDSADTYLHRV  376



>ref|XP_005107606.1| PREDICTED: spliceosome RNA helicase Ddx39b-like [Aplysia californica]
Length=311

 Score =   400 bits (1028),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 187/251 (75%), Positives = 219/251 (87%), Gaps = 0/251 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR   L+L+NV+HFILDECDKML +LDMRRDVQEIF+MTPH+KQVMMFSATLSK
Sbjct  58   GRILALARSKALALKNVKHFILDECDKMLSALDMRRDVQEIFRMTPHEKQVMMFSATLSK  117

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPME+YVDD++KLTLHGL QHY KL + EKNRKL +LLD L+FNQV+IF
Sbjct  118  EIRPVCKKFMQDPMEVYVDDDSKLTLHGLQQHYAKLKDNEKNRKLFELLDVLEFNQVIIF  177

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKS+ R   L +LL E NFP+I IH  M+QEERL+RY+ FK+  KRILVATDL GRG+DI
Sbjct  178  VKSIQRCMALAQLLQEQNFPAIAIHRAMTQEERLSRYQSFKDFQKRILVATDLFGRGMDI  237

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIV NYDMP+++DTYLHRV RAGRFGTKGLAITFVS   D+ +LN+VQERFEV+I E
Sbjct  238  ERVNIVFNYDMPENSDTYLHRVARAGRFGTKGLAITFVSDEKDAKILNEVQERFEVNITE  297

Query  280  LPEQIDTSTYM  248
            LP++ID S+Y+
Sbjct  298  LPDEIDISSYI  308



>emb|CDS12473.1| Putative ATP-dependent RNA helicase uap56 [Absidia idahoensis 
var. thermophila]
Length=442

 Score =   405 bits (1040),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 187/253 (74%), Positives = 218/253 (86%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+  L R+ ++ L NV+HF+LDECDKMLE LDMRRDVQ+IF+ TPH KQVMMFSATL+K
Sbjct  190  GRVWGLVRDKHMKLNNVKHFVLDECDKMLEQLDMRRDVQDIFRSTPHHKQVMMFSATLAK  249

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            E+RPVCKKFMQ+P+EIYVDDEAKLTLHGL Q YI+L E EKNRKLNDLLD+L+FNQV IF
Sbjct  250  EMRPVCKKFMQNPLEIYVDDEAKLTLHGLQQFYIQLEEREKNRKLNDLLDSLEFNQVCIF  309

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            V+SV RA ELN++L  CNFPSICIHS M+QEER+ RYK FK+  KRI+VATD+ GRGIDI
Sbjct  310  VRSVPRAIELNRILTSCNFPSICIHSQMTQEERIKRYKSFKDFEKRIMVATDIFGRGIDI  369

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPD ADTYLHRVGRAGRFGTKGL ITFVS+  D++VLN VQ RFE++I  
Sbjct  370  ERVNIVINYDMPDGADTYLHRVGRAGRFGTKGLGITFVSNEKDTEVLNDVQSRFEINITP  429

Query  280  LPEQIDTSTYMPS  242
            LPE +D +TYM +
Sbjct  430  LPEDVDVNTYMAA  442



>gb|EXX60912.1| Sub2p [Rhizophagus irregularis DAOM 197198w]
Length=433

 Score =   404 bits (1039),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/253 (75%), Positives = 216/253 (85%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL  +  L + +V+HF+LDECDKML+ LDMRRDVQ IF+ TPH+KQVMMFSATLSK
Sbjct  181  GRILALVNDGQLKVGSVKHFVLDECDKMLDQLDMRRDVQAIFRKTPHNKQVMMFSATLSK  240

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQ+P+EIYVDDE KLTLHGL QH+IKL E  KNRKLNDLLD L+FNQV IF
Sbjct  241  EIRPVCKKFMQNPLEIYVDDETKLTLHGLQQHFIKLPETSKNRKLNDLLDTLEFNQVCIF  300

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RA ELNKLL +CNFPSICIH  M QEER+ +YK FK+  KRI+VATD+ GRGIDI
Sbjct  301  VKSVQRANELNKLLCDCNFPSICIHGAMKQEERIAKYKSFKDFQKRIMVATDVFGRGIDI  360

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPD  DTYLHRVGRAGRFGTKGLAITFV++  D+D LN+VQERFEV+I E
Sbjct  361  ERVNIVINYDMPDGPDTYLHRVGRAGRFGTKGLAITFVANQEDADTLNKVQERFEVNITE  420

Query  280  LPEQIDTSTYMPS  242
            LP +++ + YM S
Sbjct  421  LPTELEINDYMAS  433



>emb|CEI95092.1| Putative ATP-dependent RNA helicase SUB2 [Rhizopus microsporus]
Length=494

 Score =   406 bits (1044),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 190/253 (75%), Positives = 219/253 (87%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LAL R+ +L L NV+HF+LDECDKMLE LDMRRDVQ+IF+ TPH KQVMMF+ATL+K
Sbjct  242  GRVLALVRDKHLKLNNVKHFVLDECDKMLEQLDMRRDVQDIFRATPHHKQVMMFTATLAK  301

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            ++RPVCKKFMQ+P+EIYVDDEAKLTLHGL Q YIKL E EKNRKLNDLLD+L+FNQV IF
Sbjct  302  DMRPVCKKFMQNPLEIYVDDEAKLTLHGLQQFYIKLEEREKNRKLNDLLDSLEFNQVCIF  361

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            V+SV RA ELN++L +CNFPSICIHS M+QEER+ RY+ FKE  KRI+VATD+ GRGIDI
Sbjct  362  VRSVARANELNRILTDCNFPSICIHSHMTQEERIKRYRSFKEFEKRIMVATDIFGRGIDI  421

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSAD+YLHRVGRAGRFGTKGL ITFVS  +D+ VLN VQ RFEV+I  
Sbjct  422  ERVNIVINYDMPDSADSYLHRVGRAGRFGTKGLGITFVSDENDTKVLNDVQSRFEVNIAP  481

Query  280  LPEQIDTSTYMPS  242
            LPE  D + YM S
Sbjct  482  LPEDADINAYMTS  494



>emb|CEG73344.1| Putative ATP dependent RNA helicase [Rhizopus microsporus]
Length=435

 Score =   404 bits (1038),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/253 (75%), Positives = 218/253 (86%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LAL R+ +L L NV+HF+LDECDKMLE LDMRRDVQ+IF+ TPH KQVMMF+ATL+K
Sbjct  183  GRVLALVRDKHLKLNNVKHFVLDECDKMLEQLDMRRDVQDIFRATPHHKQVMMFTATLAK  242

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            ++RPVCKKFMQ+P+EIYVDDEAKLTLHGL Q YIKL E EKNRKLNDLLD+L+FNQV IF
Sbjct  243  DMRPVCKKFMQNPLEIYVDDEAKLTLHGLQQFYIKLEEREKNRKLNDLLDSLEFNQVCIF  302

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            V+SV RA ELN++L +CNFPSICIHS M+QEER+ RY+ FKE  KRI+VATD+ GRGIDI
Sbjct  303  VRSVARANELNRILTDCNFPSICIHSHMTQEERIKRYRSFKEFEKRIMVATDIFGRGIDI  362

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPD AD+YLHRVGRAGRFGTKGL ITFVS  +D+ VLN VQ RFEV+I  
Sbjct  363  ERVNIVINYDMPDGADSYLHRVGRAGRFGTKGLGITFVSDENDTKVLNDVQSRFEVNIAP  422

Query  280  LPEQIDTSTYMPS  242
            LPE  D + YM S
Sbjct  423  LPEDADINAYMTS  435



>ref|XP_002600114.1| hypothetical protein BRAFLDRAFT_118235 [Branchiostoma floridae]
 gb|EEN56126.1| hypothetical protein BRAFLDRAFT_118235 [Branchiostoma floridae]
Length=277

 Score =   398 bits (1023),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 189/255 (74%), Positives = 220/255 (86%), Gaps = 0/255 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LALAR+ +L+L++V+HFILDECDKMLE LDMRRDVQEIF+MTPH+KQVMMFSATLSK
Sbjct  23   GRLLALARDKSLNLKHVKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK  82

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQDPME+YVDDE KLTLHGL QHY+KL + EKNRKL DLLD L+FNQVVIF
Sbjct  83   EIRPVCKKFMQDPMEVYVDDETKLTLHGLQQHYVKLKDNEKNRKLFDLLDVLEFNQVVIF  142

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV R   L +LLVE NFP+I IH  M QEERL RY  FK   +RILVAT+L GRG+DI
Sbjct  143  VKSVQRCIALAQLLVEQNFPAIAIHRAMGQEERLKRYNQFKNFERRILVATNLFGRGMDI  202

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIV NYDMP+ +DTYLHRV RAGRFGTKGLAITFVS  +D+ VLN+VQ+RFEV++ E
Sbjct  203  ERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKVLNEVQDRFEVNVSE  262

Query  280  LPEQIDTSTYMPS*R  236
            LP++ID S+Y+ + R
Sbjct  263  LPDEIDISSYIEANR  277



>ref|XP_002185552.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC42917.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=428

 Score =   404 bits (1037),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 185/253 (73%), Positives = 221/253 (87%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRIL LAR+ +L L +++HF+LDECD++LESLDMRRDVQEIF+MTPH+KQV++FSATLSK
Sbjct  176  GRILKLARDKDLKLSSLKHFVLDECDRVLESLDMRRDVQEIFRMTPHEKQVLLFSATLSK  235

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKF QDPMEIYVDDE KLTLHGL  +Y KL E EKN+KLNDLLDAL+FNQVVIF
Sbjct  236  EIRPVCKKFCQDPMEIYVDDETKLTLHGLQLYYAKLAEAEKNKKLNDLLDALEFNQVVIF  295

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            V  V RA ELN+LL ECNFPSICIH+GM QEER+++YK FK+ + RILVATDL GRGIDI
Sbjct  296  VSKVARAKELNRLLTECNFPSICIHAGMRQEERISKYKSFKDFNARILVATDLFGRGIDI  355

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVN+VINYD PD +D +LHRVGRAGRFGTKG+AI+F+SS +D  +L+Q+Q RFEV+I  
Sbjct  356  ERVNVVINYDFPDDSDQFLHRVGRAGRFGTKGIAISFISSEADQTILSQIQSRFEVNIPT  415

Query  280  LPEQIDTSTYMPS  242
            LP++ID STYM +
Sbjct  416  LPDEIDMSTYMST  428



>ref|XP_002296387.1| dead box family RNA helicase [Thalassiosira pseudonana CCMP1335]
 gb|EED87083.1| dead box family RNA helicase [Thalassiosira pseudonana CCMP1335]
Length=433

 Score =   404 bits (1037),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 185/253 (73%), Positives = 219/253 (87%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+L LARE  L L +++HF+LDECD++LESLDMRRD+QEIF+MTPH+KQVMMFSATLSK
Sbjct  181  GRVLGLAREKTLKLDHIKHFVLDECDRILESLDMRRDIQEIFRMTPHEKQVMMFSATLSK  240

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKF QDPMEIYVDD+ KLTLHGL  +Y+KL E EKNRKLNDLLDAL+FNQVVIF
Sbjct  241  EIRPVCKKFCQDPMEIYVDDDTKLTLHGLQLYYVKLAEAEKNRKLNDLLDALEFNQVVIF  300

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            V  V RA ELN+LL ECNFPSICIH+G  Q+ER+ +YK FKE + RILV+TDL GRGIDI
Sbjct  301  VSKVARANELNRLLTECNFPSICIHAGQKQDERIAKYKSFKEFNARILVSTDLFGRGIDI  360

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVN+VINYD PD +D +LHRVGRAGRFGTKGLAI+F+SS  D ++L++VQ RFEV+I E
Sbjct  361  ERVNVVINYDFPDDSDQFLHRVGRAGRFGTKGLAISFISSEPDQEILDKVQSRFEVNIPE  420

Query  280  LPEQIDTSTYMPS  242
            LP++ID S YM +
Sbjct  421  LPDEIDASAYMSA  433



>ref|XP_008102811.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X2 [Anolis 
carolinensis]
Length=346

 Score =   400 bits (1027),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 186/251 (74%), Positives = 218/251 (87%), Gaps = 0/251 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL R   L+LRNV+HF+LDECDKMLE LDMRRDVQEIF++TPH+KQ MMFSATLSK
Sbjct  92   GRILALVRNKTLNLRNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVC+KFMQDPME++VDDE KLTLHGL Q+Y+KL + EKNRKL DLLD L+FNQVVIF
Sbjct  152  EIRPVCRKFMQDPMEVFVDDETKLTLHGLQQYYVKLKDTEKNRKLFDLLDVLEFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV R   L +LLVE NFP+I IH GM+QEERL+RY+ FK+  +RILVAT+L GRG+DI
Sbjct  212  VKSVQRCMALAQLLVEQNFPAIAIHRGMTQEERLSRYQQFKDFQRRILVATNLFGRGMDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIV NYDMP+ +DTYLHRV RAGRFGTKGLA+TFVS  SD+ +LN VQ+RFEV++ E
Sbjct  272  ERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAVTFVSDESDAKILNDVQDRFEVNVAE  331

Query  280  LPEQIDTSTYM  248
            LPE+ID STY+
Sbjct  332  LPEEIDISTYI  342



>gb|EPY52787.1| ATP-dependent RNA helicase Uap56 [Schizosaccharomyces cryophilus 
OY26]
Length=434

 Score =   403 bits (1035),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 184/251 (73%), Positives = 220/251 (88%), Gaps = 0/251 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+ AL RE  + + NV+HF+LDECDK+L+S+DMRRD+QE+F+ TP  KQVMMFSATLS 
Sbjct  182  GRLNALVREKIMRVNNVKHFVLDECDKLLDSVDMRRDIQEVFRATPPQKQVMMFSATLSS  241

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            E+RP+CKKFMQ+P+EIYVDDE KLTLHGL QH++KL E EKNRK+NDLLD+L+FNQVVIF
Sbjct  242  EVRPICKKFMQNPLEIYVDDETKLTLHGLQQHFVKLQEKEKNRKINDLLDSLEFNQVVIF  301

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RA EL++LL ECNFPSICIH G+ QEER+ RYK FK+  KR+ VATD+ GRGIDI
Sbjct  302  VKSVSRANELDRLLRECNFPSICIHGGLPQEERIKRYKAFKDFDKRLCVATDVFGRGIDI  361

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDS DTYLHRVGRAGRFGTKGLAITF SS  DS +L+++QERFEV+I E
Sbjct  362  ERVNIVINYDMPDSPDTYLHRVGRAGRFGTKGLAITFASSDEDSQILDKIQERFEVNITE  421

Query  280  LPEQIDTSTYM  248
            LP++ID S+YM
Sbjct  422  LPDEIDVSSYM  432



>gb|ACO10850.1| ATP-dependent RNA helicase DDX39 [Caligus rogercresseyi]
Length=426

 Score =   402 bits (1034),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 190/251 (76%), Positives = 218/251 (87%), Gaps = 0/251 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL R   L+L+NV+HFILDECDKMLE LDMRRDVQEIF+ TPH+KQVMMFSATLSK
Sbjct  173  GRILALVRSKKLNLKNVKHFILDECDKMLEQLDMRRDVQEIFRSTPHEKQVMMFSATLSK  232

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            ++RPVCKKFMQDPME+YVDDEAKLTLHGL QHY+KL + EKNRKL +LLD L+FNQVVIF
Sbjct  233  DVRPVCKKFMQDPMEVYVDDEAKLTLHGLQQHYVKLKDTEKNRKLFELLDVLEFNQVVIF  292

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV R   L +LL+E NFP+I IH GM+QEERL+RY+ FK+  KRILVAT+L GRG+DI
Sbjct  293  VKSVQRCVALAQLLIEQNFPAIAIHRGMNQEERLSRYQQFKDFQKRILVATNLFGRGMDI  352

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIV NYDMP+  DTYLHRV RAGRFGTKGLAITFVS  SD+  LN+VQ+RFEVDI E
Sbjct  353  ERVNIVFNYDMPEDTDTYLHRVARAGRFGTKGLAITFVSDESDAKTLNEVQDRFEVDITE  412

Query  280  LPEQIDTSTYM  248
            LP++ID STY+
Sbjct  413  LPDEIDLSTYI  423



>gb|EPX72634.1| ATP-dependent RNA helicase Uap56 [Schizosaccharomyces octosporus 
yFS286]
Length=434

 Score =   403 bits (1035),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 184/251 (73%), Positives = 219/251 (87%), Gaps = 0/251 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+ AL RE  + + NV+HF+LDECDK+L+S+DMRRD+QE+F+ TP  KQVMMFSATLS 
Sbjct  182  GRLNALVREKIMRVNNVKHFVLDECDKLLDSVDMRRDIQEVFRATPPQKQVMMFSATLSS  241

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            E+RP+CKKFMQ+P+EIYVDDE KLTLHGL QHY+KL E EKNRK+NDLLD+L+FNQVVIF
Sbjct  242  EVRPICKKFMQNPLEIYVDDETKLTLHGLQQHYVKLEEKEKNRKINDLLDSLEFNQVVIF  301

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RA EL++LL ECNFPSICIH G+ QEER+ RYK FK+  KR+ VATD+ GRGIDI
Sbjct  302  VKSVSRANELDRLLRECNFPSICIHGGLPQEERINRYKAFKDFDKRLCVATDVFGRGIDI  361

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDS DTYLHRVGRAGRFGTKGLAITF  S  DS +L+++QERFEV+I E
Sbjct  362  ERVNIVINYDMPDSPDTYLHRVGRAGRFGTKGLAITFAGSDEDSQILDKIQERFEVNITE  421

Query  280  LPEQIDTSTYM  248
            LP++ID S+YM
Sbjct  422  LPDEIDVSSYM  432



>emb|CEG73343.1| Putative ATP-dependent RNA helicase SUB2 [Rhizopus microsporus]
Length=494

 Score =   405 bits (1040),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 189/253 (75%), Positives = 218/253 (86%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LAL R+ +L L NV+HF+LDECDKMLE LDMRRDVQ+IF+ TPH KQVMMF+ATL+K
Sbjct  242  GRVLALVRDKHLKLNNVKHFVLDECDKMLEQLDMRRDVQDIFRATPHHKQVMMFTATLAK  301

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            ++RPVCKKFMQ+P+EIYVDDEAKLTLHGL Q YIKL E EKNRKLNDLLD+L+FNQV IF
Sbjct  302  DMRPVCKKFMQNPLEIYVDDEAKLTLHGLQQFYIKLEEREKNRKLNDLLDSLEFNQVCIF  361

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            V+SV RA ELN++L +CNFPSICIHS M+QEER+ RY+ FKE  KRI+VATD+ GRGIDI
Sbjct  362  VRSVARANELNRILTDCNFPSICIHSHMTQEERIKRYRSFKEFEKRIMVATDIFGRGIDI  421

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPD AD+YLHRVGRAGRFGTKGL ITFVS  +D+ VLN VQ RFEV+I  
Sbjct  422  ERVNIVINYDMPDGADSYLHRVGRAGRFGTKGLGITFVSDENDTKVLNDVQSRFEVNIAP  481

Query  280  LPEQIDTSTYMPS  242
            LPE  D + YM S
Sbjct  482  LPEDADINAYMTS  494



>emb|CDS11016.1| Putative ATP-dependent RNA helicase uap56 [Absidia idahoensis 
var. thermophila]
Length=445

 Score =   402 bits (1034),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 185/253 (73%), Positives = 220/253 (87%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRI  L R+ ++ L NV+HF+LDECDKMLE LDMRRDVQ+IF+ TPH KQVMMFSATL+K
Sbjct  193  GRIWGLVRDKHMKLNNVKHFVLDECDKMLEQLDMRRDVQDIFRSTPHHKQVMMFSATLAK  252

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            E+RP+CKKFMQ+P+EIYVDDEAKLTLHGL Q YI+L E EKNRKLNDLLD+L+FNQV IF
Sbjct  253  EMRPICKKFMQNPLEIYVDDEAKLTLHGLQQFYIQLDEREKNRKLNDLLDSLEFNQVCIF  312

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            V+SV RA EL+++L  CNFPS+CIHS MSQE+R+ RYK FK+  KRI+VATD+ GRGIDI
Sbjct  313  VRSVPRARELDRILTSCNFPSVCIHSQMSQEDRIKRYKSFKDFEKRIMVATDIFGRGIDI  372

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGL ITFVS+  D++VLN VQ RFE++I+ 
Sbjct  373  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLGITFVSNEKDTEVLNDVQSRFEINIQP  432

Query  280  LPEQIDTSTYMPS  242
            LPE +D ++YM +
Sbjct  433  LPEDVDVNSYMAA  445



>emb|CDH51210.1| atp-dependent rna helicase uap56 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=446

 Score =   402 bits (1033),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 185/253 (73%), Positives = 220/253 (87%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRI  L R+ ++ L NV+HF+LDECDKMLE LDMRRDVQ+IF+ TPH KQVMMFSATL+K
Sbjct  194  GRIWGLVRDKHMKLNNVKHFVLDECDKMLEQLDMRRDVQDIFRSTPHHKQVMMFSATLAK  253

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            E+RP+CKKFMQ+P+EIYVDDEAKLTLHGL Q YI+L E EKNRKLNDLLD+L+FNQV IF
Sbjct  254  EMRPICKKFMQNPLEIYVDDEAKLTLHGLQQFYIQLDEREKNRKLNDLLDSLEFNQVCIF  313

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            V+SV RA EL+++L  CNFPS+CIHS MSQE+R+ RYK FK+  KRI+VATD+ GRGIDI
Sbjct  314  VRSVPRARELDRILTSCNFPSVCIHSQMSQEDRIKRYKSFKDFEKRIMVATDIFGRGIDI  373

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGL ITFVS+  D++VLN VQ RFE++I+ 
Sbjct  374  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLGITFVSNEKDTEVLNDVQSRFEINIQP  433

Query  280  LPEQIDTSTYMPS  242
            LPE +D ++YM +
Sbjct  434  LPEDVDVNSYMAA  446



>gb|ADD24298.1| Spliceosome RNA helicase BAT1 [Lepeophtheirus salmonis]
 gb|ADD38781.1| Spliceosome RNA helicase BAT1 [Lepeophtheirus salmonis]
Length=426

 Score =   401 bits (1030),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 190/251 (76%), Positives = 217/251 (86%), Gaps = 0/251 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL R   L+L++ +HFILDECDKMLE LDMRRDVQEIF+ TPH+KQVMMFSATLSK
Sbjct  173  GRILALVRSKKLNLKHTKHFILDECDKMLEQLDMRRDVQEIFRNTPHEKQVMMFSATLSK  232

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            E+RPVCKKFMQDPME+YVDDEAKLTLHGL QHY+KL + EKNRKL +LLD L+FNQVVIF
Sbjct  233  EVRPVCKKFMQDPMEVYVDDEAKLTLHGLQQHYVKLKDTEKNRKLFELLDVLEFNQVVIF  292

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV R   L +LL+E NFP+I IH GMSQEERL+RY+ FK+  KRILVAT+L GRG+DI
Sbjct  293  VKSVQRCVALAQLLIEQNFPAIAIHRGMSQEERLSRYQQFKDFQKRILVATNLFGRGMDI  352

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIV NYDMP+  DTYLHRV RAGRFGTKGLAITFVS  SD+  LN+VQ+RFEVDI E
Sbjct  353  ERVNIVFNYDMPEDTDTYLHRVARAGRFGTKGLAITFVSDESDAKTLNEVQDRFEVDITE  412

Query  280  LPEQIDTSTYM  248
            LP++ID STY+
Sbjct  413  LPDEIDLSTYI  423



>ref|XP_008903595.1| ATP-dependent RNA helicase uap56, variant [Phytophthora parasitica 
INRA-310]
 gb|ETI48996.1| ATP-dependent RNA helicase uap56, variant [Phytophthora parasitica 
P1569]
 gb|ETK88864.1| ATP-dependent RNA helicase uap56, variant [Phytophthora parasitica]
 gb|ETL42262.1| ATP-dependent RNA helicase uap56, variant [Phytophthora parasitica]
 gb|ETL95436.1| ATP-dependent RNA helicase uap56, variant [Phytophthora parasitica]
 gb|ETM48635.1| ATP-dependent RNA helicase uap56, variant [Phytophthora parasitica]
 gb|ETN11112.1| ATP-dependent RNA helicase uap56, variant [Phytophthora parasitica 
INRA-310]
 gb|ETO77734.1| ATP-dependent RNA helicase uap56, variant [Phytophthora parasitica 
P1976]
 gb|ETP18763.1| ATP-dependent RNA helicase uap56, variant [Phytophthora parasitica 
CJ01A1]
 gb|ETP46683.1| ATP-dependent RNA helicase uap56, variant [Phytophthora parasitica 
P10297]
Length=344

 Score =   398 bits (1022),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 187/253 (74%), Positives = 215/253 (85%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRIL L RE  L L  V+HF++DECDKMLE++DMRRD+QEIFK TPHDKQVMMFSATLSK
Sbjct  92   GRILGLLREKTLKLDKVKHFVMDECDKMLEAIDMRRDIQEIFKATPHDKQVMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVC+KF QDPMEIYVDDE KLTLHGL Q+YIKL E EKNRKLNDLLDAL+FNQVVIF
Sbjct  152  EIRPVCRKFCQDPMEIYVDDETKLTLHGLQQYYIKLEESEKNRKLNDLLDALEFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            V    R  ELN+LL ECNFPSICI + +SQEER+ RYK FK+  KRILV TDL GRG+DI
Sbjct  212  VSKKNRGRELNRLLNECNFPSICITADLSQEERIKRYKSFKDFQKRILVTTDLFGRGMDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIV+NYD P+ +D YLHRVGRAGRFGTKGL+I+F+SS  D+++L +VQ RFEV+I E
Sbjct  272  ERVNIVVNYDFPNDSDQYLHRVGRAGRFGTKGLSISFISSEEDTEMLAKVQSRFEVNIPE  331

Query  280  LPEQIDTSTYMPS  242
            LP+QID STYM +
Sbjct  332  LPDQIDISTYMST  344



>emb|CDH58367.1| atp-dependent rna helicase uap56 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=442

 Score =   402 bits (1032),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 184/253 (73%), Positives = 218/253 (86%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+  L R+ ++ L NV+HF+LDECDKMLE LDMRRDVQ+IF+ TPH KQVMMFSATL+K
Sbjct  190  GRVWGLVRDKHMKLNNVKHFVLDECDKMLEQLDMRRDVQDIFRSTPHHKQVMMFSATLAK  249

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            E+RP+CKKFMQ+P+EIYVDDEAKLTLHGL Q YI+L E EKNRKLN+LLD+L+FNQV IF
Sbjct  250  EMRPICKKFMQNPLEIYVDDEAKLTLHGLQQFYIQLEEREKNRKLNELLDSLEFNQVCIF  309

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            V+SV RA ELN++L  CNFPSICIHS M+QEER+ RYK FK+  KRI+VATD+ GRGIDI
Sbjct  310  VRSVPRAIELNRILTSCNFPSICIHSQMTQEERIKRYKSFKDFEKRIMVATDIFGRGIDI  369

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPD ADTYLHRVGRAGRFGTKGL ITFVS+  D++VLN VQ RFE++I  
Sbjct  370  ERVNIVINYDMPDGADTYLHRVGRAGRFGTKGLGITFVSNEKDTEVLNDVQSRFEINITP  429

Query  280  LPEQIDTSTYMPS  242
            LPE +D ++YM +
Sbjct  430  LPEDVDVNSYMAA  442



>ref|NP_594261.1| ATP-dependent RNA helicase Uap56 [Schizosaccharomyces pombe 972h-]
 sp|O13792.3|SUB2_SCHPO RecName: Full=ATP-dependent RNA helicase uap56 [Schizosaccharomyces 
pombe 972h-]
 emb|CAB16225.1| ATP-dependent RNA helicase Uap56 [Schizosaccharomyces pombe]
Length=434

 Score =   401 bits (1031),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 185/251 (74%), Positives = 218/251 (87%), Gaps = 0/251 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+ AL RE  L + +V+HF+LDECDK+LES+DMRRD+QE+F+ TP  KQVMMFSATLS 
Sbjct  182  GRLNALVREKILKVNSVKHFVLDECDKLLESVDMRRDIQEVFRATPPQKQVMMFSATLSN  241

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRP+CKKFMQ+P+EIYVDDE KLTLHGL QHY+KL E  KNRK+NDLLD+L+FNQVVIF
Sbjct  242  EIRPICKKFMQNPLEIYVDDETKLTLHGLQQHYVKLEEKAKNRKINDLLDSLEFNQVVIF  301

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RA EL++LL ECNFPSICIH G+ QEER+ RYK FK+  KRI VATD+ GRGIDI
Sbjct  302  VKSVSRANELDRLLRECNFPSICIHGGLPQEERIKRYKAFKDFDKRICVATDVFGRGIDI  361

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDS D+YLHRVGRAGRFGTKGLAITF SS  DS +L+++QERFEV+I E
Sbjct  362  ERVNIVINYDMPDSPDSYLHRVGRAGRFGTKGLAITFSSSEEDSQILDKIQERFEVNITE  421

Query  280  LPEQIDTSTYM  248
            LP++ID  +YM
Sbjct  422  LPDEIDVGSYM  432



>ref|XP_001703776.1| subunit of exon junction complex [Chlamydomonas reinhardtii]
 gb|EDO96302.1| subunit of exon junction complex [Chlamydomonas reinhardtii]
Length=435

 Score =   400 bits (1029),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 197/264 (75%), Positives = 218/264 (83%), Gaps = 13/264 (5%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRI  LA+E  L L++VR F+LDECDKMLE LDMR D QEIFK+TPH+KQVMMFSATL++
Sbjct  169  GRIKQLAKEGALPLKHVRFFVLDECDKMLEKLDMRADCQEIFKLTPHEKQVMMFSATLNQ  228

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            ++R VCKKFM +P E+YVDDE+KLTLHGLVQHY+ L E EKNRKLNDLLDALDFNQVVIF
Sbjct  229  DMRGVCKKFMTNPQEVYVDDESKLTLHGLVQHYVMLHEEEKNRKLNDLLDALDFNQVVIF  288

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RA  LN LL ECNFPS+CI+ GM QEER+  YK FKEG  RILVATDLVGRGIDI
Sbjct  289  VKSVARAKMLNTLLNECNFPSVCIYGGMDQEERIKVYKHFKEGKHRILVATDLVGRGIDI  348

Query  460  ERVNIVINYDMPDS-------------ADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVL  320
            ERVNIVINYDMP+S             ADTYLHRVGRAGRFGTKGLAITFVSS  DS VL
Sbjct  349  ERVNIVINYDMPESDDKSKGESKHGNGADTYLHRVGRAGRFGTKGLAITFVSSQEDSAVL  408

Query  319  NQVQERFEVDIKELPEQIDTSTYM  248
            N VQ+RF+VDIK LPE+ID STYM
Sbjct  409  NAVQDRFDVDIKPLPEKIDASTYM  432



>ref|XP_006956118.1| P-loop containing nucleoside triphosphate hydrolase protein [Wallemia 
sebi CBS 633.66]
 gb|EIM24306.1| P-loop containing nucleoside triphosphate hydrolase protein [Wallemia 
sebi CBS 633.66]
Length=427

 Score =   400 bits (1028),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 191/253 (75%), Positives = 212/253 (84%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRI AL R+ +L    ++HF+LDECDKMLE LDMRRDVQEIFK+TPH KQVMMFSATLSK
Sbjct  175  GRINALVRDGSLKGSAIKHFVLDECDKMLEQLDMRRDVQEIFKVTPHHKQVMMFSATLSK  234

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            E+RPVCKKFMQ P+EIYVDDE KLTLHGL QHY+KL+E  KNRKLNDLLD+LDFNQVVIF
Sbjct  235  EVRPVCKKFMQSPLEIYVDDETKLTLHGLQQHYVKLSESAKNRKLNDLLDSLDFNQVVIF  294

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKS  RA EL+KLL ECNFPSICIHS MSQEER+ RY  FK+   RILVATD+ GRGID+
Sbjct  295  VKSTLRANELDKLLRECNFPSICIHSRMSQEERIARYTKFKQFETRILVATDIFGRGIDV  354

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYD P  AD+YLHRVGRAGRFGTKGLAITFVS   D +VL  +Q RFEV I E
Sbjct  355  ERVNIVINYDTPTDADSYLHRVGRAGRFGTKGLAITFVSQDEDDEVLKAIQSRFEVAIPE  414

Query  280  LPEQIDTSTYMPS  242
            LPE ++ STYM S
Sbjct  415  LPETLEASTYMTS  427



>gb|AAB94615.1| BAT1 [Homo sapiens]
 dbj|BAK53243.1| HLA-B associated transcript 1 [Callithrix jacchus]
Length=284

 Score =   395 bits (1014),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 186/251 (74%), Positives = 219/251 (87%), Gaps = 0/251 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR  +L+L++++HFILDECDKMLE LDMRRDVQEIF+MTPH+KQVMMFSATLSK
Sbjct  30   GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK  89

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVC+KFMQDPMEI+VDDE KLTLHGL Q+Y+KL + EKNRKL DLLD L+FNQVVIF
Sbjct  90   EIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIF  149

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV R   L +LLVE NFP+I IH GM QEERL+RY+ FK+  +RILVAT+L GRG+DI
Sbjct  150  VKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDI  209

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNI  NYDMP+ +DTYLHRV RAGRFGTKGLAITFVS  +D+ +LN VQ+RFEV+I E
Sbjct  210  ERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISE  269

Query  280  LPEQIDTSTYM  248
            LP++ID S+Y+
Sbjct  270  LPDEIDISSYI  280



>gb|ESA07313.1| hypothetical protein GLOINDRAFT_349525 [Rhizophagus irregularis 
DAOM 181602]
Length=433

 Score =   400 bits (1028),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 187/253 (74%), Positives = 215/253 (85%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL  +  L + +V+HF+LDECDKML+ LDMRRDVQ IF+ TPH+KQVMMFSATLSK
Sbjct  181  GRILALVNDGQLKVGSVKHFVLDECDKMLDQLDMRRDVQAIFRKTPHNKQVMMFSATLSK  240

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQ+P+EIYVDDE KLTLHGL QH+IKL E  KNRKLNDLLD L+FNQV IF
Sbjct  241  EIRPVCKKFMQNPLEIYVDDETKLTLHGLQQHFIKLPETSKNRKLNDLLDTLEFNQVCIF  300

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RA ELNKLL +CNFPSICIH  M QEER+ +YK FK+  KRI+VATD+ GRGIDI
Sbjct  301  VKSVQRANELNKLLCDCNFPSICIHGAMKQEERIAKYKSFKDFQKRIMVATDVFGRGIDI  360

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPD  DTYL +VGRAGRFGTKGLAITFV++  D+D LN+VQERFEV+I E
Sbjct  361  ERVNIVINYDMPDGPDTYLQKVGRAGRFGTKGLAITFVANQEDADTLNKVQERFEVNITE  420

Query  280  LPEQIDTSTYMPS  242
            LP +++ + YM S
Sbjct  421  LPTELEINDYMAS  433



>gb|KFH69832.1| ATP-dependent RNA helicase SUB2 [Mortierella verticillata NRRL 
6337]
Length=432

 Score =   400 bits (1028),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 186/253 (74%), Positives = 217/253 (86%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LAL RE  L L NV+HF+LDECDKML+ +DMRRDVQEIFK TPH KQVMMFSATLSK
Sbjct  180  GRVLALIREKTLKLGNVKHFVLDECDKMLDQIDMRRDVQEIFKSTPHHKQVMMFSATLSK  239

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            E+R VCK+FMQ+P+EIYVDDE KLTLHGL Q+Y+ L E  KNRKLNDLLD L+FNQV IF
Sbjct  240  EVRQVCKRFMQNPLEIYVDDETKLTLHGLQQYYVDLDEKSKNRKLNDLLDTLEFNQVCIF  299

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RA ELNKLLVECNFPSICIHS M+Q+ER+ R+K FKE +KRILVATD+  RG+D+
Sbjct  300  VKSVSRANELNKLLVECNFPSICIHSQMAQDERIARFKSFKEFNKRILVATDVFARGVDV  359

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
             RVN+VINYD+P+ ADTYLHRVGRAGRFGTKGLAITFV+  SD +VL  +Q RFEV I E
Sbjct  360  SRVNVVINYDVPEVADTYLHRVGRAGRFGTKGLAITFVTDDSDKEVLKTIQARFEVQISE  419

Query  280  LPEQIDTSTYMPS  242
            LP++ID +TYM +
Sbjct  420  LPDEIDVTTYMTA  432



>ref|XP_004390787.1| PREDICTED: spliceosome RNA helicase DDX39B isoform 2 [Trichechus 
manatus latirostris]
Length=351

 Score =   397 bits (1020),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 186/251 (74%), Positives = 219/251 (87%), Gaps = 0/251 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR  +L+L++++HFILDECDKMLE LDMRRDVQEIF+MTPH+KQVMMFSATLSK
Sbjct  97   GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK  156

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVC+KFMQDPMEI+VDDE KLTLHGL Q+Y+KL + EKNRKL DLLD L+FNQVVIF
Sbjct  157  EIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIF  216

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV R   L +LLVE NFP+I IH GM QEERL+RY+ FK+  +RILVAT+L GRG+DI
Sbjct  217  VKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDI  276

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNI  NYDMP+ +DTYLHRV RAGRFGTKGLAITFVS  +D+ +LN VQ+RFEV+I E
Sbjct  277  ERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISE  336

Query  280  LPEQIDTSTYM  248
            LP++ID S+Y+
Sbjct  337  LPDEIDISSYI  347



>ref|NP_956015.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 39Aa [Danio rerio]
 gb|AAH42330.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 39a [Danio rerio]
 gb|AAI64154.1| Ddx39a protein [Danio rerio]
Length=346

 Score =   397 bits (1019),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 183/251 (73%), Positives = 220/251 (88%), Gaps = 0/251 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL+R   L+L+NV+HF+LDECDKMLE LDMRRDVQ+IF++TPH+KQ MMFSATLSK
Sbjct  92   GRILALSRNKTLTLKNVKHFVLDECDKMLEQLDMRRDVQDIFRLTPHEKQCMMFSATLSK  151

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVC+KFMQDPME++VDDE KLTLHGL Q+Y+KL + EKNRKL DLLD L+FNQVVIF
Sbjct  152  EIRPVCRKFMQDPMEVFVDDETKLTLHGLQQYYVKLKDSEKNRKLFDLLDVLEFNQVVIF  211

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV R   L++LLVE NFP+I IH GM+QEERL+RY+ FK+  +RILVAT+L GRG+DI
Sbjct  212  VKSVPRCVALSQLLVEQNFPAIAIHRGMTQEERLSRYQQFKDFQRRILVATNLFGRGMDI  271

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIV NYDMP+ +DTYLHRV RAGRFGTKGLA+TFVS  +D+ +LN VQ+RFEV++ E
Sbjct  272  ERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAVTFVSDETDAKILNDVQDRFEVNVAE  331

Query  280  LPEQIDTSTYM  248
            LPE+ID STY+
Sbjct  332  LPEEIDISTYI  342



>ref|XP_004043684.1| PREDICTED: spliceosome RNA helicase DDX39B isoform 3 [Gorilla 
gorilla gorilla]
 ref|XP_007971330.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Chlorocebus 
sabaeus]
 gb|EAX03406.1| hCG2005638, isoform CRA_c [Homo sapiens]
 dbj|BAG60464.1| unnamed protein product [Homo sapiens]
Length=350

 Score =   396 bits (1018),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 186/251 (74%), Positives = 219/251 (87%), Gaps = 0/251 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR  +L+L++++HFILDECDKMLE LDMRRDVQEIF+MTPH+KQVMMFSATLSK
Sbjct  96   GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK  155

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVC+KFMQDPMEI+VDDE KLTLHGL Q+Y+KL + EKNRKL DLLD L+FNQVVIF
Sbjct  156  EIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIF  215

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV R   L +LLVE NFP+I IH GM QEERL+RY+ FK+  +RILVAT+L GRG+DI
Sbjct  216  VKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDI  275

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNI  NYDMP+ +DTYLHRV RAGRFGTKGLAITFVS  +D+ +LN VQ+RFEV+I E
Sbjct  276  ERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISE  335

Query  280  LPEQIDTSTYM  248
            LP++ID S+Y+
Sbjct  336  LPDEIDISSYI  346



>ref|XP_007949570.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Orycteropus 
afer afer]
Length=351

 Score =   397 bits (1019),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 186/251 (74%), Positives = 219/251 (87%), Gaps = 0/251 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR  +L+L++++HFILDECDKMLE LDMRRDVQEIF+MTPH+KQVMMFSATLSK
Sbjct  97   GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK  156

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVC+KFMQDPMEI+VDDE KLTLHGL Q+Y+KL + EKNRKL DLLD L+FNQVVIF
Sbjct  157  EIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIF  216

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV R   L +LLVE NFP+I IH GM QEERL+RY+ FK+  +RILVAT+L GRG+DI
Sbjct  217  VKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDI  276

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNI  NYDMP+ +DTYLHRV RAGRFGTKGLAITFVS  +D+ +LN VQ+RFEV+I E
Sbjct  277  ERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISE  336

Query  280  LPEQIDTSTYM  248
            LP++ID S+Y+
Sbjct  337  LPDEIDISSYI  347



>ref|XP_006104711.1| PREDICTED: spliceosome RNA helicase Ddx39b [Myotis lucifugus]
Length=310

 Score =   395 bits (1014),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 186/251 (74%), Positives = 219/251 (87%), Gaps = 0/251 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR  +L+L++++HFILDECDKMLE LDMRRDVQEIF+MTPH+KQVMMFSATLSK
Sbjct  56   GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK  115

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVC+KFMQDPMEI+VDDE KLTLHGL Q+Y+KL + EKNRKL DLLD L+FNQVVIF
Sbjct  116  EIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIF  175

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV R   L +LLVE NFP+I IH GM QEERL+RY+ FK+  +RILVAT+L GRG+DI
Sbjct  176  VKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDI  235

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNI  NYDMP+ +DTYLHRV RAGRFGTKGLAITFVS  +D+ +LN VQ+RFEV+I E
Sbjct  236  ERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISE  295

Query  280  LPEQIDTSTYM  248
            LP++ID S+Y+
Sbjct  296  LPDEIDISSYI  306



>ref|XP_002175680.1| ATP-dependent RNA helicase Uap56 [Schizosaccharomyces japonicus 
yFS275]
 gb|EEB09387.1| ATP-dependent RNA helicase Uap56 [Schizosaccharomyces japonicus 
yFS275]
Length=434

 Score =   399 bits (1026),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 184/251 (73%), Positives = 219/251 (87%), Gaps = 0/251 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+ AL RE  L + NV+HF+LDECDK+LE++DMRRD+QE+F+ TP  KQVMMFSATLS 
Sbjct  182  GRLNALVREKILRVNNVKHFVLDECDKLLEAVDMRRDIQEVFRATPPQKQVMMFSATLSN  241

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRP+CKKFMQ+P+EIYVDDE KLTLHGL QHY+KL E  KNRKLNDLLD+L+FNQVVIF
Sbjct  242  EIRPICKKFMQNPLEIYVDDETKLTLHGLQQHYVKLDEKAKNRKLNDLLDSLEFNQVVIF  301

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV+RA  L++LL EC+FPSICIH G+ Q+ER+ RYK FK+  KRI VATD+ GRGIDI
Sbjct  302  VKSVSRANALDRLLRECSFPSICIHGGLPQDERIKRYKAFKDFDKRICVATDVFGRGIDI  361

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDMPDS D+YLHRVGRAGRFGTKGLAITFV++  DS VL+++QERFEV+I E
Sbjct  362  ERVNIVINYDMPDSPDSYLHRVGRAGRFGTKGLAITFVTTDEDSQVLDKIQERFEVNITE  421

Query  280  LPEQIDTSTYM  248
            LP++ID S+YM
Sbjct  422  LPDEIDVSSYM  432



>ref|XP_004286666.1| PREDICTED: spliceosome RNA helicase DDX39B isoform 3 [Orcinus 
orca]
Length=350

 Score =   396 bits (1018),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 186/251 (74%), Positives = 219/251 (87%), Gaps = 0/251 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR  +L+L++++HFILDECDKMLE LDMRRDVQEIF+MTPH+KQVMMFSATLSK
Sbjct  96   GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK  155

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVC+KFMQDPMEI+VDDE KLTLHGL Q+Y+KL + EKNRKL DLLD L+FNQVVIF
Sbjct  156  EIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIF  215

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV R   L +LLVE NFP+I IH GM QEERL+RY+ FK+  +RILVAT+L GRG+DI
Sbjct  216  VKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDI  275

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNI  NYDMP+ +DTYLHRV RAGRFGTKGLAITFVS  +D+ +LN VQ+RFEV+I E
Sbjct  276  ERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISE  335

Query  280  LPEQIDTSTYM  248
            LP++ID S+Y+
Sbjct  336  LPDEIDISSYI  346



>ref|XP_004424437.1| PREDICTED: spliceosome RNA helicase DDX39B isoform 3 [Ceratotherium 
simum simum]
Length=351

 Score =   396 bits (1018),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 186/251 (74%), Positives = 219/251 (87%), Gaps = 0/251 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR  +L+L++++HFILDECDKMLE LDMRRDVQEIF+MTPH+KQVMMFSATLSK
Sbjct  97   GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK  156

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVC+KFMQDPMEI+VDDE KLTLHGL Q+Y+KL + EKNRKL DLLD L+FNQVVIF
Sbjct  157  EIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIF  216

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV R   L +LLVE NFP+I IH GM QEERL+RY+ FK+  +RILVAT+L GRG+DI
Sbjct  217  VKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDI  276

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNI  NYDMP+ +DTYLHRV RAGRFGTKGLAITFVS  +D+ +LN VQ+RFEV+I E
Sbjct  277  ERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISE  336

Query  280  LPEQIDTSTYM  248
            LP++ID S+Y+
Sbjct  337  LPDEIDISSYI  347



>emb|CCI50269.1| unnamed protein product [Albugo candida]
Length=334

 Score =   395 bits (1016),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 186/253 (74%), Positives = 215/253 (85%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRIL L +E ++ L  V+HF++DECDK+LE+LDMRRDVQEIF+ TPHDKQVMMFSATLSK
Sbjct  82   GRILGLLKEKSIKLDKVKHFVMDECDKLLEALDMRRDVQEIFRSTPHDKQVMMFSATLSK  141

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVC+KF QDPMEIYVDDE KLTLHGL Q+YIKL E EKNRKLN+LLDAL+FNQVVIF
Sbjct  142  EIRPVCRKFCQDPMEIYVDDETKLTLHGLQQYYIKLAESEKNRKLNELLDALEFNQVVIF  201

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            V    RA ELN+LL ECNFPSICI S ++QEER+ RYK FK+  KR+LV TDL GRG+DI
Sbjct  202  VSKKNRARELNRLLNECNFPSICITSDLTQEERIKRYKSFKDFQKRLLVTTDLFGRGMDI  261

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYD P+ +D YLHRVGRAGRFGTKGL+I+F+SS  DS +L QVQ RFEV+I E
Sbjct  262  ERVNIVINYDFPNDSDQYLHRVGRAGRFGTKGLSISFISSDEDSGMLAQVQSRFEVNIPE  321

Query  280  LPEQIDTSTYMPS  242
            LP+ ID STYM +
Sbjct  322  LPDSIDISTYMST  334



>gb|EAX03405.1| hCG2005638, isoform CRA_b [Homo sapiens]
Length=320

 Score =   395 bits (1015),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 186/251 (74%), Positives = 219/251 (87%), Gaps = 0/251 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR  +L+L++++HFILDECDKMLE LDMRRDVQEIF+MTPH+KQVMMFSATLSK
Sbjct  66   GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK  125

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVC+KFMQDPMEI+VDDE KLTLHGL Q+Y+KL + EKNRKL DLLD L+FNQVVIF
Sbjct  126  EIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIF  185

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV R   L +LLVE NFP+I IH GM QEERL+RY+ FK+  +RILVAT+L GRG+DI
Sbjct  186  VKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDI  245

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNI  NYDMP+ +DTYLHRV RAGRFGTKGLAITFVS  +D+ +LN VQ+RFEV+I E
Sbjct  246  ERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISE  305

Query  280  LPEQIDTSTYM  248
            LP++ID S+Y+
Sbjct  306  LPDEIDISSYI  316



>ref|XP_003217350.1| PREDICTED: ATP-dependent RNA helicase DDX39A isoform X1 [Anolis 
carolinensis]
Length=427

 Score =   399 bits (1024),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 186/251 (74%), Positives = 218/251 (87%), Gaps = 0/251 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILAL R   L+LRNV+HF+LDECDKMLE LDMRRDVQEIF++TPH+KQ MMFSATLSK
Sbjct  173  GRILALVRNKTLNLRNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSATLSK  232

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVC+KFMQDPME++VDDE KLTLHGL Q+Y+KL + EKNRKL DLLD L+FNQVVIF
Sbjct  233  EIRPVCRKFMQDPMEVFVDDETKLTLHGLQQYYVKLKDTEKNRKLFDLLDVLEFNQVVIF  292

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV R   L +LLVE NFP+I IH GM+QEERL+RY+ FK+  +RILVAT+L GRG+DI
Sbjct  293  VKSVQRCMALAQLLVEQNFPAIAIHRGMTQEERLSRYQQFKDFQRRILVATNLFGRGMDI  352

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIV NYDMP+ +DTYLHRV RAGRFGTKGLA+TFVS  SD+ +LN VQ+RFEV++ E
Sbjct  353  ERVNIVFNYDMPEDSDTYLHRVARAGRFGTKGLAVTFVSDESDAKILNDVQDRFEVNVAE  412

Query  280  LPEQIDTSTYM  248
            LPE+ID STY+
Sbjct  413  LPEEIDISTYI  423



>ref|XP_004621321.1| PREDICTED: spliceosome RNA helicase DDX39B isoform X2 [Sorex 
araneus]
Length=351

 Score =   396 bits (1017),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 186/251 (74%), Positives = 219/251 (87%), Gaps = 0/251 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GRILALAR  +L+L++++HFILDECDKMLE LDMRRDVQEIF+MTPH+KQVMMFSATLSK
Sbjct  97   GRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSK  156

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVC+KFMQDPMEI+VDDE KLTLHGL Q+Y+KL + EKNRKL DLLD L+FNQVVIF
Sbjct  157  EIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIF  216

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV R   L +LLVE NFP+I IH GM QEERL+RY+ FK+  +RILVAT+L GRG+DI
Sbjct  217  VKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDI  276

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNI  NYDMP+ +DTYLHRV RAGRFGTKGLAITFVS  +D+ +LN VQ+RFEV+I E
Sbjct  277  ERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISE  336

Query  280  LPEQIDTSTYM  248
            LP++ID S+Y+
Sbjct  337  LPDEIDISSYI  347



>ref|XP_006675142.1| hypothetical protein BATDEDRAFT_15696 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF83557.1| hypothetical protein BATDEDRAFT_15696 [Batrachochytrium dendrobatidis 
JAM81]
Length=443

 Score =   399 bits (1026),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 186/253 (74%), Positives = 220/253 (87%), Gaps = 0/253 (0%)
 Frame = -1

Query  1000 GRILALARENNLSLRNVRHFILDECDKMLESLDMRRDVQEIFKMTPHDKQVMMFSATLSK  821
            GR+LAL R+  ++L  V+HF+LDECDK+L++LDMR+DVQ+IF+ TPH KQVMM+SATLSK
Sbjct  191  GRLLALIRDKAINLATVKHFVLDECDKILDALDMRKDVQDIFRSTPHHKQVMMYSATLSK  250

Query  820  EIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLTEMEKNRKLNDLLDALDFNQVVIF  641
            EIRPVCKKFMQ+P+EI+VDD+ KLTLHGL Q+Y+KL+E  K RKLNDLLD+L+FNQV IF
Sbjct  251  EIRPVCKKFMQNPLEIFVDDQTKLTLHGLQQYYLKLSENAKTRKLNDLLDSLEFNQVCIF  310

Query  640  VKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDI  461
            VKSV RA EL++LLV+C FPSICIHS + QEER+ RYK FK+  KRI+VATD+ GRGID+
Sbjct  311  VKSVQRAVELDRLLVKCGFPSICIHSQLQQEERIARYKSFKDFEKRIMVATDIFGRGIDV  370

Query  460  ERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKE  281
            ERVNIVINYDM DS D YLHRVGRAGRFGTKGLAITFVSS  D++VLNQVQ RFEV+I E
Sbjct  371  ERVNIVINYDMSDSPDAYLHRVGRAGRFGTKGLAITFVSSDEDTEVLNQVQGRFEVNITE  430

Query  280  LPEQIDTSTYMPS  242
            LPE ID STYM S
Sbjct  431  LPETIDVSTYMAS  443



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2488971634053