BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig14025

Length=794
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002264570.1|  PREDICTED: large subunit GTPase 1 homolog          221   8e-64   Vitis vinifera
ref|XP_006340326.1|  PREDICTED: large subunit GTPase 1 homolog          219   5e-63   Solanum tuberosum [potatoes]
ref|XP_009623222.1|  PREDICTED: large subunit GTPase 1 homolog          217   2e-62   Nicotiana tomentosiformis
ref|XP_011090291.1|  PREDICTED: large subunit GTPase 1 homolog          216   7e-62   Sesamum indicum [beniseed]
ref|XP_012066353.1|  PREDICTED: large subunit GTPase 1 homolog          216   8e-62   Jatropha curcas
ref|XP_011013118.1|  PREDICTED: large subunit GTPase 1 homolog          216   1e-61   Populus euphratica
ref|XP_002313500.2|  hypothetical protein POPTR_0009s02210g             214   4e-61   
ref|XP_006378981.1|  hypothetical protein POPTR_0009s02210g             214   6e-61   
gb|KGN65017.1|  hypothetical protein Csa_1G181300                       202   1e-60   
ref|XP_009335155.1|  PREDICTED: large subunit GTPase 1 homolog          212   2e-60   Pyrus x bretschneideri [bai li]
ref|XP_010247646.1|  PREDICTED: large subunit GTPase 1 homolog          212   2e-60   Nelumbo nucifera [Indian lotus]
ref|XP_010313487.1|  PREDICTED: large subunit GTPase 1 homolog          211   3e-60   Solanum lycopersicum
ref|XP_009770039.1|  PREDICTED: large subunit GTPase 1 homolog          211   4e-60   Nicotiana sylvestris
ref|XP_004291536.1|  PREDICTED: large subunit GTPase 1 homolog          210   1e-59   Fragaria vesca subsp. vesca
gb|KJB35431.1|  hypothetical protein B456_006G116700                    206   1e-59   Gossypium raimondii
ref|XP_007015655.1|  P-loop containing nucleoside triphosphate hy...    209   2e-59   
gb|KJB35432.1|  hypothetical protein B456_006G116700                    206   6e-59   Gossypium raimondii
ref|XP_010031571.1|  PREDICTED: large subunit GTPase 1 homolog          207   9e-59   Eucalyptus grandis [rose gum]
gb|KJB35430.1|  hypothetical protein B456_006G116700                    207   1e-58   Gossypium raimondii
ref|XP_006424080.1|  hypothetical protein CICLE_v10028074mg             204   1e-58   
ref|XP_006424081.1|  hypothetical protein CICLE_v10028074mg             205   1e-57   Citrus clementina [clementine]
ref|XP_008464315.1|  PREDICTED: large subunit GTPase 1 homolog          204   2e-57   Cucumis melo [Oriental melon]
ref|XP_006487859.1|  PREDICTED: large subunit GTPase 1 homolog          204   2e-57   Citrus sinensis [apfelsine]
ref|XP_011654864.1|  PREDICTED: LOW QUALITY PROTEIN: large subuni...    204   2e-57   Cucumis sativus [cucumbers]
gb|KDO46575.1|  hypothetical protein CISIN_1g010472mg                   202   2e-57   Citrus sinensis [apfelsine]
ref|XP_002513727.1|  GTP binding protein, putative                      201   3e-56   Ricinus communis
ref|XP_004146392.1|  PREDICTED: large subunit GTPase 1 homolog          199   1e-55   Cucumis sativus [cucumbers]
ref|XP_009342719.1|  PREDICTED: large subunit GTPase 1 homolog          199   1e-55   Pyrus x bretschneideri [bai li]
ref|XP_006417692.1|  hypothetical protein EUTSA_v10007194mg             197   5e-55   Eutrema salsugineum [saltwater cress]
ref|XP_009110897.1|  PREDICTED: large subunit GTPase 1 homolog          196   2e-54   Brassica rapa
emb|CDY31149.1|  BnaA08g26990D                                          196   2e-54   Brassica napus [oilseed rape]
ref|XP_008442123.1|  PREDICTED: large subunit GTPase 1 homolog          194   9e-54   Cucumis melo [Oriental melon]
ref|XP_003543409.1|  PREDICTED: large subunit GTPase 1 homolog          194   1e-53   Glycine max [soybeans]
emb|CDX97480.1|  BnaC08g13450D                                          194   1e-53   
gb|KHN36506.1|  Large subunit GTPase 1 like                             194   1e-53   Glycine soja [wild soybean]
ref|XP_004506231.1|  PREDICTED: large subunit GTPase 1 homolog is...    193   2e-53   Cicer arietinum [garbanzo]
ref|XP_010685450.1|  PREDICTED: large subunit GTPase 1 homolog          193   2e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006303811.1|  hypothetical protein CARUB_v10012258mg             192   6e-53   Capsella rubella
ref|XP_004506230.1|  PREDICTED: large subunit GTPase 1 homolog is...    192   7e-53   
ref|NP_172317.1|  P-loop containing nucleoside triphosphate hydro...    191   1e-52   Arabidopsis thaliana [mouse-ear cress]
gb|EYU26033.1|  hypothetical protein MIMGU_mgv1a003132mg                191   1e-52   Erythranthe guttata [common monkey flower]
ref|XP_010101993.1|  Large subunit GTPase 1-like protein                191   1e-52   Morus notabilis
ref|XP_002889691.1|  GTP-binding family protein                         190   4e-52   Arabidopsis lyrata subsp. lyrata
ref|XP_007132503.1|  hypothetical protein PHAVU_011G099700g             188   1e-51   Phaseolus vulgaris [French bean]
ref|XP_010458077.1|  PREDICTED: large subunit GTPase 1 homolog          187   2e-51   Camelina sativa [gold-of-pleasure]
gb|KHN21198.1|  Large subunit GTPase 1                                  187   2e-51   Glycine soja [wild soybean]
ref|XP_003539853.1|  PREDICTED: large subunit GTPase 1 homolog          187   3e-51   Glycine max [soybeans]
emb|CDP15565.1|  unnamed protein product                                187   4e-51   Coffea canephora [robusta coffee]
ref|XP_007222281.1|  hypothetical protein PRUPE_ppa003303mg             186   6e-51   Prunus persica
ref|XP_008787774.1|  PREDICTED: LOW QUALITY PROTEIN: large subuni...    186   7e-51   Phoenix dactylifera
gb|KFK43162.1|  hypothetical protein AALP_AA1G087900                    186   9e-51   Arabis alpina [alpine rockcress]
ref|XP_010557448.1|  PREDICTED: large subunit GTPase 1 homolog          186   1e-50   Tarenaya hassleriana [spider flower]
ref|XP_010941628.1|  PREDICTED: large subunit GTPase 1 homolog          185   2e-50   Elaeis guineensis
ref|XP_003605987.1|  Large subunit GTPase-like protein                  184   3e-50   Medicago truncatula
ref|XP_010488823.1|  PREDICTED: large subunit GTPase 1 homolog          183   9e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010475638.1|  PREDICTED: large subunit GTPase 1 homolog          182   3e-49   Camelina sativa [gold-of-pleasure]
ref|XP_008219226.1|  PREDICTED: large subunit GTPase 1 homolog          181   4e-49   Prunus mume [ume]
gb|EMS49812.1|  hypothetical protein TRIUR3_12331                       174   9e-49   Triticum urartu
ref|XP_003538087.1|  PREDICTED: large subunit GTPase 1 homolog          180   2e-48   Glycine max [soybeans]
gb|KHN30244.1|  Large subunit GTPase 1 like                             179   2e-48   Glycine soja [wild soybean]
gb|AAD41267.1|  unknown                                                 175   8e-48   Zea mays [maize]
tpg|DAA47546.1|  TPA: hypothetical protein ZEAMMB73_195112              176   4e-47   
ref|XP_009407721.1|  PREDICTED: large subunit GTPase 1 homolog is...    175   8e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407722.1|  PREDICTED: large subunit GTPase 1 homolog is...    175   8e-47   
gb|ACG45515.1|  GTP binding protein                                     174   2e-46   Zea mays [maize]
ref|NP_001067291.1|  Os12g0618300                                       174   3e-46   
emb|CBI24436.3|  unnamed protein product                                170   2e-45   Vitis vinifera
ref|XP_006664755.1|  PREDICTED: large subunit GTPase 1 homolog          171   2e-45   Oryza brachyantha
gb|EPS59426.1|  hypothetical protein M569_15382                         166   4e-45   Genlisea aurea
ref|XP_004963198.1|  PREDICTED: large subunit GTPase 1 homolog          170   5e-45   Setaria italica
ref|XP_002443580.1|  hypothetical protein SORBIDRAFT_08g021890          167   4e-44   Sorghum bicolor [broomcorn]
gb|KHN17987.1|  Large subunit GTPase 1 like                             167   5e-44   Glycine soja [wild soybean]
gb|ABF97888.1|  expressed protein                                       166   6e-44   Oryza sativa Japonica Group [Japonica rice]
gb|EEC75833.1|  hypothetical protein OsI_12814                          166   2e-43   Oryza sativa Indica Group [Indian rice]
gb|AAU89192.1|  expressed protein                                       165   3e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003561853.1|  PREDICTED: large subunit GTPase 1 homolog          164   6e-43   Brachypodium distachyon [annual false brome]
ref|XP_003577256.1|  PREDICTED: large subunit GTPase 1 homolog          163   1e-42   Brachypodium distachyon [annual false brome]
ref|XP_006836535.1|  PREDICTED: large subunit GTPase 1 homolog          162   2e-42   Amborella trichopoda
gb|EMT02127.1|  Large subunit GTPase 1                                  162   3e-42   
gb|EMS54804.1|  hypothetical protein TRIUR3_20330                       161   1e-41   Triticum urartu
ref|XP_006651639.1|  PREDICTED: uncharacterized protein LOC102702646    161   9e-41   
gb|EMT21204.1|  Large subunit GTPase 1                                  158   1e-40   
ref|XP_010473112.1|  PREDICTED: large subunit GTPase 1 homolog          153   3e-39   Camelina sativa [gold-of-pleasure]
dbj|BAK03963.1|  predicted protein                                      154   4e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010417872.1|  PREDICTED: large subunit GTPase 1 homolog          152   6e-39   Camelina sativa [gold-of-pleasure]
ref|XP_006293969.1|  hypothetical protein CARUB_v10022959mg             152   7e-39   Capsella rubella
ref|XP_002879073.1|  GTP-binding family protein                         150   3e-38   
ref|NP_180288.1|  P-loop containing nucleoside triphosphate hydro...    149   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006408622.1|  hypothetical protein EUTSA_v10001955mg             146   1e-36   Eutrema salsugineum [saltwater cress]
gb|ACV52759.1|  GTP-binding protein                                     142   2e-36   Oryza sativa Indica Group [Indian rice]
gb|ACV52761.1|  GTP-binding protein                                     142   3e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_009140774.1|  PREDICTED: large subunit GTPase 1 homolog          145   3e-36   Brassica rapa
emb|CDY57792.1|  BnaCnng32480D                                          142   2e-35   Brassica napus [oilseed rape]
gb|ACV52787.1|  GTP-binding protein                                     139   2e-35   Oryza barthii [African wild rice]
ref|XP_010510799.1|  PREDICTED: large subunit GTPase 1 homolog          142   5e-35   Camelina sativa [gold-of-pleasure]
gb|KFK33535.1|  hypothetical protein AALP_AA5G026000                    139   2e-34   Arabis alpina [alpine rockcress]
gb|EYU36017.1|  hypothetical protein MIMGU_mgv1a006252mg                139   3e-34   Erythranthe guttata [common monkey flower]
emb|CDY57484.1|  BnaAnng14640D                                          135   9e-33   Brassica napus [oilseed rape]
ref|XP_001761310.1|  predicted protein                                  120   1e-27   
ref|XP_002976299.1|  hypothetical protein SELMODRAFT_228404             102   4e-21   
ref|XP_002985785.1|  hypothetical protein SELMODRAFT_229145             102   4e-21   
gb|AAD43046.1|AF124045_5  GTP-binding protein-like                    88.2    6e-18   Sorghum bicolor [broomcorn]
ref|XP_005844201.1|  hypothetical protein CHLNCDRAFT_7626             87.4    2e-16   Chlorella variabilis
ref|XP_003082920.1|  Predicted GTP-binding protein MMR1 (ISS)         87.4    6e-16   Ostreococcus tauri
emb|CDY06312.1|  BnaA09g48910D                                        82.4    1e-15   
ref|XP_628750.1|  unclassified GTPase                                 85.9    2e-15   Dictyostelium discoideum AX4
ref|XP_001699204.1|  hypothetical protein CHLREDRAFT_206017           85.5    2e-15   Chlamydomonas reinhardtii
ref|XP_004644051.1|  PREDICTED: large subunit GTPase 1 homolog        85.9    2e-15   Octodon degus
gb|EFA74535.1|  hypothetical protein PPL_00033                        84.3    6e-15   Heterostelium album PN500
ref|XP_003285885.1|  hypothetical protein DICPUDRAFT_76802            83.2    2e-14   Dictyostelium purpureum
ref|XP_005383243.1|  PREDICTED: large subunit GTPase 1 homolog        83.2    2e-14   
ref|XP_001422684.1|  predicted protein                                81.6    2e-14   Ostreococcus lucimarinus CCE9901
dbj|GAM27199.1|  hypothetical protein SAMD00019534_103740             82.4    3e-14   Acytostelium subglobosum LB1
ref|XP_002952357.1|  hypothetical protein VOLCADRAFT_105489           81.6    5e-14   Volvox carteri f. nagariensis
gb|EPZ34241.1|  P-loop containing nucleoside triphosphate hydrola...  81.3    5e-14   Rozella allomycis CSF55
gb|KHN76558.1|  Large subunit GTPase 1 -like protein                  81.3    6e-14   Toxocara canis
ref|XP_003063860.1|  predicted protein                                79.7    2e-13   Micromonas pusilla CCMP1545
gb|EHA97853.1|  Large subunit GTPase 1-like protein                   79.7    2e-13   Heterocephalus glaber [naked mole rat]
ref|XP_004876704.1|  PREDICTED: large subunit GTPase 1 homolog        79.7    2e-13   
ref|XP_002505817.1|  predicted protein                                78.6    3e-13   Micromonas commoda
ref|XP_001991793.1|  GH11875                                          79.0    3e-13   Drosophila grimshawi
ref|XP_001657366.1|  AAEL006031-PA                                    78.6    5e-13   
ref|XP_002937880.1|  PREDICTED: large subunit GTPase 1 homolog is...  78.2    7e-13   Xenopus tropicalis [western clawed frog]
gb|AAI61204.1|  LOC100145528 protein                                  78.2    7e-13   Xenopus tropicalis [western clawed frog]
gb|KFO33133.1|  Large subunit GTPase 1 like protein                   78.2    8e-13   Fukomys damarensis [Damara mole rat]
ref|XP_010622364.1|  PREDICTED: large subunit GTPase 1 homolog        77.8    8e-13   Fukomys damarensis [Damara mole rat]
ref|XP_011212101.1|  PREDICTED: LOW QUALITY PROTEIN: large subuni...  77.8    8e-13   
ref|XP_002463910.1|  hypothetical protein SORBIDRAFT_01g008777        73.6    8e-13   
ref|XP_004914428.1|  PREDICTED: large subunit GTPase 1 homolog is...  77.8    8e-13   
ref|XP_007509670.1|  predicted protein                                78.2    8e-13   Bathycoccus prasinos
emb|CAL49373.1|  novel protein similar to human hypothetical prot...  77.8    8e-13   Xenopus tropicalis [western clawed frog]
ref|XP_003741377.1|  PREDICTED: large subunit GTPase 1 homolog        77.4    1e-12   
gb|KFB47526.1|  AGAP011471-PA-like protein                            77.4    1e-12   Anopheles sinensis
ref|XP_004834811.1|  PREDICTED: large subunit GTPase 1 homolog        77.4    1e-12   Heterocephalus glaber [naked mole rat]
ref|XP_001982510.1|  GG12698                                          77.0    1e-12   Drosophila erecta
ref|XP_002040355.1|  GM18974                                          77.0    1e-12   Drosophila sechellia
ref|XP_004712396.1|  PREDICTED: large subunit GTPase 1 homolog        77.4    1e-12   
ref|XP_005111021.1|  PREDICTED: large subunit GTPase 1 homolog        77.4    1e-12   
ref|NP_569915.1|  nucleostemin ortholog 3, isoform A                  77.0    1e-12   Drosophila melanogaster
ref|XP_007118987.1|  PREDICTED: large subunit GTPase 1 homolog        76.6    2e-12   
ref|XP_004530500.1|  PREDICTED: large subunit GTPase 1 homolog is...  76.6    2e-12   Ceratitis capitata [medfly]
ref|XP_004530501.1|  PREDICTED: large subunit GTPase 1 homolog is...  76.6    2e-12   
ref|XP_317835.4|  AGAP011471-PA                                       76.3    2e-12   Anopheles gambiae str. PEST
gb|ETN66656.1|  nucleostemin 3                                        76.3    3e-12   Anopheles darlingi [American malaria mosquito]
ref|XP_011188955.1|  PREDICTED: large subunit GTPase 1 homolog        76.3    3e-12   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_007195218.1|  PREDICTED: large subunit GTPase 1 homolog        76.3    3e-12   Balaenoptera acutorostrata scammoni
ref|XP_002071668.1|  GK10107                                          75.9    3e-12   Drosophila willistoni
gb|EFX89969.1|  hypothetical protein DAPPUDRAFT_309652                75.9    3e-12   Daphnia pulex
ref|XP_002424428.1|  conserved hypothetical protein                   75.9    4e-12   Pediculus humanus corporis [human body lice]
ref|XP_004745349.1|  PREDICTED: large subunit GTPase 1 homolog is...  75.5    5e-12   
ref|XP_004745350.1|  PREDICTED: large subunit GTPase 1 homolog is...  75.5    5e-12   
ref|XP_007946217.1|  PREDICTED: large subunit GTPase 1 homolog        75.5    5e-12   Orycteropus afer afer
ref|XP_002009974.1|  GI15663                                          75.5    5e-12   Drosophila mojavensis
ref|XP_004343924.1|  large subunit GTPase                             75.5    5e-12   Capsaspora owczarzaki ATCC 30864
ref|XP_008470860.1|  PREDICTED: large subunit GTPase 1 homolog        75.5    5e-12   Diaphorina citri
gb|KJE96960.1|  large subunit GTPase                                  75.5    5e-12   Capsaspora owczarzaki ATCC 30864
ref|XP_004344108.1|  GTPase of unknown function subfamily protein     75.5    5e-12   Acanthamoeba castellanii str. Neff
ref|XP_005344864.1|  PREDICTED: large subunit GTPase 1 homolog        75.1    6e-12   Microtus ochrogaster [prairie voles]
gb|ELK17622.1|  Large subunit GTPase 1 like protein                   73.6    6e-12   Pteropus alecto
ref|XP_007465908.1|  PREDICTED: large subunit GTPase 1 homolog        75.1    6e-12   Lipotes vexillifer [baiji]
ref|XP_004278816.1|  PREDICTED: large subunit GTPase 1 homolog        75.1    6e-12   Orcinus orca [Orca]
gb|ENN76213.1|  hypothetical protein YQE_07180                        75.1    7e-12   Dendroctonus ponderosae
ref|XP_007517510.1|  PREDICTED: large subunit GTPase 1 homolog        74.7    8e-12   Erinaceus europaeus [common hedgehog]
ref|XP_006071717.1|  PREDICTED: large subunit GTPase 1 homolog        74.7    8e-12   
ref|XP_003412975.1|  PREDICTED: large subunit GTPase 1 homolog        74.7    8e-12   
ref|XP_004212815.1|  PREDICTED: large subunit GTPase 1 homolog        71.6    9e-12   
ref|XP_006762056.1|  PREDICTED: large subunit GTPase 1 homolog        74.7    9e-12   Myotis davidii
gb|ELK31557.1|  Large subunit GTPase 1 like protein                   74.7    9e-12   Myotis davidii
gb|EFB14738.1|  hypothetical protein PANDA_010389                     74.7    9e-12   Ailuropoda melanoleuca
gb|EHH16870.1|  hypothetical protein EGK_12237                        74.7    9e-12   Macaca mulatta [rhesus macaque]
sp|Q4R8L2.1|LSG1_MACFA  RecName: Full=Large subunit GTPase 1 homolog  74.7    9e-12   Macaca fascicularis [crab eating macaque]
ref|XP_011379598.1|  PREDICTED: large subunit GTPase 1 homolog        74.7    1e-11   Pteropus vampyrus
ref|NP_001039375.1|  large subunit GTPase 1 homolog                   74.7    1e-11   Bos taurus [bovine]
gb|EHH51785.1|  hypothetical protein EGM_11228                        74.7    1e-11   Macaca fascicularis [crab eating macaque]
ref|XP_010832692.1|  PREDICTED: large subunit GTPase 1 homolog        74.7    1e-11   Bison bison bison
ref|XP_002921505.1|  PREDICTED: large subunit GTPase 1 homolog        74.7    1e-11   
tpg|DAA33350.1|  TPA: large subunit GTPase 1 homolog                  74.7    1e-11   Bos taurus [bovine]
ref|XP_004424613.1|  PREDICTED: large subunit GTPase 1 homolog        74.7    1e-11   
ref|XP_006084813.1|  PREDICTED: large subunit GTPase 1 homolog        74.3    1e-11   Myotis lucifugus
ref|XP_005545399.1|  PREDICTED: large subunit GTPase 1 homolog is...  74.7    1e-11   Macaca fascicularis [crab eating macaque]
gb|ERL85308.1|  hypothetical protein D910_02729                       74.7    1e-11   Dendroctonus ponderosae
ref|XP_011844348.1|  PREDICTED: large subunit GTPase 1 homolog is...  74.7    1e-11   Mandrillus leucophaeus
ref|XP_005873255.1|  PREDICTED: large subunit GTPase 1 homolog        74.3    1e-11   Myotis brandtii
ref|XP_003895355.1|  PREDICTED: large subunit GTPase 1 homolog        74.7    1e-11   
ref|XP_001097108.2|  PREDICTED: large subunit GTPase 1 homolog        74.7    1e-11   
ref|XP_011721374.1|  PREDICTED: large subunit GTPase 1 homolog is...  74.3    1e-11   Macaca nemestrina [pigtail macaque]
ref|XP_008007767.1|  PREDICTED: large subunit GTPase 1 homolog        74.3    1e-11   Chlorocebus sabaeus
ref|XP_004373629.1|  PREDICTED: large subunit GTPase 1 homolog        74.3    1e-11   
ref|XP_011844349.1|  PREDICTED: large subunit GTPase 1 homolog is...  74.3    1e-11   Mandrillus leucophaeus
ref|XP_005545400.1|  PREDICTED: large subunit GTPase 1 homolog is...  74.3    1e-11   
gb|AAH80306.1|  Lsg1 protein                                          74.3    1e-11   Mus musculus [mouse]
ref|XP_011892151.1|  PREDICTED: large subunit GTPase 1 homolog is...  74.3    1e-11   Cercocebus atys
ref|XP_006906226.1|  PREDICTED: large subunit GTPase 1 homolog        74.3    1e-11   Pteropus alecto
ref|XP_010371289.1|  PREDICTED: large subunit GTPase 1 homolog        74.3    1e-11   
ref|XP_008703364.1|  PREDICTED: large subunit GTPase 1 homolog        74.3    1e-11   Ursus maritimus [white bear]
gb|ELR50811.1|  Large subunit GTPase 1-like protein                   74.3    1e-11   Bos mutus
ref|XP_006792133.1|  PREDICTED: large subunit GTPase 1 homolog        74.3    1e-11   Neolamprologus brichardi [lyretail cichlid]
ref|XP_008264912.1|  PREDICTED: large subunit GTPase 1 homolog is...  74.3    1e-11   Oryctolagus cuniculus [domestic rabbit]
ref|XP_002716566.1|  PREDICTED: large subunit GTPase 1 homolog is...  74.3    1e-11   Oryctolagus cuniculus [domestic rabbit]
gb|ELW50924.1|  Large subunit GTPase 1 like protein                   74.3    1e-11   Tupaia chinensis
ref|NP_835170.1|  large subunit GTPase 1 homolog                      74.3    1e-11   Mus musculus [mouse]
ref|XP_005730420.1|  PREDICTED: large subunit GTPase 1 homolog        74.3    1e-11   Pundamilia nyererei
ref|XP_004562009.1|  PREDICTED: large subunit GTPase 1 homolog is...  74.3    1e-11   
gb|EDK97741.1|  large subunit GTPase 1 homolog (S. cerevisiae), i...  74.3    1e-11   Mus musculus [mouse]
ref|XP_001499014.1|  PREDICTED: large subunit GTPase 1 homolog        74.3    1e-11   
gb|ERL85309.1|  hypothetical protein D910_02729                       74.3    1e-11   Dendroctonus ponderosae
ref|XP_008532943.1|  PREDICTED: large subunit GTPase 1 homolog        74.3    1e-11   Equus przewalskii [Przewalski horse]
ref|XP_005921035.1|  PREDICTED: large subunit GTPase 1 homolog        74.3    1e-11   Haplochromis burtoni
ref|XP_005903460.1|  PREDICTED: large subunit GTPase 1 homolog        74.3    1e-11   Bos mutus
ref|XP_006873191.1|  PREDICTED: large subunit GTPase 1 homolog        73.9    1e-11   Chrysochloris asiatica
dbj|BAE26280.1|  unnamed protein product                              73.9    1e-11   Mus musculus [mouse]
ref|XP_005639715.1|  PREDICTED: large subunit GTPase 1 homolog        74.3    1e-11   
ref|XP_008557025.1|  PREDICTED: large subunit GTPase 1 homolog        73.9    1e-11   Microplitis demolitor
ref|XP_006156812.1|  PREDICTED: large subunit GTPase 1 homolog        73.9    1e-11   Tupaia chinensis
ref|XP_008149837.1|  PREDICTED: large subunit GTPase 1 homolog        73.9    1e-11   Eptesicus fuscus
ref|XP_008837262.1|  PREDICTED: large subunit GTPase 1 homolog        73.9    1e-11   Nannospalax galili
ref|XP_002178813.1|  predicted protein                                73.9    2e-11   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002124678.1|  PREDICTED: large subunit GTPase 1 homolog        73.9    2e-11   Ciona intestinalis [sea vase]
ref|XP_006030062.1|  PREDICTED: large subunit GTPase 1 homolog        73.9    2e-11   
ref|XP_001849771.1|  conserved hypothetical protein                   73.9    2e-11   Culex quinquefasciatus
ref|XP_003280466.1|  PREDICTED: large subunit GTPase 1 homolog        73.9    2e-11   
ref|XP_012141059.1|  PREDICTED: large subunit GTPase 1 homolog is...  73.6    2e-11   Megachile rotundata
ref|XP_005966601.1|  PREDICTED: large subunit GTPase 1 homolog        73.6    2e-11   
ref|XP_002055113.1|  GJ19196                                          73.6    2e-11   Drosophila virilis
ref|XP_011816598.1|  PREDICTED: large subunit GTPase 1 homolog is...  73.6    2e-11   Colobus angolensis palliatus
ref|XP_011816599.1|  PREDICTED: large subunit GTPase 1 homolog is...  73.6    2e-11   Colobus angolensis palliatus
ref|XP_005989431.1|  PREDICTED: large subunit GTPase 1 homolog        73.6    2e-11   Latimeria chalumnae
ref|XP_001928271.1|  PREDICTED: large subunit GTPase 1 homolog        73.6    2e-11   
ref|XP_001633047.1|  predicted protein                                73.6    2e-11   Nematostella vectensis
ref|XP_001963924.1|  GF21278                                          73.6    2e-11   
ref|XP_010336050.1|  PREDICTED: large subunit GTPase 1 homolog        73.6    2e-11   Saimiri boliviensis boliviensis
ref|XP_011952108.1|  PREDICTED: large subunit GTPase 1 homolog        73.6    2e-11   Ovis aries [domestic sheep]
ref|XP_006974544.1|  PREDICTED: large subunit GTPase 1 homolog        73.6    2e-11   Peromyscus maniculatus bairdii
ref|XP_001355439.1|  GA13246                                          73.6    2e-11   Drosophila pseudoobscura pseudoobscura
ref|XP_005675154.1|  PREDICTED: large subunit GTPase 1 homolog is...  73.6    2e-11   
ref|XP_002021940.1|  GL14378                                          73.6    2e-11   Drosophila persimilis
ref|XP_005675153.1|  PREDICTED: large subunit GTPase 1 homolog is...  73.6    2e-11   
ref|XP_003691565.1|  PREDICTED: LOW QUALITY PROTEIN: large subuni...  73.6    2e-11   
ref|XP_012141057.1|  PREDICTED: large subunit GTPase 1 homolog is...  73.6    2e-11   Megachile rotundata
ref|XP_006278214.1|  PREDICTED: large subunit GTPase 1 homolog        73.6    2e-11   Alligator mississippiensis
emb|CDS20006.1|  GTP binding protein HSR1                             73.6    2e-11   Echinococcus granulosus
gb|ELW72897.1|  Large subunit GTPase 1 like protein                   71.2    2e-11   Tupaia chinensis
ref|XP_005338482.1|  PREDICTED: large subunit GTPase 1 homolog        73.2    2e-11   
ref|XP_006201007.1|  PREDICTED: large subunit GTPase 1 homolog        73.2    3e-11   Vicugna pacos
ref|XP_006179022.1|  PREDICTED: large subunit GTPase 1 homolog        73.2    3e-11   Camelus ferus
ref|XP_007091041.1|  PREDICTED: large subunit GTPase 1 homolog        73.2    3e-11   Panthera tigris altaica
ref|XP_011284181.1|  PREDICTED: large subunit GTPase 1 homolog        73.2    3e-11   
emb|CDI98348.1|  GTP binding protein, HSR1                            73.2    3e-11   Echinococcus multilocularis
ref|XP_968889.1|  PREDICTED: large subunit GTPase 1 homolog           73.2    3e-11   Tribolium castaneum [rust-red flour beetle]
ref|XP_008922841.1|  PREDICTED: large subunit GTPase 1 homolog        72.8    3e-11   
gb|KFW81506.1|  Large subunit GTPase 1                                72.8    3e-11   Manacus vitellinus
ref|NP_001153316.1|  large subunit GTPase 1 homolog                   72.8    3e-11   Acyrthosiphon pisum
ref|XP_005014428.1|  PREDICTED: large subunit GTPase 1 homolog        72.8    4e-11   
gb|EOB05190.1|  Large subunit GTPase 1-like protein                   72.8    4e-11   Anas platyrhynchos [duck]
emb|CAG08104.1|  unnamed protein product                              69.7    4e-11   Tetraodon nigroviridis
ref|XP_004675473.1|  PREDICTED: large subunit GTPase 1 homolog        72.8    4e-11   Condylura cristata
gb|KFV75443.1|  Large subunit GTPase 1                                72.8    4e-11   Picoides pubescens
ref|NP_001013439.1|  large subunit GTPase 1 homolog                   72.8    4e-11   Rattus norvegicus [brown rat]
ref|XP_516958.2|  PREDICTED: large subunit GTPase 1 homolog           72.8    4e-11   Pan troglodytes
ref|XP_009907054.1|  PREDICTED: large subunit GTPase 1 homolog        72.4    4e-11   Picoides pubescens
ref|XP_004479693.1|  PREDICTED: large subunit GTPase 1 homolog is...  72.4    4e-11   Dasypus novemcinctus
gb|ERE75561.1|  putative large subunit GTPase 1 like protein          72.4    4e-11   Cricetulus griseus [Chinese hamsters]
ref|XP_011261999.1|  PREDICTED: large subunit GTPase 1 homolog is...  72.4    4e-11   Camponotus floridanus
ref|XP_011261998.1|  PREDICTED: large subunit GTPase 1 homolog is...  72.4    5e-11   Camponotus floridanus
ref|XP_004479692.1|  PREDICTED: large subunit GTPase 1 homolog is...  72.4    5e-11   Dasypus novemcinctus
ref|XP_003792737.1|  PREDICTED: large subunit GTPase 1 homolog        72.4    5e-11   Otolemur garnettii
ref|XP_006902152.1|  PREDICTED: large subunit GTPase 1 homolog        72.4    5e-11   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_003495431.1|  PREDICTED: large subunit GTPase 1 homolog is...  72.4    5e-11   Cricetulus griseus [Chinese hamsters]
gb|ERE75562.1|  putative large subunit GTPase 1 like protein          72.4    5e-11   Cricetulus griseus [Chinese hamsters]
ref|XP_005071747.1|  PREDICTED: large subunit GTPase 1 homolog        72.4    6e-11   
ref|XP_004603299.1|  PREDICTED: large subunit GTPase 1 homolog        72.0    6e-11   Sorex araneus [Eurasian shrew]
ref|XP_004577860.1|  PREDICTED: large subunit GTPase 1 homolog        72.0    6e-11   Ochotona princeps [southern American pika]
ref|XP_010714670.1|  PREDICTED: LOW QUALITY PROTEIN: large subuni...  72.0    6e-11   
ref|XP_005237851.1|  PREDICTED: large subunit GTPase 1 homolog        72.0    7e-11   Falco peregrinus [peregrine]
ref|XP_003489969.1|  PREDICTED: large subunit GTPase 1 homolog        72.0    7e-11   
ref|XP_005443764.1|  PREDICTED: large subunit GTPase 1 homolog        72.0    7e-11   Falco cherrug
ref|XP_011301892.1|  PREDICTED: large subunit GTPase 1 homolog        72.0    7e-11   Fopius arisanus
gb|AAH40119.1|  LSG1 protein                                          72.0    7e-11   Homo sapiens [man]
gb|EAW78039.1|  large subunit GTPase 1 homolog (S. cerevisiae), i...  72.0    7e-11   Homo sapiens [man]
emb|CAL37455.1|  hypothetical protein                                 72.0    7e-11   
dbj|BAA92116.1|  unnamed protein product                              72.0    7e-11   
emb|CAB66831.1|  hypothetical protein                                 72.0    7e-11   
gb|AAH15042.1|  LSG1 protein                                          72.0    7e-11   
ref|NP_060855.2|  large subunit GTPase 1 homolog                      72.0    7e-11   
ref|XP_007252654.1|  PREDICTED: large subunit GTPase 1 homolog        71.6    7e-11   
ref|XP_004038289.1|  PREDICTED: large subunit GTPase 1 homolog        72.0    8e-11   
gb|KFP70105.1|  Large subunit GTPase 1                                71.6    8e-11   
ref|XP_008119441.1|  PREDICTED: large subunit GTPase 1 homolog        72.0    8e-11   
gb|KGL73564.1|  Large subunit GTPase 1                                71.6    8e-11   
ref|XP_009571285.1|  PREDICTED: large subunit GTPase 1 homolog        71.6    8e-11   
ref|XP_009071034.1|  PREDICTED: large subunit GTPase 1 homolog        71.6    8e-11   
ref|XP_008588921.1|  PREDICTED: large subunit GTPase 1 homolog        72.0    8e-11   
ref|XP_003807691.1|  PREDICTED: large subunit GTPase 1 homolog        71.6    8e-11   
ref|XP_010190903.1|  PREDICTED: large subunit GTPase 1 homolog        71.6    8e-11   
gb|KFQ40785.1|  Large subunit GTPase 1                                71.6    8e-11   
ref|XP_010225056.1|  PREDICTED: large subunit GTPase 1 homolog        71.6    8e-11   
ref|XP_009157624.1|  hypothetical protein HMPREF1120_05211            71.6    8e-11   
ref|XP_007505768.1|  PREDICTED: large subunit GTPase 1 homolog        71.6    8e-11   
ref|XP_004391922.1|  PREDICTED: large subunit GTPase 1 homolog        71.6    8e-11   
gb|KFO79657.1|  Large subunit GTPase 1                                71.6    9e-11   
gb|KFW00549.1|  Large subunit GTPase 1                                71.6    9e-11   
ref|XP_009563923.1|  PREDICTED: large subunit GTPase 1 homolog        71.6    9e-11   
ref|XP_010280733.1|  PREDICTED: large subunit GTPase 1 homolog        71.2    1e-10   
gb|KFQ71432.1|  Large subunit GTPase 1                                71.2    1e-10   
ref|XP_003455402.1|  PREDICTED: large subunit GTPase 1 homolog is...  71.6    1e-10   
ref|XP_005051410.1|  PREDICTED: large subunit GTPase 1 homolog        71.2    1e-10   
ref|XP_009484734.1|  PREDICTED: large subunit GTPase 1 homolog        71.2    1e-10   
gb|KFV49614.1|  Large subunit GTPase 1                                71.2    1e-10   
ref|XP_009318686.1|  PREDICTED: large subunit GTPase 1 homolog        71.2    1e-10   
gb|KFW64596.1|  Large subunit GTPase 1                                71.2    1e-10   
gb|KFO06460.1|  Large subunit GTPase 1                                71.2    1e-10   
ref|XP_010017991.1|  PREDICTED: large subunit GTPase 1 homolog        70.9    1e-10   
gb|KFZ67356.1|  Large subunit GTPase 1                                71.2    1e-10   
ref|XP_003766437.1|  PREDICTED: large subunit GTPase 1 homolog        71.2    1e-10   
ref|XP_010309339.1|  PREDICTED: large subunit GTPase 1 homolog        71.2    1e-10   
ref|XP_010135898.1|  PREDICTED: large subunit GTPase 1 homolog        70.9    1e-10   
ref|XP_009805235.1|  PREDICTED: large subunit GTPase 1 homolog        71.2    1e-10   
ref|XP_005511752.1|  PREDICTED: large subunit GTPase 1 homolog        71.2    1e-10   
gb|KFP00482.1|  Large subunit GTPase 1                                71.2    1e-10   
ref|XP_008491619.1|  PREDICTED: large subunit GTPase 1 homolog        71.2    1e-10   
ref|XP_009959491.1|  PREDICTED: large subunit GTPase 1 homolog        70.9    1e-10   
ref|XP_006559713.1|  PREDICTED: large subunit GTPase 1 homolog        71.2    1e-10   
gb|KFO90631.1|  Large subunit GTPase 1                                70.9    1e-10   
ref|XP_006612950.1|  PREDICTED: large subunit GTPase 1 homolog        71.2    1e-10   
ref|XP_009060483.1|  hypothetical protein LOTGIDRAFT_165229           71.2    1e-10   
gb|KFR03399.1|  Large subunit GTPase 1                                71.2    1e-10   
ref|XP_009943136.1|  PREDICTED: large subunit GTPase 1 homolog        71.2    1e-10   
gb|KGL91986.1|  Large subunit GTPase 1                                71.2    1e-10   
gb|EMC80823.1|  Large subunit GTPase 1 like protein                   71.2    1e-10   
gb|KFR00617.1|  Large subunit GTPase 1                                70.9    1e-10   
gb|KFQ54296.1|  Large subunit GTPase 1                                70.9    1e-10   
ref|XP_001750809.1|  hypothetical protein                             71.2    1e-10   
ref|XP_008642403.1|  PREDICTED: large subunit GTPase 1 homolog        70.9    1e-10   
gb|KFV12294.1|  Large subunit GTPase 1                                70.9    1e-10   
gb|KFV12997.1|  Large subunit GTPase 1                                70.9    1e-10   
ref|XP_009881732.1|  PREDICTED: large subunit GTPase 1 homolog        70.9    1e-10   
ref|XP_009466799.1|  PREDICTED: large subunit GTPase 1 homolog        70.9    1e-10   
ref|XP_010116306.1|  PREDICTED: large subunit GTPase 1 homolog        70.9    1e-10   
gb|KFQ63005.1|  Large subunit GTPase 1                                70.9    1e-10   
gb|KFP93835.1|  Large subunit GTPase 1                                70.9    1e-10   
ref|XP_009979651.1|  PREDICTED: large subunit GTPase 1 homolog        70.9    1e-10   
gb|KFP62420.1|  Large subunit GTPase 1                                70.9    1e-10   
ref|XP_009693207.1|  PREDICTED: large subunit GTPase 1 homolog        70.9    1e-10   
ref|XP_008288367.1|  PREDICTED: large subunit GTPase 1 homolog        70.9    1e-10   
gb|KFO54535.1|  Large subunit GTPase 1                                70.9    1e-10   
gb|KFZ48736.1|  Large subunit GTPase 1                                70.9    2e-10   
ref|XP_004176833.1|  PREDICTED: LOW QUALITY PROTEIN: large subuni...  70.9    2e-10   
ref|XP_009914331.1|  PREDICTED: LOW QUALITY PROTEIN: large subuni...  70.9    2e-10   
gb|KFQ76675.1|  Large subunit GTPase 1                                70.9    2e-10   
ref|XP_009492915.1|  hypothetical protein H696_00756                  70.9    2e-10   
ref|XP_002758255.1|  PREDICTED: large subunit GTPase 1 homolog        70.9    2e-10   
ref|XP_010078105.1|  PREDICTED: LOW QUALITY PROTEIN: large subuni...  70.9    2e-10   
ref|XP_010404495.1|  PREDICTED: large subunit GTPase 1 homolog        70.9    2e-10   
ref|XP_010173490.1|  PREDICTED: large subunit GTPase 1 homolog        70.9    2e-10   
gb|KFQ04791.1|  Large subunit GTPase 1                                70.9    2e-10   
ref|XP_010566743.1|  PREDICTED: large subunit GTPase 1 homolog        70.9    2e-10   
ref|XP_005190014.1|  PREDICTED: large subunit GTPase 1 homolog        70.9    2e-10   
gb|KFW81161.1|  Large subunit GTPase 1                                70.9    2e-10   
gb|KFP53777.1|  Large subunit GTPase 1                                70.9    2e-10   
ref|XP_003397150.1|  PREDICTED: large subunit GTPase 1 homolog        70.9    2e-10   
ref|XP_008947812.1|  PREDICTED: large subunit GTPase 1 homolog        70.9    2e-10   
gb|KFU92690.1|  Large subunit GTPase 1                                70.9    2e-10   
ref|XP_002399945.1|  conserved hypothetical protein                   70.9    2e-10   
ref|XP_009512162.1|  PREDICTED: large subunit GTPase 1 homolog        70.5    2e-10   
ref|NP_997807.1|  large subunit GTPase 1 homolog                      70.5    2e-10   
gb|KFQ24096.1|  Large subunit GTPase 1                                70.5    2e-10   
ref|XP_010000041.1|  PREDICTED: large subunit GTPase 1 homolog        70.5    2e-10   
ref|NP_001006549.1|  large subunit GTPase 1 homolog                   70.5    2e-10   
ref|XP_006637787.1|  PREDICTED: large subunit GTPase 1 homolog        70.5    2e-10   
ref|XP_005419144.1|  PREDICTED: large subunit GTPase 1 homolog        70.5    2e-10   
ref|XP_011576020.1|  PREDICTED: large subunit GTPase 1 homolog        70.5    2e-10   
ref|XP_009863607.1|  PREDICTED: large subunit GTPase 1 homolog        70.5    2e-10   
ref|XP_003385333.1|  PREDICTED: large subunit GTPase 1 homolog        70.5    2e-10   
ref|XP_009087403.1|  PREDICTED: LOW QUALITY PROTEIN: large subuni...  70.5    2e-10   
gb|KFP72479.1|  Large subunit GTPase 1                                70.5    2e-10   
ref|XP_005147063.1|  PREDICTED: large subunit GTPase 1 homolog        70.1    2e-10   
ref|XP_005489478.1|  PREDICTED: large subunit GTPase 1 homolog is...  70.1    3e-10   
ref|XP_011340354.1|  PREDICTED: large subunit GTPase 1 homolog        70.1    3e-10   
ref|XP_005489479.1|  PREDICTED: large subunit GTPase 1 homolog is...  70.1    3e-10   
ref|XP_004654594.1|  PREDICTED: large subunit GTPase 1 homolog        70.1    3e-10   
ref|XP_008060119.1|  PREDICTED: large subunit GTPase 1 homolog        70.1    3e-10   
ref|XP_007071421.1|  PREDICTED: LOW QUALITY PROTEIN: large subuni...  70.1    3e-10   
ref|XP_011698741.1|  PREDICTED: large subunit GTPase 1 homolog        69.7    4e-10   
ref|XP_008327228.1|  PREDICTED: large subunit GTPase 1 homolog        69.7    4e-10   
ref|XP_008405081.1|  PREDICTED: large subunit GTPase 1 homolog        69.7    4e-10   
ref|XP_009638013.1|  PREDICTED: large subunit GTPase 1 homolog        69.7    4e-10   
gb|KFP16711.1|  Large subunit GTPase 1                                69.7    4e-10   
ref|XP_011055778.1|  PREDICTED: large subunit GTPase 1 homolog        69.7    4e-10   
ref|XP_010206380.1|  PREDICTED: large subunit GTPase 1 homolog        69.3    4e-10   
gb|KFP27161.1|  Large subunit GTPase 1                                69.3    4e-10   
ref|XP_012064333.1|  PREDICTED: large subunit GTPase 1 homolog        69.7    4e-10   
ref|XP_007900678.1|  PREDICTED: large subunit GTPase 1 homolog        69.7    5e-10   
ref|XP_004067947.1|  PREDICTED: large subunit GTPase 1 homolog        69.3    5e-10   
ref|XP_009280693.1|  PREDICTED: large subunit GTPase 1 homolog        69.3    5e-10   
ref|XP_006750398.1|  PREDICTED: large subunit GTPase 1 homolog        69.3    6e-10   
ref|XP_005527154.1|  PREDICTED: large subunit GTPase 1 homolog        69.3    6e-10   
gb|KFM09577.1|  Large subunit GTPase 1                                68.9    6e-10   
ref|XP_005310051.1|  PREDICTED: large subunit GTPase 1 homolog        68.9    7e-10   
gb|KFV88571.1|  Large subunit GTPase 1                                68.9    7e-10   
ref|XP_007542137.1|  PREDICTED: large subunit GTPase 1 homolog        68.6    9e-10   
emb|CCG81874.1|  putative Ribosome biogenesis GTPase Lsg1             68.6    9e-10   
ref|XP_003974263.1|  PREDICTED: large subunit GTPase 1 homolog        68.6    9e-10   
gb|KDR18965.1|  Large subunit GTPase 1-like protein                   68.6    9e-10   
ref|XP_009687328.1|  PREDICTED: large subunit GTPase 1 homolog        68.6    1e-09   
ref|XP_010790051.1|  PREDICTED: large subunit GTPase 1 homolog        68.2    1e-09   
gb|EPX71528.1|  GTP binding protein                                   67.8    1e-09   
gb|KFW05182.1|  Large subunit GTPase 1                                67.8    2e-09   
ref|XP_010149859.1|  PREDICTED: large subunit GTPase 1 homolog        67.8    2e-09   
gb|EPQ12046.1|  Large subunit GTPase 1 like protein                   67.8    2e-09   
ref|XP_007667637.1|  PREDICTED: large subunit GTPase 1 homolog        67.4    2e-09   
gb|KGG51856.1|  hypothetical protein DI09_25p160                      67.0    2e-09   
ref|XP_007837886.1|  hypothetical protein PFICI_11114                 67.4    2e-09   
gb|KFH67657.1|  hypothetical protein MVEG_06389                       67.4    2e-09   
gb|KIV91193.1|  hypothetical protein PV10_05757                       67.0    3e-09   
gb|KIW38579.1|  hypothetical protein PV06_09535                       67.0    3e-09   
ref|XP_011165217.1|  PREDICTED: large subunit GTPase 1 homolog is...  66.6    4e-09   
gb|KGQ05896.1|  Large subunit GTPase 1                                66.6    4e-09   
ref|XP_008595962.1|  nucleolar GTP-binding protein                    66.6    4e-09   
ref|XP_011165215.1|  PREDICTED: large subunit GTPase 1 homolog is...  66.6    4e-09   
ref|XP_011152001.1|  PREDICTED: large subunit GTPase 1 homolog is...  66.6    4e-09   
ref|XP_005800382.1|  PREDICTED: large subunit GTPase 1 homolog        66.6    5e-09   
gb|EFN76113.1|  Large subunit GTPase 1-like protein                   66.2    5e-09   
ref|XP_011152000.1|  PREDICTED: large subunit GTPase 1 homolog is...  66.2    5e-09   
gb|KFA78565.1|  hypothetical protein S40288_01483                     66.2    5e-09   
gb|KIW16747.1|  hypothetical protein PV08_03936                       66.2    5e-09   
gb|KEY69750.1|  hypothetical protein S7711_03731                      66.2    5e-09   
gb|KFA63221.1|  hypothetical protein S40285_04903                     66.2    5e-09   
ref|XP_011675157.1|  PREDICTED: large subunit GTPase 1 homolog        66.2    5e-09   
gb|KFA49434.1|  hypothetical protein S40293_05761                     66.2    6e-09   
gb|ELU18504.1|  hypothetical protein CAPTEDRAFT_149684                66.2    6e-09   
ref|XP_659867.1|  hypothetical protein AN2263.2                       65.9    6e-09   
ref|XP_010869731.1|  PREDICTED: large subunit GTPase 1 homolog        65.9    7e-09   
ref|XP_004323923.1|  PREDICTED: large subunit GTPase 1 homolog        65.9    7e-09   
ref|XP_011454665.1|  PREDICTED: large subunit GTPase 1 homolog        65.9    8e-09   
ref|XP_007726531.1|  hypothetical protein A1O1_07473                  65.9    8e-09   
ref|XP_011275507.1|  Large subunit GTPase 1                           65.9    8e-09   
gb|KFH47563.1|  Large subunit GTPase-like protein                     65.9    8e-09   
ref|XP_003008505.1|  nucleolar GTP-binding protein                    65.9    8e-09   
ref|XP_010734940.1|  PREDICTED: large subunit GTPase 1 homolog        65.5    8e-09   
ref|XP_009658490.1|  nucleolar GTP-binding protein                    65.5    8e-09   
ref|XP_007736531.1|  hypothetical protein A1O3_08243                  65.5    9e-09   
gb|KIW51570.1|  hypothetical protein PV05_10278                       65.5    9e-09   
ref|XP_003780376.1|  PREDICTED: LOW QUALITY PROTEIN: large subuni...  65.5    9e-09   
ref|XP_001273987.1|  ribosome biogenesis GTPase Lsg1, putative        65.5    1e-08   
gb|ENH78700.1|  ribosome biogenesis gtpase                            65.5    1e-08   
ref|XP_009228769.1|  hypothetical protein GGTG_12604                  65.5    1e-08   
gb|KIX09969.1|  hypothetical protein Z518_01050                       65.5    1e-08   
ref|XP_004745351.1|  PREDICTED: large subunit GTPase 1 homolog is...  65.1    1e-08   
gb|KEF60609.1|  hypothetical protein A1O9_02170                       65.1    1e-08   
emb|CEJ81001.1|  hypothetical protein VHEMI01156                      65.1    1e-08   
ref|XP_001265986.1|  ribosome biogenesis GTPase Lsg1, putative        65.1    1e-08   
ref|XP_003173539.1|  nucleolar GTP-binding protein 2                  65.1    1e-08   
ref|XP_011647631.1|  PREDICTED: large subunit GTPase 1 homolog        65.1    1e-08   
gb|EGD92583.1|  ribosome biogenesis GTPase Lsg1                       65.1    1e-08   
ref|XP_007798116.1|  putative nucleolar gtp-binding protein           65.1    1e-08   
gb|EFQ27938.1|  hypothetical protein GLRG_03082                       65.1    1e-08   
gb|KEQ66721.1|  P-loop containing nucleoside triphosphate hydrola...  65.1    1e-08   
ref|XP_008717239.1|  hypothetical protein HMPREF1541_04673            65.1    1e-08   
gb|EXX73307.1|  Lsg1p                                                 65.1    1e-08   
ref|XP_007918562.1|  putative ribosome biogenesis gtpase protein      65.1    2e-08   
gb|ESA16331.1|  hypothetical protein GLOINDRAFT_77440                 64.7    2e-08   
ref|XP_003014576.1|  hypothetical protein ARB_07138                   64.7    2e-08   
gb|EZG06326.1|  hypothetical protein H106_04102                       64.7    2e-08   
ref|XP_003235009.1|  ribosome biogenesis GTPase Lsg1                  64.7    2e-08   
gb|EZF42030.1|  hypothetical protein H102_04276                       64.7    2e-08   
gb|EZF32910.1|  hypothetical protein H101_03500                       64.7    2e-08   
gb|EGE03955.1|  ribosome biogenesis GTPase Lsg1                       64.7    2e-08   
gb|EPS34377.1|  hypothetical protein PDE_09341                        64.7    2e-08   
gb|EZF73969.1|  hypothetical protein H105_04301                       64.7    2e-08   
gb|KEQ71165.1|  P-loop containing nucleoside triphosphate hydrola...  64.7    2e-08   
ref|XP_007346238.1|  P-loop containing nucleoside triphosphate hy...  64.7    2e-08   
ref|XP_006672983.1|  ribosome biogenesis GTPase Lsg1                  64.7    2e-08   
ref|XP_003050409.1|  predicted protein                                64.7    2e-08   
gb|KIW70996.1|  hypothetical protein PV04_03220                       64.7    2e-08   
ref|XP_003021015.1|  hypothetical protein TRV_04880                   64.7    2e-08   
ref|XP_007591094.1|  hypothetical protein CFIO01_06959                64.7    2e-08   
ref|XP_011870901.1|  PREDICTED: large subunit GTPase 1 homolog        64.7    2e-08   
gb|KEZ39928.1|  Large subunit GTPase 1                                64.7    2e-08   
emb|CDQ62614.1|  unnamed protein product                              64.7    2e-08   
ref|XP_007807103.1|  ribosome biogenesis GTPase Lsg1, putative        64.7    2e-08   
gb|ERS95748.1|  hypothetical protein HMPREF1624_07823                 64.7    2e-08   
gb|KEQ96942.1|  hypothetical protein AUEXF2481DRAFT_38346             64.7    2e-08   
ref|XP_002568757.1|  Pc21g17600                                       64.3    2e-08   
gb|KIH90876.1|  large subunit GTPase 1                                64.7    2e-08   
gb|KJZ74225.1|  hypothetical protein HIM_06456                        64.3    2e-08   
ref|XP_007755264.1|  hypothetical protein A1O7_03048                  64.3    2e-08   
gb|EDP51400.1|  ribosome biogenesis GTPase Lsg1, putative             64.3    2e-08   
ref|XP_007825624.1|  GTP-binding protein, HSR-1 related protein       64.3    2e-08   
gb|KJK75021.1|  Large subunit GTPase                                  64.3    2e-08   
ref|XP_753982.1|  ribosome biogenesis GTPase Lsg1                     64.3    2e-08   
gb|KID82653.1|  GTP-binding domain, HSR1-related protein              64.3    2e-08   
gb|KDN63058.1|  hypothetical protein CSUB01_00132                     64.3    2e-08   
emb|CCF47822.1|  hypothetical protein CH063_04294                     64.3    2e-08   
ref|XP_011892152.1|  PREDICTED: large subunit GTPase 1 homolog is...  64.3    2e-08   
ref|XP_011721375.1|  PREDICTED: large subunit GTPase 1 homolog is...  64.3    2e-08   
ref|XP_005545401.1|  PREDICTED: large subunit GTPase 1 homolog is...  64.3    2e-08   
emb|CDM29484.1|  Large subunit GTPase 1                               64.3    3e-08   
gb|KJJ21341.1|  GTP binding domain                                    64.3    3e-08   
ref|XP_002844930.1|  large-subunit GTPase                             64.3    3e-08   
gb|KGO66048.1|  hypothetical protein PITC_052480                      64.3    3e-08   



>ref|XP_002264570.1| PREDICTED: large subunit GTPase 1 homolog [Vitis vinifera]
Length=597

 Score =   221 bits (563),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 158/200 (79%), Gaps = 7/200 (4%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR VI DVYKI+LPKPKPYE Q+RPPLASE LRAYCASRGYVA+SGLPDETRAARQ
Sbjct  404  ANRVPRHVIEDVYKITLPKPKPYEQQNRPPLASEFLRAYCASRGYVASSGLPDETRAARQ  463

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGK+PHFEMPPGM +E  + E+ A  +  +  ++  S      S+    S SE 
Sbjct  464  ILKDYIDGKVPHFEMPPGMTDEVSEFEDPAEPSFSETHESDAS-----DSENPPNSESES  518

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
            E AP+L+H+LNDL+ FD+ NGL AS KA V+K P +APHKQHKKPQ+KKDRSWRV+ND  
Sbjct  519  ESAPNLEHVLNDLDAFDMANGL-ASKKAPVQKTP-KAPHKQHKKPQRKKDRSWRVKNDED  576

Query  253  DGMPAVRVLQKPVNTGPLNI  194
            DGMP  RV QKPVNTGPLN+
Sbjct  577  DGMPVARVFQKPVNTGPLNV  596



>ref|XP_006340326.1| PREDICTED: large subunit GTPase 1 homolog [Solanum tuberosum]
Length=585

 Score =   219 bits (557),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 154/200 (77%), Gaps = 4/200 (2%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPRKVI DVY ISLPKPKPYEPQSRPP A+ELLRAYCASRGYVA+SGLPDETRA RQ
Sbjct  389  ANRVPRKVIEDVYNISLPKPKPYEPQSRPPTAAELLRAYCASRGYVASSGLPDETRATRQ  448

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            +LKDYVDGKLPHFEMPPG     +D   +  D     D  GP +SD DS + ED    + 
Sbjct  449  MLKDYVDGKLPHFEMPPGE---LDDEASEEEDEVVTEDADGPIMSDSDSDEDEDEDDDDE  505

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
            +    LDH+L+DL+TFD+ NGLA S++A  KKKP+ APHKQHKK Q+KKDRSWRVQN  G
Sbjct  506  DINAHLDHVLSDLSTFDMANGLA-SNQAARKKKPSTAPHKQHKKTQRKKDRSWRVQNGEG  564

Query  253  DGMPAVRVLQKPVNTGPLNI  194
            DGMP VRV +K  NTGP+N+
Sbjct  565  DGMPVVRVFRKAANTGPVNV  584



>ref|XP_009623222.1| PREDICTED: large subunit GTPase 1 homolog [Nicotiana tomentosiformis]
Length=587

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 152/200 (76%), Gaps = 10/200 (5%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPRK+I DVY ISLPKPKPYE QSRPP A+ELLR YCASRGYVAASGLPDETRAARQ
Sbjct  397  ANRVPRKIIEDVYNISLPKPKPYESQSRPPTAAELLRTYCASRGYVAASGLPDETRAARQ  456

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            +LKDYVDGKLPHFE PPG+       E  A D D   DD GP +     S  +     E 
Sbjct  457  MLKDYVDGKLPHFETPPGVSE----DEGSAEDEDVSEDDDGPRM-----SASDSSGDDED  507

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
            E+APSL+H+L+DL+TFD+ NGL AS++A  KKKP+  PHKQHKK Q+KKDRSWRVQN   
Sbjct  508  ENAPSLEHVLSDLSTFDMANGL-ASNEAASKKKPSIKPHKQHKKSQRKKDRSWRVQNGDA  566

Query  253  DGMPAVRVLQKPVNTGPLNI  194
            DGMP VRV QKP NTGP++I
Sbjct  567  DGMPVVRVFQKPANTGPVSI  586



>ref|XP_011090291.1| PREDICTED: large subunit GTPase 1 homolog [Sesamum indicum]
Length=594

 Score =   216 bits (550),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 151/199 (76%), Gaps = 9/199 (5%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR VI DVY+ISLPKPKPYEPQSRPP A E LR YCASRGYVA+ GLPDETRAARQ
Sbjct  404  ANRVPRSVIEDVYRISLPKPKPYEPQSRPPSAVEFLRTYCASRGYVASGGLPDETRAARQ  463

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGKLPH++MPPG  + ++D E+ A  +  ++ ++  S          +      
Sbjct  464  ILKDYIDGKLPHYQMPPGTSDNKDDAEDGAGLSSSEIHESDSS--------DSEAPSVAE  515

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
             + PS +H+LNDLN FDI NGL AS+K T+KKKP+ APHKQHKKPQ+KKDRSWRV  + G
Sbjct  516  IELPSREHVLNDLNAFDIDNGL-ASTKTTIKKKPSSAPHKQHKKPQRKKDRSWRVGGNNG  574

Query  253  DGMPAVRVLQKPVNTGPLN  197
            DGMP VRV QKPVN+GPL+
Sbjct  575  DGMPVVRVFQKPVNSGPLD  593



>ref|XP_012066353.1| PREDICTED: large subunit GTPase 1 homolog [Jatropha curcas]
 gb|KDP42964.1| hypothetical protein JCGZ_23906 [Jatropha curcas]
Length=593

 Score =   216 bits (549),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 147/200 (74%), Gaps = 16/200 (8%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR VI DVYKI+LPKPKPYEPQSR PLASE LRAYCASRGYVA+SGLPDETRAARQ
Sbjct  406  ANRVPRHVIEDVYKINLPKPKPYEPQSRAPLASEFLRAYCASRGYVASSGLPDETRAARQ  465

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsv---  443
            ILKDY+DGKLPH+EMPPGM            +     ++ GPSLS+   +D  D      
Sbjct  466  ILKDYLDGKLPHYEMPPGMAR----------EEAGVEENEGPSLSETHETDSSDSEKPPD  515

Query  442  seleDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQN  263
             E E AP L+ +L+DLN+FD+ NGLA  SK  V KKP  A HK HKKPQ+KKDRSWR  N
Sbjct  516  VEGESAPVLERVLDDLNSFDMANGLA--SKKAVTKKPN-ASHKHHKKPQRKKDRSWRTVN  572

Query  262  DGGDGMPAVRVLQKPVNTGP  203
            D GDGMP VRV QKPVN+GP
Sbjct  573  DDGDGMPVVRVFQKPVNSGP  592



>ref|XP_011013118.1| PREDICTED: large subunit GTPase 1 homolog [Populus euphratica]
Length=601

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 153/203 (75%), Gaps = 16/203 (8%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR+VI DVYKI+LPKPKPYE QSRPPLASELLR YCASRGYVA+SGLPDETRAARQ
Sbjct  407  ANRVPRRVIEDVYKINLPKPKPYESQSRPPLASELLRTYCASRGYVASSGLPDETRAARQ  466

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedps---v  443
            ILKDY+DGKL H E+PPG+ +              + DDAGPSLS+   SD  D      
Sbjct  467  ILKDYIDGKLTHHEIPPGISD----------KEGSNQDDAGPSLSETHQSDSSDTENPAE  516

Query  442  seleDAPSLDHILNDLNTFDITNGLAASSKATVKK--KPTRAphkqhkkpqkkKDRSWRV  269
            ++ ++ P+L+H+L+DLN+FD+ NGL A  K TVKK      A HK HKKPQKKKDRSWR+
Sbjct  517  NDGKNTPALEHVLDDLNSFDMANGL-AHKKVTVKKPSASASASHKHHKKPQKKKDRSWRI  575

Query  268  QNDGGDGMPAVRVLQKPVNTGPL  200
            +NDGGDGMP VRV QK VNTGPL
Sbjct  576  ENDGGDGMPVVRVFQKSVNTGPL  598



>ref|XP_002313500.2| hypothetical protein POPTR_0009s02210g [Populus trichocarpa]
 gb|EEE87455.2| hypothetical protein POPTR_0009s02210g [Populus trichocarpa]
Length=603

 Score =   214 bits (545),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 153/203 (75%), Gaps = 16/203 (8%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR+VI DVYKI+LPKPKPYEPQSRPPLASELLR YCASRGYV +SGLPDETRAARQ
Sbjct  409  ANRVPRRVIEDVYKINLPKPKPYEPQSRPPLASELLRTYCASRGYVGSSGLPDETRAARQ  468

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedps---v  443
            ILKDY+DGKL H E+PPG+ +          +   D DDAG SLS+   SD  D      
Sbjct  469  ILKDYIDGKLTHHEIPPGISD----------EEGSDQDDAGSSLSETHQSDSSDTENPAE  518

Query  442  seleDAPSLDHILNDLNTFDITNGLAASSKATVKK--KPTRAphkqhkkpqkkKDRSWRV  269
            ++ ++ P+L+H+L+DLN+FD+ NGL A  K TVKK      A HK HKKPQKKKDRSWR+
Sbjct  519  NDGKNTPALEHVLDDLNSFDMANGL-AHKKVTVKKPSASASASHKHHKKPQKKKDRSWRI  577

Query  268  QNDGGDGMPAVRVLQKPVNTGPL  200
            +NDGGDGMP VRV QK VNTGPL
Sbjct  578  ENDGGDGMPVVRVFQKSVNTGPL  600



>ref|XP_006378981.1| hypothetical protein POPTR_0009s02210g [Populus trichocarpa]
 gb|ERP56778.1| hypothetical protein POPTR_0009s02210g [Populus trichocarpa]
Length=602

 Score =   214 bits (544),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 153/203 (75%), Gaps = 16/203 (8%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR+VI DVYKI+LPKPKPYEPQSRPPLASELLR YCASRGYV +SGLPDETRAARQ
Sbjct  408  ANRVPRRVIEDVYKINLPKPKPYEPQSRPPLASELLRTYCASRGYVGSSGLPDETRAARQ  467

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedps---v  443
            ILKDY+DGKL H E+PPG+ +          +   D DDAG SLS+   SD  D      
Sbjct  468  ILKDYIDGKLTHHEIPPGISD----------EEGSDQDDAGSSLSETHQSDSSDTENPAE  517

Query  442  seleDAPSLDHILNDLNTFDITNGLAASSKATVKK--KPTRAphkqhkkpqkkKDRSWRV  269
            ++ ++ P+L+H+L+DLN+FD+ NGL A  K TVKK      A HK HKKPQKKKDRSWR+
Sbjct  518  NDGKNTPALEHVLDDLNSFDMANGL-AHKKVTVKKPSASASASHKHHKKPQKKKDRSWRI  576

Query  268  QNDGGDGMPAVRVLQKPVNTGPL  200
            +NDGGDGMP VRV QK VNTGPL
Sbjct  577  ENDGGDGMPVVRVFQKSVNTGPL  599



>gb|KGN65017.1| hypothetical protein Csa_1G181300 [Cucumis sativus]
Length=214

 Score =   202 bits (515),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 151/198 (76%), Gaps = 10/198 (5%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR VI DVYKI+LPKPKPYEPQSRPPLASELL+AYC SRGYVA+SGLPDETRA+RQ
Sbjct  23   ANRVPRHVIEDVYKITLPKPKPYEPQSRPPLASELLKAYCVSRGYVASSGLPDETRASRQ  82

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDYVDGK+PH E+PPGM  E+   EEDA   +        S +    SD  + S  + 
Sbjct  83   ILKDYVDGKIPHHELPPGMLKEDHIQEEDARSFEL-------SDTHDSDSDDVEDSNMDG  135

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
            E AP  + +++ L++FDI NGLA   K ++ +K  +A HKQHKKPQ+KKDRSWRV NDGG
Sbjct  136  ESAPGFEQVVDYLDSFDIANGLA---KPSITEKKPKASHKQHKKPQRKKDRSWRVGNDGG  192

Query  253  DGMPAVRVLQKPVNTGPL  200
            DGMPAVRVLQKP+N+G L
Sbjct  193  DGMPAVRVLQKPINSGTL  210



>ref|XP_009335155.1| PREDICTED: large subunit GTPase 1 homolog [Pyrus x bretschneideri]
Length=577

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 142/200 (71%), Gaps = 14/200 (7%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANR+PR VI  VY+I LPKPK YE QSRPPLA+E LR YCASRGYVA+SGLPDETRAARQ
Sbjct  391  ANRIPRHVIEAVYRIDLPKPKSYELQSRPPLAAEFLRVYCASRGYVASSGLPDETRAARQ  450

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGKLPH++MPPGM  E+  G   +     D  +   S+              E 
Sbjct  451  ILKDYIDGKLPHYQMPPGMTEEDAVGNCLSEQHKSDSSENEHSV------------DDEG  498

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
             D P LDH+L DLN+FD+ NGLA   K TV +KPT APHKQHKK Q+KKDRSWRV NDGG
Sbjct  499  ADEPELDHVLEDLNSFDLANGLATKKKVTV-RKPT-APHKQHKKTQRKKDRSWRVGNDGG  556

Query  253  DGMPAVRVLQKPVNTGPLNI  194
            DGMP VR  QKP NTGPL +
Sbjct  557  DGMPVVRAFQKPANTGPLKV  576



>ref|XP_010247646.1| PREDICTED: large subunit GTPase 1 homolog [Nelumbo nucifera]
Length=592

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 140/198 (71%), Gaps = 7/198 (4%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR VI  VY I+LPKPKPYEPQSRPPLA ELLR YC+SRGYV +SGLPDETRAARQ
Sbjct  399  ANRVPRHVIESVYNITLPKPKPYEPQSRPPLAVELLRVYCSSRGYVGSSGLPDETRAARQ  458

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DG+LPHFEMPPGM N+++   + A       D+   S       D E     E 
Sbjct  459  ILKDYIDGRLPHFEMPPGMSNDDDGVLDIAQSISSAADELDSS-------DSEGEPEVED  511

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
                +L+H+L+DL++FDI NGL ++  A  K KP  A HK HKKPQ++KDRSWRV NDGG
Sbjct  512  SSTSNLEHVLDDLDSFDINNGLTSTKTAASKTKPATASHKHHKKPQRRKDRSWRVGNDGG  571

Query  253  DGMPAVRVLQKPVNTGPL  200
            DGMP  RV QK  N GPL
Sbjct  572  DGMPVARVFQKTANMGPL  589



>ref|XP_010313487.1| PREDICTED: large subunit GTPase 1 homolog [Solanum lycopersicum]
Length=589

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 152/201 (76%), Gaps = 2/201 (1%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPRK I DVY ISLPKPKPYEPQSRPP A+ELLRAYCASRGYVA+SGLPDETRA RQ
Sbjct  389  ANRVPRKTIEDVYNISLPKPKPYEPQSRPPTAAELLRAYCASRGYVASSGLPDETRATRQ  448

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvd-dAGPSLsdhdssdvedpsvse  437
            +LKDYVDGKLPHFEMPPG  ++E   EED   T+D  +     S  D D  + ED    +
Sbjct  449  MLKDYVDGKLPHFEMPPGESDDEASEEEDEIVTEDADNPIMSGSDEDDDDDEDEDEDEDD  508

Query  436  leDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDG  257
             +    LDH+L+DL+TFD+ NGLA++  A  KKKP  APHKQHKK Q+KKDRSWRVQN  
Sbjct  509  EDINAHLDHVLSDLSTFDMANGLASNQTAR-KKKPITAPHKQHKKTQRKKDRSWRVQNGE  567

Query  256  GDGMPAVRVLQKPVNTGPLNI  194
            GDGMP VRV +K  NTGP+NI
Sbjct  568  GDGMPVVRVFRKAANTGPVNI  588



>ref|XP_009770039.1| PREDICTED: large subunit GTPase 1 homolog [Nicotiana sylvestris]
Length=588

 Score =   211 bits (537),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 150/200 (75%), Gaps = 10/200 (5%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPRK+I DVY ISLPKPKPYE QSRPP A+ELLR YCASRGYVAASGLPDETRA+RQ
Sbjct  398  ANRVPRKIIEDVYNISLPKPKPYESQSRPPTAAELLRTYCASRGYVAASGLPDETRASRQ  457

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            +LKDYVDGKLPHFE PPG+       E  A D D   DD GP +     S  +     E 
Sbjct  458  MLKDYVDGKLPHFETPPGVSE----DEGSAEDEDVTEDDDGPRM-----SASDSSGDDED  508

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
            E+ PSL+H+L+DL+TFD+ NGLA  ++A  KKKP+  PHKQHKK Q+KKDRSWRVQN   
Sbjct  509  ENGPSLEHVLSDLSTFDMANGLAP-NEAARKKKPSIKPHKQHKKSQRKKDRSWRVQNGDA  567

Query  253  DGMPAVRVLQKPVNTGPLNI  194
            DGMP VRV QKP NTGP++I
Sbjct  568  DGMPVVRVFQKPANTGPVSI  587



>ref|XP_004291536.1| PREDICTED: large subunit GTPase 1 homolog [Fragaria vesca subsp. 
vesca]
Length=585

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 149/200 (75%), Gaps = 13/200 (7%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A+RVPR VI  VY I LPKPK YE QSRPPLA+EL+RAYCASRGYVA+SGLPDETRAARQ
Sbjct  398  ADRVPRHVIEKVYNIDLPKPKSYELQSRPPLAAELMRAYCASRGYVASSGLPDETRAARQ  457

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            +L+DY+DGKLPH+EMPPGM +E++D     ++  +       +            S S+ 
Sbjct  458  LLRDYIDGKLPHYEMPPGMTDEKDDVGHILSEQHESDSSDMET-----------RSESDN  506

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
            E+ P +DH+L+DLN+FDI NGLA + KAT KK    APHKQHKKPQ+KKDR+WRV NDGG
Sbjct  507  ENVPEIDHVLDDLNSFDIANGLATNKKATAKK--LTAPHKQHKKPQRKKDRTWRVGNDGG  564

Query  253  DGMPAVRVLQKPVNTGPLNI  194
            DGMP  RV QKPVNTGP+ +
Sbjct  565  DGMPVARVYQKPVNTGPVKV  584



>gb|KJB35431.1| hypothetical protein B456_006G116700 [Gossypium raimondii]
Length=419

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 133/202 (66%), Positives = 150/202 (74%), Gaps = 17/202 (8%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRV R VI DVYKI LPKPKPYE QSRPP ASELLRAYCASRGYVA+SGLPDETRAARQ
Sbjct  231  ANRVQRHVIEDVYKIKLPKPKPYESQSRPPQASELLRAYCASRGYVASSGLPDETRAARQ  290

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsd---hdssdvedpsv  443
            ILKD++DGKLPH+EMPPGM           +  D   DD  PSLS+    D+SDVED   
Sbjct  291  ILKDFIDGKLPHYEMPPGM-----------SAEDGVEDDGNPSLSEVLNSDASDVEDSLE  339

Query  442  seleDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQN  263
            +  E  P  +H+L+DL++FD+ NGL  S KATVKK  + A HK HKKPQ+KKDRSWRV N
Sbjct  340  NGTETTPVSEHVLDDLSSFDLANGL-VSKKATVKK--SNASHKHHKKPQRKKDRSWRVGN  396

Query  262  DGGDGMPAVRVLQKPVNTGPLN  197
            D  DGMP  RV QKPVN+GPLN
Sbjct  397  DDEDGMPVTRVFQKPVNSGPLN  418



>ref|XP_007015655.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
 gb|EOY33274.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
Length=591

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 147/202 (73%), Gaps = 17/202 (8%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRV R +I DVYKI+LPKPKPYE QSRPP ASE LRAYCASRGYVA+SGLPDETRAARQ
Sbjct  403  ANRVQRHIIEDVYKINLPKPKPYESQSRPPQASEFLRAYCASRGYVASSGLPDETRAARQ  462

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdved---psv  443
            ILKDY+DGKLPH+E+PPGM +E    ++             PSLS+  +SD  D      
Sbjct  463  ILKDYIDGKLPHYEIPPGMADEGGVEDDGK-----------PSLSEVHNSDASDVDGSLE  511

Query  442  seleDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQN  263
               E  P L H+L+DL++FD+ NGL AS KATVKK  + A HK HKKPQ+ KDRSWRV N
Sbjct  512  DGSETTPVLKHVLDDLSSFDLANGL-ASKKATVKK--SNASHKHHKKPQRTKDRSWRVGN  568

Query  262  DGGDGMPAVRVLQKPVNTGPLN  197
            D  DGMP VRV QKPVN+GPLN
Sbjct  569  DDDDGMPVVRVFQKPVNSGPLN  590



>gb|KJB35432.1| hypothetical protein B456_006G116700 [Gossypium raimondii]
Length=492

 Score =   206 bits (524),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 147/202 (73%), Gaps = 17/202 (8%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRV R VI DVYKI LPKPKPYE QSRPP ASELLRAYCASRGYVA+SGLPDETRAARQ
Sbjct  304  ANRVQRHVIEDVYKIKLPKPKPYESQSRPPQASELLRAYCASRGYVASSGLPDETRAARQ  363

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvse-  437
            ILKD++DGKLPH+EMPPGM           +  D   DD  PSLS+  +SD  D   S  
Sbjct  364  ILKDFIDGKLPHYEMPPGM-----------SAEDGVEDDGNPSLSEVLNSDASDVEDSLE  412

Query  436  --leDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQN  263
               E  P  +H+L+DL++FD+ NGL  S KATVKK  + A HK HKKPQ+KKDRSWRV N
Sbjct  413  NGTETTPVSEHVLDDLSSFDLANGL-VSKKATVKK--SNASHKHHKKPQRKKDRSWRVGN  469

Query  262  DGGDGMPAVRVLQKPVNTGPLN  197
            D  DGMP  RV QKPVN+GPLN
Sbjct  470  DDEDGMPVTRVFQKPVNSGPLN  491



>ref|XP_010031571.1| PREDICTED: large subunit GTPase 1 homolog [Eucalyptus grandis]
 gb|KCW50930.1| hypothetical protein EUGRSUZ_J00579 [Eucalyptus grandis]
 gb|KCW50931.1| hypothetical protein EUGRSUZ_J00579 [Eucalyptus grandis]
Length=593

 Score =   207 bits (528),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 149/203 (73%), Gaps = 18/203 (9%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR VI +VYKISLPKPKPYEPQ RPPLASELLRAYCASRGYVA+SGLPDETRAARQ
Sbjct  401  ANRVPRSVIENVYKISLPKPKPYEPQDRPPLASELLRAYCASRGYVASSGLPDETRAARQ  460

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedps----  446
            ILKDY+DGKLPH+EMPPGM +EE    + A           PSLS+   S+  D      
Sbjct  461  ILKDYIDGKLPHYEMPPGMGDEECYDGDAAE----------PSLSEVAESESSDIENPPD  510

Query  445  -vseleDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRV  269
               E E  P  DH+L+DL++FD+ NGL +S K TVKK  + A HK HKKPQ+KKDRSWRV
Sbjct  511  NEDESEIGPVFDHVLDDLSSFDVANGL-SSKKVTVKK--SNASHKNHKKPQRKKDRSWRV  567

Query  268  QNDGGDGMPAVRVLQKPVNTGPL  200
             ND GDGMP +RV QKP + GP+
Sbjct  568  GNDDGDGMPVIRVYQKPPSGGPV  590



>gb|KJB35430.1| hypothetical protein B456_006G116700 [Gossypium raimondii]
Length=590

 Score =   207 bits (528),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 147/202 (73%), Gaps = 17/202 (8%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRV R VI DVYKI LPKPKPYE QSRPP ASELLRAYCASRGYVA+SGLPDETRAARQ
Sbjct  402  ANRVQRHVIEDVYKIKLPKPKPYESQSRPPQASELLRAYCASRGYVASSGLPDETRAARQ  461

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvse-  437
            ILKD++DGKLPH+EMPPGM           +  D   DD  PSLS+  +SD  D   S  
Sbjct  462  ILKDFIDGKLPHYEMPPGM-----------SAEDGVEDDGNPSLSEVLNSDASDVEDSLE  510

Query  436  --leDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQN  263
               E  P  +H+L+DL++FD+ NGL  S KATVKK  + A HK HKKPQ+KKDRSWRV N
Sbjct  511  NGTETTPVSEHVLDDLSSFDLANGL-VSKKATVKK--SNASHKHHKKPQRKKDRSWRVGN  567

Query  262  DGGDGMPAVRVLQKPVNTGPLN  197
            D  DGMP  RV QKPVN+GPLN
Sbjct  568  DDEDGMPVTRVFQKPVNSGPLN  589



>ref|XP_006424080.1| hypothetical protein CICLE_v10028074mg [Citrus clementina]
 gb|ESR37320.1| hypothetical protein CICLE_v10028074mg [Citrus clementina]
Length=439

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 149/198 (75%), Gaps = 10/198 (5%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR VI +VYKI+LPKPKPYE QSRPPLA ELLRAYC SRGYVA+SGLPDETRAAR 
Sbjct  249  ANRVPRHVIENVYKINLPKPKPYESQSRPPLALELLRAYCTSRGYVASSGLPDETRAARI  308

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKD++DGKLPHFEMPPGM +EE   E+  A +          L + D+SD E+   +  
Sbjct  309  ILKDFIDGKLPHFEMPPGMSHEEVGMEDTQASSLL-------ELHESDASDAEEVPANGD  361

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
               P L+H+L+DL++FD+ NGLA  SK    KKP+ A HKQHKKPQ+KKDRSWRV ND G
Sbjct  362  RTTPVLEHVLDDLSSFDLANGLA--SKKVNVKKPS-ASHKQHKKPQRKKDRSWRVSNDDG  418

Query  253  DGMPAVRVLQKPVNTGPL  200
            DGMP VRV +K +NTGPL
Sbjct  419  DGMPVVRVFEKSMNTGPL  436



>ref|XP_006424081.1| hypothetical protein CICLE_v10028074mg [Citrus clementina]
 gb|ESR37321.1| hypothetical protein CICLE_v10028074mg [Citrus clementina]
Length=589

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 149/198 (75%), Gaps = 10/198 (5%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR VI +VYKI+LPKPKPYE QSRPPLA ELLRAYC SRGYVA+SGLPDETRAAR 
Sbjct  399  ANRVPRHVIENVYKINLPKPKPYESQSRPPLALELLRAYCTSRGYVASSGLPDETRAARI  458

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKD++DGKLPHFEMPPGM +EE   E+  A +          L + D+SD E+   +  
Sbjct  459  ILKDFIDGKLPHFEMPPGMSHEEVGMEDTQASSLL-------ELHESDASDAEEVPANGD  511

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
               P L+H+L+DL++FD+ NGLA  SK    KKP+ A HKQHKKPQ+KKDRSWRV ND G
Sbjct  512  RTTPVLEHVLDDLSSFDLANGLA--SKKVNVKKPS-ASHKQHKKPQRKKDRSWRVSNDDG  568

Query  253  DGMPAVRVLQKPVNTGPL  200
            DGMP VRV +K +NTGPL
Sbjct  569  DGMPVVRVFEKSMNTGPL  586



>ref|XP_008464315.1| PREDICTED: large subunit GTPase 1 homolog [Cucumis melo]
 ref|XP_008464316.1| PREDICTED: large subunit GTPase 1 homolog [Cucumis melo]
Length=593

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 148/198 (75%), Gaps = 10/198 (5%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR VI DVYKI+LPKPKPYEPQSRPPLASELL+AYC SR YVA+SGLPDETRAARQ
Sbjct  402  ANRVPRHVIEDVYKITLPKPKPYEPQSRPPLASELLKAYCISRSYVASSGLPDETRAARQ  461

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDYVDGK+PH E+PPGMP E+   EEDA   +        S       D  + S  + 
Sbjct  462  ILKDYVDGKIPHHELPPGMPKEDHIQEEDARTLELSDTHDSDS-------DDVEDSSRDG  514

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
            E AP  + + + L++FDI NGLA SS    +KKP +A HKQHKKPQ+KKDRSWR+ NDGG
Sbjct  515  ESAPGFEQVADYLDSFDIANGLAKSS--VTEKKP-KASHKQHKKPQRKKDRSWRIGNDGG  571

Query  253  DGMPAVRVLQKPVNTGPL  200
            D MPAVRVLQKP+N+G L
Sbjct  572  DSMPAVRVLQKPINSGTL  589



>ref|XP_006487859.1| PREDICTED: large subunit GTPase 1 homolog [Citrus sinensis]
Length=589

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 148/198 (75%), Gaps = 10/198 (5%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR VI +V KI+LPKPKPYE QSRPPLA ELLRAYCASRGYVA+SGLPDETRAAR 
Sbjct  399  ANRVPRHVIENVCKINLPKPKPYESQSRPPLALELLRAYCASRGYVASSGLPDETRAARI  458

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKD++DGKLPHFEMPPGM +EE   E+  A +          L + D+SD E+      
Sbjct  459  ILKDFIDGKLPHFEMPPGMSHEEVGMEDTQASSLL-------ELHESDASDAEEVPAHGD  511

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
               P L+H+L+DL++FD+ NGLA  SK    KKP+ A HKQHKKPQ+KKDRSWRV ND G
Sbjct  512  RTTPVLEHVLDDLSSFDLANGLA--SKKVNVKKPS-ASHKQHKKPQRKKDRSWRVSNDDG  568

Query  253  DGMPAVRVLQKPVNTGPL  200
            DGMP VRV +K VNTGPL
Sbjct  569  DGMPVVRVFEKSVNTGPL  586



>ref|XP_011654864.1| PREDICTED: LOW QUALITY PROTEIN: large subunit GTPase 1 homolog 
[Cucumis sativus]
Length=588

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 149/198 (75%), Gaps = 10/198 (5%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR VI DVYKI+LPKPKPYEPQSRPPLASELL+AYC SRGYVA+SGLPDETRA+RQ
Sbjct  397  ANRVPRHVIEDVYKITLPKPKPYEPQSRPPLASELLKAYCVSRGYVASSGLPDETRASRQ  456

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDYVDGK+PH E+PPGM  E+   EEDA   +        S       D  + S  + 
Sbjct  457  ILKDYVDGKIPHHELPPGMLKEDHIQEEDARSFELSDTHDSDS-------DDVEDSNMDG  509

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
            E AP  + +++ L++FDI NGLA   K ++ +K  +A HKQHKKPQ+KKDRSWRV NDGG
Sbjct  510  ESAPGFEQVVDYLDSFDIANGLA---KPSITEKKPKASHKQHKKPQRKKDRSWRVGNDGG  566

Query  253  DGMPAVRVLQKPVNTGPL  200
            DGMPAVRVLQKP+N+G L
Sbjct  567  DGMPAVRVLQKPINSGTL  584



>gb|KDO46575.1| hypothetical protein CISIN_1g010472mg [Citrus sinensis]
Length=509

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 148/198 (75%), Gaps = 10/198 (5%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR VI +V KI+LPKPKPYE QSRPPLA ELLRAYCASRGYVA+SGLPDETRAAR 
Sbjct  319  ANRVPRHVIENVCKINLPKPKPYESQSRPPLALELLRAYCASRGYVASSGLPDETRAARI  378

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKD++DGKLPHFEMPPGM +EE   E+  A +          L + D+SD E+      
Sbjct  379  ILKDFIDGKLPHFEMPPGMSHEEVGMEDTQASSLL-------ELHESDASDAEEVPAHGD  431

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
               P L+H+L+DL++FD+ NGLA  SK    KKP+ A HKQHKKPQ+KKDRSWRV ND G
Sbjct  432  RTTPVLEHVLDDLSSFDLANGLA--SKKVNVKKPS-ASHKQHKKPQRKKDRSWRVSNDDG  488

Query  253  DGMPAVRVLQKPVNTGPL  200
            DGMP VRV +K +NTGPL
Sbjct  489  DGMPVVRVFEKSMNTGPL  506



>ref|XP_002513727.1| GTP binding protein, putative [Ricinus communis]
 gb|EEF48674.1| GTP binding protein, putative [Ricinus communis]
Length=596

 Score =   201 bits (511),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 147/199 (74%), Gaps = 15/199 (8%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRV R +I DVYKI+LPKPKPYEPQSRPPLASE LRAYCASRGYVA+SGLPDETRAARQ
Sbjct  407  ANRVARHIIEDVYKINLPKPKPYEPQSRPPLASEFLRAYCASRGYVASSGLPDETRAARQ  466

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedps--vs  440
            ILKDY+DGKLPH+EMPP M          +A+     +D GPSLS+ + +D  D      
Sbjct  467  ILKDYLDGKLPHYEMPPRM----------SAEEPSAENDGGPSLSETNETDSSDIENPTD  516

Query  439  eleDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQND  260
            + E+A +L+ +L+DL +FD+ NGL  S K  VKK  + A +K H+KP++KKDRSWR +ND
Sbjct  517  QEENALNLEQVLDDLKSFDMANGL-TSKKVIVKK--SNASNKHHRKPKRKKDRSWRSKND  573

Query  259  GGDGMPAVRVLQKPVNTGP  203
             GDGMP +RV QKPVN  P
Sbjct  574  DGDGMPIIRVFQKPVNASP  592



>ref|XP_004146392.1| PREDICTED: large subunit GTPase 1 homolog [Cucumis sativus]
 gb|KGN54796.1| hypothetical protein Csa_4G499330 [Cucumis sativus]
Length=588

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 143/198 (72%), Gaps = 13/198 (7%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR VI DVYKI LPKPKPYEPQS+PPLASELL+AYC SRGYVA+SGLPDETRA+RQ
Sbjct  402  ANRVPRHVIEDVYKIKLPKPKPYEPQSQPPLASELLKAYCVSRGYVASSGLPDETRASRQ  461

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDYVDGK+PH E+PPGM NE+   EEDA            S               + 
Sbjct  462  ILKDYVDGKIPHHELPPGMSNEDHIQEEDAETLKLSATHDSDS------------DSDDG  509

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
            E+ P  + + + L++FD+ NGLA  +  T +KK   + HK HKKPQ+KK+RSWR+ NDGG
Sbjct  510  ENGPGFEQVADYLDSFDLANGLAKPNIIT-EKKAKASSHKHHKKPQRKKERSWRMGNDGG  568

Query  253  DGMPAVRVLQKPVNTGPL  200
            DGMPAVRVLQKP+N+GPL
Sbjct  569  DGMPAVRVLQKPINSGPL  586



>ref|XP_009342719.1| PREDICTED: large subunit GTPase 1 homolog [Pyrus x bretschneideri]
Length=578

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 145/200 (73%), Gaps = 13/200 (7%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR VI  VY+I LP+PK YE QSRPPLA+E LRAYCASRGYVA+SGLPDET+AARQ
Sbjct  391  ANRVPRHVIEAVYRIDLPQPKSYELQSRPPLAAEFLRAYCASRGYVASSGLPDETKAARQ  450

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGKLPH++MPPGM  EE+D                P      SSD E+    E 
Sbjct  451  ILKDYIDGKLPHYQMPPGMTAEEDDVGNVL-----------PEHHKSGSSDDENSEDDEG  499

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
            ED P LDH L DLN+FDI NGLA   K  V +KPT APHKQHKK Q+KKDRSWRV NDGG
Sbjct  500  EDEPELDHALEDLNSFDIANGLATKKKVAV-RKPT-APHKQHKKTQRKKDRSWRVGNDGG  557

Query  253  DGMPAVRVLQKPVNTGPLNI  194
            DGMP VRV QKP NTGP+ +
Sbjct  558  DGMPVVRVFQKPANTGPVKV  577



>ref|XP_006417692.1| hypothetical protein EUTSA_v10007194mg [Eutrema salsugineum]
 gb|ESQ36045.1| hypothetical protein EUTSA_v10007194mg [Eutrema salsugineum]
Length=577

 Score =   197 bits (502),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 145/199 (73%), Gaps = 11/199 (6%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A++VPR VI  VY ISLPKPKPYE QSRPPLA+ELLRAYCASRGYVA+SGLPDET+AAR 
Sbjct  386  ADKVPRHVIESVYNISLPKPKPYERQSRPPLAAELLRAYCASRGYVASSGLPDETKAARL  445

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+ GKLPHF MPPGM            ++  D      ++   DS D +    +E 
Sbjct  446  ILKDYIGGKLPHFAMPPGM--------SLGEESKIDESQGTGAVEGSDSEDSDVGDETES  497

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQN-DG  257
            E AP +  +L+DL++FD+ NGLA+S K TVKK+   A HKQHKKPQ+KKDR+WRVQN + 
Sbjct  498  EQAPGIGEVLDDLSSFDLANGLASSKKVTVKKQT--ASHKQHKKPQRKKDRNWRVQNTED  555

Query  256  GDGMPAVRVLQKPVNTGPL  200
            GDGMP VRV QKP NTGPL
Sbjct  556  GDGMPLVRVFQKPANTGPL  574



>ref|XP_009110897.1| PREDICTED: large subunit GTPase 1 homolog [Brassica rapa]
Length=576

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 140/201 (70%), Gaps = 16/201 (8%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A++VPR VI  VY I+LPKPK YE QSRPPLA+ELLRAYCASRGYVA+SGLPDET+AARQ
Sbjct  390  ADKVPRSVIESVYNITLPKPKTYERQSRPPLAAELLRAYCASRGYVASSGLPDETKAARQ  449

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+ GKL HF MPPGM  E+ + +       D  +  G                   
Sbjct  450  ILKDYIGGKLRHFAMPPGMTEEKIEDDTGRETGSDSEEGEGDE-------------KESD  496

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQN-DG  257
            E  P +D +L DL++FD+ NGLA+S K TVKK+   A HKQHKKPQ+KKDR+WRV+N + 
Sbjct  497  EQVPGIDDVLEDLSSFDLANGLASSKKVTVKKET--ASHKQHKKPQRKKDRNWRVKNTEE  554

Query  256  GDGMPAVRVLQKPVNTGPLNI  194
            GDGMP VRV QKP NTGPL +
Sbjct  555  GDGMPLVRVFQKPANTGPLTM  575



>emb|CDY31149.1| BnaA08g26990D [Brassica napus]
Length=576

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 140/201 (70%), Gaps = 16/201 (8%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A++VPR VI  VY I+LPKPK YE QSRPPLA+ELLRAYCASRGYVA+SGLPDET+AARQ
Sbjct  390  ADKVPRSVIESVYNITLPKPKTYERQSRPPLAAELLRAYCASRGYVASSGLPDETKAARQ  449

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+ GKL HF MPPGM  E+ + +       D  +  G                   
Sbjct  450  ILKDYIGGKLRHFAMPPGMTEEKIEDDTGRETGSDSEEGEGDE-------------KESD  496

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQN-DG  257
            E  P +D +L DL++FD+ NGLA+S K TVKK+   A HKQHKKPQ+KKDR+WRV+N + 
Sbjct  497  EQVPGIDDVLEDLSSFDLANGLASSKKVTVKKET--ASHKQHKKPQRKKDRNWRVKNTEE  554

Query  256  GDGMPAVRVLQKPVNTGPLNI  194
            GDGMP VRV QKP NTGPL +
Sbjct  555  GDGMPLVRVFQKPANTGPLTM  575



>ref|XP_008442123.1| PREDICTED: large subunit GTPase 1 homolog [Cucumis melo]
Length=586

 Score =   194 bits (493),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 136/199 (68%), Gaps = 17/199 (9%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR VI DVYKI LPKPKPYEPQS+PPLASELL+AYC SRGYVA+SGLPDETRA+RQ
Sbjct  402  ANRVPRHVIEDVYKIKLPKPKPYEPQSQPPLASELLKAYCVSRGYVASSGLPDETRASRQ  461

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDYVDGK+PH E+PPG+ NE+   EEDA                            + 
Sbjct  462  ILKDYVDGKIPHHELPPGISNEDHIQEEDAETQKLSATMHDSD-------------SDDG  508

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkp-qkkKDRSWRVQNDG  257
            E    ++ + + L++FD+ NGLA   K  + +K  +A   +  K  ++KKDRSWR+ NDG
Sbjct  509  EKGHGVEQVADYLDSFDLANGLA---KPNISEKKAKASSHKRHKKPERKKDRSWRMGNDG  565

Query  256  GDGMPAVRVLQKPVNTGPL  200
            GDGMPAVRVLQKP+N+G L
Sbjct  566  GDGMPAVRVLQKPINSGSL  584



>ref|XP_003543409.1| PREDICTED: large subunit GTPase 1 homolog [Glycine max]
Length=573

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 134/200 (67%), Gaps = 21/200 (11%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A++VPR VI ++YKISLPKPKPYEPQSRPPLASELLRAYCASR YV ASGLPDETRAARQ
Sbjct  395  ADKVPRHVIEEIYKISLPKPKPYEPQSRPPLASELLRAYCASRRYVTASGLPDETRAARQ  454

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGKLPH+EMPP M N E              +D    L                
Sbjct  455  ILKDYIDGKLPHYEMPPAMSNVELYSVNLHGSVSSRTEDVDGKL----------------  498

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
              AP  + +L+DLN+FD+ NGL  S++ T+KK    A H  H+KPQ+KKDRS R +N+  
Sbjct  499  --APDFEQVLDDLNSFDMANGL-VSNEVTIKK--ADASHNHHRKPQRKKDRSQRTENNDA  553

Query  253  DGMPAVRVLQKPVNTGPLNI  194
            DGMP VR LQKP+NT  + +
Sbjct  554  DGMPVVRFLQKPINTSYVKV  573



>emb|CDX97480.1| BnaC08g13450D [Brassica napus]
Length=577

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 142/201 (71%), Gaps = 17/201 (8%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A++VPR+VI  VY I+LPKPK YE QSRPPLA+E+LRAYCASRGYVA+SGLPDET+AARQ
Sbjct  392  ADKVPRRVIESVYNITLPKPKTYERQSRPPLAAEVLRAYCASRGYVASSGLPDETKAARQ  451

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+ GKLPHF MPPGM  E+ + +       D  +  G                   
Sbjct  452  ILKDYIGGKLPHFAMPPGMTEEKIEDDTGRETGSDSEEGEGDE--------------EGS  497

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQN-DG  257
            E  P +D +L+DL +FD+ NGLA++ K TVKK+   A HKQHKKPQ+KKDR+WRV+N + 
Sbjct  498  EQVPGIDDVLDDLTSFDLANGLASTKKVTVKKES--ASHKQHKKPQRKKDRNWRVKNTEE  555

Query  256  GDGMPAVRVLQKPVNTGPLNI  194
            GDGMP VRV QKP NTGPL +
Sbjct  556  GDGMPLVRVFQKPANTGPLTM  576



>gb|KHN36506.1| Large subunit GTPase 1 like [Glycine soja]
Length=573

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 134/200 (67%), Gaps = 21/200 (11%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A++VPR VI ++YKISLPKPKPYEPQSRPPLASELLRAYCASR YV ASGLPDETRAARQ
Sbjct  395  ADKVPRHVIEEIYKISLPKPKPYEPQSRPPLASELLRAYCASRRYVTASGLPDETRAARQ  454

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGKLPH+EMPP M N E              +D    L                
Sbjct  455  ILKDYIDGKLPHYEMPPAMSNVELYSVNLHGSVSSGTEDVDGKL----------------  498

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
              AP  + +L+DLN+FD+ NGL  S++ T+KK    A H  H+KPQ+KKDRS R +N+  
Sbjct  499  --APDFEQVLDDLNSFDMANGL-VSNEVTIKK--ADASHNHHRKPQRKKDRSQRTENNDA  553

Query  253  DGMPAVRVLQKPVNTGPLNI  194
            DGMP VR LQKP+NT  + +
Sbjct  554  DGMPVVRFLQKPINTSYVKV  573



>ref|XP_004506231.1| PREDICTED: large subunit GTPase 1 homolog isoform X2 [Cicer arietinum]
Length=590

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 145/203 (71%), Gaps = 13/203 (6%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR  + ++YKISLPKPK YE QSRPPLASELLR YCASRG+VA+SGLPDETRAARQ
Sbjct  398  ANRVPRHALEEIYKISLPKPKSYESQSRPPLASELLRTYCASRGHVASSGLPDETRAARQ  457

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGKLPH+EMPP + N+E   E+               L + DSS +ED S  E 
Sbjct  458  ILKDYIDGKLPHYEMPPDVSNQELASEDPNEHDQV-------GLHESDSSGIEDSSDVET  510

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWR---VQN  263
            E AP L+H+L+DL++FDI NGL AS+K  VKK  ++   K HKKPQ+KKDRSWR     N
Sbjct  511  ELAPKLEHVLDDLSSFDIANGL-ASNKVAVKK--SKESQKHHKKPQRKKDRSWRAGKAGN  567

Query  262  DGGDGMPAVRVLQKPVNTGPLNI  194
            D  DGMP  R  QKPVN GPL +
Sbjct  568  DDTDGMPIARFHQKPVNAGPLKV  590



>ref|XP_010685450.1| PREDICTED: large subunit GTPase 1 homolog [Beta vulgaris subsp. 
vulgaris]
Length=596

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 147/198 (74%), Gaps = 6/198 (3%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A++VPR  I +VYKI+LPKPK YE QSRPPLASELLRAYCASRGY ++SGLPDETRAARQ
Sbjct  403  ADKVPRYAIEEVYKITLPKPKSYESQSRPPLASELLRAYCASRGYTSSSGLPDETRAARQ  462

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            +LKDY+DGKLPHFE+PPGM +EE   + +A       D          SSD ED S    
Sbjct  463  MLKDYIDGKLPHFELPPGMSDEESKEKNEAYTAFGLSDIDESD-----SSDAEDSSAELE  517

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
            E  P L+ ++NDL +FD+ NGLAA  KA VKKKP +APHK H+KPQ+KKDR+WRV ND G
Sbjct  518  ETGPGLEDVMNDLVSFDLANGLAA-EKANVKKKPPKAPHKLHRKPQRKKDRTWRVGNDNG  576

Query  253  DGMPAVRVLQKPVNTGPL  200
            DGMP  R  QKPVNTGPL
Sbjct  577  DGMPLARAFQKPVNTGPL  594



>ref|XP_006303811.1| hypothetical protein CARUB_v10012258mg [Capsella rubella]
 gb|EOA36709.1| hypothetical protein CARUB_v10012258mg [Capsella rubella]
Length=589

 Score =   192 bits (487),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 143/201 (71%), Gaps = 10/201 (5%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A++VPR+VI  VY ISLPKPK YE QSRPP A+ELL++YCASRGYVA+SGLPDET+AAR 
Sbjct  397  ADKVPRRVIESVYNISLPKPKTYERQSRPPHAAELLKSYCASRGYVASSGLPDETKAARL  456

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+ GKLPH+ MPPGM               +D  + G  L   +S D      +E 
Sbjct  457  ILKDYIGGKLPHYAMPPGMTQ-------GDEPDVEDTQELGDILEGSESEDSAAGDETES  509

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQN-DG  257
            E  P +D +L+DL++FD+ NGL +S K T KK+   A HKQHKKPQ+KKDR+WRVQN + 
Sbjct  510  EQVPGIDDVLDDLSSFDLANGLKSSKKVTAKKQT--ASHKQHKKPQRKKDRTWRVQNTED  567

Query  256  GDGMPAVRVLQKPVNTGPLNI  194
            GDGMPAV+V QKP NTGPL +
Sbjct  568  GDGMPAVKVFQKPANTGPLTM  588



>ref|XP_004506230.1| PREDICTED: large subunit GTPase 1 homolog isoform X1 [Cicer arietinum]
Length=659

 Score =   192 bits (489),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 145/203 (71%), Gaps = 13/203 (6%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR  + ++YKISLPKPK YE QSRPPLASELLR YCASRG+VA+SGLPDETRAARQ
Sbjct  467  ANRVPRHALEEIYKISLPKPKSYESQSRPPLASELLRTYCASRGHVASSGLPDETRAARQ  526

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGKLPH+EMPP + N+E   E+               L + DSS +ED S  E 
Sbjct  527  ILKDYIDGKLPHYEMPPDVSNQELASEDPNEHDQV-------GLHESDSSGIEDSSDVET  579

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWR---VQN  263
            E AP L+H+L+DL++FDI NGL AS+K  VKK  ++   K HKKPQ+KKDRSWR     N
Sbjct  580  ELAPKLEHVLDDLSSFDIANGL-ASNKVAVKK--SKESQKHHKKPQRKKDRSWRAGKAGN  636

Query  262  DGGDGMPAVRVLQKPVNTGPLNI  194
            D  DGMP  R  QKPVN GPL +
Sbjct  637  DDTDGMPIARFHQKPVNAGPLKV  659



>ref|NP_172317.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
 sp|Q9SJF1.1|LSG12_ARATH RecName: Full=GTPase LSG1-2; Short=AtLSG1-2; AltName: Full=DAR 
GTPase 7; AltName: Full=Protein YEAST LSG1 ORTHOLOG 2 [Arabidopsis 
thaliana]
 gb|AAF22888.1|AC006932_5 T27G7.9 [Arabidopsis thaliana]
 gb|AAY56435.1| At1g08410 [Arabidopsis thaliana]
 gb|ABO38780.1| At1g08410 [Arabidopsis thaliana]
 gb|AEE28286.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
Length=589

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 147/201 (73%), Gaps = 10/201 (5%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A++VPR+VI  VY ISLPKPK YE QSRPP A+ELL++YCASRGYVA+SGLPDET+AAR 
Sbjct  397  ADKVPRRVIESVYNISLPKPKTYERQSRPPHAAELLKSYCASRGYVASSGLPDETKAARL  456

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+ GKLPH+ MPPGMP  +E   ED  + +D        L   +S D      +E 
Sbjct  457  ILKDYIGGKLPHYAMPPGMPQADEPDIEDTQELEDI-------LEGSESDDSAVGDETEN  509

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQN-DG  257
            E  P +D +L+DL++FD+ NGL +S K T KK+   A HKQHKKPQ+KKDR+WRVQN + 
Sbjct  510  EQVPGIDDVLDDLSSFDLANGLKSSKKVTAKKQT--ASHKQHKKPQRKKDRTWRVQNTED  567

Query  256  GDGMPAVRVLQKPVNTGPLNI  194
            GDGMP+V+V QKP NTGPL +
Sbjct  568  GDGMPSVKVFQKPANTGPLTM  588



>gb|EYU26033.1| hypothetical protein MIMGU_mgv1a003132mg [Erythranthe guttata]
Length=605

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 154/202 (76%), Gaps = 7/202 (3%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR  I  VY+ISLPKP+ YE QSR PLA E LR+YCASRGYVA+SGLPDET+AARQ
Sbjct  405  ANRVPRAAIEGVYRISLPKPRSYEKQSRAPLAVEFLRSYCASRGYVASSGLPDETKAARQ  464

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGKLPHF+MPPG+ N+E+D + +++ + +D D         D  + E+    E 
Sbjct  465  ILKDYIDGKLPHFQMPPGISNDEDDEKHESSYSSNDDDFDDDF---DDVDEDEEDDEEEE  521

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATV----KKKPTRAphkqhkkpqkkKDRSWRVQ  266
            ED P L+++LNDL++FDI NGLA ++KA      KK  + APHKQHKKPQ+KKDR+WRV+
Sbjct  522  EDGPGLENVLNDLSSFDIDNGLAPTTKAAATAVRKKAASIAPHKQHKKPQRKKDRTWRVK  581

Query  265  NDGGDGMPAVRVLQKPVNTGPL  200
            N+GGDGMP VRV QKPVNT PL
Sbjct  582  NNGGDGMPIVRVFQKPVNTAPL  603



>ref|XP_010101993.1| Large subunit GTPase 1-like protein [Morus notabilis]
 gb|EXB91213.1| Large subunit GTPase 1-like protein [Morus notabilis]
Length=580

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 143/188 (76%), Gaps = 14/188 (7%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR VI DVYKI LPKPKPYEPQSRPPLA ELLR YCASRGYVA+SGLPDETRAARQ
Sbjct  407  ANRVPRHVIEDVYKIKLPKPKPYEPQSRPPLAIELLRTYCASRGYVASSGLPDETRAARQ  466

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGKLPH++MPPGM + E+     +               + DSSDVE+    E 
Sbjct  467  ILKDYIDGKLPHYQMPPGMLDSEDTVVNSSV-----------DTHESDSSDVENAPADED  515

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
            ++  +++H+L+DLN+FD+ +GL AS KATV +KPT   HKQHKKPQ+KKDRSWRV NDGG
Sbjct  516  KNPSNIEHVLDDLNSFDMAHGL-ASKKATV-QKPT-PSHKQHKKPQRKKDRSWRVGNDGG  572

Query  253  DGMPAVRV  230
            DGMP  RV
Sbjct  573  DGMPVFRV  580



>ref|XP_002889691.1| GTP-binding family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65950.1| GTP-binding family protein [Arabidopsis lyrata subsp. lyrata]
Length=583

 Score =   190 bits (482),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 145/201 (72%), Gaps = 10/201 (5%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A++VPR+VI  VY ISLPKPK YE QSRPP A+ELLR+YCASRGYVA+SGLPDET+AAR 
Sbjct  391  ADKVPRRVIESVYNISLPKPKTYERQSRPPHAAELLRSYCASRGYVASSGLPDETKAARL  450

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+ GKLPH+ MPPGM   +E   ED  + +D        L   +S D      +E 
Sbjct  451  ILKDYIGGKLPHYAMPPGMTQGDEADIEDTEELEDI-------LEGSESEDSTVGDETES  503

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQN-DG  257
            E  P +D +L+DL++FD+ NGL +S K T KK+   A HKQHKKPQ+KKDR+WRVQN + 
Sbjct  504  EQVPGIDAVLDDLSSFDLANGLKSSKKVTAKKQT--ASHKQHKKPQRKKDRTWRVQNTED  561

Query  256  GDGMPAVRVLQKPVNTGPLNI  194
            GDGMP V+V QKP NTGPL +
Sbjct  562  GDGMPMVKVFQKPANTGPLTM  582



>ref|XP_007132503.1| hypothetical protein PHAVU_011G099700g [Phaseolus vulgaris]
 gb|ESW04497.1| hypothetical protein PHAVU_011G099700g [Phaseolus vulgaris]
Length=586

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 140/198 (71%), Gaps = 10/198 (5%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A+RVPR  I  +YKI LPKPKPYE QSRPPLASELLRAYCASRGYV +SGLPDETRA RQ
Sbjct  397  ADRVPRDAIEQIYKIRLPKPKPYESQSRPPLASELLRAYCASRGYVGSSGLPDETRATRQ  456

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGKLPH+EMPPG   EE+  E+               L   DSSDVED S  E 
Sbjct  457  ILKDYIDGKLPHYEMPPGTSEEEQALEDPTRHDSV-------DLHASDSSDVEDSSDVES  509

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
              AP+L+H+L+DL++FD+ NGLA   K+T  KKP +  HK HKKPQ+KKDR+WR  N   
Sbjct  510  GVAPNLEHVLDDLSSFDMANGLAP--KSTTLKKP-KESHKHHKKPQRKKDRTWRTGNTDA  566

Query  253  DGMPAVRVLQKPVNTGPL  200
            DGMP  R  QKP NTG L
Sbjct  567  DGMPIARFFQKPANTGSL  584



>ref|XP_010458077.1| PREDICTED: large subunit GTPase 1 homolog [Camelina sativa]
Length=587

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 140/199 (70%), Gaps = 10/199 (5%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A++VPR+VI  VY ISLPKPK YE QSRPP A+ELLR+YCASR YVA+SGLPDET+AAR 
Sbjct  395  ADKVPRRVIESVYNISLPKPKTYERQSRPPHAAELLRSYCASRSYVASSGLPDETKAARL  454

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+ GKLPH+ MPPGM               DD  + G  L   +S D      +E 
Sbjct  455  ILKDYIGGKLPHYTMPPGMTQ-------GDEPDIDDTQELGDILEGSESEDSAVGDETES  507

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQN-DG  257
            E  P +D +L+DL++FD+ NGL +S K T KK+   A HKQHKKPQ+KKDR+WRVQN + 
Sbjct  508  EQVPGIDDVLDDLSSFDLANGLKSSKKETAKKQT--ASHKQHKKPQRKKDRTWRVQNTED  565

Query  256  GDGMPAVRVLQKPVNTGPL  200
            GDGMP V+V QKP NTGPL
Sbjct  566  GDGMPVVKVFQKPANTGPL  584



>gb|KHN21198.1| Large subunit GTPase 1 [Glycine soja]
Length=576

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 143/203 (70%), Gaps = 11/203 (5%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A+RVPR VI ++YKI LPKPK YE QSRPPLASELLRAYC SRGYVA+SGLPDETRAARQ
Sbjct  381  ADRVPRHVIEEIYKIRLPKPKSYESQSRPPLASELLRAYCTSRGYVASSGLPDETRAARQ  440

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            +LKDY+DGKLPH++MPPG  +EE+  EE A             L   DSS +ED S  E 
Sbjct  441  MLKDYIDGKLPHYQMPPGASDEEQALEEPAGHDSV-------DLDASDSSAIEDASDVES  493

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWR---VQN  263
            E AP+L+H+L DLN+FD+ NGLA  +  TVKK    +    HKKPQ+KKDRSWR     N
Sbjct  494  ELAPNLEHVLVDLNSFDMANGLAPKNTTTVKKP-KASHKHHHKKPQRKKDRSWRAGKAGN  552

Query  262  DGGDGMPAVRVLQKPVNTGPLNI  194
            +  DGMP  R  QKP NTGPL +
Sbjct  553  EDADGMPVARFFQKPANTGPLKV  575



>ref|XP_003539853.1| PREDICTED: large subunit GTPase 1 homolog [Glycine max]
Length=598

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 143/203 (70%), Gaps = 11/203 (5%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A+RVPR VI ++YKI LPKPK YE QSRPPLASELLRAYC SRGYVA+SGLPDETRAARQ
Sbjct  403  ADRVPRHVIEEIYKIRLPKPKSYESQSRPPLASELLRAYCTSRGYVASSGLPDETRAARQ  462

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            +LKDY+DGKLPH++MPPG  +EE+  EE A             L   DSS +ED S  E 
Sbjct  463  MLKDYIDGKLPHYQMPPGASDEEQALEEPAGHDSV-------DLDASDSSAIEDASDVES  515

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWR---VQN  263
            E AP+L+H+L DLN+FD+ NGLA  +  TVKK    +    HKKPQ+KKDRSWR     N
Sbjct  516  ELAPNLEHVLVDLNSFDMANGLAPKNTTTVKKP-KASHKHHHKKPQRKKDRSWRAGKAGN  574

Query  262  DGGDGMPAVRVLQKPVNTGPLNI  194
            +  DGMP  R  QKP NTGPL +
Sbjct  575  EDADGMPVARFFQKPANTGPLKV  597



>emb|CDP15565.1| unnamed protein product [Coffea canephora]
Length=561

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 143/198 (72%), Gaps = 23/198 (12%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR++I DVY ISLPKPK YE Q+RPPLASELLR YCASRGYVAASGLPDETRAARQ
Sbjct  385  ANRVPRQMIEDVYNISLPKPKSYELQTRPPLASELLRTYCASRGYVAASGLPDETRAARQ  444

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGKLPH+E+PPGM NEE   ++       D  ++  S       D E+PSVSE 
Sbjct  445  ILKDYIDGKLPHYELPPGMANEETAMKDTVGICLSDTYESDSS-------DAENPSVSEH  497

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
            ED PSL+H+LNDLN+FDI NGL++      KKKP+ APHKQHKKPQ+KKDR+WR      
Sbjct  498  EDGPSLEHVLNDLNSFDIANGLSSVQGQVKKKKPSTAPHKQHKKPQRKKDRTWR------  551

Query  253  DGMPAVRVLQKPVNTGPL  200
                      KPVN GPL
Sbjct  552  ----------KPVNAGPL  559



>ref|XP_007222281.1| hypothetical protein PRUPE_ppa003303mg [Prunus persica]
 gb|EMJ23480.1| hypothetical protein PRUPE_ppa003303mg [Prunus persica]
Length=586

 Score =   186 bits (473),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 138/188 (73%), Gaps = 13/188 (7%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR VI +VY+I LPKPK YE QSRPPLA+E LRAYCASRGYVA+SGLPDETRAARQ
Sbjct  395  ANRVPRHVIEEVYRIDLPKPKSYELQSRPPLAAEFLRAYCASRGYVASSGLPDETRAARQ  454

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGKLPH++MPPGM NEE+  E   ++  +       +           P+ +E 
Sbjct  455  ILKDYIDGKLPHYQMPPGMSNEEDVAEHSLSEQHESDASDNEN-----------PADAEG  503

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
            E+ P LDH L+DLN+FDI NGLA   K T  KKPT A HKQHKKPQ+KKDR+WRV NDGG
Sbjct  504  ENVPELDHALDDLNSFDIANGLATKKKVT-VKKPT-ASHKQHKKPQRKKDRTWRVGNDGG  561

Query  253  DGMPAVRV  230
            DGMP  R 
Sbjct  562  DGMPVARC  569



>ref|XP_008787774.1| PREDICTED: LOW QUALITY PROTEIN: large subunit GTPase 1 homolog 
[Phoenix dactylifera]
Length=610

 Score =   186 bits (473),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 134/197 (68%), Gaps = 5/197 (3%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            AN+VPR V+   Y I+LPKPKPYEPQSRPPLASELLRAYC+SRGYV++SGLPDETRAARQ
Sbjct  405  ANKVPRHVVESTYNITLPKPKPYEPQSRPPLASELLRAYCSSRGYVSSSGLPDETRAARQ  464

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGKLPHFEMPPG     +   + A          G  L+   S D  D   S  
Sbjct  465  ILKDYIDGKLPHFEMPPGTTG-RDAEGDSAHGLVSPSLLVGHELNIMQSDDCNDQISSNS  523

Query  433  eDAPS----LDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQ  266
                +    + H+L+DL +F+++  L + + A VK+K +    K HKKPQ+KKDRSWRV 
Sbjct  524  TVVDTGKVDVGHVLDDLESFELSGELYSKNSAAVKQKKSGKTEKHHKKPQRKKDRSWRVG  583

Query  265  NDGGDGMPAVRVLQKPV  215
            ND GDGMP VRV+QKP 
Sbjct  584  NDNGDGMPVVRVIQKPT  600



>gb|KFK43162.1| hypothetical protein AALP_AA1G087900 [Arabis alpina]
Length=590

 Score =   186 bits (472),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 145/201 (72%), Gaps = 11/201 (5%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A++VPR VI  VY ISLPKPKPYE QSRPP ASELLRA+CASRGYVA+SGLPDET+AAR 
Sbjct  399  ADKVPRHVIESVYNISLPKPKPYERQSRPPHASELLRAFCASRGYVASSGLPDETKAARM  458

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+ GKLPHF +PPGM  ++E   ED  +T         +L   DS D      +E 
Sbjct  459  ILKDYIGGKLPHFALPPGMTKDDEPEIEDTPETG--------TLEGSDSEDSTVEDETES  510

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQN-DG  257
            E  P ++ +L+DL++FD+ NGL +S K   KK+   A HKQHKKPQ+KKDR+WRV+N + 
Sbjct  511  EQVPGINDVLDDLSSFDLANGLKSSKKEMAKKQT--ASHKQHKKPQRKKDRTWRVKNTED  568

Query  256  GDGMPAVRVLQKPVNTGPLNI  194
            GDGMP V+V QKP NTGPL +
Sbjct  569  GDGMPVVKVYQKPANTGPLKM  589



>ref|XP_010557448.1| PREDICTED: large subunit GTPase 1 homolog [Tarenaya hassleriana]
Length=581

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 146/203 (72%), Gaps = 16/203 (8%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A+RVPR ++ +VY I+LPKPKPYEPQSRPPLA+ELLR YCASRGYVA+SGLPDETRAARQ
Sbjct  391  ADRVPRNIVENVYNITLPKPKPYEPQSRPPLAAELLRTYCASRGYVASSGLPDETRAARQ  450

Query  613  ILKDYVDGKLPHFEMPPG-MPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvse  437
            ILKDY+DGKLPHF MPPG  P  E+    +  D  +  D AG                +E
Sbjct  451  ILKDYIDGKLPHFAMPPGNKPEVEDTRGSETDDGSEPEDSAGDE-----------DEAAE  499

Query  436  leDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDG  257
             +    LD++L+DL++FD+ NGLA+S K +VKKKP    HKQHKKPQ+KKDR+WR  N G
Sbjct  500  QQQPQVLDNVLDDLSSFDLANGLASSKKVSVKKKP--ESHKQHKKPQRKKDRTWRAGNVG  557

Query  256  --GDGMPAVRVLQKPVNTGPLNI  194
              GDGMP VRV QKP NTGPL +
Sbjct  558  EDGDGMPVVRVFQKPANTGPLKM  580



>ref|XP_010941628.1| PREDICTED: large subunit GTPase 1 homolog [Elaeis guineensis]
Length=609

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 137/202 (68%), Gaps = 17/202 (8%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            AN++PR V+  +Y I+LPKPKPYEPQSRPPLASELLRAYC+SRGYV++SGLPDET+AARQ
Sbjct  404  ANKIPRHVVESIYNITLPKPKPYEPQSRPPLASELLRAYCSSRGYVSSSGLPDETKAARQ  463

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGKLPHFEMPPG            A+ D      GPSL   + SD+        
Sbjct  464  ILKDYIDGKLPHFEMPPGATG-------RGAEGDSVHGLVGPSLLAGNESDIAQSDDCND  516

Query  433  eDAPS----------LDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKD  284
            + + S          +  +L+DL +FD++  L + + A VK+K +  P K HKKPQ+KKD
Sbjct  517  QISSSSALVDTGKVDVGRVLDDLESFDLSGELYSKTSAIVKQKKSAKPEKHHKKPQRKKD  576

Query  283  RSWRVQNDGGDGMPAVRVLQKP  218
            RSWRV ND GDGMP VR+ QKP
Sbjct  577  RSWRVGNDNGDGMPVVRMFQKP  598



>ref|XP_003605987.1| Large subunit GTPase-like protein [Medicago truncatula]
 gb|AES88184.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=589

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 139/203 (68%), Gaps = 13/203 (6%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR VI ++Y ISLPKPK YE QSRPPLASELLR YCASRG   +SGLPDETRA+RQ
Sbjct  397  ANRVPRHVIEEIYNISLPKPKSYESQSRPPLASELLRTYCASRGQTTSSGLPDETRASRQ  456

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGKLPH+EMPPG+  +E   E+       +   +  S       D+ED SV E 
Sbjct  457  ILKDYIDGKLPHYEMPPGLSTQELASEDSNEHDQVNPHVSDAS-------DIEDSSVVET  509

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQN---  263
            E AP L+H+L+DL++FD+ NGLA++    V  K T+   K H+KP + K+RSWR  N   
Sbjct  510  ELAPKLEHVLDDLSSFDMANGLASNK---VAPKKTKESQKHHRKPPRTKNRSWRAGNAGK  566

Query  262  DGGDGMPAVRVLQKPVNTGPLNI  194
            D  DGMP  R  QKPVN+GPL +
Sbjct  567  DDTDGMPIARFHQKPVNSGPLKV  589



>ref|XP_010488823.1| PREDICTED: large subunit GTPase 1 homolog [Camelina sativa]
Length=587

 Score =   183 bits (465),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 114/199 (57%), Positives = 138/199 (69%), Gaps = 10/199 (5%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A++VPR+VI  VY ISLPKPK YE QSRPP A+ELLR+YCASR YVA+SGLPDET+AAR 
Sbjct  395  ADKVPRRVIESVYNISLPKPKTYERQSRPPHAAELLRSYCASRSYVASSGLPDETKAARL  454

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+ GKLPH+ MPP M               +D  + G  L   +S D      +E 
Sbjct  455  ILKDYIGGKLPHYAMPPEMTK-------GDEPDIEDDQELGDILEGSESEDSAVGDETES  507

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQN-DG  257
            E  P +D +L+DL++FD+ NGL  S K T KK+   A HKQHKKPQ+KKDR+WRVQN + 
Sbjct  508  EQVPGIDDVLDDLSSFDLANGLKPSKKETAKKQT--ASHKQHKKPQRKKDRTWRVQNTED  565

Query  256  GDGMPAVRVLQKPVNTGPL  200
            GDGMP V+V QKP NTGPL
Sbjct  566  GDGMPVVKVFQKPANTGPL  584



>ref|XP_010475638.1| PREDICTED: large subunit GTPase 1 homolog [Camelina sativa]
Length=588

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 138/202 (68%), Gaps = 11/202 (5%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A++VPR+VI  VY ISLPKPK YE QSRPP A+ELL++YCASR YVA+SGLPDET+AAR 
Sbjct  395  ADKVPRRVIESVYNISLPKPKTYERQSRPPHAAELLKSYCASRSYVASSGLPDETKAARL  454

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLs-dhdssdvedpsvse  437
            ILKDY+ GKLPH+ MPPGM               DD  + G  L       D      +E
Sbjct  455  ILKDYIGGKLPHYTMPPGMTQ-------GDEPDIDDTQELGDILEGSESEEDSAVGDETE  507

Query  436  leDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQN-D  260
             E  P +D +L+DL++FD+ NGL  S K T KK+   A HKQHKKPQ+KKDR+WRVQN +
Sbjct  508  SEQVPGIDDVLDDLSSFDLANGLKPSKKETAKKQT--ASHKQHKKPQRKKDRTWRVQNTE  565

Query  259  GGDGMPAVRVLQKPVNTGPLNI  194
             GDGMP V+V QKP NTGPL +
Sbjct  566  DGDGMPVVKVFQKPANTGPLTM  587



>ref|XP_008219226.1| PREDICTED: large subunit GTPase 1 homolog [Prunus mume]
Length=572

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 138/188 (73%), Gaps = 13/188 (7%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR VI +VY+I LPKPK YE QSRPPLA+E +RAYCASRGYVA+SGLPDETRAARQ
Sbjct  381  ANRVPRHVIEEVYRIDLPKPKSYELQSRPPLAAEFMRAYCASRGYVASSGLPDETRAARQ  440

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGKLPH+++PPGM +EE+  E   ++  +       +           P+ +E 
Sbjct  441  ILKDYIDGKLPHYQIPPGMTDEEDVVEHSLSEQHESDASDNEN-----------PADAEG  489

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
            E+ P LDH L+DLN+FDI NGLA   K T  KKPT A HKQHKKPQ+KKDR+WRV NDGG
Sbjct  490  ENVPELDHALDDLNSFDIANGLATKKKVT-VKKPT-ASHKQHKKPQRKKDRTWRVGNDGG  547

Query  253  DGMPAVRV  230
            DGMP  R 
Sbjct  548  DGMPVARC  555



>gb|EMS49812.1| hypothetical protein TRIUR3_12331 [Triticum urartu]
Length=307

 Score =   174 bits (442),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 133/200 (67%), Gaps = 11/200 (6%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A+RVPR V+  +YKI+LPKPKPYEPQSRPP A+ELLRAYCASRG+V+  GLPDETRAARQ
Sbjct  108  ADRVPRDVLEQIYKITLPKPKPYEPQSRPPTAAELLRAYCASRGHVSHGGLPDETRAARQ  167

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdss-dvedpsvse  437
            ILKDY+DGK+PH+E+PPG+       +E            GP+ S  D S   +     +
Sbjct  168  ILKDYIDGKIPHYELPPGV----VTDDEVETRESTVAAAEGPTASAVDESGSDDSDEQDD  223

Query  436  leDAPSLDHILNDLNTFDITNGLAAS--SKATVKKKPTRAphkqhkkpqkkKDRSWRVQN  263
            +   P +  +L+DL +FD    LAAS  S AT KKK  +A  KQH+KPQ+KKDRSWR  N
Sbjct  224  MTGGPDMRQLLSDLESFD----LAASEGSNATGKKKQHQASQKQHRKPQRKKDRSWRASN  279

Query  262  DGGDGMPAVRVLQKPVNTGP  203
            DG DG   VR  QKP  + P
Sbjct  280  DGSDGTAVVRDFQKPTVSHP  299



>ref|XP_003538087.1| PREDICTED: large subunit GTPase 1 homolog [Glycine max]
Length=594

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 137/198 (69%), Gaps = 8/198 (4%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A+RVPR VI ++YKI LPKPK YE QSRPPLASELLRAYC SRGYVA+SGLPDETRAAR 
Sbjct  402  ADRVPRHVIEEIYKIRLPKPKSYESQSRPPLASELLRAYCTSRGYVASSGLPDETRAARL  461

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            +LKDY DGKLPH++ PPG  +EE+  EE A             L   DSS  E+ S  + 
Sbjct  462  MLKDYTDGKLPHYQKPPGASDEEQALEEPAGHDLV-------DLDASDSSGTEESSDDKS  514

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
            E AP+L+H+L+DLN+FD+ NGLA  +  TVKK    +    HKKPQ+ K+RSWR  N+  
Sbjct  515  ELAPNLEHVLDDLNSFDMANGLAPKNITTVKKP-KASHKHHHKKPQRTKNRSWRAGNEDA  573

Query  253  DGMPAVRVLQKPVNTGPL  200
            DGMP  R  QK  NTGP+
Sbjct  574  DGMPVARFFQKAANTGPM  591



>gb|KHN30244.1| Large subunit GTPase 1 like [Glycine soja]
Length=572

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 137/198 (69%), Gaps = 8/198 (4%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A+RVPR VI ++YKI LPKPK YE QSRPPLASELLRAYC SRGYVA+SGLPDETRAAR 
Sbjct  380  ADRVPRHVIEEIYKIRLPKPKSYESQSRPPLASELLRAYCTSRGYVASSGLPDETRAARL  439

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            +LKDY DGKLPH++ PPG  +EE+  EE A             L   DSS  E+ S  + 
Sbjct  440  MLKDYTDGKLPHYQKPPGASDEEQALEEPAGHDLV-------DLDASDSSGTEESSDDKS  492

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
            E AP+L+H+L+DLN+FD+ NGLA  +  TVKK    +    HKKPQ+ K+RSWR  N+  
Sbjct  493  ELAPNLEHVLDDLNSFDMANGLAPKNITTVKKP-KASHKHHHKKPQRTKNRSWRAGNEDA  551

Query  253  DGMPAVRVLQKPVNTGPL  200
            DGMP  R  QK  NTGP+
Sbjct  552  DGMPVARFFQKAANTGPM  569



>gb|AAD41267.1| unknown [Zea mays]
Length=444

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 140/201 (70%), Gaps = 9/201 (4%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A+RVPR ++  +YKI+LPKPKPYEPQSRPP A+ELLRAYCASRG+V+ +GLPDETRAARQ
Sbjct  248  ADRVPRDILEQIYKIALPKPKPYEPQSRPPTAAELLRAYCASRGHVSHAGLPDETRAARQ  307

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGK+PHFE+PPG+   E D E+ A         A  S++D    + +D      
Sbjct  308  ILKDYIDGKIPHFELPPGVTGPEVDFEQIAGSESPTTSAANESVTDDLDEEDDDAVDPAE  367

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
                ++  +L+DL +FD+ NG    SK T KKK   A HK HKKPQ+KKDRSWRV NDGG
Sbjct  368  S---NMRDVLDDLESFDLGNG---GSKTTAKKK--EASHKHHKKPQRKKDRSWRVGNDGG  419

Query  253  DGMPAVRVLQKP-VNTGPLNI  194
            DG   VRV QKP VN   +++
Sbjct  420  DGTAVVRVYQKPAVNLSTVSL  440



>tpg|DAA47546.1| TPA: hypothetical protein ZEAMMB73_195112 [Zea mays]
Length=596

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 140/201 (70%), Gaps = 9/201 (4%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A+RVPR ++  +YKI+LPKPKPYEPQSRPP A+ELLRAYCASRG+V+ +GLPDETRAARQ
Sbjct  400  ADRVPRDILEQIYKIALPKPKPYEPQSRPPTAAELLRAYCASRGHVSHAGLPDETRAARQ  459

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGK+PHFE+PPG+   E D E+ A         A  S++D    + +D      
Sbjct  460  ILKDYIDGKIPHFELPPGVTGPEVDFEQIAGSESPTTSAANESVTDDLDEEDDDAVDPAE  519

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
                ++  +L+DL +FD+ NG    SK T KKK   A HK HKKPQ+KKDRSWRV NDGG
Sbjct  520  S---NMRDVLDDLESFDLGNG---GSKTTAKKK--EASHKHHKKPQRKKDRSWRVGNDGG  571

Query  253  DGMPAVRVLQKP-VNTGPLNI  194
            DG   VRV QKP VN   +++
Sbjct  572  DGTAVVRVYQKPAVNLSTVSL  592



>ref|XP_009407721.1| PREDICTED: large subunit GTPase 1 homolog isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=609

 Score =   175 bits (444),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 129/192 (67%), Gaps = 0/192 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR V+  VY I+LPKPK YE QSRPPL+SELLR YC+SRGYV++SGLPDETRAARQ
Sbjct  406  ANRVPRNVLESVYNITLPKPKAYEAQSRPPLSSELLRTYCSSRGYVSSSGLPDETRAARQ  465

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDYVDGKLPHFE+PPG   E+ +        D +        +               
Sbjct  466  ILKDYVDGKLPHFELPPGAETEDVEVNATDDMVDPNFLTDNEPDACDSDEATISDITGVD  525

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
                +L + LNDL +FD+ + L+++  A  KKK + + HK HKKPQ+KKDRSWRV+ND G
Sbjct  526  AREHALSNALNDLESFDLASELSSNKAAAAKKKSSDSTHKHHKKPQRKKDRSWRVENDDG  585

Query  253  DGMPAVRVLQKP  218
            DGMP VRV QKP
Sbjct  586  DGMPVVRVFQKP  597



>ref|XP_009407722.1| PREDICTED: large subunit GTPase 1 homolog isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=607

 Score =   175 bits (444),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 129/192 (67%), Gaps = 0/192 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR V+  VY I+LPKPK YE QSRPPL+SELLR YC+SRGYV++SGLPDETRAARQ
Sbjct  404  ANRVPRNVLESVYNITLPKPKAYEAQSRPPLSSELLRTYCSSRGYVSSSGLPDETRAARQ  463

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDYVDGKLPHFE+PPG   E+ +        D +        +               
Sbjct  464  ILKDYVDGKLPHFELPPGAETEDVEVNATDDMVDPNFLTDNEPDACDSDEATISDITGVD  523

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
                +L + LNDL +FD+ + L+++  A  KKK + + HK HKKPQ+KKDRSWRV+ND G
Sbjct  524  AREHALSNALNDLESFDLASELSSNKAAAAKKKSSDSTHKHHKKPQRKKDRSWRVENDDG  583

Query  253  DGMPAVRVLQKP  218
            DGMP VRV QKP
Sbjct  584  DGMPVVRVFQKP  595



>gb|ACG45515.1| GTP binding protein [Zea mays]
Length=596

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 140/202 (69%), Gaps = 11/202 (5%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A+RVPR ++  +YKI+LPKPKPYEPQSRPP A+ELLRAYCASRG+V+ +GLPDETRAARQ
Sbjct  400  ADRVPRDILEQIYKIALPKPKPYEPQSRPPTAAELLRAYCASRGHVSHAGLPDETRAARQ  459

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+D K+PHFE+PPG+   E D E+ A         A  S++D    + +D      
Sbjct  460  ILKDYIDVKIPHFELPPGVTGPEVDFEQIAGSESPTTSAANESVTDDLDEEDDDAVDPAE  519

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
                ++  +L+DL +FD+ NG    SK T KKK   A HK HKKPQ+KKDRSWRV NDGG
Sbjct  520  S---NMRDVLDDLESFDLGNG---GSKTTAKKK--EASHKHHKKPQRKKDRSWRVGNDGG  571

Query  253  DGMPAVRVLQKP---VNTGPLN  197
            DG   VRV QKP   ++TG L+
Sbjct  572  DGTAVVRVYQKPAVNLSTGSLS  593



>ref|NP_001067291.1| Os12g0618300 [Oryza sativa Japonica Group]
 gb|ABA99879.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF30310.1| Os12g0618300 [Oryza sativa Japonica Group]
 gb|EAY83917.1| hypothetical protein OsI_39140 [Oryza sativa Indica Group]
 gb|EAZ21239.1| hypothetical protein OsJ_36891 [Oryza sativa Japonica Group]
Length=598

 Score =   174 bits (440),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 131/195 (67%), Gaps = 14/195 (7%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A+RVPR V+  +YKI+LPKPKPYE QSRPP A+ELLRAYCASRG+V+ +GLPDETRAARQ
Sbjct  402  ADRVPRSVLEQIYKITLPKPKPYESQSRPPTAAELLRAYCASRGHVSHAGLPDETRAARQ  461

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGK+PHFE+PPGM +          + ++     GP+ S ++ S   D    + 
Sbjct  462  ILKDYIDGKIPHFELPPGMVD-------TENEHEETSGLEGPTTSAYNESGGSDSDERDD  514

Query  433  e---DAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQN  263
                  P + H+L+DL +FD    LA        KK   A HKQHKKPQ+KKDRSWRV N
Sbjct  515  TVDPAQPDMRHVLSDLESFD----LATEGSKPAGKKKKEASHKQHKKPQRKKDRSWRVGN  570

Query  262  DGGDGMPAVRVLQKP  218
            DGGDG   +RV QKP
Sbjct  571  DGGDGTAVLRVYQKP  585



>emb|CBI24436.3| unnamed protein product [Vitis vinifera]
Length=503

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 125/200 (63%), Gaps = 47/200 (24%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR VI DVYKI+LPKPKPYE Q+RPPLASE LRAYCASRGYVA+SGLPDETRAARQ
Sbjct  350  ANRVPRHVIEDVYKITLPKPKPYEQQNRPPLASEFLRAYCASRGYVASSGLPDETRAARQ  409

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGK+PHFEMPPGM +E  + E+ A  +  +  ++  S      S+    S SE 
Sbjct  410  ILKDYIDGKVPHFEMPPGMTDEVSEFEDPAEPSFSETHESDAS-----DSENPPNSESES  464

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
            E AP+L+H+LNDL+ FD+ NGLA+      KK P                          
Sbjct  465  ESAPNLEHVLNDLDAFDMANGLAS------KKAP--------------------------  492

Query  253  DGMPAVRVLQKPVNTGPLNI  194
                      KPVNTGPLN+
Sbjct  493  ----------KPVNTGPLNV  502



>ref|XP_006664755.1| PREDICTED: large subunit GTPase 1 homolog [Oryza brachyantha]
Length=599

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 131/195 (67%), Gaps = 14/195 (7%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A+RVPR V+  +Y+I+LPKPKPYE QSRPP A+ELLRAYCASRG+V+ +GLPDETRAARQ
Sbjct  403  ADRVPRSVLEQIYRITLPKPKPYESQSRPPTAAELLRAYCASRGHVSHAGLPDETRAARQ  462

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssd---vedpsv  443
            ILKDY+DGK+PHFE+PPG  +          + ++     GPS S HD SD    ++   
Sbjct  463  ILKDYIDGKIPHFELPPGTVD-------AEIEHEETTGLEGPSTSAHDESDGSGSDEHDD  515

Query  442  seleDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQN  263
            +     P + H+L+DL +FD    LA        KK   A HKQHKKPQ+KKDRSWRV N
Sbjct  516  TIDSAQPDIRHVLSDLESFD----LATEGSKPAGKKKKEASHKQHKKPQRKKDRSWRVGN  571

Query  262  DGGDGMPAVRVLQKP  218
            DGGDG   VRV Q P
Sbjct  572  DGGDGTAVVRVFQNP  586



>gb|EPS59426.1| hypothetical protein M569_15382, partial [Genlisea aurea]
Length=347

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 128/201 (64%), Gaps = 22/201 (11%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A RVPR VI   Y I+LPKPKPYEP+SRPP ASELLRAYC SRGYVAA GLPDETRAAR 
Sbjct  168  AERVPRSVIEGTYGIALPKPKPYEPRSRPPSASELLRAYCGSRGYVAAGGLPDETRAART  227

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGKL H+EMPP   + + D ++D  D DDD DD   S                 
Sbjct  228  ILKDYIDGKLLHYEMPPEEDDGDHDDDDDGDDVDDDDDDENGS-----------------  270

Query  433  eDAPSLD-HILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDG  257
                 LD  ++ D+ +FD+ NGL    + T  K      HK H+KP +KKDRSWRV+N  
Sbjct  271  ----GLDEEVMGDMRSFDVDNGLVVRKEVTRAKAEKGGAHKMHRKPPRKKDRSWRVKNGD  326

Query  256  GDGMPAVRVLQKPVNTGPLNI  194
            GDGMP VRV +KPVN  P N+
Sbjct  327  GDGMPVVRVFRKPVNIRPSNV  347



>ref|XP_004963198.1| PREDICTED: large subunit GTPase 1 homolog [Setaria italica]
Length=596

 Score =   170 bits (431),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 136/204 (67%), Gaps = 17/204 (8%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A+ VPR ++  +YKI+LPKPKPYE QSRPP A+ELLRAYC+SRG+V+ +GLPDETRAARQ
Sbjct  400  ADHVPRNILEQIYKITLPKPKPYESQSRPPTAAELLRAYCSSRGHVSHAGLPDETRAARQ  459

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGK+PHFE+PPG+ +          + +      GP+ S  + SD +D    + 
Sbjct  460  ILKDYIDGKIPHFELPPGVTD-------IETECEVIAISEGPTTSAANESDADDLDEEDE  512

Query  433  e----DAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQ  266
            +      P +  +L+DL +FD+ N     SK   KKK T   HK HKKPQ+KKDRSWRV 
Sbjct  513  DTADPAEPDMRDVLDDLESFDLAN---EGSKTATKKKET--SHKHHKKPQRKKDRSWRVG  567

Query  265  NDGGDGMPAVRVLQKP-VNTGPLN  197
            NDGGDG   VRV QKP VN   +N
Sbjct  568  NDGGDGTAVVRVFQKPAVNLPAVN  591



>ref|XP_002443580.1| hypothetical protein SORBIDRAFT_08g021890 [Sorghum bicolor]
 gb|EES17418.1| hypothetical protein SORBIDRAFT_08g021890 [Sorghum bicolor]
Length=597

 Score =   167 bits (424),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 127/203 (63%), Gaps = 29/203 (14%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A+RVPR ++  +YKI+LPKPKPYEPQSRP  A+ELLRAYCASRG+V+ +GLPDETRAARQ
Sbjct  400  ADRVPRDILEQIYKITLPKPKPYEPQSRPATAAELLRAYCASRGHVSHAGLPDETRAARQ  459

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGK+PH+E+PPG+ +          D +      GP+ S  + SD +D    + 
Sbjct  460  ILKDYIDGKIPHYELPPGVTD-------SEMDLEQTTGSEGPTTSAANESDADDLDEEDG  512

Query  433  eDA----PSLDHILNDLNTFDITNGLAASSKATV-------KKKPTRAphkqhkkpqkkK  287
            +      P +  +L+DL +FD+ NG + ++            KKP R           KK
Sbjct  513  DTVDPAEPDMRDVLDDLESFDLANGGSKTTAKKKKEASHKHHKKPQR-----------KK  561

Query  286  DRSWRVQNDGGDGMPAVRVLQKP  218
            DRSWRV NDGGDG   VRV QKP
Sbjct  562  DRSWRVGNDGGDGTAVVRVYQKP  584



>gb|KHN17987.1| Large subunit GTPase 1 like [Glycine soja]
Length=549

 Score =   167 bits (422),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 105/152 (69%), Gaps = 19/152 (13%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A++VPR VI ++YKISLPKPKPYEPQSRPPLASELLRAYCASRGYV ASGLPDET+AARQ
Sbjct  395  ADKVPRHVIEEIYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVTASGLPDETKAARQ  454

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGKLPH EMPPGM N E                  P   +   S        + 
Sbjct  455  ILKDYIDGKLPHHEMPPGMSNVE------------------PDPVNLHGSVSSGTEDVDS  496

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKK  338
            + AP  + +L+DLN+FD+ NGL  S++ T+KK
Sbjct  497  KVAPDFEQVLDDLNSFDMANGL-VSNEVTIKK  527



>gb|ABF97888.1| expressed protein [Oryza sativa Japonica Group]
Length=473

 Score =   166 bits (419),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 128/192 (67%), Gaps = 8/192 (4%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR V+  +YKI+LPKPK YE  SRPP A+ELLRAYC SRG+V+ +GLPDETRAARQ
Sbjct  281  ANRVPRNVLEQIYKITLPKPKAYEQLSRPPTAAELLRAYCTSRGHVSHAGLPDETRAARQ  340

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGK+PHFE+PPG  + E D EE       D      +    D    ++      
Sbjct  341  ILKDYLDGKIPHFELPPGDTDSETDPEETTDLEGSDTAVGATA----DHCASDEQDEEIS  396

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
            +  P++ H+L+DL +FD+ + ++ +S     KK   A +K HKKPQ+KKDRSWRV NDG 
Sbjct  397  QADPNISHVLSDLESFDLASEVSKNS----TKKKKEASYKHHKKPQRKKDRSWRVGNDGA  452

Query  253  DGMPAVRVLQKP  218
            DG   VRV QKP
Sbjct  453  DGSAVVRVFQKP  464



>gb|EEC75833.1| hypothetical protein OsI_12814 [Oryza sativa Indica Group]
Length=604

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 128/192 (67%), Gaps = 8/192 (4%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR V+  +YKI+LPKPK YE  SRPP A+ELLRAYC SRG+V+ +GLPDETRAARQ
Sbjct  412  ANRVPRNVLEQIYKITLPKPKAYEQLSRPPTAAELLRAYCTSRGHVSHAGLPDETRAARQ  471

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGK+PHFE+PPG  + E D EE       D      +    D    ++      
Sbjct  472  ILKDYLDGKIPHFELPPGDTDSETDPEETTDLEGSDTAVGATT----DHCASDEQDEEIS  527

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
            +  P++ H+L+DL +FD+ + ++ +S     KK   A +K HKKPQ+KKDRSWRV NDG 
Sbjct  528  QADPNISHVLSDLESFDLASEVSKNS----TKKKKEASYKHHKKPQRKKDRSWRVGNDGA  583

Query  253  DGMPAVRVLQKP  218
            DG   VRV QKP
Sbjct  584  DGSAVVRVFQKP  595



>gb|AAU89192.1| expressed protein [Oryza sativa Japonica Group]
 gb|EEE59592.1| hypothetical protein OsJ_11901 [Oryza sativa Japonica Group]
Length=605

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 128/192 (67%), Gaps = 8/192 (4%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR V+  +YKI+LPKPK YE  SRPP A+ELLRAYC SRG+V+ +GLPDETRAARQ
Sbjct  413  ANRVPRNVLEQIYKITLPKPKAYEQLSRPPTAAELLRAYCTSRGHVSHAGLPDETRAARQ  472

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGK+PHFE+PPG  + E D EE       D      +    D    ++      
Sbjct  473  ILKDYLDGKIPHFELPPGDTDSETDPEETTDLEGSDTAVGATA----DHCASDEQDEEIS  528

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
            +  P++ H+L+DL +FD+ + ++ +S     KK   A +K HKKPQ+KKDRSWRV NDG 
Sbjct  529  QADPNISHVLSDLESFDLASEVSKNS----TKKKKEASYKHHKKPQRKKDRSWRVGNDGA  584

Query  253  DGMPAVRVLQKP  218
            DG   VRV QKP
Sbjct  585  DGSAVVRVFQKP  596



>ref|XP_003561853.1| PREDICTED: large subunit GTPase 1 homolog [Brachypodium distachyon]
Length=602

 Score =   164 bits (416),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 128/192 (67%), Gaps = 9/192 (5%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR+++  VYKI+LPKPK YE  SRPP A+ELLRAYC SRG+V+ +GLPDETRAARQ
Sbjct  407  ANRVPREILEQVYKITLPKPKAYEQASRPPTAAELLRAYCTSRGHVSHAGLPDETRAARQ  466

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGK+PHFE+PPG  +   D E+ +   D +           D    ++      
Sbjct  467  ILKDYIDGKIPHFELPPGEIDAGTDMEDTSDVEDSNTAADDQE----DDIASDEHDEEIN  522

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
               P++ H L+DL +FD+   +   SKA+ KKK +   HK H+KPQ+KKDRSWRV NDG 
Sbjct  523  RAEPNISHALSDLESFDLHGEV---SKASTKKKES--SHKHHRKPQRKKDRSWRVGNDGA  577

Query  253  DGMPAVRVLQKP  218
            DG   +RV QKP
Sbjct  578  DGSGVIRVFQKP  589



>ref|XP_003577256.1| PREDICTED: large subunit GTPase 1 homolog [Brachypodium distachyon]
Length=600

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 133/198 (67%), Gaps = 12/198 (6%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A+RVPR V+  +Y+I+LPKPKPYE QSRPP A+ELLRAYCASRG+V+  GLPDETRAARQ
Sbjct  406  ADRVPRDVLEQIYRITLPKPKPYESQSRPPTAAELLRAYCASRGHVSHGGLPDETRAARQ  465

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGK+PH+E+PPG+ +          +        G + S  D SD  D    + 
Sbjct  466  ILKDYIDGKIPHYELPPGVTS-------HETEQRGTAAAEGLTTSPADESDGYDSDEQDD  518

Query  433  eDAPSLDHILNDLNTFDI-TNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDG  257
             + P +  +L+DL +FD+ T G  A+ K T ++    A HKQH+KPQ+KKDRSWRV NDG
Sbjct  519  PEDPDMRRVLSDLESFDLATEGPKAAGKNTKEE----ASHKQHRKPQRKKDRSWRVGNDG  574

Query  256  GDGMPAVRVLQKPVNTGP  203
             DG   VR LQKPV   P
Sbjct  575  DDGTTVVRALQKPVVNVP  592



>ref|XP_006836535.1| PREDICTED: large subunit GTPase 1 homolog [Amborella trichopoda]
 gb|ERM99388.1| hypothetical protein AMTR_s00131p00025250 [Amborella trichopoda]
Length=601

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 107/215 (50%), Positives = 126/215 (59%), Gaps = 39/215 (18%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR V+ DVY I+LPKPK YEPQSRPPLASELL AYC SRGYV + GLPDETRAARQ
Sbjct  398  ANRVPRAVLQDVYNIALPKPKAYEPQSRPPLASELLGAYCMSRGYVGSRGLPDETRAARQ  457

Query  613  ILKDYVDGKLPHFEMP-------------PGMPNeeedgeedaadtdddvddAGPSLsdh  473
            ILKDY+DGKLPH+EMP              G PN                     S    
Sbjct  458  ILKDYIDGKLPHYEMPLDHHPVSSTLGEENGNPNGTYL-----------------SFDRE  500

Query  472  dssdvedpsvseleDAP------SLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkq  311
            D   +   S  E ++AP       ++H+L +L++FD +    A  K   K  P RA HK 
Sbjct  501  DGFHISSCSTIEDQNAPPSNDVDDIEHVLKELDSFDGSFSGTAKEK---KAAPQRASHKL  557

Query  310  hkkpqkkKDRSWRVQNDGGDGMPAVRVLQKPVNTG  206
            H KP ++KDRSWRV +DG DGMP V V QK V+ G
Sbjct  558  HMKPARRKDRSWRVGSDGSDGMPMVGVFQKEVSYG  592



>gb|EMT02127.1| Large subunit GTPase 1 [Aegilops tauschii]
Length=603

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 129/197 (65%), Gaps = 8/197 (4%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A+RVPR ++  +YKI+L KPKPYEPQSRPP A+ELLRAYCASRG+V+  G PDETRAARQ
Sbjct  404  ADRVPRDILEQIYKITLAKPKPYEPQSRPPTAAELLRAYCASRGHVSHGGQPDETRAARQ  463

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGK+PH+E+PPG+       +E A          GP+ S  D SD +D    + 
Sbjct  464  ILKDYIDGKIPHYELPPGV----VTDDEVATTEPTVAAAEGPTASAADESDSDDSDEQDD  519

Query  433  eD-APSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDG  257
                P +  +L+DL +FD+    A  S  T  KK  +A  KQ +KPQ+KKDRSWR  NDG
Sbjct  520  TTGVPDMRCLLSDLESFDL--AAAEGSNVTGNKKQHQASQKQRRKPQRKKDRSWRASNDG  577

Query  256  GDGMPAVRVLQKP-VNT  209
             DG   VR  QKP VNT
Sbjct  578  SDGTAVVRDFQKPAVNT  594



>gb|EMS54804.1| hypothetical protein TRIUR3_20330 [Triticum urartu]
Length=631

 Score =   161 bits (407),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 132/200 (66%), Gaps = 8/200 (4%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR ++  VYKI+LPKPK YE  SRPP A+ELL AYC SRG+V+ +GLPDETRAARQ
Sbjct  434  ANRVPRNILEQVYKITLPKPKAYEEASRPPTAAELLMAYCTSRGHVSHAGLPDETRAARQ  493

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGK+PHFE+PPG  ++E DGE+++         A  S    D    ++      
Sbjct  494  ILKDYIDGKIPHFELPPGEIDDETDGEDNSDLEGSSTAAADQS----DDGASDEDDEEIN  549

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
               P++ H LNDL +FD+   +   +K + KKK   A HK H+KPQ+KKDRSWRV NDG 
Sbjct  550  RAEPNISHALNDLASFDMHGQM---TKGSTKKKKKEASHKHHRKPQRKKDRSWRVGNDGA  606

Query  253  DGMPAVRVLQKP-VNTGPLN  197
            DG   +RV QKP VN    N
Sbjct  607  DGSGVIRVFQKPAVNLAASN  626



>ref|XP_006651639.1| PREDICTED: uncharacterized protein LOC102702646 [Oryza brachyantha]
Length=1308

 Score =   161 bits (408),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 132/192 (69%), Gaps = 9/192 (5%)
 Frame = -2

Query  793   ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
             ANRVPR V+  +YKI+LPKPK YE  SRPP A+ELLRAYC SRG+V+ +GLPDETRAARQ
Sbjct  1117  ANRVPRSVLEQIYKITLPKPKEYEQPSRPPTAAELLRAYCTSRGHVSHAGLPDETRAARQ  1176

Query  613   ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
             ILKDY+DGK+PHFE+PP   + E   EE       D + A  ++        E+   ++ 
Sbjct  1177  ILKDYLDGKIPHFELPPSDTDSETYLEETTGLEGSDTEVAATTVHCASDEQDEEIGQAD-  1235

Query  433   eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
                 ++ H+L+DL +F++ +G+  S K+T KK+P+   +K HKKPQ+KKDRSWRV NDG 
Sbjct  1236  ---ANIGHLLSDLESFNLGSGV--SKKSTKKKEPS---YKHHKKPQRKKDRSWRVGNDGA  1287

Query  253   DGMPAVRVLQKP  218
             DG   VRV QKP
Sbjct  1288  DGSGVVRVFQKP  1299



>gb|EMT21204.1| Large subunit GTPase 1 [Aegilops tauschii]
Length=608

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 129/192 (67%), Gaps = 7/192 (4%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR ++  VYKI+LPKPK YE  SRPP A+ELL AYC SRG+V+ +GLPDETRAARQ
Sbjct  411  ANRVPRNILEQVYKITLPKPKAYEEASRPPTAAELLMAYCTSRGHVSHAGLPDETRAARQ  470

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGK+PHFE+PPG  ++E DGE+++         A  S    D    ++      
Sbjct  471  ILKDYIDGKIPHFELPPGEIDDETDGEDNSDIEGSSTAAADQS----DDDASDEDDEEIN  526

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
               P++ H LNDL +FD+   +   +K + KKK   A HK H+KPQ+KKDRSWRV NDG 
Sbjct  527  RAEPNISHALNDLASFDMHGQM---TKGSTKKKKKEASHKHHRKPQRKKDRSWRVGNDGA  583

Query  253  DGMPAVRVLQKP  218
            DG   +RV QKP
Sbjct  584  DGSGVIRVFQKP  595



>ref|XP_010473112.1| PREDICTED: large subunit GTPase 1 homolog [Camelina sativa]
Length=538

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 96/152 (63%), Gaps = 11/152 (7%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A RVPR  I DVY ISLPKPK YEPQSRPPLASELLR YC SRGYVA+SGLPDET+AARQ
Sbjct  393  AERVPRHAIEDVYNISLPKPKTYEPQSRPPLASELLRTYCLSRGYVASSGLPDETKAARQ  452

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY++GKLPHF MPP M              D++  + G +L              E 
Sbjct  453  ILKDYIEGKLPHFAMPPEMTR-----------EDENESEDGDTLGAEIVEGSRSVKEGEE  501

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKK  338
                 LD +L+DL++FD+ NG+  S K   KK
Sbjct  502  APGLGLDQVLDDLSSFDLANGIGPSKKKQNKK  533



>dbj|BAK03963.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93641.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=608

 Score =   154 bits (388),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 130/195 (67%), Gaps = 13/195 (7%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR ++  VYKI+LPKPK YE  SRPP A+ELL AYC SRG+V+ +GLPDETRAARQ
Sbjct  411  ANRVPRNILEQVYKITLPKPKAYEEASRPPTAAELLMAYCTSRGHVSHAGLPDETRAARQ  470

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGK+PHFE+PPG  +       D  D +D+ D  G S++  D SD +     + 
Sbjct  471  ILKDYIDGKIPHFELPPGEID-------DETDAEDNSDQEGSSIAAADQSDDDASDEDDE  523

Query  433  ---eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQN  263
               +  P++ H L+DL +FD+   +   +K + KK      HK H+KPQ+KKDRSWRV N
Sbjct  524  DINQAEPNISHALSDLASFDMHGQV---TKGSTKKMKKEKSHKHHRKPQRKKDRSWRVGN  580

Query  262  DGGDGMPAVRVLQKP  218
            DG DG   +RV QKP
Sbjct  581  DGADGSGVIRVFQKP  595



>ref|XP_010417872.1| PREDICTED: large subunit GTPase 1 homolog [Camelina sativa]
Length=538

 Score =   152 bits (385),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 103/154 (67%), Gaps = 15/154 (10%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A RVPR  I DVY ISLPKPK YEPQSRPPLASELLR YC SRGYVA+SGLPDET+AARQ
Sbjct  393  AERVPRNAIEDVYNISLPKPKTYEPQSRPPLASELLRTYCLSRGYVASSGLPDETKAARQ  452

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY++GKLPHF MPP M  E+E+   D      ++ +  PS+              E 
Sbjct  453  ILKDYIEGKLPHFAMPPEMTREDENETRDDDTLGAEIVEGSPSV-------------KEG  499

Query  433  eDAP--SLDHILNDLNTFDITNGLAASSKATVKK  338
             +AP   LD +L+DL++FD+ NG+  S K   KK
Sbjct  500  GEAPGLGLDQVLDDLSSFDLANGIGPSKKKQNKK  533



>ref|XP_006293969.1| hypothetical protein CARUB_v10022959mg [Capsella rubella]
 gb|EOA26867.1| hypothetical protein CARUB_v10022959mg [Capsella rubella]
Length=537

 Score =   152 bits (385),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 104/154 (68%), Gaps = 16/154 (10%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A RVPR  I DVY ISLPKPK YEPQSRPPLASELLR YC SRGYVA+SGLPDET+AARQ
Sbjct  393  AERVPRNAIEDVYNISLPKPKTYEPQSRPPLASELLRTYCLSRGYVASSGLPDETKAARQ  452

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY++GKLPHF MPP M  E+E+   D     + V  + P              V + 
Sbjct  453  ILKDYIEGKLPHFAMPPEMTREDENETADDTLGAEIVKGSQP--------------VEKS  498

Query  433  eDAPS--LDHILNDLNTFDITNGLAASSKATVKK  338
            E+APS  L+ +L+DL++FD+ NGL  S K   KK
Sbjct  499  EEAPSLGLEQVLDDLSSFDLANGLGPSKKTQNKK  532



>ref|XP_002879073.1| GTP-binding family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55332.1| GTP-binding family protein [Arabidopsis lyrata subsp. lyrata]
Length=539

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 99/152 (65%), Gaps = 10/152 (7%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A RVPR  I DVY ISLPKPK YEPQSRPPLASELLR YC SRGYVA+SGLPDETRAARQ
Sbjct  393  AERVPRHAIEDVYNISLPKPKSYEPQSRPPLASELLRTYCLSRGYVASSGLPDETRAARQ  452

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY++GKLPHF MPP +  ++E+   D     +  + + P           +      
Sbjct  453  ILKDYIEGKLPHFAMPPEITRDDENETADDNMGAETREGSQPE----------EEGKEAT  502

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKK  338
                 LD +L+DL++FD+ NG+ ++ K   KK
Sbjct  503  GLGLGLDQVLDDLSSFDLANGIGSNKKKQHKK  534



>ref|NP_180288.1| P-loop containing nucleoside triphosphate hydrolase-like protein 
[Arabidopsis thaliana]
 sp|Q9SHS8.1|LSG11_ARATH RecName: Full=GTPase LSG1-1; Short=AtLSG1-1; AltName: Full=DAR 
GTPase 6; AltName: Full=Protein YEAST LSG1 ORTHOLOG 1 [Arabidopsis 
thaliana]
 gb|AAD26884.1| putative nucleotide-binding protein [Arabidopsis thaliana]
 gb|AAY25442.1| At2g27200 [Arabidopsis thaliana]
 gb|AEC07952.1| P-loop containing nucleoside triphosphate hydrolase-like protein 
[Arabidopsis thaliana]
Length=537

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 99/156 (63%), Gaps = 13/156 (8%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A  VPR  I DVY ISLPKPK YEPQSRPPLASELLR YC SRGYVA+SGLPDETRAARQ
Sbjct  393  AELVPRHAIEDVYNISLPKPKSYEPQSRPPLASELLRTYCLSRGYVASSGLPDETRAARQ  452

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY++GKLPHF MPP +              DD+ + A  +L        +     E 
Sbjct  453  ILKDYIEGKLPHFAMPPEITR------------DDENETADDTLGAETREGSQTEKKGEE  500

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTR  326
              +  LD +L+DL++FD+ NGL  SSK    KK  R
Sbjct  501  APSLGLDQVLDDLSSFDLANGL-VSSKTKQHKKSHR  535



>ref|XP_006408622.1| hypothetical protein EUTSA_v10001955mg [Eutrema salsugineum]
 gb|ESQ50075.1| hypothetical protein EUTSA_v10001955mg [Eutrema salsugineum]
Length=532

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/161 (50%), Positives = 96/161 (60%), Gaps = 29/161 (18%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A RVPR+ I +VY ISLPKPK YEPQ RPPLASELLR YC SRGYVA+SGLPDETRAARQ
Sbjct  394  AERVPREAIEEVYNISLPKPKTYEPQFRPPLASELLRTYCLSRGYVASSGLPDETRAARQ  453

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY++GKLPHF +PP                        P   +      +     E 
Sbjct  454  ILKDYIEGKLPHFALPP------------------------PDGENAVEEGSQSEDEGEE  489

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVK-----KKPTR  326
                 LD +L+DL++FD+ NGL +S K  V+     KKP R
Sbjct  490  APGRGLDQVLDDLSSFDLANGLGSSKKKQVESHKQHKKPHR  530



>gb|ACV52759.1| GTP-binding protein, partial [Oryza sativa Indica Group]
 gb|ACV52760.1| GTP-binding protein, partial [Oryza sativa Indica Group]
 gb|ACV52762.1| GTP-binding protein, partial [Oryza sativa Indica Group]
 gb|ACV52764.1| GTP-binding protein, partial [Oryza sativa Indica Group]
 gb|ACV52765.1| GTP-binding protein, partial [Oryza sativa Indica Group]
 gb|ACV52767.1| GTP-binding protein, partial [Oryza sativa Indica Group]
 gb|ACV52768.1| GTP-binding protein, partial [Oryza sativa Indica Group]
 gb|ACV52769.1| GTP-binding protein, partial [Oryza sativa Indica Group]
 gb|ACV52771.1| GTP-binding protein, partial [Oryza sativa Indica Group]
 gb|ACV52772.1| GTP-binding protein, partial [Oryza sativa Indica Group]
 gb|ACV52773.1| GTP-binding protein, partial [Oryza sativa Japonica Group]
 gb|ACV52774.1| GTP-binding protein, partial [Oryza sativa Japonica Group]
 gb|ACV52775.1| GTP-binding protein, partial [Oryza sativa Japonica Group]
 gb|ACV52777.1| GTP-binding protein, partial [Oryza sativa Japonica Group]
 gb|ACV52778.1| GTP-binding protein, partial [Oryza sativa Japonica Group]
 gb|ACV52779.1| GTP-binding protein, partial [Oryza sativa Japonica Group]
 gb|ACV52780.1| GTP-binding protein, partial [Oryza sativa Japonica Group]
 gb|ACV52781.1| GTP-binding protein, partial [Oryza sativa Japonica Group]
 gb|ACV52783.1| GTP-binding protein, partial [Oryza sativa Japonica Group]
 gb|ACV52784.1| GTP-binding protein, partial [Oryza sativa Japonica Group]
 gb|ACV52785.1| GTP-binding protein, partial [Oryza sativa Japonica Group]
 gb|ACV52786.1| GTP-binding protein, partial [Oryza sativa Japonica Group]
Length=301

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A+RVPR V+  +YKI+LPKPKPYE QSRPP A+ELLRAYCASRG+V+ +GLPDETRAARQ
Sbjct  181  ADRVPRSVLEQIYKITLPKPKPYESQSRPPTAAELLRAYCASRGHVSHAGLPDETRAARQ  240

Query  613  ILKDYVDGKLPHFEMPPGM  557
            ILKDY+DGK+PHFE+PPGM
Sbjct  241  ILKDYIDGKIPHFELPPGM  259



>gb|ACV52761.1| GTP-binding protein, partial [Oryza sativa Indica Group]
 gb|ACV52763.1| GTP-binding protein, partial [Oryza sativa Indica Group]
 gb|ACV52766.1| GTP-binding protein, partial [Oryza sativa Indica Group]
 gb|ACV52770.1| GTP-binding protein, partial [Oryza sativa Indica Group]
 gb|ACV52776.1| GTP-binding protein, partial [Oryza sativa Japonica Group]
 gb|ACV52782.1| GTP-binding protein, partial [Oryza sativa Japonica Group]
Length=301

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A+RVPR V+  +YKI+LPKPKPYE QSRPP A+ELLRAYCASRG+V+ +GLPDETRAARQ
Sbjct  181  ADRVPRSVLEQIYKITLPKPKPYESQSRPPTAAELLRAYCASRGHVSHAGLPDETRAARQ  240

Query  613  ILKDYVDGKLPHFEMPPGM  557
            ILKDY+DGK+PHFE+PPGM
Sbjct  241  ILKDYIDGKIPHFELPPGM  259



>ref|XP_009140774.1| PREDICTED: large subunit GTPase 1 homolog [Brassica rapa]
Length=530

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 98/162 (60%), Gaps = 27/162 (17%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A RVPR VI  VY ISLPKPK YE + RPPLASELLR YC SRGYVAASGLPDETRAARQ
Sbjct  388  AERVPRDVIEGVYNISLPKPKSYESKLRPPLASELLRTYCLSRGYVAASGLPDETRAARQ  447

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+DGKLPHF MPP           +  + +      G S+            VSE 
Sbjct  448  ILKDYIDGKLPHFAMPP-----------EDDENETGETGDGGSV----------SEVSEE  486

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATV------KKKPTR  326
                 LD +L DL++FD+ NGL +S K  V      KK+P R
Sbjct  487  ARGLGLDQVLEDLSSFDLANGLGSSKKKQVESHKQHKKQPQR  528



>emb|CDY57792.1| BnaCnng32480D [Brassica napus]
Length=530

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 98/162 (60%), Gaps = 27/162 (17%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A RVPR VI  VY ISLPKPK YE + RPPLASELLR YC SRGYVAASGLPDETRAARQ
Sbjct  388  AERVPRDVIEGVYNISLPKPKSYESRFRPPLASELLRTYCLSRGYVAASGLPDETRAARQ  447

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY++GKLPHF MPP           +  + +      G S+            VSE 
Sbjct  448  ILKDYIEGKLPHFAMPP-----------EDDENETGETGDGGSV----------SEVSEE  486

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATV------KKKPTR  326
                 LD +L DL++FD+ NGL +S K  V      KK+P R
Sbjct  487  ARGLGLDQVLEDLSSFDLANGLGSSKKKQVDSHKQHKKQPLR  528



>gb|ACV52787.1| GTP-binding protein, partial [Oryza barthii]
Length=301

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A+RVPR V+  +YKI+LPKPKPYE QSRPP A+ELLRAYCASRG+V+ +GLPDETRAARQ
Sbjct  181  ADRVPRSVLEQIYKITLPKPKPYESQSRPPTAAELLRAYCASRGHVSHAGLPDETRAARQ  240

Query  613  ILKDYVDGKLPHFEMPPGM  557
            ILKDY+DGK+PHFE+PP M
Sbjct  241  ILKDYIDGKIPHFELPPCM  259



>ref|XP_010510799.1| PREDICTED: large subunit GTPase 1 homolog [Camelina sativa]
Length=535

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A RVPR  I DVY ISLPKPK YEPQSRPPLASELLR YC SRGYVA+SGLPDET+AARQ
Sbjct  393  AERVPRHAIEDVYNISLPKPKTYEPQSRPPLASELLRTYCLSRGYVASSGLPDETKAARQ  452

Query  613  ILKDYVDGKLPHFEMPPGM  557
            ILKDY++GKLPHF MPP M
Sbjct  453  ILKDYIEGKLPHFAMPPEM  471



>gb|KFK33535.1| hypothetical protein AALP_AA5G026000 [Arabis alpina]
Length=498

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 87/147 (59%), Gaps = 33/147 (22%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A RVPR VI  VY ISLPKPK YEPQSRPPL SELL +YC SRGYVAA GLPDETRAARQ
Sbjct  384  AERVPRDVIEQVYNISLPKPKTYEPQSRPPLPSELLNSYCLSRGYVAAGGLPDETRAARQ  443

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY++GKLPHF MPP   N                 +  P L                
Sbjct  444  ILKDYIEGKLPHFAMPPDAEN-------------KTTGEEAPRL----------------  474

Query  433  eDAPSLDHILNDLNTFDITNGLAASSK  353
                 L  +L+DL++FD+ NG+ +S K
Sbjct  475  ----GLVQVLDDLSSFDLANGIGSSRK  497



>gb|EYU36017.1| hypothetical protein MIMGU_mgv1a006252mg [Erythranthe guttata]
Length=450

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/81 (78%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            ANRVPR  I  VY+ISLPKP+ YE QSR PLA E LR+YCASRGYVA+SGLPDET+AARQ
Sbjct  233  ANRVPRAAIEGVYRISLPKPRSYEKQSRAPLAVEFLRSYCASRGYVASSGLPDETKAARQ  292

Query  613  ILKDYVDGKLPHFEMPPGMPN  551
            ILKDY+DGKLPHF+MPPG+ N
Sbjct  293  ILKDYIDGKLPHFQMPPGISN  313


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = -2

Query  427  APSLDHILNDLNTFDITNGLAASSKATVKKKP-TRAphkqhkkpqkkKDRSWRVQNDGGD  251
             P L+++LNDL++FDI NGLA +  A   +K  + APHKQHKKPQ+KKDR+WRV+N+GGD
Sbjct  372  GPGLENVLNDLSSFDIDNGLATTKAAAAVRKKASIAPHKQHKKPQRKKDRTWRVKNNGGD  431

Query  250  GMPAVRVLQKPVNTGPL  200
            GMP VRV QKPVN  PL
Sbjct  432  GMPIVRVFQKPVNAAPL  448



>emb|CDY57484.1| BnaAnng14640D [Brassica napus]
Length=512

 Score =   135 bits (339),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A RVPR VI  VY ISLPKPK YE + RPPLASELLR YC SRGYVAASGLPDETRAARQ
Sbjct  388  AERVPRDVIEGVYNISLPKPKSYESKLRPPLASELLRTYCLSRGYVAASGLPDETRAARQ  447

Query  613  ILKDYVDGKLPHFEMPP  563
            ILKDY+DGKLPHF MPP
Sbjct  448  ILKDYIDGKLPHFAMPP  464



>ref|XP_001761310.1| predicted protein [Physcomitrella patens]
 gb|EDQ74032.1| predicted protein [Physcomitrella patens]
Length=575

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 88/200 (44%), Positives = 116/200 (58%), Gaps = 6/200 (3%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            AN+VPR V+   Y  +LP PKPYE   RPP A+ELLRAY  SRG+VA+SGLPDETRA+R 
Sbjct  378  ANKVPRAVLESTYGFTLPAPKPYERADRPPTAAELLRAYAMSRGHVASSGLPDETRASRT  437

Query  613  ILKDYVDGKLPHFEMPPGMPNeeedgeedaadtdddvddAGPSLsdhdssdvedpsvsel  434
            ILKDY+ GKL     P   PNEE+ G        ++ DD   +  + +   V +      
Sbjct  438  ILKDYLSGKLLFCYAP---PNEEQAGFSQRIANSNEDDDEDENDDEDEDELVMEDGKLLG  494

Query  433  eDAPSLDHILNDLNTFDITNGLAASSKATVKKKPTRAphkqhkkpqkkKDRSWRVQNDGG  254
             +  +++ +  DL+T  I   L       +KK   +APHK H+K  +KKDR+WRV NDG 
Sbjct  495  VNDANMEDVFGDLDTLTIGADLRGPK---LKKGKEKAPHKMHRKAARKKDRTWRVTNDGS  551

Query  253  DGMPAVRVLQKPVNTGPLNI  194
            DGMP   V QK V+ G   +
Sbjct  552  DGMPCSGVTQKAVSHGAAKV  571



>ref|XP_002976299.1| hypothetical protein SELMODRAFT_228404 [Selaginella moellendorffii]
 gb|EFJ22559.1| hypothetical protein SELMODRAFT_228404 [Selaginella moellendorffii]
Length=487

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            AN++PR+ + + Y + LPKPKPYE Q+RPP A+ELL++Y  SRGYVA+ GLPDETR+ARQ
Sbjct  279  ANQIPRRQLEETYGLLLPKPKPYEDQNRPPTAAELLKSYAQSRGYVASRGLPDETRSARQ  338

Query  613  ILKDYVDGKLPH  578
            +LKDY++GKL +
Sbjct  339  MLKDYLNGKLLY  350



>ref|XP_002985785.1| hypothetical protein SELMODRAFT_229145 [Selaginella moellendorffii]
 gb|EFJ12962.1| hypothetical protein SELMODRAFT_229145 [Selaginella moellendorffii]
Length=487

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            AN++PR+ + + Y + LPKPKPYE Q+RPP A+ELL++Y  SRGYVA+ GLPDETR+ARQ
Sbjct  279  ANQIPRRQLEETYGLLLPKPKPYEDQNRPPTAAELLKSYAQSRGYVASRGLPDETRSARQ  338

Query  613  ILKDYVDGKLPH  578
            +LKDY++GKL +
Sbjct  339  MLKDYLNGKLLY  350



>gb|AAD43046.1|AF124045_5 GTP-binding protein-like, partial [Sorghum bicolor]
Length=142

 Score = 88.2 bits (217),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 51/59 (86%), Gaps = 3/59 (5%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAAR  617
            A+RVPR ++  +YKI+LPKPKPYEPQSRPP A+ELLRAY ASRG+   +GLPDETRAAR
Sbjct  87   ADRVPRDILEQIYKITLPKPKPYEPQSRPPTAAELLRAYYASRGH---AGLPDETRAAR  142



>ref|XP_005844201.1| hypothetical protein CHLNCDRAFT_7626, partial [Chlorella variabilis]
 gb|EFN52099.1| hypothetical protein CHLNCDRAFT_7626, partial [Chlorella variabilis]
Length=383

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/83 (57%), Positives = 57/83 (69%), Gaps = 5/83 (6%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSR-----PPLASELLRAYCASRGYVAASGLPDET  629
            A RV R+ +  VY + LP P   E   R     PP A ELLRA+  +RG+VAASGLPDET
Sbjct  296  AQRVGRRQLESVYGLRLPPPGHQEDPHRHVPLVPPTAIELLRAFAYARGWVAASGLPDET  355

Query  628  RAARQILKDYVDGKLPHFEMPPG  560
            RA R+ILKDYVDGK+ +F+ PPG
Sbjct  356  RAGRRILKDYVDGKILYFKAPPG  378



>ref|XP_003082920.1| Predicted GTP-binding protein MMR1 (ISS) [Ostreococcus tauri]
 emb|CAL56875.1| P-loop containing nucleoside triphosphate hydrolase [Ostreococcus 
tauri]
Length=595

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A R+PR  I  VY + LP P  +E Q+R P A ELLRAYCA+RGY      PDE RA R 
Sbjct  395  AERIPRDTIEHVYNMKLPLPALHEDQNRNPTARELLRAYCAARGYTVQGNRPDEQRAGRA  454

Query  613  ILKDYVDGKLPHFEMPPG  560
            +LKDYV GKL +   P G
Sbjct  455  VLKDYVSGKLLYCIAPEG  472



>emb|CDY06312.1| BnaA09g48910D [Brassica napus]
Length=182

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 47/54 (87%), Gaps = 1/54 (2%)
 Frame = -2

Query  757  YKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILKDYV  596
            +KI LPKPKPYE Q RPP A+ELLRAYCAS GY+A+SGLPDET+AA  ILKDY+
Sbjct  66   FKI-LPKPKPYERQLRPPHAAELLRAYCASLGYLASSGLPDETKAAWGILKDYL  118



>ref|XP_628750.1| unclassified GTPase [Dictyostelium discoideum AX4]
 gb|EAL60337.1| unclassified GTPase [Dictyostelium discoideum AX4]
Length=674

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
              R+PR  + ++Y++ +PKP+ +EPQ RPP A+E L AY   RG+    G PD++RAAR 
Sbjct  419  CERLPRSHLEEIYRVGIPKPQEHEPQDRPPTANEFLSAYGYMRGFRTVHGAPDQSRAARI  478

Query  613  ILKDYVDGKLPHFEMPPGM  557
            +LKD+V+GKL +   PPG 
Sbjct  479  VLKDFVNGKLLYCHPPPGF  497



>ref|XP_001699204.1| hypothetical protein CHLREDRAFT_206017 [Chlamydomonas reinhardtii]
 gb|EDO98844.1| hypothetical protein CHLREDRAFT_206017 [Chlamydomonas reinhardtii]
Length=582

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A R  R+ +G VY I LP    + P + PP A +LLRAY   RG+ A SGLPDETRA RQ
Sbjct  414  AKRCGREQLGRVYGIKLPPAPKHLPPTSPPTAEQLLRAYAVLRGWTAGSGLPDETRAGRQ  473

Query  613  ILKDYVDGKLPHFEMPPGM  557
            IL+DY +GKL +  +PPG+
Sbjct  474  ILRDYTNGKLVYCLLPPGV  492



>ref|XP_004644051.1| PREDICTED: large subunit GTPase 1 homolog [Octodon degus]
Length=649

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR+V+   Y IS+PKP+  E   RPP + ELL AY + RG++ A G PDE R+AR ILK
Sbjct  470  IPRRVLEATYGISIPKPREDEDPHRPPTSEELLTAYGSMRGFMTAHGQPDEPRSARYILK  529

Query  604  DYVDGKLPHFEMPPGM  557
            DYV GKL H   PPGM
Sbjct  530  DYVRGKLLHCHPPPGM  545



>gb|EFA74535.1| hypothetical protein PPL_00033 [Polysphondylium pallidum PN500]
Length=627

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
              +V R  I +VY I +PKPK +EPQ RPP  +E+L  Y   RG++   G PD++RAAR 
Sbjct  407  CEKVARSYIEEVYSIGIPKPKEHEPQDRPPTGAEVLSVYAYMRGFMTVHGAPDQSRAARI  466

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKD+V GKL +   PPG
Sbjct  467  ILKDFVAGKLLYCHPPPG  484



>ref|XP_003285885.1| hypothetical protein DICPUDRAFT_76802 [Dictyostelium purpureum]
 gb|EGC37624.1| hypothetical protein DICPUDRAFT_76802 [Dictyostelium purpureum]
Length=658

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
              R+PR  + + Y I +PKPK +EPQ R P A+E L AY   RG+    G PD++RAAR 
Sbjct  410  CERLPRTHLEEFYSIGIPKPKEHEPQDRAPTAAEFLSAYGYMRGFRTVHGAPDQSRAARI  469

Query  613  ILKDYVDGKLPHFEMPPGM  557
            +LKD+V+GKL +   PPG 
Sbjct  470  VLKDFVNGKLLYCHPPPGF  488



>ref|XP_005383243.1| PREDICTED: large subunit GTPase 1 homolog [Chinchilla lanigera]
Length=708

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR+V+   Y ISL KP+  E   RPP A ELL AY + RG++ A G PDE R+AR ILK
Sbjct  529  IPRRVLEATYGISLTKPREDEDPHRPPTAEELLTAYGSMRGFMTAHGQPDEPRSARYILK  588

Query  604  DYVDGKLPHFEMPPGM  557
            DYV GKL H   PPG+
Sbjct  589  DYVRGKLLHCHPPPGI  604



>ref|XP_001422684.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABP01001.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=378

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 46/76 (61%), Gaps = 0/76 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A R+PR  I  VY ++LP P  +E Q R   A E LRAYCA+RGY      PDE RA R 
Sbjct  303  AERIPRSTIEHVYNLTLPLPALHEDQGRNATAREFLRAYCAARGYTVQGNRPDEVRAGRA  362

Query  613  ILKDYVDGKLPHFEMP  566
            +LKDY+ GKL +   P
Sbjct  363  VLKDYISGKLLYCVAP  378



>dbj|GAM27199.1| hypothetical protein SAMD00019534_103740 [Acytostelium subglobosum 
LB1]
Length=629

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
              RV R  + D+Y ++LP PK +E Q RPP  +ELL AY   RG++   G PD++RAAR 
Sbjct  405  CERVARSYLEDMYAVALPLPKEHEAQDRPPTGAELLSAYAYMRGFMTVHGAPDQSRAARI  464

Query  613  ILKDYVDGKLPHFEMPPGM  557
            +LKD+V GKL     PPG+
Sbjct  465  VLKDFVAGKLLFCSPPPGL  483



>ref|XP_002952357.1| hypothetical protein VOLCADRAFT_105489 [Volvox carteri f. nagariensis]
 gb|EFJ46500.1| hypothetical protein VOLCADRAFT_105489 [Volvox carteri f. nagariensis]
Length=640

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A RV R  +  VY I LP P  +     PP A ++LRAY   RG+ A SGLPDETRA RQ
Sbjct  423  AGRVGRAQLTAVYGIKLPPPPRHMSPDDPPTAEQVLRAYAVLRGWTAGSGLPDETRAGRQ  482

Query  613  ILKDYVDGKLPHFEMPPG  560
            IL+DY +GKL +  MPPG
Sbjct  483  ILRDYTNGKLVYCLMPPG  500



>gb|EPZ34241.1| P-loop containing nucleoside triphosphate hydrolase domain-containing 
protein [Rozella allomycis CSF55]
Length=580

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYV-AASGLPDETRAAR  617
            A R+PR V+  VY + +P P  +E  +RPP   ELL+ Y   RGYV +  G PDE+RAAR
Sbjct  373  AERIPRSVLERVYGMKIPLPADHEDPNRPPTVYELLQTYAILRGYVRSVQGNPDESRAAR  432

Query  616  QILKDYVDGKLPHFEMPPGM  557
             ILKDYV+GKL +   PPG+
Sbjct  433  VILKDYVNGKLIYCHAPPGI  452



>gb|KHN76558.1| Large subunit GTPase 1 -like protein [Toxocara canis]
Length=616

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A+RVPR V    Y + LPK   +E  S+PP A ELL +    RG++AASG+PD +RAAR 
Sbjct  432  ASRVPRFVFEKAYSVMLPKATEHEQDSQPPTAHELLTSVAYMRGFMAASGVPDCSRAARL  491

Query  613  ILKDYVDGKLPHFEMPPGM  557
            I+KD V+G+L     PPGM
Sbjct  492  IVKDVVNGRLKWIAAPPGM  510



>ref|XP_003063860.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52233.1| predicted protein [Micromonas pusilla CCMP1545]
Length=626

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A R+PR+     YK+ LP P  +E Q R   A E+LRAY A+RG     G PDE RA R 
Sbjct  398  AARIPREAFEATYKVKLPLPALHEDQKRRATAGEMLRAYSAARGLTVQHGRPDEQRAGRA  457

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKD+  GKL H   PPG
Sbjct  458  ILKDFTQGKLLHCVGPPG  475



>gb|EHA97853.1| Large subunit GTPase 1-like protein [Heterocephalus glaber]
Length=647

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR+V+   Y IS+ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  467  IPRQVLEATYGISIIKPREDEDPYRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARYILK  526

Query  604  DYVDGKLPHFEMPPGM  557
            DYV GKL H   PPGM
Sbjct  527  DYVRGKLLHCHPPPGM  542



>ref|XP_004876704.1| PREDICTED: large subunit GTPase 1 homolog [Heterocephalus glaber]
Length=646

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR+V+   Y IS+ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  466  IPRQVLEATYGISIIKPREDEDPYRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARYILK  525

Query  604  DYVDGKLPHFEMPPGM  557
            DYV GKL H   PPGM
Sbjct  526  DYVRGKLLHCHPPPGM  541



>ref|XP_002505817.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO67075.1| predicted protein, partial [Micromonas sp. RCC299]
Length=371

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A+R+ R+++   Y   LP P  +E QSR   A ELLRAYCA+R      G PDE RA R 
Sbjct  292  ASRISRRLLEATYHFKLPLPALHEDQSRNATAGELLRAYCAARRLTVQQGRPDEQRAGRA  351

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKD+++GKL H   P G
Sbjct  352  ILKDFINGKLLHCVGPDG  369



>ref|XP_001991793.1| GH11875 [Drosophila grimshawi]
 gb|EDW00418.1| GH11875 [Drosophila grimshawi]
Length=611

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
              R+PR ++ D Y I + KP   E Q RPP A ELL AY  +RG++ ++G PD+ R+AR 
Sbjct  432  CERIPRHILEDKYGIVIAKPMEGEDQERPPFAEELLLAYGYNRGFMTSNGQPDQARSARY  491

Query  613  ILKDYVDGKLPHFEMPPGM  557
            +LKDYV+GKL     PP +
Sbjct  492  VLKDYVNGKLLFALGPPSV  510



>ref|XP_001657366.1| AAEL006031-PA [Aedes aegypti]
 gb|EAT42422.1| AAEL006031-PA [Aedes aegypti]
Length=615

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+ D Y I + KP   E  +RPP A ELL A+  +RGY+ A+G PD++R +R +LK
Sbjct  437  IPRHVLEDTYGIMITKPLEAEDPNRPPFAEELLLAFAYNRGYMTANGQPDQSRGSRYVLK  496

Query  604  DYVDGKLPHFEMPPGM  557
            D+V+GKL +   PP +
Sbjct  497  DFVNGKLLYCHAPPNV  512



>ref|XP_002937880.1| PREDICTED: large subunit GTPase 1 homolog isoformX1 [Xenopus 
(Silurana) tropicalis]
Length=637

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A R+PR  +  +Y I++ +P+  E Q RPP + E L AY   RG++ A G PD+ R+AR 
Sbjct  454  AQRIPRHALETIYGINIIRPREDEDQDRPPTSEEFLCAYGYMRGFMTAHGQPDQPRSARY  513

Query  613  ILKDYVDGKLPHFEMPPGM  557
            +LKDYV GKL +   PPG+
Sbjct  514  VLKDYVSGKLLYCHPPPGI  532



>gb|AAI61204.1| LOC100145528 protein [Xenopus (Silurana) tropicalis]
Length=625

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A R+PR  +  +Y I++ +P+  E Q RPP + E L AY   RG++ A G PD+ R+AR 
Sbjct  451  AQRIPRHALETIYGINIIRPREDEDQDRPPTSEEFLCAYGYMRGFMTAHGQPDQPRSARY  510

Query  613  ILKDYVDGKLPHFEMPPGM  557
            +LKDYV GKL +   PPG+
Sbjct  511  VLKDYVSGKLLYCHPPPGI  529



>gb|KFO33133.1| Large subunit GTPase 1 like protein [Fukomys damarensis]
Length=643

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR+V+   Y IS+ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  463  IPRRVLEATYGISIVKPREDEDPHRPPTSEELLMAYGYMRGFMTAHGQPDQPRSARYILK  522

Query  604  DYVDGKLPHFEMPPG  560
            DYV GKL H   PPG
Sbjct  523  DYVRGKLLHCHPPPG  537



>ref|XP_010622364.1| PREDICTED: large subunit GTPase 1 homolog [Fukomys damarensis]
Length=642

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR+V+   Y IS+ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  462  IPRRVLEATYGISIVKPREDEDPHRPPTSEELLMAYGYMRGFMTAHGQPDQPRSARYILK  521

Query  604  DYVDGKLPHFEMPPG  560
            DYV GKL H   PPG
Sbjct  522  DYVRGKLLHCHPPPG  536



>ref|XP_011212101.1| PREDICTED: LOW QUALITY PROTEIN: large subunit GTPase 1 homolog 
[Bactrocera dorsalis]
Length=641

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
              R+PR V+ + Y I + KP   E Q RPP + ELL AY  +RG++ ++G PD++R+AR 
Sbjct  461  CERIPRHVLEEKYGIIIAKPIEGEDQERPPHSEELLLAYGYNRGFMTSNGQPDQSRSARY  520

Query  613  ILKDYVDGKLPHFEMPPGMP  554
            + KDYV+GKL +   PP +P
Sbjct  521  VCKDYVNGKLLYCVAPPTVP  540



>ref|XP_002463910.1| hypothetical protein SORBIDRAFT_01g008777 [Sorghum bicolor]
 gb|EER90908.1| hypothetical protein SORBIDRAFT_01g008777, partial [Sorghum bicolor]
Length=137

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGY  659
            A+RVPR ++  +YKI+LPKPKPYEPQSRPP A+ELLRAY ASRG+
Sbjct  93   ADRVPRDILEQIYKITLPKPKPYEPQSRPPTAAELLRAYYASRGH  137



>ref|XP_004914428.1| PREDICTED: large subunit GTPase 1 homolog isoform X2 [Xenopus 
(Silurana) tropicalis]
Length=588

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A R+PR  +  +Y I++ +P+  E Q RPP + E L AY   RG++ A G PD+ R+AR 
Sbjct  405  AQRIPRHALETIYGINIIRPREDEDQDRPPTSEEFLCAYGYMRGFMTAHGQPDQPRSARY  464

Query  613  ILKDYVDGKLPHFEMPPGM  557
            +LKDYV GKL +   PPG+
Sbjct  465  VLKDYVSGKLLYCHPPPGI  483



>ref|XP_007509670.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18785.1| predicted protein [Bathycoccus prasinos]
Length=743

 Score = 78.2 bits (191),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
              R+PRK +       LPKP  +E Q+R P A ELLRA+CA+RG+    G PD+++A R 
Sbjct  541  CERIPRKSLEVALHCQLPKPALHEDQNRQPTAGELLRAFCAARGWALVHGRPDDSKAGRY  600

Query  613  ILKDYVDGKLPHFEMP  566
            +LK Y +G+L H E P
Sbjct  601  LLKMYAEGRLLHCEKP  616



>emb|CAL49373.1| novel protein similar to human hypothetical protein FLJ11301 
[Xenopus (Silurana) tropicalis]
Length=572

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A R+PR  +  +Y I++ +P+  E Q RPP + E L AY   RG++ A G PD+ R+AR 
Sbjct  405  AQRIPRHALETIYGINIIRPREDEDQDRPPTSEEFLCAYGYMRGFMTAHGQPDQPRSARY  464

Query  613  ILKDYVDGKLPHFEMPPGM  557
            +LKDYV GKL +   PPG+
Sbjct  465  VLKDYVSGKLLYCHPPPGI  483



>ref|XP_003741377.1| PREDICTED: large subunit GTPase 1 homolog [Metaseiulus occidentalis]
Length=551

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 52/78 (67%), Gaps = 0/78 (0%)
 Frame = -2

Query  790  NRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQI  611
            +++PR ++ + Y I +P P   E   RPP ++ELL AY  +RG++ +SG PD  R AR I
Sbjct  382  SQIPRHILEETYGICIPHPPEGEDPDRPPTSAELLNAYSYNRGFMTSSGQPDNPRGARYI  441

Query  610  LKDYVDGKLPHFEMPPGM  557
            LKDYV+GKL +   PPG+
Sbjct  442  LKDYVNGKLKYCIAPPGI  459



>gb|KFB47526.1| AGAP011471-PA-like protein [Anopheles sinensis]
Length=609

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+ D Y I + KP   E  +RPP + ELL A+  +RG++ A+G PD++R +R +LK
Sbjct  425  IPRHVLEDTYGIIITKPLETEDPNRPPYSEELLLAFAYNRGFMTANGQPDQSRGSRYVLK  484

Query  604  DYVDGKLPHFEMPPGM  557
            DYV+GKL +   PPG+
Sbjct  485  DYVNGKLLYCYAPPGV  500



>ref|XP_004834811.1| PREDICTED: large subunit GTPase 1 homolog [Heterocephalus glaber]
Length=646

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR+V+   Y IS+ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  466  IPRRVLEATYGISIIKPREDEDPYRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARYILK  525

Query  604  DYVDGKLPHFEMPPG  560
            DYV GKL H   PPG
Sbjct  526  DYVRGKLLHCHPPPG  540



>ref|XP_001982510.1| GG12698 [Drosophila erecta]
 gb|EDV45479.1| GG12698 [Drosophila erecta]
Length=607

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
              R+PR V+ D Y I + KP   E   RPP + ELL AY  +RG++ ++G PD+ R+AR 
Sbjct  427  CERIPRHVLEDKYGIVIAKPLEGEDMERPPHSEELLLAYGYNRGFMTSNGQPDQARSARY  486

Query  613  ILKDYVDGKLPHFEMPPGMPN  551
            +LKDYV+G+L +   PP +P 
Sbjct  487  VLKDYVNGRLLYAMSPPSVPQ  507



>ref|XP_002040355.1| GM18974 [Drosophila sechellia]
 gb|EDW43826.1| GM18974 [Drosophila sechellia]
Length=607

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
              R+PR V+ D Y I + KP   E   RPP + ELL AY  +RG++ ++G PD+ R+AR 
Sbjct  427  CERIPRHVLEDKYGIVIAKPLEGEDMERPPHSEELLLAYGYNRGFMTSNGQPDQARSARY  486

Query  613  ILKDYVDGKLPHFEMPPGMPN  551
            +LKDYV+G+L +   PP +P 
Sbjct  487  VLKDYVNGRLLYAMSPPSVPQ  507



>ref|XP_004712396.1| PREDICTED: large subunit GTPase 1 homolog [Echinops telfairi]
Length=692

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR+V    Y +++ KP+  E   RPP + ELL AY + RG++ A G PD+ R+AR ILK
Sbjct  512  IPRRVFEATYAVAIIKPREDEDPHRPPTSEELLSAYGSMRGFMTAHGQPDQPRSARYILK  571

Query  604  DYVDGKLPHFEMPPG  560
            DYV GKL H   PPG
Sbjct  572  DYVSGKLLHCHPPPG  586



>ref|XP_005111021.1| PREDICTED: large subunit GTPase 1 homolog [Aplysia californica]
Length=712

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR+V+   Y I +P+P   +  SRPP A ELL +Y A RG++   G+ D  RAAR ILK
Sbjct  530  IPRQVLEATYSIMIPRPSVDDDASRPPTAEELLMSYGAMRGFMTPRGVADAPRAARYILK  589

Query  604  DYVDGKLPHFEMPPGM  557
            D+V GKL + E PPG+
Sbjct  590  DFVKGKLLYCEAPPGL  605



>ref|NP_569915.1| nucleostemin ortholog 3, isoform A [Drosophila melanogaster]
 ref|NP_001284779.1| nucleostemin ortholog 3, isoform B [Drosophila melanogaster]
 sp|Q9W590.1|LSG1_DROME RecName: Full=Large subunit GTPase 1 homolog; AltName: Full=Nucleostemin-3 
[Drosophila melanogaster]
 emb|CAB38462.1| EG:BACN32G11.5 [Drosophila melanogaster]
 gb|AAF45628.1| nucleostemin ortholog 3, isoform A [Drosophila melanogaster]
 gb|AAK77288.1| GH06695p [Drosophila melanogaster]
 gb|ACL85082.1| l(1)G0431-PA, partial [synthetic construct]
 gb|ACL89953.1| l(1)G0431-PA [synthetic construct]
 gb|AHN59250.1| nucleostemin ortholog 3, isoform B [Drosophila melanogaster]
Length=606

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
              R+PR V+ D Y I + KP   E   RPP + ELL AY  +RG++ ++G PD+ R+AR 
Sbjct  426  CERIPRHVLEDKYGIVIAKPLEGEDMERPPHSEELLLAYGYNRGFMTSNGQPDQARSARY  485

Query  613  ILKDYVDGKLPHFEMPPGMPN  551
            +LKDYV+G+L +   PP +P 
Sbjct  486  VLKDYVNGRLLYAMSPPSVPQ  506



>ref|XP_007118987.1| PREDICTED: large subunit GTPase 1 homolog [Physeter catodon]
Length=653

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR+V+   Y I + KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  470  CQNIPRRVLETTYGIDIIKPREDEDPQRPPTSEELLTAYGCMRGFMTAHGQPDQPRSARY  529

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV+GKL +   PPG
Sbjct  530  ILKDYVNGKLLYCHPPPG  547



>ref|XP_004530500.1| PREDICTED: large subunit GTPase 1 homolog isoform X1 [Ceratitis 
capitata]
Length=640

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
             +R+PR V+ D Y I + KP   E + R P A ELL AY  +RG++ ++G PD++R+AR 
Sbjct  460  CSRIPRHVLEDKYGIIIAKPIEGEDEHRSPHAEELLLAYGYNRGFMTSNGQPDQSRSARY  519

Query  613  ILKDYVDGKLPHFEMPPGMP  554
            + KDYV+GKL +   PP +P
Sbjct  520  VCKDYVNGKLLYCLAPPNVP  539



>ref|XP_004530501.1| PREDICTED: large subunit GTPase 1 homolog isoform X2 [Ceratitis 
capitata]
Length=615

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 53/81 (65%), Gaps = 0/81 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
             +R+PR V+ D Y I + KP   E + R P A ELL AY  +RG++ ++G PD++R+AR 
Sbjct  435  CSRIPRHVLEDKYGIIIAKPIEGEDEHRSPHAEELLLAYGYNRGFMTSNGQPDQSRSARY  494

Query  613  ILKDYVDGKLPHFEMPPGMPN  551
            + KDYV+GKL +   PP +P 
Sbjct  495  VCKDYVNGKLLYCLAPPNVPQ  515



>ref|XP_317835.4| AGAP011471-PA [Anopheles gambiae str. PEST]
 gb|EAA13064.4| AGAP011471-PA [Anopheles gambiae str. PEST]
Length=616

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR ++ D Y I + KP   E  +RPP + ELL A+  +RG++ A+G PD++R +R +LK
Sbjct  432  IPRHILEDTYGIMISKPLEGEDPNRPPYSEELLLAFAYNRGFMTANGQPDQSRGSRYVLK  491

Query  604  DYVDGKLPHFEMPPGM  557
            DYV+GKL +   PPG+
Sbjct  492  DYVNGKLLYCYAPPGV  507



>gb|ETN66656.1| nucleostemin 3 [Anopheles darlingi]
Length=621

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+ D Y I + KP   E  +RPP + ELL A+  +RG++ A+G PD++R +R +LK
Sbjct  438  IPRHVLEDTYGIMISKPLEGENPTRPPHSEELLLAFAYNRGFMTANGQPDQSRGSRYVLK  497

Query  604  DYVDGKLPHFEMPPGM  557
            DYV+GKL +   PPG+
Sbjct  498  DYVNGKLLYCYAPPGV  513



>ref|XP_011188955.1| PREDICTED: large subunit GTPase 1 homolog [Bactrocera cucurbitae]
Length=640

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
              R+PR V+ D Y I + KP   E + RPP + ELL +Y  +RG++ ++G PD++R+AR 
Sbjct  460  CERIPRHVLEDKYGIIIAKPIEGEDEDRPPHSEELLLSYGYNRGFMTSNGQPDQSRSARY  519

Query  613  ILKDYVDGKLPHFEMPPGMP  554
            + KDYV+GKL     PP +P
Sbjct  520  VCKDYVNGKLLFCVAPPNVP  539



>ref|XP_007195218.1| PREDICTED: large subunit GTPase 1 homolog [Balaenoptera acutorostrata 
scammoni]
Length=653

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR+V+   Y I + KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  470  CQNIPRRVLEATYGIDIIKPREDEDPQRPPTSEELLTAYGCMRGFMTAHGQPDQPRSARY  529

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV+GKL +   PPG
Sbjct  530  ILKDYVNGKLLYCHPPPG  547



>ref|XP_002071668.1| GK10107 [Drosophila willistoni]
 gb|EDW82654.1| GK10107 [Drosophila willistoni]
Length=610

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
              R+PR V+ D Y I + KP   E   RPP + ELL AY  +RG++ ++G PD+ R+AR 
Sbjct  427  CERIPRHVLEDKYGIVIAKPLEGEDMERPPHSEELLLAYGYNRGFMTSNGQPDQARSARY  486

Query  613  ILKDYVDGKLPHFEMPPGM  557
            +LKDYV+GKL +   PP +
Sbjct  487  VLKDYVNGKLLYALAPPSI  505



>gb|EFX89969.1| hypothetical protein DAPPUDRAFT_309652 [Daphnia pulex]
Length=620

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A+ +PR ++   Y I +PKP   E  +RPP + ELL AY   RG++ A GLPD  R++R 
Sbjct  431  ASLIPRSILESTYGIFIPKPSEGEDATRPPTSEELLNAYGFMRGFMTARGLPDNPRSSRH  490

Query  613  ILKDYVDGKLPHFEMPP  563
            ILKD+V GKL +   PP
Sbjct  491  ILKDFVQGKLLYCNPPP  507



>ref|XP_002424428.1| conserved hypothetical protein [Pediculus humanus corporis]
 gb|EEB11690.1| conserved hypothetical protein [Pediculus humanus corporis]
Length=578

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A+ +PR V+ D Y + LPKPK  E   R P + ELL AY  +RG++  +GLPD  R++R 
Sbjct  389  ASLIPRHVLEDTYGLILPKPKEGEDPDRGPTSEELLNAYGYNRGFMTQNGLPDNPRSSRY  448

Query  613  ILKDYVDGKLPHFEMPP  563
            ILKD+V GKL +   PP
Sbjct  449  ILKDFVSGKLLYCHAPP  465



>ref|XP_004745349.1| PREDICTED: large subunit GTPase 1 homolog isoform X1 [Mustela 
putorius furo]
 ref|XP_004806871.1| PREDICTED: large subunit GTPase 1 homolog isoform X1 [Mustela 
putorius furo]
Length=659

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+  +Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  476  CQNIPRHVLEAIYGINIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARY  535

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV+GKL +   PPG
Sbjct  536  ILKDYVNGKLLYCHPPPG  553



>ref|XP_004745350.1| PREDICTED: large subunit GTPase 1 homolog isoform X2 [Mustela 
putorius furo]
Length=627

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+  +Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  476  CQNIPRHVLEAIYGINIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARY  535

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV+GKL +   PPG
Sbjct  536  ILKDYVNGKLLYCHPPPG  553



>ref|XP_007946217.1| PREDICTED: large subunit GTPase 1 homolog [Orycteropus afer afer]
Length=662

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  482  IPRHVLETTYGITIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARYILK  541

Query  604  DYVDGKLPHFEMPPG  560
            DYV+GKL +   PPG
Sbjct  542  DYVNGKLLYCHPPPG  556



>ref|XP_002009974.1| GI15663 [Drosophila mojavensis]
 gb|EDW07291.1| GI15663 [Drosophila mojavensis]
Length=613

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
              R+PR V+ D Y I + KP   E  +RPP A ELL AY  +RG++ ++G PD+ R+AR 
Sbjct  434  CERIPRHVLEDKYGIVIAKPLEGEDPNRPPFAEELLLAYGYNRGFMTSNGQPDQARSARY  493

Query  613  ILKDYVDGKLPHFEMPPGM  557
            +LKDYV+GKL     PP +
Sbjct  494  VLKDYVNGKLLFALGPPSV  512



>ref|XP_004343924.1| large subunit GTPase [Capsaspora owczarzaki ATCC 30864]
Length=743

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A R+PR+VI   Y I L +P   +   RPP A ELL  Y  +RG++ A G PDE R+AR 
Sbjct  547  AQRIPRRVIESTYGIKLIRPAEGQDPDRPPTAHELLHCYGFNRGFMTAHGSPDEPRSARY  606

Query  613  ILKDYVDGKLPHFEMPPGM  557
            ILKDYV GKL     PP +
Sbjct  607  ILKDYVKGKLLFCHPPPNV  625



>ref|XP_008470860.1| PREDICTED: large subunit GTPase 1 homolog [Diaphorina citri]
Length=595

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            VPR V+ ++Y I + +P   E  +RPP + EL  AY  +RG++ ++G PD  R+AR ILK
Sbjct  414  VPRHVLENIYGIMITQPDEGEDPNRPPFSEELCNAYGYNRGFMTSNGQPDNPRSARYILK  473

Query  604  DYVDGKLPHFEMPPGMP  554
            D+V+G L + + PPG+P
Sbjct  474  DFVNGHLLYCQAPPGVP  490



>gb|KJE96960.1| large subunit GTPase [Capsaspora owczarzaki ATCC 30864]
Length=832

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 48/79 (61%), Gaps = 0/79 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A R+PR+VI   Y I L +P   +   RPP A ELL  Y  +RG++ A G PDE R+AR 
Sbjct  636  AQRIPRRVIESTYGIKLIRPAEGQDPDRPPTAHELLHCYGFNRGFMTAHGSPDEPRSARY  695

Query  613  ILKDYVDGKLPHFEMPPGM  557
            ILKDYV GKL     PP +
Sbjct  696  ILKDYVKGKLLFCHPPPNV  714



>ref|XP_004344108.1| GTPase of unknown function subfamily protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR20705.1| GTPase of unknown function subfamily protein [Acanthamoeba castellanii 
str. Neff]
Length=697

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
              R+PR ++   Y I LPKP   E  +R P  SELL+AY   RG++   G PDE+RAAR 
Sbjct  505  CERIPRSILEGTYGIMLPKPTEEEDPNRVPTPSELLKAYGRIRGFMTVHGSPDESRAARI  564

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV GKL +    PG
Sbjct  565  ILKDYVSGKLLYCHPVPG  582



>ref|XP_005344864.1| PREDICTED: large subunit GTPase 1 homolog [Microtus ochrogaster]
Length=649

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR+V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  469  IPRRVLEATYGINIIKPREDEDPCRPPTSEELLTAYGCMRGFMTAHGQPDQPRSARYILK  528

Query  604  DYVDGKLPHFEMPPG  560
            DYV GKL +   PPG
Sbjct  529  DYVRGKLLYCHPPPG  543



>gb|ELK17622.1| Large subunit GTPase 1 like protein [Pteropus alecto]
Length=291

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I + KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  111  IPRHVLEATYGIDIIKPREDEDPGRPPTSEELLTAYGHMRGFMTAHGQPDQPRSARYILK  170

Query  604  DYVDGKLPHFEMPPG  560
            DYV+GKL +   PPG
Sbjct  171  DYVNGKLLYCHPPPG  185



>ref|XP_007465908.1| PREDICTED: large subunit GTPase 1 homolog [Lipotes vexillifer]
Length=653

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I + KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  469  CQNIPRHVLEATYGIDIIKPREDEDPQRPPTSEELLTAYGCMRGFMTAHGQPDQPRSARY  528

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV+GKL +   PPG
Sbjct  529  ILKDYVNGKLLYCHPPPG  546



>ref|XP_004278816.1| PREDICTED: large subunit GTPase 1 homolog [Orcinus orca]
Length=653

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I + KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  469  CQNIPRHVLEATYGIDIIKPREDEDPQRPPTSEELLTAYGCMRGFMTAHGQPDQPRSARY  528

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV+GKL +   PPG
Sbjct  529  ILKDYVNGKLLYCHPPPG  546



>gb|ENN76213.1| hypothetical protein YQE_07180, partial [Dendroctonus ponderosae]
Length=611

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 51/81 (63%), Gaps = 3/81 (4%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYE--PQSRPPLASELLRAYCASRGYVAASGLPDETRAA  620
              R+PR V+ D+Y I LP P+  E  PQ R   A E L AY  +RG++ A G PD +RAA
Sbjct  426  TQRIPRHVLEDMYGIMLPIPREDEEDPQ-RCSTAEEFLNAYAYNRGFMTAHGQPDGSRAA  484

Query  619  RQILKDYVDGKLPHFEMPPGM  557
            R++LKDY  GKL +   PPG+
Sbjct  485  RKVLKDYTSGKLVYCHAPPGV  505



>ref|XP_007517510.1| PREDICTED: large subunit GTPase 1 homolog [Erinaceus europaeus]
Length=660

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I++ KP+  E  +RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  477  CQNIPRHVLESTYGINIIKPREDEDPNRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARY  536

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV GKL +   PPG
Sbjct  537  ILKDYVSGKLLYCHPPPG  554



>ref|XP_006071717.1| PREDICTED: large subunit GTPase 1 homolog [Bubalus bubalis]
Length=652

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I + KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  472  IPRHVLEATYGIDIIKPREDEDPQRPPTSEELLTAYGCMRGFMTARGQPDQPRSARYILK  531

Query  604  DYVDGKLPHFEMPPG  560
            DYV+GKL +   PPG
Sbjct  532  DYVNGKLLYCHPPPG  546



>ref|XP_003412975.1| PREDICTED: large subunit GTPase 1 homolog [Loxodonta africana]
Length=653

 Score = 74.7 bits (182),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  473  IPRHVLEATYGITIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARYILK  532

Query  604  DYVDGKLPHFEMPPG  560
            DYV+GKL +   PPG
Sbjct  533  DYVNGKLLYCHPPPG  547



>ref|XP_004212815.1| PREDICTED: large subunit GTPase 1 homolog, partial [Hydra vulgaris]
Length=195

 Score = 71.6 bits (174),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR +I ++Y I++PKP   E  +RPP A ELL  Y   RG++ A+G PD  R +R +LK
Sbjct  87   IPRVIIENIYGINIPKPGEGEDLNRPPTAEELLSTYGRMRGFMTANGQPDCPRTSRYVLK  146

Query  604  DYVDGKLPHFEMPPGMPN  551
            D++ GKL +   PP + N
Sbjct  147  DFIKGKLLYCHPPPDVSN  164



>ref|XP_006762056.1| PREDICTED: large subunit GTPase 1 homolog [Myotis davidii]
Length=658

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  475  CQNIPRHVLEATYGINIIKPREDEDPQRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARY  534

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV+GKL +   PPG
Sbjct  535  ILKDYVNGKLLYCHPPPG  552



>gb|ELK31557.1| Large subunit GTPase 1 like protein [Myotis davidii]
Length=665

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  482  CQNIPRHVLEATYGINIIKPREDEDPQRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARY  541

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV+GKL +   PPG
Sbjct  542  ILKDYVNGKLLYCHPPPG  559



>gb|EFB14738.1| hypothetical protein PANDA_010389, partial [Ailuropoda melanoleuca]
Length=627

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  445  CQNIPRHVLESTYGITIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARY  504

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV GKL +   PPG
Sbjct  505  ILKDYVSGKLLYCHPPPG  522



>gb|EHH16870.1| hypothetical protein EGK_12237 [Macaca mulatta]
Length=658

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  478  IPRHVLEATYGINIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARYILK  537

Query  604  DYVDGKLPHFEMPPG  560
            DYV+GKL +   PPG
Sbjct  538  DYVNGKLLYCHPPPG  552



>sp|Q4R8L2.1|LSG1_MACFA RecName: Full=Large subunit GTPase 1 homolog [Macaca fascicularis]
 dbj|BAE00560.1| unnamed protein product [Macaca fascicularis]
Length=653

 Score = 74.7 bits (182),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  479  IPRHVLEATYGINIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARYILK  538

Query  604  DYVDGKLPHFEMPPG  560
            DYV+GKL +   PPG
Sbjct  539  DYVNGKLLYCHPPPG  553



>ref|XP_011379598.1| PREDICTED: large subunit GTPase 1 homolog [Pteropus vampyrus]
Length=658

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I + KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  475  CQNIPRHVLEATYGIDIIKPREDEDPCRPPTSEELLTAYGHMRGFMTAHGQPDQPRSARY  534

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV+GKL +   PPG
Sbjct  535  ILKDYVNGKLLYCHPPPG  552



>ref|NP_001039375.1| large subunit GTPase 1 homolog [Bos taurus]
 sp|Q2YDM7.1|LSG1_BOVIN RecName: Full=Large subunit GTPase 1 homolog [Bos taurus]
 gb|AAI10151.1| Large subunit GTPase 1 homolog (S. cerevisiae) [Bos taurus]
Length=652

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I + KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  469  CQNIPRHVLEATYGIDIIKPREDEDPRRPPTSEELLTAYGCMRGFMTAHGQPDQPRSARY  528

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV+GKL +   PPG
Sbjct  529  ILKDYVNGKLLYCHPPPG  546



>gb|EHH51785.1| hypothetical protein EGM_11228 [Macaca fascicularis]
Length=658

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  478  IPRHVLEATYGINIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARYILK  537

Query  604  DYVDGKLPHFEMPPG  560
            DYV+GKL +   PPG
Sbjct  538  DYVNGKLLYCHPPPG  552



>ref|XP_010832692.1| PREDICTED: large subunit GTPase 1 homolog [Bison bison bison]
Length=649

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I + KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  466  CQNIPRHVLEATYGIDIIKPREDEDPRRPPTSEELLTAYGCMRGFMTAHGQPDQPRSARY  525

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV+GKL +   PPG
Sbjct  526  ILKDYVNGKLLYCHPPPG  543



>ref|XP_002921505.1| PREDICTED: large subunit GTPase 1 homolog [Ailuropoda melanoleuca]
Length=659

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  476  CQNIPRHVLESTYGITIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARY  535

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV GKL +   PPG
Sbjct  536  ILKDYVSGKLLYCHPPPG  553



>tpg|DAA33350.1| TPA: large subunit GTPase 1 homolog [Bos taurus]
Length=652

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I + KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  469  CQNIPRHVLEATYGIDIIKPREDEDPRRPPTSEELLTAYGCMRGFMTAHGQPDQPRSARY  528

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV+GKL +   PPG
Sbjct  529  ILKDYVNGKLLYCHPPPG  546



>ref|XP_004424613.1| PREDICTED: large subunit GTPase 1 homolog [Ceratotherium simum 
simum]
Length=659

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  476  CQNIPRYVLEATYGINIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARY  535

Query  613  ILKDYVDGKLPHFEMPPGM  557
            ILKDYV+GKL +   PPG+
Sbjct  536  ILKDYVNGKLLYCHPPPGI  554



>ref|XP_006084813.1| PREDICTED: large subunit GTPase 1 homolog [Myotis lucifugus]
Length=658

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  475  CQNIPRHVLEATYGINIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARY  534

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV+GKL +   PPG
Sbjct  535  ILKDYVNGKLLYCHPPPG  552



>ref|XP_005545399.1| PREDICTED: large subunit GTPase 1 homolog isoform X1 [Macaca 
fascicularis]
Length=717

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  537  IPRHVLEATYGINIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARYILK  596

Query  604  DYVDGKLPHFEMPPG  560
            DYV+GKL +   PPG
Sbjct  597  DYVNGKLLYCHPPPG  611



>gb|ERL85308.1| hypothetical protein D910_02729 [Dendroctonus ponderosae]
Length=1119

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 51/81 (63%), Gaps = 3/81 (4%)
 Frame = -2

Query  793   ANRVPRKVIGDVYKISLPKPKPYE--PQSRPPLASELLRAYCASRGYVAASGLPDETRAA  620
               R+PR V+ D+Y I LP P+  E  PQ R   A E L AY  +RG++ A G PD +RAA
Sbjct  934   TQRIPRHVLEDMYGIMLPIPREDEEDPQ-RCSTAEEFLNAYAYNRGFMTAHGQPDGSRAA  992

Query  619   RQILKDYVDGKLPHFEMPPGM  557
             R++LKDY  GKL +   PPG+
Sbjct  993   RKVLKDYTSGKLVYCHAPPGV  1013



>ref|XP_011844348.1| PREDICTED: large subunit GTPase 1 homolog isoform X1 [Mandrillus 
leucophaeus]
Length=717

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  537  IPRHVLEATYGINIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARYILK  596

Query  604  DYVDGKLPHFEMPPG  560
            DYV+GKL +   PPG
Sbjct  597  DYVNGKLLYCHPPPG  611



>ref|XP_005873255.1| PREDICTED: large subunit GTPase 1 homolog [Myotis brandtii]
Length=658

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  475  CQNIPRHVLEATYGINIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARY  534

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV+GKL +   PPG
Sbjct  535  ILKDYVNGKLLYCHPPPG  552



>ref|XP_003895355.1| PREDICTED: large subunit GTPase 1 homolog [Papio anubis]
Length=717

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  537  IPRHVLEATYGINIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARYILK  596

Query  604  DYVDGKLPHFEMPPG  560
            DYV+GKL +   PPG
Sbjct  597  DYVNGKLLYCHPPPG  611



>ref|XP_001097108.2| PREDICTED: large subunit GTPase 1 homolog [Macaca mulatta]
Length=717

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  537  IPRHVLEATYGINIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARYILK  596

Query  604  DYVDGKLPHFEMPPG  560
            DYV+GKL +   PPG
Sbjct  597  DYVNGKLLYCHPPPG  611



>ref|XP_011721374.1| PREDICTED: large subunit GTPase 1 homolog isoform X1 [Macaca 
nemestrina]
Length=717

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  537  IPRHVLEATYGINIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARYILK  596

Query  604  DYVDGKLPHFEMPPG  560
            DYV+GKL +   PPG
Sbjct  597  DYVNGKLLYCHPPPG  611



>ref|XP_008007767.1| PREDICTED: large subunit GTPase 1 homolog [Chlorocebus sabaeus]
Length=717

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  537  IPRHVLEATYGINIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARYILK  596

Query  604  DYVDGKLPHFEMPPG  560
            DYV+GKL +   PPG
Sbjct  597  DYVNGKLLYCHPPPG  611



>ref|XP_004373629.1| PREDICTED: large subunit GTPase 1 homolog [Trichechus manatus 
latirostris]
Length=658

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR+V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  478  IPRRVLEATYGITIIKPREDEDPHRPPTSEELLTAYGYLRGFMTAHGQPDQPRSARYILK  537

Query  604  DYVDGKLPHFEMPPG  560
            DYV GKL +   PPG
Sbjct  538  DYVSGKLLYCHPPPG  552



>ref|XP_011844349.1| PREDICTED: large subunit GTPase 1 homolog isoform X2 [Mandrillus 
leucophaeus]
Length=717

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  537  IPRHVLEATYGINIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARYILK  596

Query  604  DYVDGKLPHFEMPPG  560
            DYV+GKL +   PPG
Sbjct  597  DYVNGKLLYCHPPPG  611



>ref|XP_005545400.1| PREDICTED: large subunit GTPase 1 homolog isoform X2 [Macaca 
fascicularis]
Length=717

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  537  IPRHVLEATYGINIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARYILK  596

Query  604  DYVDGKLPHFEMPPG  560
            DYV+GKL +   PPG
Sbjct  597  DYVNGKLLYCHPPPG  611



>gb|AAH80306.1| Lsg1 protein, partial [Mus musculus]
Length=572

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR+V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  389  CQNIPRRVLEVTYGINIIKPREDEDPYRPPTSEELLTAYGCMRGFMTAHGQPDQPRSARY  448

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV GKL +   PPG
Sbjct  449  ILKDYVGGKLLYCHPPPG  466



>ref|XP_011892151.1| PREDICTED: large subunit GTPase 1 homolog isoform X1 [Cercocebus 
atys]
Length=717

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  537  IPRHVLEATYGINIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARYILK  596

Query  604  DYVDGKLPHFEMPPG  560
            DYV+GKL +   PPG
Sbjct  597  DYVNGKLLYCHPPPG  611



>ref|XP_006906226.1| PREDICTED: large subunit GTPase 1 homolog [Pteropus alecto]
Length=658

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I + KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  475  CQNIPRHVLEATYGIDIIKPREDEDPGRPPTSEELLTAYGHMRGFMTAHGQPDQPRSARY  534

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV+GKL +   PPG
Sbjct  535  ILKDYVNGKLLYCHPPPG  552



>ref|XP_010371289.1| PREDICTED: large subunit GTPase 1 homolog [Rhinopithecus roxellana]
Length=716

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  536  IPRHVLEATYGINIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARYILK  595

Query  604  DYVDGKLPHFEMPPG  560
            DYV+GKL +   PPG
Sbjct  596  DYVNGKLLYCHPPPG  610



>ref|XP_008703364.1| PREDICTED: large subunit GTPase 1 homolog [Ursus maritimus]
Length=659

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  476  CQNIPRHVLESTYGINIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARY  535

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV GKL +   PPG
Sbjct  536  ILKDYVSGKLLYCHPPPG  553



>gb|ELR50811.1| Large subunit GTPase 1-like protein [Bos mutus]
Length=659

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I + KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  476  CQNIPRHVLEATYGIDIIKPREDEDPWRPPTSEELLTAYGCMRGFMTAHGQPDQPRSARY  535

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV+GKL +   PPG
Sbjct  536  ILKDYVNGKLLYCHPPPG  553



>ref|XP_006792133.1| PREDICTED: large subunit GTPase 1 homolog [Neolamprologus brichardi]
Length=583

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I++ +P+  E   RPP A ELL AY   RG++ + G PD++R+AR +LK
Sbjct  403  IPRHVLEGTYGINIIRPREDEDPDRPPTAEELLMAYGYMRGFMTSHGQPDQSRSARYVLK  462

Query  604  DYVDGKLPHFEMPPGM  557
            DYV GKL H   PP +
Sbjct  463  DYVSGKLLHCHPPPHI  478



>ref|XP_008264912.1| PREDICTED: large subunit GTPase 1 homolog isoform X2 [Oryctolagus 
cuniculus]
Length=657

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  474  CQNIPRHVLEATYGITIIKPREDEDPHRPPTSEELLTAYGHMRGFMTAHGQPDQPRSARY  533

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV GKL +   PPG
Sbjct  534  ILKDYVSGKLLYCHPPPG  551



>ref|XP_002716566.1| PREDICTED: large subunit GTPase 1 homolog isoform X1 [Oryctolagus 
cuniculus]
Length=659

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  476  CQNIPRHVLEATYGITIIKPREDEDPHRPPTSEELLTAYGHMRGFMTAHGQPDQPRSARY  535

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV GKL +   PPG
Sbjct  536  ILKDYVSGKLLYCHPPPG  553



>gb|ELW50924.1| Large subunit GTPase 1 like protein [Tupaia chinensis]
Length=576

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  397  IPRHVLEATYGINIIKPREDEDPLRPPTSEELLTAYGCMRGFMTAHGQPDQPRSARYILK  456

Query  604  DYVDGKLPHFEMPPG  560
            DYV GKL +   PPG
Sbjct  457  DYVSGKLLYCHPPPG  471



>ref|NP_835170.1| large subunit GTPase 1 homolog [Mus musculus]
 sp|Q3UM18.2|LSG1_MOUSE RecName: Full=Large subunit GTPase 1 homolog [Mus musculus]
 gb|AAH43724.1| Large subunit GTPase 1 homolog (S. cerevisiae) [Mus musculus]
 dbj|BAE27512.1| unnamed protein product [Mus musculus]
 dbj|BAE22495.1| unnamed protein product [Mus musculus]
Length=644

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR+V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  461  CQNIPRRVLEVTYGINIIKPREDEDPYRPPTSEELLTAYGCMRGFMTAHGQPDQPRSARY  520

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV GKL +   PPG
Sbjct  521  ILKDYVGGKLLYCHPPPG  538



>ref|XP_005730420.1| PREDICTED: large subunit GTPase 1 homolog [Pundamilia nyererei]
Length=641

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I++ +P+  E   RPP A ELL AY   RG++ + G PD++R+AR +LK
Sbjct  461  IPRHVLEGTYGINIIRPREDEDPDRPPTAEELLMAYGYMRGFMTSHGQPDQSRSARYVLK  520

Query  604  DYVDGKLPHFEMPPGM  557
            DYV GKL H   PP +
Sbjct  521  DYVSGKLLHCHPPPHI  536



>ref|XP_004562009.1| PREDICTED: large subunit GTPase 1 homolog isoform X1 [Maylandia 
zebra]
 ref|XP_004562010.1| PREDICTED: large subunit GTPase 1 homolog isoform X2 [Maylandia 
zebra]
Length=641

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I++ +P+  E   RPP A ELL AY   RG++ + G PD++R+AR +LK
Sbjct  461  IPRHVLEGTYGINIIRPREDEDPDRPPTAEELLMAYGYMRGFMTSHGQPDQSRSARYVLK  520

Query  604  DYVDGKLPHFEMPPGM  557
            DYV GKL H   PP +
Sbjct  521  DYVSGKLLHCHPPPHI  536



>gb|EDK97741.1| large subunit GTPase 1 homolog (S. cerevisiae), isoform CRA_b 
[Mus musculus]
Length=643

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR+V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  463  IPRRVLEVTYGINIIKPREDEDPYRPPTSEELLTAYGCMRGFMTAHGQPDQPRSARYILK  522

Query  604  DYVDGKLPHFEMPPG  560
            DYV GKL +   PPG
Sbjct  523  DYVGGKLLYCHPPPG  537



>ref|XP_001499014.1| PREDICTED: large subunit GTPase 1 homolog [Equus caballus]
Length=659

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  476  CQNIPRYVLEATYGINIIKPREDEDPCRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARY  535

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV+GKL +   PPG
Sbjct  536  ILKDYVNGKLLYCHPPPG  553



>gb|ERL85309.1| hypothetical protein D910_02729 [Dendroctonus ponderosae]
Length=1048

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 51/81 (63%), Gaps = 3/81 (4%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYE--PQSRPPLASELLRAYCASRGYVAASGLPDETRAA  620
              R+PR V+ D+Y I LP P+  E  PQ R   A E L AY  +RG++ A G PD +RAA
Sbjct  863  TQRIPRHVLEDMYGIMLPIPREDEEDPQ-RCSTAEEFLNAYAYNRGFMTAHGQPDGSRAA  921

Query  619  RQILKDYVDGKLPHFEMPPGM  557
            R++LKDY  GKL +   PPG+
Sbjct  922  RKVLKDYTSGKLVYCHAPPGV  942



>ref|XP_008532943.1| PREDICTED: large subunit GTPase 1 homolog [Equus przewalskii]
Length=659

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  476  CQNIPRYVLEATYGINIIKPREDEDPCRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARY  535

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV+GKL +   PPG
Sbjct  536  ILKDYVNGKLLYCHPPPG  553



>ref|XP_005921035.1| PREDICTED: large subunit GTPase 1 homolog [Haplochromis burtoni]
Length=641

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I++ +P+  E   RPP A ELL AY   RG++ + G PD++R+AR +LK
Sbjct  461  IPRHVLEGTYGINIIRPREDEDPDRPPTAEELLMAYGYMRGFMTSHGQPDQSRSARYVLK  520

Query  604  DYVDGKLPHFEMPPGM  557
            DYV GKL H   PP +
Sbjct  521  DYVSGKLLHCHPPPHI  536



>ref|XP_005903460.1| PREDICTED: large subunit GTPase 1 homolog [Bos mutus]
Length=649

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I + KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  469  IPRHVLEATYGIDIIKPREDEDPWRPPTSEELLTAYGCMRGFMTAHGQPDQPRSARYILK  528

Query  604  DYVDGKLPHFEMPPG  560
            DYV+GKL +   PPG
Sbjct  529  DYVNGKLLYCHPPPG  543



>ref|XP_006873191.1| PREDICTED: large subunit GTPase 1 homolog [Chrysochloris asiatica]
Length=659

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  476  CQNIPRYVLEATYGIAIIKPREDEDPHRPPTSEELLMAYGYMRGFMTAHGQPDQPRSARY  535

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV+GKL +   PPG
Sbjct  536  ILKDYVNGKLLYCHPPPG  553



>dbj|BAE26280.1| unnamed protein product [Mus musculus]
Length=645

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR+V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  462  CQNIPRRVLEVTYGINIIKPREDEDPYRPPTSEELLTAYGCMRGFMTAHGQPDQPRSARY  521

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV GKL +   PPG
Sbjct  522  ILKDYVGGKLLYCHPPPG  539



>ref|XP_005639715.1| PREDICTED: large subunit GTPase 1 homolog [Canis lupus familiaris]
Length=718

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD++R+AR 
Sbjct  535  CQNIPRHVLEATYGINIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQSRSARY  594

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKD+V GKL +   PPG
Sbjct  595  ILKDFVSGKLLYCHPPPG  612



>ref|XP_008557025.1| PREDICTED: large subunit GTPase 1 homolog [Microplitis demolitor]
 gb|EZA45989.1| large subunit GTPase 1-like protein [Microplitis demolitor]
Length=634

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR ++ D Y I LP P+  E  +RPP + E+L  Y  SRG++ A+G PD  R+AR +LK
Sbjct  461  IPRHILEDTYGIMLPPPRDGEDLTRPPTSEEILNTYGYSRGFMTANGQPDNPRSARYLLK  520

Query  604  DYVDGKLPHFEMPPG  560
            D+V+GKL +   PP 
Sbjct  521  DFVNGKLLYCVAPPN  535



>ref|XP_006156812.1| PREDICTED: large subunit GTPase 1 homolog [Tupaia chinensis]
Length=656

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  477  IPRHVLEATYGINIIKPREDEDPLRPPTSEELLTAYGCMRGFMTAHGQPDQPRSARYILK  536

Query  604  DYVDGKLPHFEMPPG  560
            DYV GKL +   PPG
Sbjct  537  DYVSGKLLYCHPPPG  551



>ref|XP_008149837.1| PREDICTED: large subunit GTPase 1 homolog [Eptesicus fuscus]
Length=659

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  476  CQNIPRHVLEATYGINIIKPREDEDPYRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARY  535

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV+GKL +   PPG
Sbjct  536  ILKDYVNGKLLYCHPPPG  553



>ref|XP_008837262.1| PREDICTED: large subunit GTPase 1 homolog [Nannospalax galili]
Length=659

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  476  CQNIPRHVLEATYGINIIKPREDEDPYRPPTSEELLTAYGCMRGFMTAHGQPDQPRSARY  535

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV GKL +   PPG
Sbjct  536  ILKDYVKGKLLYCHPPPG  553



>ref|XP_002178813.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC49511.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=529

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 49/84 (58%), Gaps = 7/84 (8%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSR------PPLASELLRAYCASRGYVAAS-GLPD  635
              R+PR+VI   Y I LPKP   E   R      PP   E L  +C +RG +AAS G+PD
Sbjct  445  CQRIPREVINAHYGIVLPKPSQLEMNERGLTKLPPPSGEEFLGTFCIARGMLAASSGVPD  504

Query  634  ETRAARQILKDYVDGKLPHFEMPP  563
             TRAAR I+KDY DGKL +   PP
Sbjct  505  YTRAARTIIKDYADGKLLYCHPPP  528



>ref|XP_002124678.1| PREDICTED: large subunit GTPase 1 homolog [Ciona intestinalis]
Length=549

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 51/78 (65%), Gaps = 0/78 (0%)
 Frame = -2

Query  790  NRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQI  611
            +R+PR+VI   Y  ++ KPK  E   R P A+E+L A+  SRG++   G PD +R+AR I
Sbjct  375  HRIPRRVIEVTYGFNISKPKEGENPDRVPTAAEILSAHALSRGFMTTHGQPDNSRSARVI  434

Query  610  LKDYVDGKLPHFEMPPGM  557
            LKDYV+GKL     PPG+
Sbjct  435  LKDYVNGKLLCSVPPPGV  452



>ref|XP_006030062.1| PREDICTED: large subunit GTPase 1 homolog [Alligator sinensis]
Length=602

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I++ +P+  E   RPP A ELL AY   RG++ A G PD+ R+AR 
Sbjct  419  CQHIPRHVLEATYGINIIRPREDEDPDRPPTAEELLTAYGYMRGFMTAHGQPDQPRSARY  478

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV GKL +   PPG
Sbjct  479  ILKDYVSGKLLYCHPPPG  496



>ref|XP_001849771.1| conserved hypothetical protein [Culex quinquefasciatus]
 gb|EDS30865.1| conserved hypothetical protein [Culex quinquefasciatus]
Length=613

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR ++ D Y I + KP   E   RPP + ELL A+  +RGY+ A+G PD++R +R +LK
Sbjct  430  IPRHILEDTYGIMIAKPLEGEDPLRPPYSEELLLAFAYNRGYMTANGQPDQSRGSRYVLK  489

Query  604  DYVDGKLPHFEMPP  563
            DYV+GKL +   PP
Sbjct  490  DYVNGKLLYCYAPP  503



>ref|XP_003280466.1| PREDICTED: large subunit GTPase 1 homolog [Nomascus leucogenys]
Length=658

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  478  IPRHVLEATYGINIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARYILK  537

Query  604  DYVDGKLPHFEMPPG  560
            DYV GKL +   PPG
Sbjct  538  DYVSGKLLYCHPPPG  552



>ref|XP_012141059.1| PREDICTED: large subunit GTPase 1 homolog isoform X2 [Megachile 
rotundata]
Length=629

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR VI D+Y I +P P   E   RPP A E+L AY  +RG++  +G PD  R+AR +LK
Sbjct  478  IPRHVIEDLYGIMIPLPLEGEDSDRPPTAEEILNAYGYNRGFMTQNGQPDNPRSARYLLK  537

Query  604  DYVDGKLPHFEMPP  563
            D+V+GKL +   PP
Sbjct  538  DFVNGKLLYCVAPP  551



>ref|XP_005966601.1| PREDICTED: large subunit GTPase 1 homolog [Pantholops hodgsonii]
Length=653

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I + KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR +LK
Sbjct  473  IPRHVLEATYGIDIIKPREDEDPQRPPTSEELLTAYGCMRGFMTAHGQPDQPRSARYVLK  532

Query  604  DYVDGKLPHFEMPPG  560
            DYV GKL +   PPG
Sbjct  533  DYVSGKLLYCHPPPG  547



>ref|XP_002055113.1| GJ19196 [Drosophila virilis]
 gb|EDW65314.1| GJ19196 [Drosophila virilis]
Length=611

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
              R+PR ++ D Y I + KP   E   RPP + ELL AY  +RG++ ++G PD+ R+AR 
Sbjct  432  CERIPRHILEDKYGIVIAKPLEGEDPDRPPFSEELLLAYGYNRGFMTSNGQPDQARSARY  491

Query  613  ILKDYVDGKLPHFEMPPGM  557
            +LKDYV+GKL     PP +
Sbjct  492  VLKDYVNGKLLFALGPPSV  510



>ref|XP_011816598.1| PREDICTED: large subunit GTPase 1 homolog isoform X1 [Colobus 
angolensis palliatus]
Length=717

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  537  IPRHVLEATYGINIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARYILK  596

Query  604  DYVDGKLPHFEMPPG  560
            DYV GKL +   PPG
Sbjct  597  DYVSGKLLYCHPPPG  611



>ref|XP_011816599.1| PREDICTED: large subunit GTPase 1 homolog isoform X2 [Colobus 
angolensis palliatus]
Length=717

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  537  IPRHVLEATYGINIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARYILK  596

Query  604  DYVDGKLPHFEMPPG  560
            DYV GKL +   PPG
Sbjct  597  DYVSGKLLYCHPPPG  611



>ref|XP_005989431.1| PREDICTED: large subunit GTPase 1 homolog [Latimeria chalumnae]
Length=662

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+  +Y I++ +P+  E  +RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  479  CQHIPRAVLEAIYGINIVRPREDEDPNRPPTSEELLVAYGYMRGFMTAHGQPDQPRSARY  538

Query  613  ILKDYVDGKLPHFEMPPGM  557
            ILKDYV+GKL +   PPG+
Sbjct  539  ILKDYVNGKLLYCYPPPGV  557



>ref|XP_001928271.1| PREDICTED: large subunit GTPase 1 homolog [Sus scrofa]
Length=652

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR+V+   Y I + KP+  E   RPP + E L AY   RG++ A G PD+ R+AR 
Sbjct  469  CQNIPRRVLEATYGIDIIKPREDEDPHRPPTSEEFLTAYGYMRGFMTAHGQPDQPRSARY  528

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV+GKL +   PPG
Sbjct  529  ILKDYVNGKLLYCHPPPG  546



>ref|XP_001633047.1| predicted protein [Nematostella vectensis]
 gb|EDO40984.1| predicted protein [Nematostella vectensis]
Length=624

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
             +R+PR V+  +Y I++  P   E   R P A ELL AY   RGY+ +SG PD  R+AR 
Sbjct  456  CHRIPRLVLEGIYGINIASPAEGEDPDRAPYAHELLNAYGYMRGYMTSSGTPDCPRSARY  515

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV+GKL +   PPG
Sbjct  516  ILKDYVNGKLLYCTPPPG  533



>ref|XP_001963924.1| GF21278 [Drosophila ananassae]
 gb|EDV34373.1| GF21278 [Drosophila ananassae]
Length=605

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
              R+PR V+ D Y I + KP   E  +RPP + ELL AY  +RG++ ++G PD+ R+AR 
Sbjct  425  CERIPRHVLEDKYGIVIAKPLEGEDPNRPPHSEELLLAYGYNRGFMTSNGQPDQARSARY  484

Query  613  ILKDYVDGKLPHFEMPPGM  557
            +LKDYV+GKL +   PP +
Sbjct  485  VLKDYVNGKLLYSLGPPSV  503



>ref|XP_010336050.1| PREDICTED: large subunit GTPase 1 homolog [Saimiri boliviensis 
boliviensis]
Length=658

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  475  CQNIPRHVLEVTYGINIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARY  534

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV GKL +   PPG
Sbjct  535  ILKDYVSGKLLYCHPPPG  552



>ref|XP_011952108.1| PREDICTED: large subunit GTPase 1 homolog [Ovis aries]
 ref|XP_011995860.1| PREDICTED: large subunit GTPase 1 homolog [Ovis aries musimon]
Length=652

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I + KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  469  CQNIPRHVLEATYGIDIIKPREDEDPQRPPTSEELLTAYGCMRGFMTAHGQPDQPRSARY  528

Query  613  ILKDYVDGKLPHFEMPPG  560
            +LKDYV GKL +   PPG
Sbjct  529  VLKDYVSGKLLYCHPPPG  546



>ref|XP_006974544.1| PREDICTED: large subunit GTPase 1 homolog [Peromyscus maniculatus 
bairdii]
Length=650

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR+V+   Y I++ KP   E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  466  CQHIPRRVLEATYGINIIKPGEDEDPYRPPTSEELLTAYGCMRGFMTAHGQPDQPRSARY  525

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV GKL +   PPG
Sbjct  526  ILKDYVKGKLLYCHPPPG  543



>ref|XP_001355439.1| GA13246 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL32497.1| GA13246 [Drosophila pseudoobscura pseudoobscura]
Length=602

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
              R+PR V+ D Y I + KP   E   R P + ELL AY  +RG++ ++G PD+ R+AR 
Sbjct  422  CERIPRHVLEDKYGIVIAKPVEGEDMERAPHSEELLLAYGYNRGFMTSNGQPDQARSARY  481

Query  613  ILKDYVDGKLPHFEMPPGM  557
            +LKDYV+GKL +   PP +
Sbjct  482  VLKDYVNGKLLYAMSPPSV  500



>ref|XP_005675154.1| PREDICTED: large subunit GTPase 1 homolog isoform X2 [Capra hircus]
Length=653

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I + KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR +LK
Sbjct  473  IPRHVLEATYGIDIIKPREDEDPQRPPTSEELLTAYGCMRGFMTAHGQPDQPRSARYVLK  532

Query  604  DYVDGKLPHFEMPPG  560
            DYV GKL +   PPG
Sbjct  533  DYVSGKLLYCHPPPG  547



>ref|XP_002021940.1| GL14378 [Drosophila persimilis]
 gb|EDW25881.1| GL14378 [Drosophila persimilis]
Length=602

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
              R+PR V+ D Y I + KP   E   R P + ELL AY  +RG++ ++G PD+ R+AR 
Sbjct  422  CERIPRHVLEDKYGIVIAKPVEGEDMERAPHSEELLLAYGYNRGFMTSNGQPDQARSARY  481

Query  613  ILKDYVDGKLPHFEMPPGM  557
            +LKDYV+GKL +   PP +
Sbjct  482  VLKDYVNGKLLYAMSPPSV  500



>ref|XP_005675153.1| PREDICTED: large subunit GTPase 1 homolog isoform X1 [Capra hircus]
Length=653

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I + KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  470  CQNIPRHVLEATYGIDIIKPREDEDPQRPPTSEELLTAYGCMRGFMTAHGQPDQPRSARY  529

Query  613  ILKDYVDGKLPHFEMPPG  560
            +LKDYV GKL +   PPG
Sbjct  530  VLKDYVSGKLLYCHPPPG  547



>ref|XP_003691565.1| PREDICTED: LOW QUALITY PROTEIN: large subunit GTPase 1 homolog 
[Apis florea]
Length=624

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +P+ +I D+Y I +P P   E   RPP A E+L AY  SRG++  +G PD  R+AR +LK
Sbjct  436  IPKHIIEDLYGIMIPLPLEGEDSDRPPTAEEILNAYGYSRGFMTQNGQPDNPRSARYLLK  495

Query  604  DYVDGKLPHFEMPPGM  557
            D+V+GKL +   PP +
Sbjct  496  DFVNGKLLYCVAPPTI  511



>ref|XP_012141057.1| PREDICTED: large subunit GTPase 1 homolog isoform X1 [Megachile 
rotundata]
 ref|XP_012141058.1| PREDICTED: large subunit GTPase 1 homolog isoform X1 [Megachile 
rotundata]
Length=666

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR VI D+Y I +P P   E   RPP A E+L AY  +RG++  +G PD  R+AR +LK
Sbjct  478  IPRHVIEDLYGIMIPLPLEGEDSDRPPTAEEILNAYGYNRGFMTQNGQPDNPRSARYLLK  537

Query  604  DYVDGKLPHFEMPP  563
            D+V+GKL +   PP
Sbjct  538  DFVNGKLLYCVAPP  551



>ref|XP_006278214.1| PREDICTED: large subunit GTPase 1 homolog [Alligator mississippiensis]
Length=668

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I++ +P+  E   RPP A ELL AY   RG++ A G PD+ R+AR 
Sbjct  485  CQHIPRHVLEAAYGINIIRPREDEDPDRPPTAEELLTAYGYMRGFMTAHGQPDQPRSARY  544

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV GKL +   PPG
Sbjct  545  ILKDYVSGKLLYCHPPPG  562



>emb|CDS20006.1| GTP binding protein HSR1 [Echinococcus granulosus]
Length=739

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
              ++PR+V+  +Y IS+  PK +E  +RPP   ELL AY   RG+++A G P   RAAR 
Sbjct  456  CEQIPREVLTALYGISIRPPKEFEDPNRPPTPHELLAAYACIRGFMSAKGNPHYDRAARI  515

Query  613  ILKDYVDGKLPHFEMPPGM  557
            ILKDYV G+L +   PPG+
Sbjct  516  ILKDYVKGRLRYCHPPPGI  534



>gb|ELW72897.1| Large subunit GTPase 1 like protein [Tupaia chinensis]
Length=242

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y IS+ KP+  E   RPP + ELL AY    G++ A G PD+ R+AR 
Sbjct  59   CQNIPRHVLEATYSISIIKPREDEDPLRPPTSEELLTAYGCMPGFMTAHGQPDQPRSARY  118

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV GKL +   PPG
Sbjct  119  ILKDYVSGKLLYCHPPPG  136



>ref|XP_005338482.1| PREDICTED: large subunit GTPase 1 homolog [Ictidomys tridecemlineatus]
Length=551

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  368  CQNIPRHVLEATYGINIIKPREDEDPYRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARY  427

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV GKL +   PPG
Sbjct  428  ILKDYVKGKLLYCHPPPG  445



>ref|XP_006201007.1| PREDICTED: large subunit GTPase 1 homolog [Vicugna pacos]
Length=658

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I + KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  475  CQNIPRHVLEATYGIDIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARY  534

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV GKL +   PPG
Sbjct  535  ILKDYVSGKLLYCHPPPG  552



>ref|XP_006179022.1| PREDICTED: large subunit GTPase 1 homolog [Camelus ferus]
 ref|XP_010957584.1| PREDICTED: large subunit GTPase 1 homolog [Camelus bactrianus]
 ref|XP_010992691.1| PREDICTED: large subunit GTPase 1 homolog [Camelus dromedarius]
Length=658

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR V+   Y I + KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR 
Sbjct  475  CQNIPRHVLEATYGIDIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARY  534

Query  613  ILKDYVDGKLPHFEMPPG  560
            ILKDYV GKL +   PPG
Sbjct  535  ILKDYVSGKLLYCHPPPG  552



>ref|XP_007091041.1| PREDICTED: large subunit GTPase 1 homolog [Panthera tigris altaica]
Length=659

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  479  IPRYVLEATYGINIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARYILK  538

Query  604  DYVDGKLPHFEMPPG  560
            DYV GKL +   PPG
Sbjct  539  DYVSGKLLYCHPPPG  553



>ref|XP_011284181.1| PREDICTED: large subunit GTPase 1 homolog [Felis catus]
Length=659

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = -2

Query  784  VPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQILK  605
            +PR V+   Y I++ KP+  E   RPP + ELL AY   RG++ A G PD+ R+AR ILK
Sbjct  479  IPRYVLEATYGINIIKPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQPDQPRSARYILK  538

Query  604  DYVDGKLPHFEMPPG  560
            DYV GKL +   PPG
Sbjct  539  DYVSGKLLYCHPPPG  553



>emb|CDI98348.1| GTP binding protein, HSR1 [Echinococcus multilocularis]
Length=736

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
              ++PR+V+  +Y IS+  PK +E  +RPP   ELL AY   RG+++A G P   RAAR 
Sbjct  456  CEQIPREVLTALYGISIRPPKEFEDPNRPPTPHELLAAYACIRGFMSAKGNPHYDRAARI  515

Query  613  ILKDYVDGKLPHFEMPPGM  557
            ILKDYV G+L +   PPG+
Sbjct  516  ILKDYVKGRLRYCHPPPGI  534



>ref|XP_968889.1| PREDICTED: large subunit GTPase 1 homolog [Tribolium castaneum]
 gb|EFA03822.1| hypothetical protein TcasGA2_TC013937 [Tribolium castaneum]
Length=593

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
            A  +P+ V+ D Y I LP P   E   R P + ELL AY  +RG++ A+G PD  RAAR 
Sbjct  413  ATLIPKHVLEDKYGIMLPAPLEGEDPDRCPTSEELLNAYAYNRGFMTANGQPDNPRAARY  472

Query  613  ILKDYVDGKLPHFEMPPGM  557
            ILKDY++GKL +   PP +
Sbjct  473  ILKDYMNGKLLYCHAPPNV  491



>ref|XP_008922841.1| PREDICTED: large subunit GTPase 1 homolog, partial [Manacus vitellinus]
Length=595

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = -2

Query  793  ANRVPRKVIGDVYKISLPKPKPYEPQSRPPLASELLRAYCASRGYVAASGLPDETRAARQ  614
               +PR ++   Y IS+ +P+  E   R P A ELL AY   RG++ A G PD+ R+AR 
Sbjct  412  CQHIPRNILEATYGISIIRPREDEDPDRKPTAEELLTAYGYMRGFMTAHGQPDQPRSARY  471

Query  613  ILKDYVDGKLPHFEMPPGM-PN  551
            +LKDYV+GKL +   PPG+ PN
Sbjct  472  VLKDYVNGKLLYCHPPPGIDPN  493



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1614230233668