BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig14018

Length=782
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006365002.1|  PREDICTED: allantoate deiminase-like               323   3e-104   Solanum tuberosum [potatoes]
ref|XP_009628190.1|  PREDICTED: allantoate deiminase                    322   2e-103   Nicotiana tomentosiformis
ref|XP_004233270.1|  PREDICTED: allantoate deiminase                    320   4e-103   Solanum lycopersicum
ref|XP_009774500.1|  PREDICTED: allantoate deiminase                    320   1e-102   Nicotiana sylvestris
gb|EYU43647.1|  hypothetical protein MIMGU_mgv1a005319mg                311   2e-99    Erythranthe guttata [common monkey flower]
ref|XP_011096836.1|  PREDICTED: allantoate deiminase                    310   5e-99    Sesamum indicum [beniseed]
ref|XP_011035488.1|  PREDICTED: allantoate deiminase isoform X3         300   4e-96    Populus euphratica
ref|XP_011035487.1|  PREDICTED: allantoate deiminase isoform X2         300   3e-95    Populus euphratica
ref|XP_011035486.1|  PREDICTED: allantoate deiminase isoform X1         300   3e-95    Populus euphratica
ref|XP_006369050.1|  peptidase M20/M25/M40 family protein               298   1e-94    
emb|CAN83127.1|  hypothetical protein VITISV_029535                     291   4e-94    Vitis vinifera
ref|XP_008225895.1|  PREDICTED: allantoate deiminase                    294   1e-92    Prunus mume [ume]
emb|CBI27216.3|  unnamed protein product                                293   2e-92    Vitis vinifera
ref|XP_012088571.1|  PREDICTED: allantoate deiminase isoform X2         293   2e-92    Jatropha curcas
ref|XP_012088570.1|  PREDICTED: allantoate deiminase isoform X1         293   2e-92    Jatropha curcas
ref|XP_002275843.2|  PREDICTED: allantoate deiminase                    293   2e-92    Vitis vinifera
ref|XP_007212027.1|  hypothetical protein PRUPE_ppa005027mg             291   3e-92    
ref|XP_009354000.1|  PREDICTED: allantoate deiminase-like               291   9e-92    Pyrus x bretschneideri [bai li]
ref|XP_010051828.1|  PREDICTED: allantoate deiminase isoform X2         288   1e-91    Eucalyptus grandis [rose gum]
ref|XP_007041020.1|  Allantoate amidohydrolase isoform 2                288   1e-91    
ref|XP_011652398.1|  PREDICTED: allantoate deiminase isoform X2         288   1e-91    Cucumis sativus [cucumbers]
ref|XP_010684279.1|  PREDICTED: allantoate deiminase                    290   2e-91    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008383283.1|  PREDICTED: allantoate deiminase                    290   2e-91    Malus domestica [apple tree]
ref|XP_006596931.1|  PREDICTED: allantoate amidohydrolase isoform X1    287   2e-91    
ref|XP_009340289.1|  PREDICTED: allantoate deiminase-like               290   3e-91    
ref|XP_007041019.1|  Allantoate amidohydrolase isoform 1                290   4e-91    Theobroma cacao [chocolate]
ref|XP_010051826.1|  PREDICTED: allantoate deiminase isoform X1         289   4e-91    Eucalyptus grandis [rose gum]
ref|XP_004293794.2|  PREDICTED: allantoate deiminase                    292   5e-91    Fragaria vesca subsp. vesca
ref|XP_004145132.1|  PREDICTED: allantoate deiminase isoform X1         289   8e-91    Cucumis sativus [cucumbers]
emb|CAO78893.1|  allantoate amidohydrolase                              288   2e-90    Glycine max [soybeans]
ref|NP_001236563.1|  allantoate amidohydrolase precursor                287   2e-90    Glycine max [soybeans]
gb|KHN47732.1|  Allantoate deiminase, chloroplastic                     287   3e-90    Glycine soja [wild soybean]
gb|ACK75561.1|  allantoate amidohydrolase                               287   3e-90    Glycine max [soybeans]
ref|XP_010097117.1|  Allantoate deiminase                               287   3e-90    
ref|XP_006586949.1|  PREDICTED: allantoate deiminase-like isoform X2    284   5e-90    Glycine max [soybeans]
ref|XP_008446305.1|  PREDICTED: allantoate deiminase                    288   5e-90    
gb|KJB48032.1|  hypothetical protein B456_008G050700                    284   5e-90    Gossypium raimondii
ref|XP_007138853.1|  hypothetical protein PHAVU_009G242900g             283   1e-89    Phaseolus vulgaris [French bean]
ref|XP_003533667.1|  PREDICTED: allantoate deiminase-like isoform X1    283   7e-89    
gb|KJB48025.1|  hypothetical protein B456_008G050700                    283   7e-89    Gossypium raimondii
ref|XP_007138851.1|  hypothetical protein PHAVU_009G242900g             283   1e-88    Phaseolus vulgaris [French bean]
gb|ABR57240.2|  putative allantoate amidohydrolase                      283   1e-88    Phaseolus vulgaris [French bean]
gb|KEH37361.1|  allantoate amidohydrolase                               279   3e-88    Medicago truncatula
ref|XP_004487909.1|  PREDICTED: allantoate deiminase, chloroplast...    280   4e-88    Cicer arietinum [garbanzo]
ref|XP_004487908.1|  PREDICTED: allantoate deiminase, chloroplast...    280   5e-88    
ref|XP_002532138.1|  conserved hypothetical protein                     280   5e-88    
ref|XP_004487907.1|  PREDICTED: allantoate deiminase, chloroplast...    280   2e-87    Cicer arietinum [garbanzo]
gb|KEH37360.1|  allantoate amidohydrolase                               279   4e-87    Medicago truncatula
ref|XP_007212028.1|  hypothetical protein PRUPE_ppa005027mg             277   2e-86    
ref|XP_003594851.1|  Allantoate amidohydrolase                          280   2e-86    
gb|EPS72270.1|  hypothetical protein M569_02484                         274   1e-85    Genlisea aurea
gb|KDO77265.1|  hypothetical protein CISIN_1g015341mg                   268   2e-85    Citrus sinensis [apfelsine]
ref|XP_006448626.1|  hypothetical protein CICLE_v10015120mg             273   8e-85    Citrus clementina [clementine]
ref|XP_006283501.1|  hypothetical protein CARUB_v10004553mg             274   1e-84    Capsella rubella
gb|KDO77263.1|  hypothetical protein CISIN_1g015341mg                   270   1e-84    Citrus sinensis [apfelsine]
gb|KCW75654.1|  hypothetical protein EUGRSUZ_D00017                     273   2e-84    Eucalyptus grandis [rose gum]
ref|XP_002869950.1|  hypothetical protein ARALYDRAFT_914645             272   7e-84    Arabidopsis lyrata subsp. lyrata
ref|XP_006468549.1|  PREDICTED: allantoate deiminase-like               270   8e-84    Citrus sinensis [apfelsine]
ref|NP_193740.1|  allantoate amidohydrolase                             271   1e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009137035.1|  PREDICTED: allantoate deiminase                    271   1e-83    Brassica rapa
ref|XP_010536943.1|  PREDICTED: allantoate deiminase                    271   1e-83    Tarenaya hassleriana [spider flower]
ref|XP_010439619.1|  PREDICTED: allantoate deiminase-like               271   2e-83    Camelina sativa [gold-of-pleasure]
gb|AFK37421.1|  unknown                                                 266   5e-83    Lotus japonicus
ref|XP_010434321.1|  PREDICTED: allantoate deiminase-like               269   8e-83    Camelina sativa [gold-of-pleasure]
ref|XP_006413904.1|  hypothetical protein EUTSA_v10024702mg             269   6e-82    
ref|XP_010449233.1|  PREDICTED: allantoate deiminase                    266   2e-81    Camelina sativa [gold-of-pleasure]
ref|XP_006413901.1|  hypothetical protein EUTSA_v10025370mg             261   3e-81    
emb|CDY01635.1|  BnaC07g36250D                                          257   3e-78    
emb|CDX98655.1|  BnaA03g44400D                                          254   4e-77    
ref|XP_010260694.1|  PREDICTED: allantoate deiminase isoform X1         245   1e-75    Nelumbo nucifera [Indian lotus]
ref|XP_009408250.1|  PREDICTED: probable allantoate deiminase iso...    241   3e-73    
ref|XP_011628473.1|  PREDICTED: allantoate deiminase                    243   4e-73    Amborella trichopoda
gb|ERN19684.1|  hypothetical protein AMTR_s00062p00185230               243   4e-73    Amborella trichopoda
ref|XP_009408248.1|  PREDICTED: probable allantoate deiminase iso...    241   2e-72    
ref|XP_009408249.1|  PREDICTED: probable allantoate deiminase iso...    241   2e-72    
gb|ACN31546.1|  unknown                                                 238   7e-72    Zea mays [maize]
ref|XP_002438812.1|  hypothetical protein SORBIDRAFT_10g026590          239   2e-71    Sorghum bicolor [broomcorn]
ref|XP_010914255.1|  PREDICTED: probable allantoate deiminase iso...    238   2e-71    
ref|XP_008809343.1|  PREDICTED: probable allantoate deiminase iso...    238   2e-71    
ref|XP_008809341.1|  PREDICTED: probable allantoate deiminase iso...    238   2e-71    Phoenix dactylifera
ref|XP_008809339.1|  PREDICTED: probable allantoate deiminase iso...    238   3e-71    
ref|XP_008809340.1|  PREDICTED: probable allantoate deiminase iso...    238   3e-71    
ref|NP_001151245.1|  metallopeptidase precursor                         237   7e-71    Zea mays [maize]
ref|XP_004965622.1|  PREDICTED: allantoate deiminase, chloroplast...    235   4e-70    Setaria italica
ref|XP_010914254.1|  PREDICTED: probable allantoate deiminase iso...    234   1e-69    Elaeis guineensis
ref|XP_004965621.1|  PREDICTED: allantoate deiminase, chloroplast...    233   1e-69    
gb|EEE66180.1|  hypothetical protein OsJ_22281                          233   1e-69    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010240394.1|  PREDICTED: probable allantoate deiminase iso...    232   3e-69    Brachypodium distachyon [annual false brome]
ref|XP_010240400.1|  PREDICTED: probable allantoate deiminase iso...    233   3e-69    
ref|NP_001058304.1|  Os06g0665500                                       231   5e-69    
gb|EMT22145.1|  Allantoate deiminase, chloroplastic                     231   8e-69    
emb|CDP18200.1|  unnamed protein product                                221   9e-69    Coffea canephora [robusta coffee]
dbj|BAK06888.1|  predicted protein                                      226   3e-67    Hordeum vulgare subsp. vulgare [two-rowed barley]
pir||T04891  hyuC protein homolog F18F4.170 - Arabidopsis thalian...    220   1e-66 
gb|EEC81134.1|  hypothetical protein OsI_24029                          221   5e-66    Oryza sativa Indica Group [Indian rice]
ref|XP_006657227.1|  PREDICTED: probable allantoate deiminase-like      207   6e-62    
gb|KDO77267.1|  hypothetical protein CISIN_1g015341mg                   196   1e-60    Citrus sinensis [apfelsine]
gb|ABX10796.1|  putative allantoate amidohydrolase                      197   3e-60    Glycine max [soybeans]
gb|ABX10795.1|  putative allantoate amidohydrolase                      196   1e-58    Glycine max [soybeans]
ref|XP_001751276.1|  predicted protein                                  196   2e-55    
ref|XP_001783993.1|  predicted protein                                  191   1e-53    
ref|XP_002986766.1|  hypothetical protein SELMODRAFT_182622             185   3e-53    
ref|XP_002969520.1|  hypothetical protein SELMODRAFT_91525              184   4e-53    
gb|KDO77266.1|  hypothetical protein CISIN_1g015341mg                   161   4e-50    Citrus sinensis [apfelsine]
gb|KJB48030.1|  hypothetical protein B456_008G050700                    134   4e-41    Gossypium raimondii
gb|KJB48028.1|  hypothetical protein B456_008G050700                    134   4e-41    Gossypium raimondii
ref|XP_010260695.1|  PREDICTED: allantoate deiminase isoform X2         120   4e-38    Nelumbo nucifera [Indian lotus]
ref|XP_002948874.1|  hypothetical protein VOLCADRAFT_58608              134   7e-37    Volvox carteri f. nagariensis
ref|XP_002507571.1|  predicted protein                                  126   8e-35    Micromonas commoda
gb|EMS60014.1|  Allantoate deiminase, chloroplastic                     113   8e-34    Triticum urartu
ref|WP_034845163.1|  allantoate amidohydrolase                          123   3e-31    Inquilinus limosus
gb|KIE63294.1|  allantoate amidohydrolase                               124   3e-31    
ref|WP_039732860.1|  allantoate amidohydrolase                          124   3e-31    Komagataeibacter intermedius
ref|WP_018391035.1|  allantoate amidohydrolase                          121   5e-31    Ancylobacter sp. FA202
ref|WP_013166520.1|  allantoate amidohydrolase                          119   2e-30    Starkeya novella
ref|WP_044056798.1|  allantoate amidohydrolase                          115   3e-30    Alteromonas australica
gb|EGD59653.1|  allantoate amidohydrolase                               119   4e-30    Novosphingobium nitrogenifigens DSM 19370
ref|WP_018075493.1|  allantoate amidohydrolase                          119   4e-30    Novosphingobium nitrogenifigens
ref|WP_044447014.1|  allantoate amidohydrolase                          114   6e-30    Alteromonas australica
ref|WP_032095087.1|  MULTISPECIES: allantoate amidohydrolase            114   8e-30    Alteromonas
ref|WP_023850475.1|  hypothetical protein                               113   9e-30    Rhodobacteraceae bacterium PD-2
ref|WP_044538498.1|  allantoate amidohydrolase                          116   9e-30    Bradyrhizobium sp. LTSP885
ref|WP_037523298.1|  allantoate amidohydrolase                          122   1e-29    Sphingomonas wittichii
ref|WP_013784605.1|  allantoate amidohydrolase                          113   2e-29    Alteromonas naphthalenivorans
ref|XP_011398581.1|  Allantoate deiminase                               112   2e-29    Auxenochlorella protothecoides
ref|WP_018181698.1|  hypothetical protein                               108   3e-29    Kaistia granuli
ref|WP_007917264.1|  amidase                                            115   4e-29    Ktedonobacter racemifer
ref|WP_037019426.1|  allantoate amidohydrolase                          114   5e-29    Rhizobiales bacterium YIM 77505
ref|WP_029356018.1|  allantoate amidohydrolase                          113   6e-29    Bosea sp. 117
ref|WP_039999451.1|  allantoate amidohydrolase                          115   7e-29    Komagataeibacter
gb|EGG76053.1|  Allantoate deiminase                                    114   8e-29    Gluconacetobacter sp. SXCC-1
ref|WP_018307755.1|  allantoate amidohydrolase                          116   9e-29    Acetobacter aceti
dbj|GAN58440.1|  amidohydrolase/allantoate amidohydrolase               116   1e-28    Acetobacter aceti NBRC 14818
dbj|GAN70979.1|  amidohydrolase/N-carbamoyl-L-amino acid hydrolase      122   1e-28    Acetobacter syzygii 9H-2
ref|WP_044330471.1|  allantoate amidohydrolase                          122   1e-28    
ref|WP_026870833.1|  allantoate amidohydrolase                          122   2e-28    Inquilinus limosus
ref|WP_044587468.1|  allantoate amidohydrolase                          112   2e-28    Bradyrhizobium sp. LTSPM299
ref|WP_034931655.1|  allantoate amidohydrolase                          113   2e-28    Komagataeibacter rhaeticus
ref|WP_024511318.1|  allantoate amidohydrolase                          114   2e-28    
ref|WP_006115346.1|  allantoate amidohydrolase                          113   3e-28    Acetobacter
gb|KGB25587.1|  N-carbamoyl-L-amino acid hydrolase                      113   3e-28    Acetobacter pomorum
emb|CCT58240.1|  N-carbamyl-L-amino acid amidohydrolase                 113   3e-28    Acetobacter pasteurianus 386B
ref|WP_003624336.1|  N-carbamoyl-L-amino-acid hydrolase                 113   3e-28    Acetobacter pasteurianus
ref|WP_012812933.1|  allantoate amidohydrolase                          113   3e-28    Acetobacter pasteurianus
ref|WP_013653000.1|  allantoate amidohydrolase                          107   4e-28    Polymorphum gilvum
emb|CCD00529.1|  N-carbamoyl-L-amino acid hydrolase (fragment)          107   4e-28    Azospirillum brasilense Sp245
ref|WP_004449887.1|  allantoate amidohydrolase                          112   5e-28    Acetobacter pasteurianus
ref|WP_029329455.1|  allantoate amidohydrolase                          112   6e-28    Komagataeibacter oboediens
ref|WP_027135007.1|  allantoate amidohydrolase                          111   6e-28    Geminicoccus roseus
ref|WP_041247455.1|  allantoate amidohydrolase                          113   7e-28    Komagataeibacter medellinensis
ref|WP_016843100.1|  hypothetical protein                               112   7e-28    
ref|WP_028339443.1|  allantoate amidohydrolase                          111   7e-28    Bradyrhizobium elkanii
ref|WP_005859514.1|  N-carbamoyl-L-amino acid amidohydrolase            107   7e-28    Sagittula stellata
dbj|BAK85109.1|  allantoate amidohydrolase                              113   7e-28    Komagataeibacter medellinensis NBRC 3288
dbj|GAN98451.1|  amidohydrolase/allantoate amidohydrolase               112   8e-28    Komagataeibacter xylinus NBRC 13693
ref|WP_018270389.1|  allantoate amidohydrolase                          112   8e-28    
ref|WP_019090352.1|  allantoate amidohydrolase                          112   8e-28    Acetobacter pasteurianus
ref|WP_039216178.1|  allantoate amidohydrolase                          108   8e-28    Alteromonas marina
gb|ADM10348.1|  N-carbamoyl-L-amino acid amidohydrolase                 109   9e-28    Parvularcula bermudensis HTCC2503
emb|CDP18199.1|  unnamed protein product                              87.0    9e-28    Coffea canephora [robusta coffee]
ref|WP_028170521.1|  allantoate amidohydrolase                          111   1e-27    Bradyrhizobium japonicum
dbj|GAN79857.1|  amidohydrolase/hydantoinase/carbamoylase family ...    110   1e-27    Acidocella aminolytica 101 = DSM 11237
ref|WP_039279170.1|  allantoate amidohydrolase                          114   1e-27    Novosphingobium malaysiense
ref|WP_026790146.1|  allantoate amidohydrolase                          105   1e-27    
dbj|BAL08835.1|  hypothetical protein BJ6T_35610                        111   1e-27    Bradyrhizobium japonicum USDA 6
ref|WP_043645604.1|  allantoate amidohydrolase                          115   1e-27    
ref|WP_043332840.1|  hypothetical protein                               111   1e-27    
gb|EKV29225.1|  N-carbamoyl-L-amino acid hydrolase                      115   1e-27    Caenispirillum salinarum AK4
ref|WP_026783474.1|  allantoate amidohydrolase                          103   1e-27    
gb|ERF83069.1|  hydantoinase/carbamoylase family amidase                111   1e-27    Bradyrhizobium sp. DFCI-1
ref|WP_035650405.1|  allantoate amidohydrolase                          111   1e-27    Bradyrhizobium sp. MOS004
ref|WP_029587081.1|  allantoate amidohydrolase                          111   1e-27    Bradyrhizobium sp. URHD0069
ref|WP_038098309.1|  allantoate amidohydrolase                          107   1e-27    Thioalkalivibrio sp. HK1
ref|WP_029073666.1|  allantoate amidohydrolase                          106   2e-27    Kaistia adipata
ref|WP_038934664.1|  allantoate amidohydrolase                          110   2e-27    Bradyrhizobium japonicum
ref|WP_008993392.1|  allantoate amidohydrolase                          113   2e-27    Novosphingobium sp. Rr 2-17
ref|WP_014998038.1|  allantoate amidohydrolase                          106   2e-27    Alteromonas macleodii
ref|WP_024016109.1|  allantoate amidohydrolase                          105   2e-27    Alteromonas mediterranea
ref|WP_014978988.1|  allantoate amidohydrolase                          106   2e-27    Alteromonas macleodii
ref|WP_012518076.1|  allantoate amidohydrolase                          105   2e-27    Alteromonas mediterranea
ref|WP_014976208.1|  allantoate amidohydrolase                          106   2e-27    Alteromonas macleodii
ref|WP_024580744.1|  MULTISPECIES: allantoate amidohydrolase            110   2e-27    Bradyrhizobium
ref|WP_039227177.1|  allantoate amidohydrolase                          106   2e-27    Alteromonas macleodii
ref|XP_006413903.1|  hypothetical protein EUTSA_v10024702mg           75.5    2e-27    
ref|WP_035690370.1|  allantoate amidohydrolase                          109   2e-27    Bradyrhizobium elkanii
ref|WP_014949087.1|  allantoate amidohydrolase                          106   2e-27    Alteromonas
ref|WP_041959304.1|  allantoate amidohydrolase                          110   3e-27    Bradyrhizobium japonicum
ref|WP_028334435.1|  allantoate amidohydrolase                          110   3e-27    Bradyrhizobium elkanii
ref|WP_037446856.1|  hypothetical protein                               110   3e-27    Skermanella stibiiresistens
ref|WP_014250122.1|  allantoate amidohydrolase                          103   3e-27    Azospirillum lipoferum
ref|WP_041535635.1|  hypothetical protein                               107   3e-27    
ref|WP_019084783.1|  allantoate amidohydrolase                          110   3e-27    Komagataeibacter europaeus
ref|WP_026019539.1|  allantoate amidohydrolase                          110   3e-27    Komagataeibacter europaeus
ref|WP_025254850.1|  allantoate amidohydrolase                          107   3e-27    Alteromonas sp. ALT199
ref|WP_007416480.1|  amidase                                            109   3e-27    Pedosphaera parvula
ref|WP_035773888.1|  allantoate amidohydrolase                          118   3e-27    
ref|WP_019241899.1|  hypothetical protein                               106   3e-27    Bacillus massilioanorexius
ref|WP_024953308.1|  hypothetical protein                               110   4e-27    Cobetia crustatorum
dbj|GAN97207.1|  amidohydrolase/allantoate amidohydrolase               109   4e-27    Komagataeibacter europaeus NBRC 3261
ref|WP_027705824.1|  hypothetical protein                               111   4e-27    Zymobacter palmae
ref|WP_028156669.1|  allantoate amidohydrolase                          109   4e-27    Bradyrhizobium japonicum
gb|AGP77713.1|  allantoate amidohydrolase                               104   4e-27    Alteromonas mediterranea 615
ref|WP_015066873.1|  allantoate amidohydrolase                          103   4e-27    Alteromonas mediterranea
ref|WP_038388099.1|  allantoate amidohydrolase                          109   5e-27    
ref|WP_045585323.1|  allantoate amidohydrolase                          110   5e-27    Azospirillum thiophilum
ref|WP_023944582.1|  deacylase                                          110   6e-27    
ref|WP_023978281.1|  MULTISPECIES: allantoate amidohydrolase            117   6e-27    Asaia
ref|WP_041090521.1|  hydantoinase                                       104   6e-27    Jeotgalibacillus soli
ref|WP_010507608.1|  allantoate amidohydrolase                          108   6e-27    Komagataeibacter europaeus
ref|WP_011252850.1|  allantoate amidohydrolase                          105   7e-27    Gluconobacter oxydans
gb|AHI24598.1|  allantoate amidohydrolase                               108   7e-27    Komagataeibacter xylinus E25
ref|WP_024816379.1|  allantoate amidohydrolase                          117   7e-27    Methylopila sp. 73B
gb|KDD76601.1|  hypothetical protein H632_c166p1                        114   8e-27    Helicosporidium sp. ATCC 50920
ref|WP_007104588.1|  hydantoin utilization protein C                    103   8e-27    Paraglaciecola polaris
ref|WP_041111684.1|  allantoate amidohydrolase                          105   8e-27    Gluconobacter oxydans
ref|WP_025437681.1|  allantoate amidohydrolase                          108   8e-27    Komagataeibacter xylinus
emb|CDG40691.1|  N-carbamoyl-L-amino acid hydrolase                     117   8e-27    Asaia platycodi SF2.1
ref|WP_036474329.1|  hydantoinase                                       117   9e-27    Nesterenkonia sp. AN1
gb|AHY53199.1|  N-carbamoyl-L-amino acid hydrolase                      108   1e-26    Bradyrhizobium japonicum SEMIA 5079
ref|WP_038966724.1|  allantoate amidohydrolase                          105   1e-26    
ref|WP_011088888.1|  allantoate amidohydrolase                          105   1e-26    Bradyrhizobium diazoefficiens
ref|WP_039157600.1|  allantoate amidohydrolase                          108   1e-26    Bradyrhizobium japonicum
gb|AJQ93433.1|  acetylornithine deacetylase/Succinyl-diaminopimel...    108   1e-26    Gynuella sunshinyii YC6258
ref|WP_024343296.1|  allantoate amidohydrolase                          110   1e-26    Bradyrhizobium japonicum
gb|ESQ79076.1|  hypothetical protein AEYBE204_11670                     107   1e-26    Asticcacaulis sp. YBE204
ref|WP_044616225.1|  allantoate amidohydrolase                          108   1e-26    Gynuella sunshinyii
ref|WP_045123696.1|  allantoate amidohydrolase                          106   1e-26    Yersinia pestis
ref|WP_035372394.1|  allantoate amidohydrolase                          116   1e-26    
ref|WP_043149779.1|  allantoate amidohydrolase                          117   1e-26    Sphingobium sp. Ant17
ref|WP_042446589.1|  allantoate amidohydrolase                          102   1e-26    Azospirillum lipoferum
ref|WP_031230786.1|  allantoate amidohydrolase                          107   1e-26    Asticcacaulis sp. YBE204
dbj|BAI76499.1|  allantoate amidohydrolase                              102   1e-26    Azospirillum sp. B510
ref|WP_042787242.1|  allantoate amidohydrolase                          110   2e-26    
ref|WP_028395750.1|  hydantoinase                                       107   2e-26    Bacillus sp. FJAT-14578
ref|WP_038905612.1|  allantoate amidohydrolase                          106   2e-26    Yersinia pestis
ref|WP_016255928.1|  allantoate amidohydrolase                          105   2e-26    Yersinia pestis
gb|AAS60949.1|  putative amino acid hydrolase                           105   2e-26    Yersinia pestis biovar Microtus str. 91001
gb|AAM84520.1|AE013696_13  putative N-carbamyl-L-amino acid amido...    105   2e-26    Yersinia pestis KIM10+
ref|WP_016588400.1|  allantoate amidohydrolase                          105   2e-26    Yersinia pestis
ref|WP_033849543.1|  allantoate amidohydrolase                          107   2e-26    Yersinia wautersii
ref|WP_002231082.1|  allantoate amidohydrolase                          105   2e-26    Yersinia pestis
ref|WP_002208729.1|  allantoate amidohydrolase                          105   2e-26    Yersinia pestis
ref|WP_019122255.1|  hypothetical protein                               105   2e-26    Brevibacillus massiliensis
ref|WP_016603951.1|  allantoate amidohydrolase                          105   2e-26    Yersinia pestis
gb|ADG06712.1|  amidase, hydantoinase/carbamoylase family               110   2e-26    Kyrpidia tusciae DSM 2912
ref|WP_042872342.1|  allantoate amidohydrolase                          108   2e-26    Dickeya sp. NCPPB 569
ref|WP_016676248.1|  allantoate amidohydrolase                          105   2e-26    Yersinia pestis
gb|ETO50142.1|  allantoate amidohydrolase                               105   2e-26    Yersinia pestis S3
ref|WP_036007776.1|  allantoate amidohydrolase                          107   3e-26    Bradyrhizobium yuanmingense
ref|WP_004439892.1|  hydantoinase                                       103   3e-26    Bacillus smithii
ref|WP_035726587.1|  allantoate amidohydrolase                          105   3e-26    Bradyrhizobium elkanii
ref|WP_044442125.1|  hypothetical protein                               115   3e-26    Agreia bicolorata
ref|WP_027579451.1|  allantoate amidohydrolase                          109   3e-26    Bradyrhizobium sp. Ai1a-2
ref|WP_018456684.1|  allantoate amidohydrolase                          106   3e-26    Bradyrhizobium sp. WSM4349
ref|WP_013659366.1|  allantoate amidohydrolase                          103   3e-26    Marinomonas mediterranea
ref|WP_042819786.1|  allantoate amidohydrolase                          106   3e-26    Yersinia wautersii
ref|WP_027545871.1|  allantoate amidohydrolase                          105   3e-26    
ref|WP_025037671.1|  allantoate amidohydrolase                          108   4e-26    Bradyrhizobium sp. DOA9
ref|WP_036045330.1|  allantoate amidohydrolase                          106   4e-26    Bradyrhizobium yuanmingense
ref|WP_039186028.1|  allantoate amidohydrolase                          105   4e-26    
ref|WP_028174413.1|  allantoate amidohydrolase                          105   4e-26    Bradyrhizobium
ref|WP_038957596.1|  allantoate amidohydrolase                          106   4e-26    Bradyrhizobium japonicum
ref|WP_027576194.1|  allantoate amidohydrolase                          106   4e-26    Bradyrhizobium sp. WSM1743
emb|CFR24996.1|  acetylornithine deacetylase/succinyl-diaminopime...    105   4e-26    Yersinia kristensenii
ref|WP_028481043.1|  allantoate amidohydrolase                          100   4e-26    
ref|WP_045123871.1|  allantoate amidohydrolase                          104   4e-26    Yersinia pestis
ref|WP_025382758.1|  allantoate amidohydrolase                          109   5e-26    Yersinia pseudotuberculosis complex
ref|WP_010503594.1|  allantoate amidohydrolase                          108   5e-26    Gluconobacter frateurii
ref|WP_008130275.1|  allantoate amidohydrolase                          106   5e-26    Bradyrhizobium sp. YR681
ref|WP_027882050.1|  allantoate amidohydrolase                          102   5e-26    Meiothermus rufus
ref|WP_045543418.1|  allantoate amidohydrolase                          105   5e-26    Acetobacter tropicalis
ref|WP_024514499.1|  allantoate amidohydrolase                          108   5e-26    Bradyrhizobium sp. Tv2a-2
ref|WP_027519320.1|  allantoate amidohydrolase                          105   5e-26    Bradyrhizobium sp. WSM1417
ref|WP_042702363.1|  allantoate amidohydrolase                        99.8    5e-26    Azospirillum sp. B506
ref|WP_045014744.1|  allantoate amidohydrolase                          105   6e-26    Bradyrhizobium sp. LTSP849
ref|WP_028178899.1|  MULTISPECIES: allantoate amidohydrolase            107   6e-26    Bradyrhizobium
ref|WP_045006884.1|  allantoate amidohydrolase                          105   6e-26    Bradyrhizobium sp. LTSP857
ref|WP_041550976.1|  allantoate amidohydrolase                          107   6e-26    
ref|WP_035379700.1|  allantoate amidohydrolase                          104   6e-26    
ref|WP_044559541.1|  allantoate amidohydrolase                        99.4    6e-26    
gb|KGB23742.1|  N-carbamoyl-L-amino acid hydrolase                      104   6e-26    
ref|WP_045049386.1|  allantoate amidohydrolase                          108   7e-26    
ref|WP_002224964.1|  allantoate amidohydrolase                          104   7e-26    
gb|ACQ93553.1|  amidase, hydantoinase/carbamoylase family               101   7e-26    
gb|ACE83178.1|  N-carbamoyl-L-amino acid hydrolase                      107   7e-26    
ref|WP_016260311.1|  allantoate amidohydrolase                          103   7e-26    
ref|WP_016674168.1|  allantoate amidohydrolase                          103   8e-26    
ref|WP_004392926.1|  allantoate amidohydrolase                          103   8e-26    
ref|WP_035730949.1|  MULTISPECIES: allantoate amidohydrolase            105   8e-26    
ref|WP_008494814.1|  allantoate amidohydrolase                          110   8e-26    
ref|WP_011770715.1|  amidase                                            105   9e-26    
ref|WP_026438972.1|  allantoate amidohydrolase                          110   9e-26    
emb|CFR09687.1|  acetylornithine deacetylase/succinyl-diaminopime...    105   9e-26    
gb|KDE37308.1|  allantoate amidohydrolase                               108   9e-26    
ref|WP_038985545.1|  allantoate amidohydrolase                          106   9e-26    
ref|WP_038949186.1|  allantoate amidohydrolase                          105   1e-25    
ref|WP_035886234.1|  allantoate amidohydrolase                          108   1e-25    
ref|XP_010037235.1|  PREDICTED: allantoate deiminase-like               108   1e-25    
ref|WP_041154407.1|  amidase                                            104   1e-25    
ref|WP_007374300.1|  allantoate amidohydrolase                          108   1e-25    
dbj|GAE25524.1|  amidase                                              98.6    1e-25    
ref|WP_008844571.1|  hydantoin utilization protein C                    103   1e-25    
ref|WP_040391179.1|  allantoate amidohydrolase                          105   1e-25    
ref|WP_028639695.1|  allantoate amidohydrolase                          110   1e-25    
ref|WP_034744068.1|  hydantoinase                                     98.6    1e-25    
gb|EIK46983.1|  allantoate amidohydrolase                               105   1e-25    
ref|WP_035665434.1|  allantoate amidohydrolase                          105   1e-25    
ref|WP_018274371.1|  allantoate amidohydrolase                        97.8    1e-25    
dbj|GAN78059.1|  amidohydrolase/amidase                               99.8    1e-25    
dbj|GAM65565.1|  N-carbamoyl-L-amino acid hydrolase                     106   1e-25    
ref|WP_032466131.1|  allantoate amidohydrolase                          104   1e-25    
ref|WP_018416407.1|  allantoate amidohydrolase                        99.0    1e-25    
ref|WP_038823114.1|  allantoate amidohydrolase                          103   1e-25    
ref|WP_026015607.1|  allantoate amidohydrolase                          105   1e-25    
ref|WP_026695340.1|  hydantoinase                                       104   1e-25    
ref|WP_025731768.1|  hypothetical protein                               113   2e-25    
ref|WP_027531888.1|  allantoate amidohydrolase                          105   2e-25    
ref|WP_007686123.1|  allantoate amidohydrolase                          107   2e-25    
ref|WP_014831366.1|  allantoate amidohydrolase                          106   2e-25    
ref|WP_011191828.1|  allantoate amidohydrolase                          104   2e-25    
ref|WP_029883248.1|  MULTISPECIES: allantoate amidohydrolase            105   2e-25    
dbj|GAM68513.1|  N-carbamoyl-L-amino acid hydrolase                     105   2e-25    
ref|WP_038400330.1|  allantoate amidohydrolase                          104   2e-25    
ref|WP_043970908.1|  allantoate amidohydrolase                          106   2e-25    
ref|WP_038419063.1|  allantoate amidohydrolase                          105   2e-25    
dbj|GAM76300.1|  N-carbamoyl-L-amino acid hydrolase                     105   2e-25    
ref|WP_029677513.1|  allantoate amidohydrolase                          103   2e-25    
ref|WP_038824717.1|  allantoate amidohydrolase                          104   2e-25    
ref|WP_012304530.1|  allantoate amidohydrolase                          104   2e-25    
dbj|GAM57926.1|  N-carbamoyl-L-amino acid hydrolase                     105   2e-25    
ref|WP_032910633.1|  allantoate amidohydrolase                          103   2e-25    
ref|WP_040112725.1|  hypothetical protein                               100   2e-25    
ref|WP_018644804.1|  allantoate amidohydrolase                          103   2e-25    
ref|WP_028152895.1|  allantoate amidohydrolase                          104   2e-25    
ref|WP_038924807.1|  allantoate amidohydrolase                          105   2e-25    
ref|WP_045902789.1|  allantoate amidohydrolase                          105   2e-25    
ref|WP_035976025.1|  allantoate amidohydrolase                          103   2e-25    
ref|WP_028085686.1|  allantoate amidohydrolase                          105   2e-25    
gb|KGE04323.1|  N-carbamoyl-L-amino acid hydrolase                      101   3e-25    
ref|WP_035515050.1|  hypothetical protein                               101   3e-25    
gb|ADG09595.1|  amidase, hydantoinase/carbamoylase family               100   3e-25    
ref|WP_038916714.1|  allantoate amidohydrolase                          105   3e-25    
ref|WP_036200247.1|  allantoate amidohydrolase                          101   3e-25    
ref|WP_012105604.1|  allantoate amidohydrolase                          104   3e-25    
ref|WP_019845239.1|  allantoate amidohydrolase                          105   3e-25    
ref|WP_027566598.1|  allantoate amidohydrolase                          103   3e-25    
ref|WP_028885294.1|  allantoate amidohydrolase                        97.8    3e-25    
ref|WP_041538489.1|  allantoate amidohydrolase                          100   3e-25    
ref|WP_024050150.1|  allantoate amidohydrolase                          101   3e-25    
ref|WP_013013670.1|  allantoate amidohydrolase                          101   3e-25    
ref|WP_004587083.1|  allantoate amidohydrolase                          102   3e-25    
ref|WP_038313007.1|  allantoate amidohydrolase                        97.1    3e-25    
ref|WP_024032808.1|  allantoate amidohydrolase                          102   3e-25    
ref|WP_039390687.1|  allantoate amidohydrolase                          107   3e-25    
ref|WP_038914500.1|  allantoate amidohydrolase                          104   4e-25    
dbj|GAA08741.1|  N-carbamyl-L-amino acid amidohydrolase                 107   4e-25    
ref|WP_026202134.1|  allantoate amidohydrolase                          103   4e-25    
dbj|GAM05159.1|  allantoate amidohydrolase                              106   4e-25    
ref|WP_041609834.1|  allantoate amidohydrolase                        98.6    4e-25    
ref|WP_019605313.1|  allantoate amidohydrolase                        97.8    4e-25    
ref|WP_039904477.1|  allantoate amidohydrolase                          106   4e-25    
ref|WP_026743259.1|  allantoate amidohydrolase                          106   4e-25    
ref|WP_040725490.1|  hypothetical protein                             96.7    5e-25    
ref|WP_038926489.1|  allantoate amidohydrolase                          104   5e-25    
ref|WP_038971995.1|  allantoate amidohydrolase                          102   5e-25    
ref|WP_040557234.1|  allantoate amidohydrolase                          103   5e-25    
dbj|GAN64014.1|  amidohydrolase/N-carbamyl-L-amino acid amidohydr...    104   5e-25    
gb|EIG62038.1|  amidase, hydantoinase/carbamoylase family               102   5e-25    
gb|EAR10075.1|  N-carbamoyl-L-amino acid amidohydrolase                 103   5e-25    
ref|WP_035995577.1|  allantoate amidohydrolase                          102   6e-25    
ref|WP_036158379.1|  allantoate amidohydrolase                          101   6e-25    
ref|WP_041305658.1|  hydantoinase                                       105   6e-25    
ref|WP_045825516.1|  allantoate amidohydrolase                        96.7    6e-25    
gb|AJC67419.1|  allantoate amidohydrolase                               103   6e-25    
ref|WP_016941699.1|  allantoate amidohydrolase                          103   6e-25    
ref|WP_028142651.1|  MULTISPECIES: allantoate amidohydrolase            102   7e-25    
ref|WP_038902756.1|  allantoate amidohydrolase                          103   7e-25    
ref|WP_035705107.1|  allantoate amidohydrolase                          103   7e-25    
ref|WP_037488596.1|  allantoate amidohydrolase                          108   8e-25    
ref|WP_015820129.1|  allantoate amidohydrolase                        96.3    8e-25    
ref|WP_008699681.1|  N-carbamoyl-L-amino acid hydrolase                 103   8e-25    
ref|WP_020328586.1|  N-carbamoyl-L-amino acid hydrolase                 105   8e-25    
emb|CCW16450.1|  N-carbamoyl-L-amino acid hydrolase                     108   8e-25    
ref|WP_032082376.1|  amidase                                            105   8e-25    
ref|WP_035049207.1|  allantoate amidohydrolase                          103   8e-25    
ref|WP_045295764.1|  allantoate amidohydrolase                          103   1e-24    
ref|WP_014231720.1|  amidase                                            100   1e-24    
ref|WP_027551062.1|  allantoate amidohydrolase                          101   1e-24    
ref|WP_044364045.1|  amidase                                            104   1e-24    
gb|KFC83607.1|  N-carbamoyl-L-amino acid hydrolase                      104   1e-24    
ref|WP_009111656.1|  allantoate amidohydrolase                          104   1e-24    
ref|WP_018467075.1|  hypothetical protein                               100   1e-24    
ref|WP_034493622.1|  allantoate amidohydrolase                          104   1e-24    
ref|WP_032488545.1|  hydantoin utilization protein C                  98.6    1e-24    
ref|WP_020430920.1|  N-carbamoyl-L-amino acid hydrolase                 104   1e-24    
ref|WP_013097219.1|  allantoate amidohydrolase                          102   1e-24    
pir||D42594  N-carbamyl-L-amino acid amidohydrolase (EC 3.5.1.-) ...  98.6    1e-24 
emb|CFQ75393.1|  acetylornithine deacetylase/succinyl-diaminopime...    100   1e-24    
ref|WP_028882516.1|  allantoate amidohydrolase                        95.5    1e-24    
ref|WP_026149897.1|  allantoate amidohydrolase                          107   1e-24    
ref|WP_024606050.1|  allantoate amidohydrolase                          103   1e-24    
ref|WP_046051498.1|  allantoate amidohydrolase                          100   1e-24    
ref|WP_035376564.1|  hypothetical protein                               100   1e-24    
ref|YP_001339327.1|  allantoate amidohydrolase                        99.0    1e-24    
ref|WP_028876079.1|  allantoate amidohydrolase                        95.5    2e-24    
ref|WP_008306430.1|  MULTISPECIES: allantoate amidohydrolase          97.1    2e-24    
ref|WP_018014453.1|  allantoate amidohydrolase                        95.5    2e-24    
ref|WP_019082494.1|  allantoate amidohydrolase                          100   2e-24    
ref|WP_019601763.1|  allantoate amidohydrolase                        95.1    2e-24    
ref|WP_043953975.1|  allantoate amidohydrolase                          104   2e-24    
ref|WP_042482809.1|  amidase                                            102   2e-24    
ref|WP_027888447.1|  MULTISPECIES: allantoate amidohydrolase            100   2e-24    
gb|AGE22697.1|  allantoate amidohydrolase                               100   2e-24    
ref|WP_041470520.1|  hydantoinase                                       100   2e-24    
ref|WP_034340368.1|  hypothetical protein                               100   2e-24    
ref|WP_042318523.1|  allantoate amidohydrolase                          102   2e-24    
ref|WP_038912623.1|  allantoate amidohydrolase                          102   2e-24    
ref|WP_015684689.1|  allantoate amidohydrolase                          100   2e-24    
ref|WP_026677006.1|  hydantoinase                                       101   2e-24    
ref|WP_024596153.1|  allantoate amidohydrolase                          102   2e-24    
ref|WP_008133474.1|  allantoate amidohydrolase                          102   2e-24    
gb|ADM99754.1|  N-carbamoyl-L-amino acid hydrolase                      102   2e-24    
ref|WP_038908850.1|  allantoate amidohydrolase                          102   2e-24    
ref|WP_038905403.1|  allantoate amidohydrolase                          102   2e-24    
emb|CFB71047.1|  acetylornithine deacetylase/succinyl-diaminopime...    100   2e-24    
ref|WP_019081376.1|  allantoate amidohydrolase                          100   2e-24    
ref|WP_026594830.1|  MULTISPECIES: allantoate amidohydrolase            102   2e-24    
ref|WP_007584335.1|  allantoate amidohydrolase                          102   2e-24    
ref|WP_024599979.1|  allantoate amidohydrolase                          102   2e-24    
ref|WP_024591952.1|  MULTISPECIES: allantoate amidohydrolase            102   3e-24    
ref|WP_006273823.1|  allantoate amidohydrolase                          101   3e-24    
ref|WP_022521666.1|  Amidase, hydantoinase/carbamoylase family        99.4    3e-24    
ref|WP_033028491.1|  allantoate amidohydrolase                          102   3e-24    
ref|WP_014069675.1|  allantoate amidohydrolase                          103   3e-24    
ref|WP_027891299.1|  allantoate amidohydrolase                          101   3e-24    
ref|WP_007991166.1|  N-carbamoyl-L-amino acid hydrolase               95.9    3e-24    
emb|CRF15328.1|  acetylornithine deacetylase/succinyl-diaminopime...    100   3e-24    
ref|WP_006792614.1|  allantoate amidohydrolase                          100   4e-24    
ref|WP_016587418.1|  allantoate amidohydrolase                          106   4e-24    
ref|WP_011299406.1|  allantoate amidohydrolase                        98.6    4e-24    
ref|WP_008128532.1|  allantoate amidohydrolase                          102   5e-24    
ref|WP_033038934.1|  allantoate amidohydrolase                          101   5e-24    
gb|ERS91643.1|  hypothetical protein Q671_15710                         100   5e-24    
ref|WP_020333208.1|  amidase                                          98.6    5e-24    
ref|WP_024608360.1|  allantoate amidohydrolase                          101   5e-24    
ref|WP_004334656.1|  allantoate amidohydrolase                          101   5e-24    
ref|WP_021295978.1|  hypothetical protein                             97.1    5e-24    
ref|WP_039488374.1|  MULTISPECIES: allantoate amidohydrolase            101   5e-24    
ref|WP_029046616.1|  allantoate amidohydrolase                        97.8    5e-24    
ref|WP_026638206.1|  allantoate amidohydrolase                          101   5e-24    
ref|WP_007883556.1|  allantoate amidohydrolase                          102   5e-24    
ref|WP_024593245.1|  allantoate amidohydrolase                          100   6e-24    
ref|WP_043197023.1|  allantoate amidohydrolase                        98.2    6e-24    
ref|WP_035048246.1|  allantoate amidohydrolase                          100   6e-24    
ref|WP_031217541.1|  hypothetical protein                               100   6e-24    
ref|WP_012287724.1|  allantoate amidohydrolase                          103   6e-24    
gb|ERO56685.1|  Amino acid hydrolase                                    100   6e-24    
ref|WP_004728106.1|  amidase                                            102   6e-24    
ref|WP_027876660.1|  allantoate amidohydrolase                        97.1    7e-24    
ref|WP_020825352.1|  allantoate amidohydrolase                        99.8    7e-24    
ref|WP_017449981.1|  allantoate amidohydrolase                        98.2    7e-24    
ref|WP_007561578.1|  allantoate amidohydrolase                          103   7e-24    
ref|WP_005164986.1|  allantoate amidohydrolase                        97.8    7e-24    
ref|WP_045630062.1|  allantoate amidohydrolase                          101   8e-24    
ref|WP_028669333.1|  allantoate amidohydrolase                        96.3    8e-24    
ref|WP_034358300.1|  allantoate amidohydrolase                        97.8    8e-24    
ref|WP_039037524.1|  allantoate amidohydrolase                        99.8    8e-24    
ref|WP_016851528.1|  hypothetical protein                               105   8e-24    
ref|WP_010553589.1|  allantoate amidohydrolase                          100   8e-24    
ref|WP_010920457.1|  allantoate amidohydrolase                        99.8    8e-24    
ref|WP_013649397.1|  allantoate amidohydrolase                        98.2    8e-24    
ref|WP_007378547.1|  allantoate deiminase                             99.8    9e-24    
ref|WP_010556858.1|  allantoate amidohydrolase                        99.8    9e-24    
ref|WP_032644982.1|  allantoate amidohydrolase                          101   9e-24    
gb|KFD20499.1|  N-carbamoyl-L-amino acid hydrolase                      100   9e-24    
ref|WP_006993948.1|  N-carbamoyl-L-amino acid hydrolase               94.0    9e-24    
ref|WP_038011086.1|  MULTISPECIES: allantoate amidohydrolase            100   9e-24    
ref|WP_007283182.1|  allantoate amidohydrolase                          108   9e-24    
ref|WP_015072681.1|  allantoate amidohydrolase                          108   1e-23    
ref|WP_025886027.1|  allantoate amidohydrolase                          108   1e-23    
ref|WP_033570589.1|  allantoate amidohydrolase                          108   1e-23    
dbj|GAN89530.1|  amidohydrolase/N-carbamyl-L-amino acid amidohydr...    108   1e-23    
ref|WP_033187327.1|  allantoate amidohydrolase                        93.6    1e-23    
ref|WP_021181940.1|  N-carbamoyl-L-amino acid hydrolase               97.8    1e-23    
ref|WP_045142970.1|  allantoate amidohydrolase                          100   1e-23    
ref|WP_013811617.1|  MULTISPECIES: allantoate amidohydrolase          99.0    1e-23    
ref|WP_038150116.1|  allantoate amidohydrolase                        95.1    1e-23    
ref|WP_029603984.1|  allantoate amidohydrolase                          108   1e-23    
ref|WP_038885099.1|  allantoate amidohydrolase                        99.8    1e-23    
ref|WP_044434117.1|  hypothetical protein                               100   1e-23    
ref|WP_014257294.1|  amidase                                            103   1e-23    
ref|WP_034307077.1|  allantoate amidohydrolase                        97.8    1e-23    
ref|WP_045888461.1|  allantoate amidohydrolase                          100   1e-23    
ref|WP_009638192.1|  allantoate amidohydrolase                          100   1e-23    
gb|ERE64899.1|  allantoate amidohydrolase                               102   1e-23    
ref|WP_045812060.1|  hypothetical protein                             96.3    1e-23    
ref|WP_035078746.1|  allantoate amidohydrolase                          100   1e-23    
ref|WP_040253118.1|  allantoate amidohydrolase                          102   1e-23    
gb|KGR35089.1|  amidase                                               99.4    1e-23    
ref|WP_011574859.1|  allantoate amidohydrolase                        94.0    1e-23    



>ref|XP_006365002.1| PREDICTED: allantoate deiminase-like [Solanum tuberosum]
Length=492

 Score =   323 bits (829),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 167/183 (91%), Gaps = 1/183 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CKQP+YYLSYD +C +STV+SLAGSLVCTVGEISTWPSASNVIPGQV FTVD+RAMDD+G
Sbjct  311  CKQPDYYLSYDGQCTSSTVESLAGSLVCTVGEISTWPSASNVIPGQVTFTVDVRAMDDSG  370

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REAIIYEFSNR++ +CD+R++FC +ERKHDANAVVCD  LS+QLKSA++TA  RITGE  
Sbjct  371  REAIIYEFSNRLYHMCDRRSVFCNVERKHDANAVVCDPGLSTQLKSASYTALKRITGEDP  430

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
              DVPVLMSGAGHDAMAMS LTKVGMLFVRCRGGISHSP EHVLDDDVWAAGMA+LAF E
Sbjct  431  -GDVPVLMSGAGHDAMAMSHLTKVGMLFVRCRGGISHSPAEHVLDDDVWAAGMAVLAFFE  489

Query  119  TLL  111
            TLL
Sbjct  490  TLL  492


 Score = 65.5 bits (158),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTV+GTQGHAGTVPM MRQDPMVA+AEL
Sbjct  271  QTRLKVTVKGTQGHAGTVPMNMRQDPMVAAAEL  303



>ref|XP_009628190.1| PREDICTED: allantoate deiminase [Nicotiana tomentosiformis]
Length=497

 Score =   322 bits (824),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 166/183 (91%), Gaps = 1/183 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CKQP+YYLSYD +C +STV+SLAGSLVCTVGEIS+WPSASNVIPGQV FTVD+RAMDDTG
Sbjct  316  CKQPDYYLSYDGQCASSTVESLAGSLVCTVGEISSWPSASNVIPGQVTFTVDVRAMDDTG  375

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REAIIYEFSNR++ +CD+R++FC +ERKHDANAVVCD  LS++LKSA+H A  RITGE  
Sbjct  376  REAIIYEFSNRLYHMCDRRSVFCNVERKHDANAVVCDPGLSTELKSASHAALKRITGEDP  435

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
              DVPVLMSGAGHDAMAMS LTKVGMLFVRCRGGISHSP EHVLDDD+WAAGMA+L FLE
Sbjct  436  -GDVPVLMSGAGHDAMAMSHLTKVGMLFVRCRGGISHSPAEHVLDDDIWAAGMAVLTFLE  494

Query  119  TLL  111
            TLL
Sbjct  495  TLL  497


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTVRGTQGHAGTVPM MRQDPMVA+AEL
Sbjct  276  QTRLKVTVRGTQGHAGTVPMNMRQDPMVAAAEL  308



>ref|XP_004233270.1| PREDICTED: allantoate deiminase [Solanum lycopersicum]
Length=493

 Score =   320 bits (821),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 165/183 (90%), Gaps = 1/183 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CKQP+YYLSYD +C +STV+SLAGSLVCTVGEISTWPSASNVIPGQV FTVD+RAMDD G
Sbjct  312  CKQPDYYLSYDGQCTSSTVESLAGSLVCTVGEISTWPSASNVIPGQVTFTVDVRAMDDLG  371

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REAIIYEFSNR++ +CD+R++FC +ERKHDANAVVCD  LS QLKSA++TA  RIT E  
Sbjct  372  REAIIYEFSNRLYHMCDRRSVFCNVERKHDANAVVCDPSLSRQLKSASYTALKRITDEDP  431

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
              DVPVLMSGAGHDAMAMS LTKVGMLFVRCRGGISHSP EHVLDDDVWAAGMA+LAFLE
Sbjct  432  -GDVPVLMSGAGHDAMAMSHLTKVGMLFVRCRGGISHSPAEHVLDDDVWAAGMAVLAFLE  490

Query  119  TLL  111
            TLL
Sbjct  491  TLL  493


 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTV+GTQGHAGTVPM MRQDPMVA+AEL
Sbjct  272  QTRLKVTVKGTQGHAGTVPMNMRQDPMVAAAEL  304



>ref|XP_009774500.1| PREDICTED: allantoate deiminase [Nicotiana sylvestris]
Length=500

 Score =   320 bits (819),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 166/183 (91%), Gaps = 1/183 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CKQP+YYLSYD +C +STV+SLAGSLVCTVGEIS+WPSASNVIPGQV FTVD+RAMDDTG
Sbjct  319  CKQPDYYLSYDGQCASSTVESLAGSLVCTVGEISSWPSASNVIPGQVTFTVDVRAMDDTG  378

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REAIIYEFSN+++ +CD+R++FC +ERKHDANAVVCD  LS++LKSA+H A  RITGE  
Sbjct  379  REAIIYEFSNKLYHMCDRRSVFCNVERKHDANAVVCDPGLSTELKSASHAALKRITGEDP  438

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
              DVPVLMSGAGHDAMAMS LTKVGMLFVRCRGGISHSP EHVLDDD+WAAGMA+L FLE
Sbjct  439  -GDVPVLMSGAGHDAMAMSHLTKVGMLFVRCRGGISHSPAEHVLDDDIWAAGMAVLTFLE  497

Query  119  TLL  111
            TLL
Sbjct  498  TLL  500


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTVRGTQGHAGTVPM MRQDPMVA+AEL
Sbjct  279  QTRLKVTVRGTQGHAGTVPMNMRQDPMVAAAEL  311



>gb|EYU43647.1| hypothetical protein MIMGU_mgv1a005319mg [Erythranthe guttata]
Length=489

 Score =   311 bits (796),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 161/183 (88%), Gaps = 1/183 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CKQP+ YLSYD +C TS V+SLAGSLVCTVGEISTWPSASNVIPGQV FTVD+RAMDD G
Sbjct  308  CKQPQDYLSYDSQCTTSAVQSLAGSLVCTVGEISTWPSASNVIPGQVTFTVDVRAMDDLG  367

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REAIIYE SNRM+ +CDKR++ CVIERKHDAN V CD ELSS+LKSAA+TA  R++GE  
Sbjct  368  REAIIYEMSNRMYHICDKRSVLCVIERKHDANGVACDPELSSKLKSAAYTALKRLSGENP  427

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
              +VPVLMSGAGHDAMAMS LTKV MLFVRCRGG+SHSP EHV DDDVWA+GMA+L+FLE
Sbjct  428  -GEVPVLMSGAGHDAMAMSHLTKVAMLFVRCRGGVSHSPAEHVSDDDVWASGMAVLSFLE  486

Query  119  TLL  111
            TLL
Sbjct  487  TLL  489


 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRL+VTV+G+QGHAGTVPM MRQDPM A+AE+
Sbjct  268  QTRLRVTVKGSQGHAGTVPMKMRQDPMAAAAEM  300



>ref|XP_011096836.1| PREDICTED: allantoate deiminase [Sesamum indicum]
Length=489

 Score =   310 bits (794),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 161/182 (88%), Gaps = 1/182 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CKQPE YLSYD +C  STV+SLAGSLVCTVGEISTWPSASNVIPGQV FTVD+RAMDD G
Sbjct  308  CKQPEDYLSYDGQCTASTVQSLAGSLVCTVGEISTWPSASNVIPGQVTFTVDVRAMDDLG  367

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REAIIYE SNRM+++CDKR++ C+IERKHDANAVVC+  LSSQLKSA + A  RI+GE  
Sbjct  368  REAIIYELSNRMYRICDKRSVLCLIERKHDANAVVCNPGLSSQLKSATYAALKRISGEDL  427

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             DDVP+LMSGAGHDAMAMS LTKV MLFVRCRGG+SHSP EHV D+DVWAAGMA+LAFLE
Sbjct  428  -DDVPILMSGAGHDAMAMSHLTKVAMLFVRCRGGVSHSPAEHVSDNDVWAAGMALLAFLE  486

Query  119  TL  114
            TL
Sbjct  487  TL  488


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRL+VTV+G+QGHAGTVPM MRQDPM A+AEL
Sbjct  268  QTRLRVTVKGSQGHAGTVPMTMRQDPMAAAAEL  300



>ref|XP_011035488.1| PREDICTED: allantoate deiminase isoform X3 [Populus euphratica]
Length=408

 Score =   300 bits (768),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 161/181 (89%), Gaps = 1/181 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ +LSYD +C  STV+SL+ SLVCTVGEISTWPSASNVIPGQV FTVD+RAMD+ G
Sbjct  227  CKNPKDFLSYDGQCNDSTVESLSNSLVCTVGEISTWPSASNVIPGQVTFTVDLRAMDNMG  286

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA+IYE SNRM+++C++R++ C+IERKHDANAV+CD EL+S+LK AA+ A  RITGE  
Sbjct  287  REAVIYELSNRMYEICERRSVSCIIERKHDANAVICDSELTSELKFAANAALKRITGE-I  345

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VPVLMSGAGHDAMAMS LTKVGMLFVRCRGG+SHSP EHVLDDDVWAAG++ILAFLE
Sbjct  346  QDEVPVLMSGAGHDAMAMSHLTKVGMLFVRCRGGVSHSPAEHVLDDDVWAAGLSILAFLE  405

Query  119  T  117
            T
Sbjct  406  T  406


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTVRG+QGHAGTVPM++RQDPM ASAEL
Sbjct  187  QTRLKVTVRGSQGHAGTVPMSLRQDPMAASAEL  219



>ref|XP_011035487.1| PREDICTED: allantoate deiminase isoform X2 [Populus euphratica]
Length=471

 Score =   300 bits (767),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 161/181 (89%), Gaps = 1/181 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ +LSYD +C  STV+SL+ SLVCTVGEISTWPSASNVIPGQV FTVD+RAMD+ G
Sbjct  290  CKNPKDFLSYDGQCNDSTVESLSNSLVCTVGEISTWPSASNVIPGQVTFTVDLRAMDNMG  349

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA+IYE SNRM+++C++R++ C+IERKHDANAV+CD EL+S+LK AA+ A  RITGE  
Sbjct  350  REAVIYELSNRMYEICERRSVSCIIERKHDANAVICDSELTSELKFAANAALKRITGE-I  408

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VPVLMSGAGHDAMAMS LTKVGMLFVRCRGG+SHSP EHVLDDDVWAAG++ILAFLE
Sbjct  409  QDEVPVLMSGAGHDAMAMSHLTKVGMLFVRCRGGVSHSPAEHVLDDDVWAAGLSILAFLE  468

Query  119  T  117
            T
Sbjct  469  T  469


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTVRG+QGHAGTVPM++RQDPM ASAEL
Sbjct  250  QTRLKVTVRGSQGHAGTVPMSLRQDPMAASAEL  282



>ref|XP_011035486.1| PREDICTED: allantoate deiminase isoform X1 [Populus euphratica]
Length=476

 Score =   300 bits (767),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 161/181 (89%), Gaps = 1/181 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ +LSYD +C  STV+SL+ SLVCTVGEISTWPSASNVIPGQV FTVD+RAMD+ G
Sbjct  295  CKNPKDFLSYDGQCNDSTVESLSNSLVCTVGEISTWPSASNVIPGQVTFTVDLRAMDNMG  354

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA+IYE SNRM+++C++R++ C+IERKHDANAV+CD EL+S+LK AA+ A  RITGE  
Sbjct  355  REAVIYELSNRMYEICERRSVSCIIERKHDANAVICDSELTSELKFAANAALKRITGE-I  413

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VPVLMSGAGHDAMAMS LTKVGMLFVRCRGG+SHSP EHVLDDDVWAAG++ILAFLE
Sbjct  414  QDEVPVLMSGAGHDAMAMSHLTKVGMLFVRCRGGVSHSPAEHVLDDDVWAAGLSILAFLE  473

Query  119  T  117
            T
Sbjct  474  T  474


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTVRG+QGHAGTVPM++RQDPM ASAEL
Sbjct  255  QTRLKVTVRGSQGHAGTVPMSLRQDPMAASAEL  287



>ref|XP_006369050.1| peptidase M20/M25/M40 family protein [Populus trichocarpa]
 gb|ERP65619.1| peptidase M20/M25/M40 family protein [Populus trichocarpa]
Length=471

 Score =   298 bits (763),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 160/181 (88%), Gaps = 1/181 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ +LSYD  C  STV+SL+ SLVCTVGEISTWPSASNVIPGQV FTVD+RAMD+ G
Sbjct  290  CKNPKDFLSYDGHCNDSTVESLSNSLVCTVGEISTWPSASNVIPGQVTFTVDLRAMDNMG  349

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA++YE SNRM+++C++R++ C+IERKHDANAV+CD EL+S+LK AA+ A  RITGE  
Sbjct  350  REAVLYELSNRMYEICERRSVSCIIERKHDANAVICDSELTSELKFAANAALKRITGE-I  408

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VPVLMSGAGHDAMAMS LTKVGMLFVRCRGG+SHSP EHVLDDDVWAAG++ILAFLE
Sbjct  409  QDEVPVLMSGAGHDAMAMSHLTKVGMLFVRCRGGVSHSPAEHVLDDDVWAAGLSILAFLE  468

Query  119  T  117
            T
Sbjct  469  T  469


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTVRG+QGHAGTVPM++RQDPM ASAEL
Sbjct  250  QTRLKVTVRGSQGHAGTVPMSLRQDPMAASAEL  282



>emb|CAN83127.1| hypothetical protein VITISV_029535 [Vitis vinifera]
Length=321

 Score =   291 bits (746),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 159/183 (87%), Gaps = 1/183 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK+P+ +LSYD +C    V+SL+GSLVCTVGEIS+WPSASNVIPGQV FTVD+RA+DD G
Sbjct  140  CKRPKDFLSYDGQCNGFAVESLSGSLVCTVGEISSWPSASNVIPGQVTFTVDLRAIDDMG  199

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA++YE S+RM+Q+C+KR++ C IERKHDANAV+CD ELS+QLKSA ++   R+ GE  
Sbjct  200  REAVLYELSDRMYQICEKRSVSCTIERKHDANAVICDTELSTQLKSATYSTLKRMEGE-I  258

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
              DVPVLMSGAGHDAMAMS LTKVGMLFVRCRGGISHSP EHVLD+DVWAAG+AILAFLE
Sbjct  259  QGDVPVLMSGAGHDAMAMSHLTKVGMLFVRCRGGISHSPAEHVLDEDVWAAGLAILAFLE  318

Query  119  TLL  111
            T L
Sbjct  319  THL  321


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTVRG+QGHAGTVPM+MRQDPM A+AEL
Sbjct  100  QTRLKVTVRGSQGHAGTVPMSMRQDPMAAAAEL  132



>ref|XP_008225895.1| PREDICTED: allantoate deiminase [Prunus mume]
Length=503

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ +LS+D  C++ +++SL+ SLVCTVGEISTWPSASNVIPGQV FTVD+R +DD G
Sbjct  321  CKHPQDFLSFDGHCKSFSMQSLSTSLVCTVGEISTWPSASNVIPGQVMFTVDLRTIDDMG  380

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA++YEFSNRM+Q+CDKR++ C I+RKHDA+AV+CD ELSS+LKSA +    R+TG   
Sbjct  381  REAVVYEFSNRMYQICDKRSVSCTIDRKHDADAVICDSELSSKLKSATYIGLKRMTGAAI  440

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VPVLMSGAGHDAMA+S LTKVGMLFVRCRGGISHSPEEHVLDDDVWA+G+AILAF+E
Sbjct  441  QDEVPVLMSGAGHDAMALSHLTKVGMLFVRCRGGISHSPEEHVLDDDVWASGLAILAFIE  500

Query  119  T  117
            T
Sbjct  501  T  501


 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            QTRLKVT+RG+QGHAGTVPM+MR DPM A+AE
Sbjct  281  QTRLKVTMRGSQGHAGTVPMSMRHDPMAAAAE  312



>emb|CBI27216.3| unnamed protein product [Vitis vinifera]
Length=478

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 159/183 (87%), Gaps = 1/183 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK+P+ +LSYD +C    V+SL+GSLVCTVGEIS+WPSASNVIPGQV FTVD+RA+DD G
Sbjct  297  CKRPKDFLSYDGQCNGFAVESLSGSLVCTVGEISSWPSASNVIPGQVTFTVDLRAIDDMG  356

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA++YE S+RM+Q+C+KR++ C IERKHDANAV+CD ELS+QLKSA ++   R+ GE  
Sbjct  357  REAVLYELSDRMYQICEKRSVSCTIERKHDANAVICDTELSTQLKSATYSTLKRMEGE-I  415

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
              DVPVLMSGAGHDAMAMS LTKVGMLFVRCRGGISHSP EHVLD+DVWAAG+AILAFLE
Sbjct  416  QGDVPVLMSGAGHDAMAMSHLTKVGMLFVRCRGGISHSPAEHVLDEDVWAAGLAILAFLE  475

Query  119  TLL  111
            T L
Sbjct  476  THL  478


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTVRG+QGHAGTVPM+MRQDPM A+AEL
Sbjct  257  QTRLKVTVRGSQGHAGTVPMSMRQDPMAAAAEL  289



>ref|XP_012088571.1| PREDICTED: allantoate deiminase isoform X2 [Jatropha curcas]
Length=474

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 157/181 (87%), Gaps = 1/181 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ +LSYD  C  S V+SL+ SLVCTVGEISTWPSASNVIPGQV FTVD+RAMDD G
Sbjct  293  CKHPKDFLSYDGYCNDSIVESLSSSLVCTVGEISTWPSASNVIPGQVTFTVDLRAMDDMG  352

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA++YE SN+++ +CD+R++ C+IERKHDA AV+CD ELS QLKSAA+ A  R+TGE  
Sbjct  353  REAVLYELSNQIYHICDRRSVSCIIERKHDAKAVICDSELSLQLKSAANAALKRMTGE-I  411

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VPVLMSGAGHDAMAMS LTKVGMLFVRCRGG+SHSP EHVLDDDVWAAG+A++AFLE
Sbjct  412  QDEVPVLMSGAGHDAMAMSHLTKVGMLFVRCRGGVSHSPAEHVLDDDVWAAGLAVMAFLE  471

Query  119  T  117
            T
Sbjct  472  T  472


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKV V+G+QGHAGTVPM++RQDPM A+AEL
Sbjct  253  QTRLKVMVKGSQGHAGTVPMSLRQDPMAAAAEL  285



>ref|XP_012088570.1| PREDICTED: allantoate deiminase isoform X1 [Jatropha curcas]
 gb|KDP23910.1| hypothetical protein JCGZ_27110 [Jatropha curcas]
Length=479

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 157/181 (87%), Gaps = 1/181 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ +LSYD  C  S V+SL+ SLVCTVGEISTWPSASNVIPGQV FTVD+RAMDD G
Sbjct  298  CKHPKDFLSYDGYCNDSIVESLSSSLVCTVGEISTWPSASNVIPGQVTFTVDLRAMDDMG  357

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA++YE SN+++ +CD+R++ C+IERKHDA AV+CD ELS QLKSAA+ A  R+TGE  
Sbjct  358  REAVLYELSNQIYHICDRRSVSCIIERKHDAKAVICDSELSLQLKSAANAALKRMTGE-I  416

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VPVLMSGAGHDAMAMS LTKVGMLFVRCRGG+SHSP EHVLDDDVWAAG+A++AFLE
Sbjct  417  QDEVPVLMSGAGHDAMAMSHLTKVGMLFVRCRGGVSHSPAEHVLDDDVWAAGLAVMAFLE  476

Query  119  T  117
            T
Sbjct  477  T  477


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKV V+G+QGHAGTVPM++RQDPM A+AEL
Sbjct  258  QTRLKVMVKGSQGHAGTVPMSLRQDPMAAAAEL  290



>ref|XP_002275843.2| PREDICTED: allantoate deiminase [Vitis vinifera]
Length=492

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 159/183 (87%), Gaps = 1/183 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK+P+ +LSYD +C    V+SL+GSLVCTVGEIS+WPSASNVIPGQV FTVD+RA+DD G
Sbjct  311  CKRPKDFLSYDGQCNGFAVESLSGSLVCTVGEISSWPSASNVIPGQVTFTVDLRAIDDMG  370

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA++YE S+RM+Q+C+KR++ C IERKHDANAV+CD ELS+QLKSA ++   R+ GE  
Sbjct  371  REAVLYELSDRMYQICEKRSVSCTIERKHDANAVICDTELSTQLKSATYSTLKRMEGE-I  429

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
              DVPVLMSGAGHDAMAMS LTKVGMLFVRCRGGISHSP EHVLD+DVWAAG+AILAFLE
Sbjct  430  QGDVPVLMSGAGHDAMAMSHLTKVGMLFVRCRGGISHSPAEHVLDEDVWAAGLAILAFLE  489

Query  119  TLL  111
            T L
Sbjct  490  THL  492


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTVRG+QGHAGTVPM+MRQDPM A+AEL
Sbjct  271  QTRLKVTVRGSQGHAGTVPMSMRQDPMAAAAEL  303



>ref|XP_007212027.1| hypothetical protein PRUPE_ppa005027mg [Prunus persica]
 gb|EMJ13226.1| hypothetical protein PRUPE_ppa005027mg [Prunus persica]
Length=456

 Score =   291 bits (745),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ +LS+D  C++ +++SL+ SLVCTVGEISTWPSASNVIPGQV FTVD+R +DD G
Sbjct  274  CKHPQDFLSFDGHCKSFSMESLSTSLVCTVGEISTWPSASNVIPGQVTFTVDLRTIDDMG  333

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA++YEFSNRM+Q+CDKR++ C I+RKHDA+AV+CD ELSS+LKSA +    R+TG   
Sbjct  334  REAVVYEFSNRMYQICDKRSVSCTIDRKHDADAVICDSELSSKLKSATYIGLKRMTGAAI  393

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D++PV+MSGAGHDAMA+S LTKVGMLFVRCRGGISHSPEEHVLDDDVWA+G+AILAF+E
Sbjct  394  QDEIPVVMSGAGHDAMALSHLTKVGMLFVRCRGGISHSPEEHVLDDDVWASGLAILAFIE  453

Query  119  T  117
            T
Sbjct  454  T  454


 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            QTRLKVT+RG+QGHAGTVPM+MR DPM A+AE
Sbjct  234  QTRLKVTMRGSQGHAGTVPMSMRHDPMAAAAE  265



>ref|XP_009354000.1| PREDICTED: allantoate deiminase-like [Pyrus x bretschneideri]
Length=498

 Score =   291 bits (746),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ +LS+D  C++ +++SL+ SLVCTVGEISTWPSASNVIPGQV FTVD+R +DD G
Sbjct  316  CKSPQDFLSFDGHCKSFSMESLSASLVCTVGEISTWPSASNVIPGQVTFTVDLRTIDDMG  375

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA++YEFSN+++Q+CD+R++ C I+RKHDA AV+CD ELSS+LKSAA+    R+TG   
Sbjct  376  REAVVYEFSNQVYQICDRRSVSCTIDRKHDAGAVICDSELSSKLKSAAYIGLKRMTGAAI  435

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
            +D++PVLMSGAGHDAMA+S LTKVGMLFVRCRGGISHSPEEHVLDDDVWA+G+AILAF+E
Sbjct  436  EDEIPVLMSGAGHDAMALSHLTKVGMLFVRCRGGISHSPEEHVLDDDVWASGLAILAFIE  495

Query  119  TLL  111
            T L
Sbjct  496  TQL  498


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            QTR+KVT+RG+QGHAGTVPM+MR DPM A+AE
Sbjct  276  QTRIKVTMRGSQGHAGTVPMSMRHDPMAAAAE  307



>ref|XP_010051828.1| PREDICTED: allantoate deiminase isoform X2 [Eucalyptus grandis]
 gb|KCW75655.1| hypothetical protein EUGRSUZ_D00017 [Eucalyptus grandis]
Length=409

 Score =   288 bits (738),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK+PE +LS+D  C+ STV+SL+ SLVCTVGEIS+WPSASNVIPGQV FTVDIRA+DD G
Sbjct  227  CKRPEDFLSFDGHCKDSTVQSLSTSLVCTVGEISSWPSASNVIPGQVVFTVDIRAIDDMG  286

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA+IYE SNRM+Q+CD+R++ C+IERKHDA AV+CD EL  QLK AA +A  R++    
Sbjct  287  REAVIYELSNRMYQICDRRSVSCIIERKHDAGAVMCDDELRRQLKFAADSALKRMSDNQF  346

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VPVLMSGAGHDAMA+S LTKVGM+FVRCRGG+SHSPEEHVLDDDVWAAG+++LAFLE
Sbjct  347  LDEVPVLMSGAGHDAMAISHLTKVGMIFVRCRGGVSHSPEEHVLDDDVWAAGLSVLAFLE  406

Query  119  T  117
            T
Sbjct  407  T  407


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTR+KVTVRG+QGHAGTVPM+MRQDPM A+AEL
Sbjct  187  QTRMKVTVRGSQGHAGTVPMSMRQDPMSAAAEL  219



>ref|XP_007041020.1| Allantoate amidohydrolase isoform 2 [Theobroma cacao]
 gb|EOX96851.1| Allantoate amidohydrolase isoform 2 [Theobroma cacao]
Length=381

 Score =   288 bits (736),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 156/181 (86%), Gaps = 1/181 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P  +LS        T++SL+ SLVCTVGEISTWPSASNVIPGQV FTVD+RA+DD G
Sbjct  200  CKHPRDFLSDSGNYNEFTMESLSTSLVCTVGEISTWPSASNVIPGQVTFTVDLRAIDDVG  259

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA++YE SNRM+Q+CD+R++ C+IERKHDANAV+CD ELSSQLKSA++TA  ++ GE  
Sbjct  260  REAVLYELSNRMYQICDRRSVSCIIERKHDANAVICDPELSSQLKSASYTALNKMMGE-I  318

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VPVLMSGAGHDAMAMS LTKVGMLFVRCRGGISHSPEEHVLDDDVW AG+AILAFLE
Sbjct  319  QDEVPVLMSGAGHDAMAMSHLTKVGMLFVRCRGGISHSPEEHVLDDDVWTAGLAILAFLE  378

Query  119  T  117
            T
Sbjct  379  T  379


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTR+KV+VRG+QGHAGTVPM+MR+DPM A+AEL
Sbjct  160  QTRMKVSVRGSQGHAGTVPMSMRRDPMAAAAEL  192



>ref|XP_011652398.1| PREDICTED: allantoate deiminase isoform X2 [Cucumis sativus]
Length=421

 Score =   288 bits (738),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 155/183 (85%), Gaps = 1/183 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CKQPE YLS+D  C  ST+KSL+ SLVCTVGEISTWPSASNVIPGQV FTVD+R +DD G
Sbjct  240  CKQPESYLSFDGHCTDSTLKSLSTSLVCTVGEISTWPSASNVIPGQVTFTVDLRTIDDIG  299

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA+IYEFSN++H +C  R++ C IERKHDANA++ + ELSSQLKSAA TA  ++ GE  
Sbjct  300  REAVIYEFSNQVHNICSSRSVSCNIERKHDANAIISNSELSSQLKSAASTALKKMVGE-I  358

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             ++VPVLMSGAGHDAMAMS LTKVGMLFVRCRGG+SHSP EHVLDDD+WAAG+A+L FLE
Sbjct  359  QEEVPVLMSGAGHDAMAMSHLTKVGMLFVRCRGGVSHSPAEHVLDDDIWAAGLAVLEFLE  418

Query  119  TLL  111
              L
Sbjct  419  NHL  421


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTVRG+QGHAGTVPM MRQDPM ASAEL
Sbjct  200  QTRLKVTVRGSQGHAGTVPMPMRQDPMAASAEL  232



>ref|XP_010684279.1| PREDICTED: allantoate deiminase [Beta vulgaris subsp. vulgaris]
Length=480

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 158/181 (87%), Gaps = 3/181 (2%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK+P+ +LSYDD+C  STV+SL GSLVCTVGEIS WPSASNVIPGQV FT+D+RAMDD G
Sbjct  301  CKRPKEFLSYDDDC--STVESLFGSLVCTVGEISLWPSASNVIPGQVTFTIDLRAMDDAG  358

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA++YE S RM+ +CD+R++ CVIERKHDANAV CD ELSSQL+SAA TAF ++ G   
Sbjct  359  REAVLYELSARMYNICDRRSVSCVIERKHDANAVKCDSELSSQLQSAALTAFRKMAG-NV  417

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
            + DVP LMSGAGHDAMAMSRLTK+GMLFVRCRGGISHSP EHVLDDDVWAAG+A+LAFLE
Sbjct  418  EVDVPKLMSGAGHDAMAMSRLTKMGMLFVRCRGGISHSPAEHVLDDDVWAAGLAVLAFLE  477

Query  119  T  117
             
Sbjct  478  N  478


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTV G+QGHAGTVPM+MR+DPM A+AEL
Sbjct  261  QTRLKVTVSGSQGHAGTVPMSMRRDPMAATAEL  293



>ref|XP_008383283.1| PREDICTED: allantoate deiminase [Malus domestica]
Length=499

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ +LS+D +C++ +++SL+ SLVCTVGEISTWPSASNVIPGQV FTVD+R +DD G
Sbjct  317  CKSPQDFLSFDGQCKSFSMESLSASLVCTVGEISTWPSASNVIPGQVTFTVDLRTIDDMG  376

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA++YEFSN+++Q+CD+R++ C I+RKHDA A +CD ELSS+LKSAA+    R+TG   
Sbjct  377  REAVVYEFSNQVYQICDRRSVSCTIDRKHDAGAAICDSELSSKLKSAAYIGLKRMTGAAI  436

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
            +D++PVLMSGAGHDAMA+S LTKVGMLFVRCRGG+SHSPEEHVLDDDVWA+G+AILAF+E
Sbjct  437  EDEIPVLMSGAGHDAMALSHLTKVGMLFVRCRGGVSHSPEEHVLDDDVWASGLAILAFIE  496

Query  119  TLL  111
            T L
Sbjct  497  TQL  499


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            QTR+KVT+RG+QGHAGTVPM+MR+DPM A+AE
Sbjct  277  QTRIKVTMRGSQGHAGTVPMSMRRDPMAAAAE  308



>ref|XP_006596931.1| PREDICTED: allantoate amidohydrolase isoform X1 [Glycine max]
Length=403

 Score =   287 bits (735),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK PE YLSYD  C  STVKSL+ SLVCTVGEISTWPSASNVIPGQV +TVDIRA+DD G
Sbjct  222  CKHPEEYLSYDGHCSDSTVKSLSSSLVCTVGEISTWPSASNVIPGQVTYTVDIRAIDDLG  281

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA+IY+ S +++Q+CDKR++ C+IE KHDA AV+CD +LSSQLKSAA++A  ++ G+  
Sbjct  282  REAVIYDLSKQIYQICDKRSVSCIIEHKHDAGAVICDSDLSSQLKSAAYSALKKMEGD-I  340

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VP LMSGAGHDAMA+S LTKVGMLFVRCRGGISHSP+EHVLD+DVWAAG+A L+FLE
Sbjct  341  QDEVPTLMSGAGHDAMAISHLTKVGMLFVRCRGGISHSPQEHVLDNDVWAAGLATLSFLE  400

Query  119  TL  114
             L
Sbjct  401  NL  402


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            QTRLKVTVRG+QGHAGTVPM+MRQDPM A+AE
Sbjct  182  QTRLKVTVRGSQGHAGTVPMSMRQDPMAAAAE  213



>ref|XP_009340289.1| PREDICTED: allantoate deiminase-like [Pyrus x bretschneideri]
 ref|XP_009340290.1| PREDICTED: allantoate deiminase-like [Pyrus x bretschneideri]
Length=498

 Score =   290 bits (742),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 128/183 (70%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ +LS+D  C++ +++SL+ SLVCTVGEISTWPSASNVIPGQV FTVD+R +DD G
Sbjct  316  CKSPQDFLSFDGHCKSFSMESLSASLVCTVGEISTWPSASNVIPGQVTFTVDLRTIDDMG  375

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA++YEFSN+++Q+CD+R++ C I+RKHDA AV+CD ELSS+LKSAA+    R+TG   
Sbjct  376  REAVVYEFSNQVYQICDRRSVSCTIDRKHDAGAVICDSELSSKLKSAAYIGLKRMTGADI  435

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
            +D++PVLMSGAGHDAMA+S LTKVGMLFVRCRGG+SHSPEEHVLDDDVWA+G+AILAF+E
Sbjct  436  EDEIPVLMSGAGHDAMALSHLTKVGMLFVRCRGGVSHSPEEHVLDDDVWASGLAILAFIE  495

Query  119  TLL  111
            T L
Sbjct  496  TQL  498


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            QTR+KVT+RG+QGHAGTVPM+MR DPM A+AE
Sbjct  276  QTRIKVTMRGSQGHAGTVPMSMRHDPMAAAAE  307



>ref|XP_007041019.1| Allantoate amidohydrolase isoform 1 [Theobroma cacao]
 gb|EOX96850.1| Allantoate amidohydrolase isoform 1 [Theobroma cacao]
Length=490

 Score =   290 bits (741),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 156/181 (86%), Gaps = 1/181 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P  +LS        T++SL+ SLVCTVGEISTWPSASNVIPGQV FTVD+RA+DD G
Sbjct  309  CKHPRDFLSDSGNYNEFTMESLSTSLVCTVGEISTWPSASNVIPGQVTFTVDLRAIDDVG  368

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA++YE SNRM+Q+CD+R++ C+IERKHDANAV+CD ELSSQLKSA++TA  ++ GE  
Sbjct  369  REAVLYELSNRMYQICDRRSVSCIIERKHDANAVICDPELSSQLKSASYTALNKMMGE-I  427

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VPVLMSGAGHDAMAMS LTKVGMLFVRCRGGISHSPEEHVLDDDVW AG+AILAFLE
Sbjct  428  QDEVPVLMSGAGHDAMAMSHLTKVGMLFVRCRGGISHSPEEHVLDDDVWTAGLAILAFLE  487

Query  119  T  117
            T
Sbjct  488  T  488


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTR+KV+VRG+QGHAGTVPM+MR+DPM A+AEL
Sbjct  269  QTRMKVSVRGSQGHAGTVPMSMRRDPMAAAAEL  301



>ref|XP_010051826.1| PREDICTED: allantoate deiminase isoform X1 [Eucalyptus grandis]
 ref|XP_010051827.1| PREDICTED: allantoate deiminase isoform X1 [Eucalyptus grandis]
 gb|KCW75653.1| hypothetical protein EUGRSUZ_D00017 [Eucalyptus grandis]
Length=474

 Score =   289 bits (739),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK+PE +LS+D  C+ STV+SL+ SLVCTVGEIS+WPSASNVIPGQV FTVDIRA+DD G
Sbjct  292  CKRPEDFLSFDGHCKDSTVQSLSTSLVCTVGEISSWPSASNVIPGQVVFTVDIRAIDDMG  351

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA+IYE SNRM+Q+CD+R++ C+IERKHDA AV+CD EL  QLK AA +A  R++    
Sbjct  352  REAVIYELSNRMYQICDRRSVSCIIERKHDAGAVMCDDELRRQLKFAADSALKRMSDNQF  411

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VPVLMSGAGHDAMA+S LTKVGM+FVRCRGG+SHSPEEHVLDDDVWAAG+++LAFLE
Sbjct  412  LDEVPVLMSGAGHDAMAISHLTKVGMIFVRCRGGVSHSPEEHVLDDDVWAAGLSVLAFLE  471

Query  119  T  117
            T
Sbjct  472  T  472


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTR+KVTVRG+QGHAGTVPM+MRQDPM A+AEL
Sbjct  252  QTRMKVTVRGSQGHAGTVPMSMRQDPMSAAAEL  284



>ref|XP_004293794.2| PREDICTED: allantoate deiminase [Fragaria vesca subsp. vesca]
Length=575

 Score =   292 bits (747),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 162/183 (89%), Gaps = 1/183 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ +LS+D +C++ +++SL+ SLVCTVGEISTWPSASNVIPGQV FTVDIRA+DD G
Sbjct  394  CKHPQDFLSFDGQCKSYSLESLSTSLVCTVGEISTWPSASNVIPGQVTFTVDIRAIDDMG  453

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA++YE SNR++Q+CD R++ C I+RKHDANAV+C+ EL+S+LKSAAH    R+TG + 
Sbjct  454  REAVVYELSNRLYQICDGRSVLCTIDRKHDANAVICNSELTSKLKSAAHLGLKRMTG-SV  512

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VPVLMSGAGHDAMA+S LTKVGMLFVRCRGGISHSPEEHVLDDDVWA+G+A+LAF+E
Sbjct  513  QDEVPVLMSGAGHDAMALSHLTKVGMLFVRCRGGISHSPEEHVLDDDVWASGLAVLAFIE  572

Query  119  TLL  111
            T L
Sbjct  573  TQL  575


 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            QTRLKVT+RG+QGHAGTVPM+MR DPM A+AE
Sbjct  354  QTRLKVTMRGSQGHAGTVPMSMRHDPMAAAAE  385



>ref|XP_004145132.1| PREDICTED: allantoate deiminase isoform X1 [Cucumis sativus]
 gb|KGN64461.1| hypothetical protein Csa_1G056970 [Cucumis sativus]
Length=504

 Score =   289 bits (740),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 155/183 (85%), Gaps = 1/183 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CKQPE YLS+D  C  ST+KSL+ SLVCTVGEISTWPSASNVIPGQV FTVD+R +DD G
Sbjct  323  CKQPESYLSFDGHCTDSTLKSLSTSLVCTVGEISTWPSASNVIPGQVTFTVDLRTIDDIG  382

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA+IYEFSN++H +C  R++ C IERKHDANA++ + ELSSQLKSAA TA  ++ GE  
Sbjct  383  REAVIYEFSNQVHNICSSRSVSCNIERKHDANAIISNSELSSQLKSAASTALKKMVGE-I  441

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             ++VPVLMSGAGHDAMAMS LTKVGMLFVRCRGG+SHSP EHVLDDD+WAAG+A+L FLE
Sbjct  442  QEEVPVLMSGAGHDAMAMSHLTKVGMLFVRCRGGVSHSPAEHVLDDDIWAAGLAVLEFLE  501

Query  119  TLL  111
              L
Sbjct  502  NHL  504


 Score = 65.5 bits (158),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTVRG+QGHAGTVPM MRQDPM ASAEL
Sbjct  283  QTRLKVTVRGSQGHAGTVPMPMRQDPMAASAEL  315



>emb|CAO78893.1| allantoate amidohydrolase [Glycine max]
Length=483

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK PE YLSYD  C  STVKSL+ SLVCTVGEISTWPSASNVIPGQV +TVDIRA+DD G
Sbjct  302  CKHPEEYLSYDGHCSDSTVKSLSSSLVCTVGEISTWPSASNVIPGQVTYTVDIRAIDDLG  361

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA+IY+ S +++Q+CDKR++ C+IE KHDA AV+CD +LSSQLKSAA++A  ++ G+  
Sbjct  362  REAVIYDLSKQIYQICDKRSVSCIIEHKHDAGAVICDSDLSSQLKSAAYSALKKMEGD-I  420

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VP LMSGAGHDAMA+S LTKVGMLFVRCRGGISHSP+EHVLD+DVWAAG+A L+FLE
Sbjct  421  QDEVPTLMSGAGHDAMAISHLTKVGMLFVRCRGGISHSPQEHVLDNDVWAAGLATLSFLE  480

Query  119  TL  114
             L
Sbjct  481  NL  482


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            QTRLKVTVRG+QGHAGTVPM+MRQDPM A+AE
Sbjct  262  QTRLKVTVRGSQGHAGTVPMSMRQDPMAAAAE  293



>ref|NP_001236563.1| allantoate amidohydrolase precursor [Glycine max]
 gb|ACN87318.1| allantoate amidohydrolase [Glycine max]
Length=483

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK PE YLSYD  C  STVKSL+ SLVCTVGEISTWPSASNVIPGQV +TVDIRA+DD G
Sbjct  302  CKHPEEYLSYDGHCSDSTVKSLSSSLVCTVGEISTWPSASNVIPGQVTYTVDIRAIDDLG  361

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA+IY+ S +++Q+CDKR++ C+IE KHDA AV+CD +LSSQLKSAA++A  ++ G+  
Sbjct  362  REAVIYDLSKQIYQICDKRSVSCIIEHKHDAGAVICDSDLSSQLKSAAYSALKKMEGD-I  420

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VP LMSGAGHDAMA+S LTKVGMLFVRCRGGISHSP+EHVLD+DVWAAG+A L+FLE
Sbjct  421  QDEVPTLMSGAGHDAMAISHLTKVGMLFVRCRGGISHSPQEHVLDNDVWAAGLATLSFLE  480

Query  119  TL  114
             L
Sbjct  481  NL  482


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            QTRLKVTVRG+QGHAGTVPM+MRQDPM A+AE
Sbjct  262  QTRLKVTVRGSQGHAGTVPMSMRQDPMAAAAE  293



>gb|KHN47732.1| Allantoate deiminase, chloroplastic [Glycine soja]
Length=483

 Score =   287 bits (735),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK PE YLSYD  C  STVKSL+ SLVCTVGEISTWPSASNVIPGQV +TVDIRA+DD G
Sbjct  302  CKHPEEYLSYDGHCSDSTVKSLSSSLVCTVGEISTWPSASNVIPGQVTYTVDIRAIDDLG  361

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA+IY+ S +++Q+CDKR++ C+IE KHDA AV+CD +LSSQLKSAA++A  ++ G+  
Sbjct  362  REAVIYDLSKQIYQICDKRSVSCIIEHKHDAGAVICDSDLSSQLKSAAYSALKKMEGD-I  420

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VP LMSGAGHDAMA+S LTKVGMLFVRCRGGISHSP+EHVLD+DVWAAG+A L+FLE
Sbjct  421  QDEVPTLMSGAGHDAMAISHLTKVGMLFVRCRGGISHSPQEHVLDNDVWAAGLATLSFLE  480

Query  119  TL  114
             L
Sbjct  481  NL  482


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            QTRLKVTVRG+QGHAGTVPM+MRQDPM A+AE
Sbjct  262  QTRLKVTVRGSQGHAGTVPMSMRQDPMAAAAE  293



>gb|ACK75561.1| allantoate amidohydrolase [Glycine max]
Length=479

 Score =   287 bits (734),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK PE YLSYD  C  STVKSL+ SLVCTVGEISTWPSASNVIPGQV +TVDIRA+DD G
Sbjct  298  CKHPEEYLSYDGHCSDSTVKSLSSSLVCTVGEISTWPSASNVIPGQVTYTVDIRAIDDLG  357

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA+IY+ S +++Q+CDKR++ C+IE KHDA AV+CD +LSSQLKSAA++A  ++ G+  
Sbjct  358  REAVIYDLSKQIYQICDKRSVSCIIEHKHDAGAVICDSDLSSQLKSAAYSALKKMEGD-I  416

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VP LMSGAGHDAMA+S LTKVGMLFVRCRGGISHSP+EHVLD+DVWAAG+A L+FLE
Sbjct  417  QDEVPTLMSGAGHDAMAISHLTKVGMLFVRCRGGISHSPQEHVLDNDVWAAGLATLSFLE  476

Query  119  TL  114
             L
Sbjct  477  NL  478


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            QTRLKVTVRG+QGHAGTVPM+MRQDPM A+AE
Sbjct  258  QTRLKVTVRGSQGHAGTVPMSMRQDPMAAAAE  289



>ref|XP_010097117.1| Allantoate deiminase [Morus notabilis]
 gb|EXB66978.1| Allantoate deiminase [Morus notabilis]
Length=480

 Score =   287 bits (734),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 159/183 (87%), Gaps = 1/183 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ +LSYD  C++S ++SL+ SLVCTVGEISTWPSASNVIPGQV FTVD+R +DDTG
Sbjct  299  CKHPKNFLSYDGNCKSSILESLSNSLVCTVGEISTWPSASNVIPGQVTFTVDLRTIDDTG  358

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA+IYE S+RM+Q+CD+R++ C I+RKHDANAV+CD ELSSQLKSAA  A  R+ GE  
Sbjct  359  REAVIYELSSRMYQICDRRSVSCTIDRKHDANAVICDSELSSQLKSAAFAAVKRMRGE-I  417

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
              ++PVLMSGAGHDAMA+S LTKVGMLFVRCRGG+SHSP EHVLD+DVWA+G+A+LAF+E
Sbjct  418  HTELPVLMSGAGHDAMAISHLTKVGMLFVRCRGGVSHSPAEHVLDEDVWASGLALLAFIE  477

Query  119  TLL  111
            T L
Sbjct  478  TQL  480


 Score = 60.1 bits (144),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRL+V VRG+QGHAGTVPM+MRQDPM A+AE+
Sbjct  259  QTRLQVKVRGSQGHAGTVPMSMRQDPMAAAAEM  291



>ref|XP_006586949.1| PREDICTED: allantoate deiminase-like isoform X2 [Glycine max]
Length=403

 Score =   284 bits (727),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 156/182 (86%), Gaps = 1/182 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK PE YLSYD  C  STVKSL+ SLVCTVGEISTWPSASNVIPGQV +TVDIRA+DD G
Sbjct  222  CKHPEEYLSYDGHCSDSTVKSLSTSLVCTVGEISTWPSASNVIPGQVTYTVDIRAIDDLG  281

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA+IY+ S +++Q+CDKR++ C+IE KHDA AV+CD +LSSQLKSAA++A  ++ G+  
Sbjct  282  REAVIYDLSKQIYQICDKRSVSCIIEHKHDAGAVICDSDLSSQLKSAAYSALKKMEGD-I  340

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VP LMSGAGHDAMA+S LTKVGMLFVRCRGGISHSP+EHVLD+DVWAA +A L+FLE
Sbjct  341  QDEVPTLMSGAGHDAMAISHLTKVGMLFVRCRGGISHSPQEHVLDNDVWAASLATLSFLE  400

Query  119  TL  114
             L
Sbjct  401  NL  402


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            QTRLKVTVRG+QGHAGTVPM+MRQDPM A+AE
Sbjct  182  QTRLKVTVRGSQGHAGTVPMSMRQDPMAAAAE  213



>ref|XP_008446305.1| PREDICTED: allantoate deiminase, partial [Cucumis melo]
Length=538

 Score =   288 bits (737),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 155/183 (85%), Gaps = 1/183 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CKQPE YLS+D  C  ST+KSL+ SLVCTVGEISTWPSASNVIPGQV FTVD+R +DD G
Sbjct  357  CKQPESYLSFDGHCTDSTLKSLSTSLVCTVGEISTWPSASNVIPGQVTFTVDLRTIDDIG  416

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA+IYEFSN++H +C  R++ C IERKHDANA++ D ELSSQLKSAA TA  ++ GE  
Sbjct  417  REAVIYEFSNQVHNICSSRSVSCNIERKHDANAIISDSELSSQLKSAASTALKKMVGE-I  475

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             ++VPVLMSGAGHDAMA+S LTKVGMLFVRCRGGISHSP EHVLDDD+WAAG+A+L FLE
Sbjct  476  QEEVPVLMSGAGHDAMAISHLTKVGMLFVRCRGGISHSPAEHVLDDDIWAAGLAVLEFLE  535

Query  119  TLL  111
              L
Sbjct  536  NHL  538


 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTVRG+QGHAGTVPM MRQDPM ASAEL
Sbjct  317  QTRLKVTVRGSQGHAGTVPMPMRQDPMAASAEL  349



>gb|KJB48032.1| hypothetical protein B456_008G050700 [Gossypium raimondii]
Length=408

 Score =   284 bits (727),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P  +LS    C   T++SL+ SLVCTVGEISTWPSASNVIPGQV FTVD+RA+DD G
Sbjct  227  CKHPRDFLSSGGNCNEQTLESLSTSLVCTVGEISTWPSASNVIPGQVTFTVDLRAIDDVG  286

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA++YE SN+M+++CD+R++ C+IERKHDANAV+CD+ELSS+LKSAA++A  ++ G+  
Sbjct  287  REAVVYELSNQMYKICDRRSVSCIIERKHDANAVICDQELSSRLKSAAYSAVNKMVGQ-I  345

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             ++VPVLMSGAGHDAMA+S LTKVGMLFVRCRGGISHSPEEHVL+DDVWAAG+A+LAFLE
Sbjct  346  HEEVPVLMSGAGHDAMAISHLTKVGMLFVRCRGGISHSPEEHVLEDDVWAAGLAVLAFLE  405

Query  119  T  117
            +
Sbjct  406  S  406


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTR+KVTVRG+QGHAGTVPM+MR+DPM A+AEL
Sbjct  187  QTRMKVTVRGSQGHAGTVPMSMRRDPMAAAAEL  219



>ref|XP_007138853.1| hypothetical protein PHAVU_009G242900g [Phaseolus vulgaris]
 gb|ESW10847.1| hypothetical protein PHAVU_009G242900g [Phaseolus vulgaris]
Length=391

 Score =   283 bits (723),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 156/182 (86%), Gaps = 1/182 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK PE +LSYD  C  STVKSL+ SLVCTVGEISTWPSASNVIPGQV +TVDIRA+DD G
Sbjct  210  CKHPEEFLSYDAHCSDSTVKSLSSSLVCTVGEISTWPSASNVIPGQVTYTVDIRAIDDLG  269

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA+IY+ S +++Q+CDKR++ C+IE KHDA AV+CD +LSSQLKSA ++A  ++ G+  
Sbjct  270  REAVIYDLSKQIYQICDKRSVSCIIEHKHDAGAVICDSDLSSQLKSATYSALKKMEGD-I  328

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VP LMSGAGHDAMA+S LTKVGMLFVRCRGGISHSP+EHVLD+DVWAAG+A L+FLE
Sbjct  329  QDEVPTLMSGAGHDAMAISHLTKVGMLFVRCRGGISHSPQEHVLDNDVWAAGLATLSFLE  388

Query  119  TL  114
             L
Sbjct  389  NL  390


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            QTRLKVTVRG+QGHAGTVPM+MRQDPM A+AE
Sbjct  170  QTRLKVTVRGSQGHAGTVPMSMRQDPMAAAAE  201



>ref|XP_003533667.1| PREDICTED: allantoate deiminase-like isoform X1 [Glycine max]
 gb|KHN26612.1| Allantoate deiminase, chloroplastic [Glycine soja]
Length=483

 Score =   283 bits (725),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 156/182 (86%), Gaps = 1/182 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK PE YLSYD  C  STVKSL+ SLVCTVGEISTWPSASNVIPGQV +TVDIRA+DD G
Sbjct  302  CKHPEEYLSYDGHCSDSTVKSLSTSLVCTVGEISTWPSASNVIPGQVTYTVDIRAIDDLG  361

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA+IY+ S +++Q+CDKR++ C+IE KHDA AV+CD +LSSQLKSAA++A  ++ G+  
Sbjct  362  REAVIYDLSKQIYQICDKRSVSCIIEHKHDAGAVICDSDLSSQLKSAAYSALKKMEGD-I  420

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VP LMSGAGHDAMA+S LTKVGMLFVRCRGGISHSP+EHVLD+DVWAA +A L+FLE
Sbjct  421  QDEVPTLMSGAGHDAMAISHLTKVGMLFVRCRGGISHSPQEHVLDNDVWAASLATLSFLE  480

Query  119  TL  114
             L
Sbjct  481  NL  482


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            QTRLKVTVRG+QGHAGTVPM+MRQDPM A+AE
Sbjct  262  QTRLKVTVRGSQGHAGTVPMSMRQDPMAAAAE  293



>gb|KJB48025.1| hypothetical protein B456_008G050700 [Gossypium raimondii]
Length=482

 Score =   283 bits (725),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P  +LS    C   T++SL+ SLVCTVGEISTWPSASNVIPGQV FTVD+RA+DD G
Sbjct  301  CKHPRDFLSSGGNCNEQTLESLSTSLVCTVGEISTWPSASNVIPGQVTFTVDLRAIDDVG  360

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA++YE SN+M+++CD+R++ C+IERKHDANAV+CD+ELSS+LKSAA++A  ++ G+  
Sbjct  361  REAVVYELSNQMYKICDRRSVSCIIERKHDANAVICDQELSSRLKSAAYSAVNKMVGQ-I  419

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             ++VPVLMSGAGHDAMA+S LTKVGMLFVRCRGGISHSPEEHVL+DDVWAAG+A+LAFLE
Sbjct  420  HEEVPVLMSGAGHDAMAISHLTKVGMLFVRCRGGISHSPEEHVLEDDVWAAGLAVLAFLE  479

Query  119  T  117
            +
Sbjct  480  S  480


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTR+KVTVRG+QGHAGTVPM+MR+DPM A+AEL
Sbjct  261  QTRMKVTVRGSQGHAGTVPMSMRRDPMAAAAEL  293



>ref|XP_007138851.1| hypothetical protein PHAVU_009G242900g [Phaseolus vulgaris]
 gb|ESW10845.1| hypothetical protein PHAVU_009G242900g [Phaseolus vulgaris]
Length=482

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 156/182 (86%), Gaps = 1/182 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK PE +LSYD  C  STVKSL+ SLVCTVGEISTWPSASNVIPGQV +TVDIRA+DD G
Sbjct  301  CKHPEEFLSYDAHCSDSTVKSLSSSLVCTVGEISTWPSASNVIPGQVTYTVDIRAIDDLG  360

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA+IY+ S +++Q+CDKR++ C+IE KHDA AV+CD +LSSQLKSA ++A  ++ G+  
Sbjct  361  REAVIYDLSKQIYQICDKRSVSCIIEHKHDAGAVICDSDLSSQLKSATYSALKKMEGD-I  419

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VP LMSGAGHDAMA+S LTKVGMLFVRCRGGISHSP+EHVLD+DVWAAG+A L+FLE
Sbjct  420  QDEVPTLMSGAGHDAMAISHLTKVGMLFVRCRGGISHSPQEHVLDNDVWAAGLATLSFLE  479

Query  119  TL  114
             L
Sbjct  480  NL  481


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            QTRLKVTVRG+QGHAGTVPM+MRQDPM A+AE
Sbjct  261  QTRLKVTVRGSQGHAGTVPMSMRQDPMAAAAE  292



>gb|ABR57240.2| putative allantoate amidohydrolase [Phaseolus vulgaris]
Length=483

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 156/182 (86%), Gaps = 1/182 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK PE +LSYD  C  STVKSL+ SLVCTVGEISTWPSASNVIPGQV +TVDIRA+DD G
Sbjct  302  CKHPEEFLSYDAHCSDSTVKSLSSSLVCTVGEISTWPSASNVIPGQVTYTVDIRAIDDLG  361

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA+IY+ S +++Q+CDKR++ C+IE KHDA AV+CD +LSSQLKSA ++A  ++ G+  
Sbjct  362  REAVIYDLSKQIYQICDKRSVSCIIEHKHDAGAVICDSDLSSQLKSATYSALKKMEGD-I  420

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VP LMSGAGHDAMA+S LTKVGMLFVRCRGGISHSP+EHVLD+DVWAAG+A L+FLE
Sbjct  421  QDEVPTLMSGAGHDAMAISHLTKVGMLFVRCRGGISHSPQEHVLDNDVWAAGLATLSFLE  480

Query  119  TL  114
             L
Sbjct  481  NL  482


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            QTRLKVTVRG+QGHAGTVPM+MRQDPM A+AE
Sbjct  262  QTRLKVTVRGSQGHAGTVPMSMRQDPMAAAAE  293



>gb|KEH37361.1| allantoate amidohydrolase [Medicago truncatula]
Length=392

 Score =   279 bits (714),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK PE YLSYD  C  S++KSL+ SLVCTVGEISTWPSASNVIPGQV +TVDIRA+DD G
Sbjct  212  CKHPEEYLSYDGRCSGSSIKSLSSSLVCTVGEISTWPSASNVIPGQVTYTVDIRAIDDLG  271

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA+IY+ SNR++Q+CDKR++ CVIE KHDA AV+CD ELSSQLKSAA++A  R+ G+  
Sbjct  272  REAVIYDLSNRIYQICDKRSVSCVIEHKHDAGAVICDPELSSQLKSAAYSALKRMEGD-I  330

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VP LMSGAGHDAMAMS LTKVGMLFVRCRGGISHSP+E VLDDDVWAAG+A L+FLE
Sbjct  331  QDEVPTLMSGAGHDAMAMSHLTKVGMLFVRCRGGISHSPQEDVLDDDVWAAGLATLSFLE  390

Query  119  TL  114
             L
Sbjct  391  NL  392


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            QTRLKVTVRG+QGHAGTVPM+MRQDPMVA+AE
Sbjct  172  QTRLKVTVRGSQGHAGTVPMSMRQDPMVAAAE  203



>ref|XP_004487909.1| PREDICTED: allantoate deiminase, chloroplastic-like isoform X3 
[Cicer arietinum]
Length=420

 Score =   280 bits (715),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 158/182 (87%), Gaps = 1/182 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK PE YLSYD  C  S++KSL+ SLVCTVGEISTWPSASNVIPGQV +TVDIRA+DD G
Sbjct  240  CKHPEEYLSYDGHCSDSSIKSLSSSLVCTVGEISTWPSASNVIPGQVTYTVDIRAIDDLG  299

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA+IY+ SNR++Q+CDKR++ C+IE KHDA AV+CD ELSSQLKSAA++A  ++ G+  
Sbjct  300  REAVIYDLSNRIYQICDKRSVSCLIEHKHDAGAVICDPELSSQLKSAAYSALKKMEGD-I  358

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VP LMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSP+E VLDDDVWAAG+A L+FLE
Sbjct  359  QDEVPTLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPQEDVLDDDVWAAGLAFLSFLE  418

Query  119  TL  114
             L
Sbjct  419  NL  420


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            QTRLKVTVRG+QGHAGTVPM+MRQDPMVA+AE
Sbjct  200  QTRLKVTVRGSQGHAGTVPMSMRQDPMVAAAE  231



>ref|XP_004487908.1| PREDICTED: allantoate deiminase, chloroplastic-like isoform X2 
[Cicer arietinum]
Length=423

 Score =   280 bits (715),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 158/182 (87%), Gaps = 1/182 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK PE YLSYD  C  S++KSL+ SLVCTVGEISTWPSASNVIPGQV +TVDIRA+DD G
Sbjct  243  CKHPEEYLSYDGHCSDSSIKSLSSSLVCTVGEISTWPSASNVIPGQVTYTVDIRAIDDLG  302

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA+IY+ SNR++Q+CDKR++ C+IE KHDA AV+CD ELSSQLKSAA++A  ++ G+  
Sbjct  303  REAVIYDLSNRIYQICDKRSVSCLIEHKHDAGAVICDPELSSQLKSAAYSALKKMEGD-I  361

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VP LMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSP+E VLDDDVWAAG+A L+FLE
Sbjct  362  QDEVPTLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPQEDVLDDDVWAAGLAFLSFLE  421

Query  119  TL  114
             L
Sbjct  422  NL  423


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            QTRLKVTVRG+QGHAGTVPM+MRQDPMVA+AE
Sbjct  203  QTRLKVTVRGSQGHAGTVPMSMRQDPMVAAAE  234



>ref|XP_002532138.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30237.1| conserved hypothetical protein, partial [Ricinus communis]
Length=436

 Score =   280 bits (716),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 158/181 (87%), Gaps = 1/181 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ +LSYD +C  ST++SL+ SLVCTVGEISTWPSASNVIPGQV FTVD+RAMDD G
Sbjct  255  CKYPKDFLSYDSQCNGSTLESLSSSLVCTVGEISTWPSASNVIPGQVTFTVDLRAMDDMG  314

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            R+A++YE SNR++Q+CD+R++ C+IERKHDA AV CD ELSSQLK AA+ A  R+TGE  
Sbjct  315  RDAVLYELSNRIYQICDRRSVSCIIERKHDAQAVSCDPELSSQLKLAANAALKRMTGE-I  373

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             DD+P LMSGAGHDAMAMS LTKVGMLFVRCRGGISHSP EHV+DDD+WAAG+AI+AFLE
Sbjct  374  QDDIPTLMSGAGHDAMAMSHLTKVGMLFVRCRGGISHSPAEHVMDDDIWAAGLAIVAFLE  433

Query  119  T  117
            T
Sbjct  434  T  434


 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTV+G+QGHAGTVPM++RQDPM A+AEL
Sbjct  215  QTRLKVTVKGSQGHAGTVPMSLRQDPMAAAAEL  247



>ref|XP_004487907.1| PREDICTED: allantoate deiminase, chloroplastic-like isoform X1 
[Cicer arietinum]
Length=473

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 158/182 (87%), Gaps = 1/182 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK PE YLSYD  C  S++KSL+ SLVCTVGEISTWPSASNVIPGQV +TVDIRA+DD G
Sbjct  293  CKHPEEYLSYDGHCSDSSIKSLSSSLVCTVGEISTWPSASNVIPGQVTYTVDIRAIDDLG  352

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA+IY+ SNR++Q+CDKR++ C+IE KHDA AV+CD ELSSQLKSAA++A  ++ G+  
Sbjct  353  REAVIYDLSNRIYQICDKRSVSCLIEHKHDAGAVICDPELSSQLKSAAYSALKKMEGD-I  411

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VP LMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSP+E VLDDDVWAAG+A L+FLE
Sbjct  412  QDEVPTLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPQEDVLDDDVWAAGLAFLSFLE  471

Query  119  TL  114
             L
Sbjct  472  NL  473


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            QTRLKVTVRG+QGHAGTVPM+MRQDPMVA+AE
Sbjct  253  QTRLKVTVRGSQGHAGTVPMSMRQDPMVAAAE  284



>gb|KEH37360.1| allantoate amidohydrolase [Medicago truncatula]
Length=478

 Score =   279 bits (713),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK PE YLSYD  C  S++KSL+ SLVCTVGEISTWPSASNVIPGQV +TVDIRA+DD G
Sbjct  298  CKHPEEYLSYDGRCSGSSIKSLSSSLVCTVGEISTWPSASNVIPGQVTYTVDIRAIDDLG  357

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA+IY+ SNR++Q+CDKR++ CVIE KHDA AV+CD ELSSQLKSAA++A  R+ G+  
Sbjct  358  REAVIYDLSNRIYQICDKRSVSCVIEHKHDAGAVICDPELSSQLKSAAYSALKRMEGD-I  416

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VP LMSGAGHDAMAMS LTKVGMLFVRCRGGISHSP+E VLDDDVWAAG+A L+FLE
Sbjct  417  QDEVPTLMSGAGHDAMAMSHLTKVGMLFVRCRGGISHSPQEDVLDDDVWAAGLATLSFLE  476

Query  119  TL  114
             L
Sbjct  477  NL  478


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            QTRLKVTVRG+QGHAGTVPM+MRQDPMVA+AE
Sbjct  258  QTRLKVTVRGSQGHAGTVPMSMRQDPMVAAAE  289



>ref|XP_007212028.1| hypothetical protein PRUPE_ppa005027mg [Prunus persica]
 gb|EMJ13227.1| hypothetical protein PRUPE_ppa005027mg [Prunus persica]
Length=480

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 159/205 (78%), Gaps = 24/205 (12%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ +LS+D  C++ +++SL+ SLVCTVGEISTWPSASNVIPGQV FTVD+R +DD G
Sbjct  274  CKHPQDFLSFDGHCKSFSMESLSTSLVCTVGEISTWPSASNVIPGQVTFTVDLRTIDDMG  333

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERK------------------------HDANAVVC  372
            REA++YEFSNRM+Q+CDKR++ C I+RK                        HDA+AV+C
Sbjct  334  REAVVYEFSNRMYQICDKRSVSCTIDRKVRDFRILVPSFCRLLNPVCLVFFQHDADAVIC  393

Query  371  DRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGIS  192
            D ELSS+LKSA +    R+TG    D++PV+MSGAGHDAMA+S LTKVGMLFVRCRGGIS
Sbjct  394  DSELSSKLKSATYIGLKRMTGAAIQDEIPVVMSGAGHDAMALSHLTKVGMLFVRCRGGIS  453

Query  191  HSPEEHVLDDDVWAAGMAILAFLET  117
            HSPEEHVLDDDVWA+G+AILAF+ET
Sbjct  454  HSPEEHVLDDDVWASGLAILAFIET  478


 Score = 59.7 bits (143),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            QTRLKVT+RG+QGHAGTVPM+MR DPM A+AE
Sbjct  234  QTRLKVTMRGSQGHAGTVPMSMRHDPMAAAAE  265



>ref|XP_003594851.1| Allantoate amidohydrolase [Medicago truncatula]
Length=568

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK PE YLSYD  C  S++KSL+ SLVCTVGEISTWPSASNVIPGQV +TVDIRA+DD G
Sbjct  388  CKHPEEYLSYDGRCSGSSIKSLSSSLVCTVGEISTWPSASNVIPGQVTYTVDIRAIDDLG  447

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA+IY+ SNR++Q+CDKR++ CVIE KHDA AV+CD ELSSQLKSAA++A  R+ G+  
Sbjct  448  REAVIYDLSNRIYQICDKRSVSCVIEHKHDAGAVICDPELSSQLKSAAYSALKRMEGD-I  506

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VP LMSGAGHDAMAMS LTKVGMLFVRCRGGISHSP+E VLDDDVWAAG+A L+FLE
Sbjct  507  QDEVPTLMSGAGHDAMAMSHLTKVGMLFVRCRGGISHSPQEDVLDDDVWAAGLATLSFLE  566

Query  119  TL  114
             L
Sbjct  567  NL  568


 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            QTRLKVTVRG+QGHAGTVPM+MRQDPMVA+AE
Sbjct  348  QTRLKVTVRGSQGHAGTVPMSMRQDPMVAAAE  379



>gb|EPS72270.1| hypothetical protein M569_02484, partial [Genlisea aurea]
Length=442

 Score =   274 bits (701),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 147/184 (80%), Gaps = 1/184 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK+PE YLSYD  C  S    LAGSLVCTVGEIS WP ASNVIPGQV FTVDIRAMDD G
Sbjct  259  CKKPEEYLSYDGHCSGSVSPYLAGSLVCTVGEISAWPGASNVIPGQVVFTVDIRAMDDQG  318

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITG-ET  303
            RE ++YE S RMH++CDKR+I C+IERKHDANAV CD ELSSQLKSAA ++  R++G E 
Sbjct  319  REDVLYEMSERMHRICDKRSIVCLIERKHDANAVACDPELSSQLKSAARSSLERLSGEEI  378

Query  302  TDDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFL  123
                VPV+MSGAGHDAMAMS LTKV MLFVRCRGGISHSP EHV D+DV AA  A+L F+
Sbjct  379  IGGGVPVVMSGAGHDAMAMSHLTKVAMLFVRCRGGISHSPAEHVADEDVLAASTAVLTFI  438

Query  122  ETLL  111
             TL+
Sbjct  439  GTLV  442


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPM  700
            QTRL VTV+G+QGHAGTVPM MR+DPM
Sbjct  219  QTRLMVTVKGSQGHAGTVPMGMRKDPM  245



>gb|KDO77265.1| hypothetical protein CISIN_1g015341mg [Citrus sinensis]
Length=290

 Score =   268 bits (686),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 158/181 (87%), Gaps = 1/181 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ +LSYD     ST++SL+ SLVCTVGEIS+WPSASNVIPG+V FTVD+RA+DD G
Sbjct  109  CKHPKDFLSYDGRSNCSTLESLSSSLVCTVGEISSWPSASNVIPGEVTFTVDLRAIDDAG  168

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            RE ++YE SN+++Q+C+KR++ C++ERKHDANAV+CD +LSSQLKSA++ A  R+TG  T
Sbjct  169  RETVLYELSNQLYQICEKRSVSCIVERKHDANAVMCDADLSSQLKSASYAALKRMTG-AT  227

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
              ++PV+MSGAGHDAMAMS LTKVGMLFVRCRGGISHSP EHVLDDDVWAAG+A+LAFLE
Sbjct  228  QHEIPVIMSGAGHDAMAMSHLTKVGMLFVRCRGGISHSPAEHVLDDDVWAAGLAVLAFLE  287

Query  119  T  117
            T
Sbjct  288  T  288


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTVRG+QGHAGTVPM+MRQDPM A+AEL
Sbjct  69   QTRLKVTVRGSQGHAGTVPMSMRQDPMTAAAEL  101



>ref|XP_006448626.1| hypothetical protein CICLE_v10015120mg [Citrus clementina]
 gb|ESR61866.1| hypothetical protein CICLE_v10015120mg [Citrus clementina]
Length=472

 Score =   273 bits (697),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ +LSYD     ST++SL+ SLVCTVGEIS+WPSASNVIPG+V FTVD+RA+DD G
Sbjct  291  CKHPKDFLSYDGRSNGSTLESLSSSLVCTVGEISSWPSASNVIPGEVTFTVDLRAIDDAG  350

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            RE ++YE SN+++Q+C+KR++ C++ERKHDANAV+CD +LSSQLKSA++ A  R+TGE T
Sbjct  351  RETVLYELSNQLYQICEKRSVSCIVERKHDANAVMCDADLSSQLKSASYAALKRMTGE-T  409

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
              ++PV+MSGAGHDAMAMS LTKVGMLFVRCRGGISHSP EHVLDDDVWAAG+A+LAFLE
Sbjct  410  QHEIPVIMSGAGHDAMAMSHLTKVGMLFVRCRGGISHSPAEHVLDDDVWAAGLAVLAFLE  469

Query  119  T  117
            T
Sbjct  470  T  470


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTVRG+QGHAGTVPM+MRQDPM A+AEL
Sbjct  251  QTRLKVTVRGSQGHAGTVPMSMRQDPMTAAAEL  283



>ref|XP_006283501.1| hypothetical protein CARUB_v10004553mg [Capsella rubella]
 gb|EOA16399.1| hypothetical protein CARUB_v10004553mg [Capsella rubella]
Length=537

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 152/181 (84%), Gaps = 1/181 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ YLS + +C   T++SLA SLVCTVGEISTWPSASNVIPGQV FTVD+R +DD G
Sbjct  356  CKNPKDYLSCNGQCNEGTIESLANSLVCTVGEISTWPSASNVIPGQVTFTVDLRTIDDVG  415

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            R AI+++ S RM+Q+CDKR++ C IERKHDA+AV+ D  LSSQLKSAA +A  ++TGE  
Sbjct  416  RNAILHDLSTRMYQICDKRSLLCSIERKHDADAVMSDPHLSSQLKSAAQSALKKMTGE-V  474

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VPVLMSGAGHDAMAMS LTKVGMLFVRCRGGISHSP EHVLDDDV AAG+AIL FLE
Sbjct  475  QDEVPVLMSGAGHDAMAMSHLTKVGMLFVRCRGGISHSPAEHVLDDDVGAAGLAILEFLE  534

Query  119  T  117
            +
Sbjct  535  S  535


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVT++G+QGHAGTVPM++R DPM  +AEL
Sbjct  316  QTRLKVTLKGSQGHAGTVPMSLRHDPMTGAAEL  348



>gb|KDO77263.1| hypothetical protein CISIN_1g015341mg [Citrus sinensis]
 gb|KDO77264.1| hypothetical protein CISIN_1g015341mg [Citrus sinensis]
Length=408

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 158/181 (87%), Gaps = 1/181 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ +LSYD     ST++SL+ SLVCTVGEIS+WPSASNVIPG+V FTVD+RA+DD G
Sbjct  227  CKHPKDFLSYDGRSNCSTLESLSSSLVCTVGEISSWPSASNVIPGEVTFTVDLRAIDDAG  286

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            RE ++YE SN+++Q+C+KR++ C++ERKHDANAV+CD +LSSQLKSA++ A  R+TG  T
Sbjct  287  RETVLYELSNQLYQICEKRSVSCIVERKHDANAVMCDADLSSQLKSASYAALKRMTG-AT  345

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
              ++PV+MSGAGHDAMAMS LTKVGMLFVRCRGGISHSP EHVLDDDVWAAG+A+LAFLE
Sbjct  346  QHEIPVIMSGAGHDAMAMSHLTKVGMLFVRCRGGISHSPAEHVLDDDVWAAGLAVLAFLE  405

Query  119  T  117
            T
Sbjct  406  T  406


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTVRG+QGHAGTVPM+MRQDPM A+AEL
Sbjct  187  QTRLKVTVRGSQGHAGTVPMSMRQDPMTAAAEL  219



>gb|KCW75654.1| hypothetical protein EUGRSUZ_D00017 [Eucalyptus grandis]
Length=502

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 158/209 (76%), Gaps = 28/209 (13%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK+PE +LS+D  C+ STV+SL+ SLVCTVGEIS+WPSASNVIPGQV FTVDIRA+DD G
Sbjct  292  CKRPEDFLSFDGHCKDSTVQSLSTSLVCTVGEISSWPSASNVIPGQVVFTVDIRAIDDMG  351

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERK----------------------------HDAN  384
            REA+IYE SNRM+Q+CD+R++ C+IERK                            HDA 
Sbjct  352  REAVIYELSNRMYQICDRRSVSCIIERKVGCLIALCISSFNLFYYVCRYLCFGDEQHDAG  411

Query  383  AVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCR  204
            AV+CD EL  QLK AA +A  R++     D+VPVLMSGAGHDAMA+S LTKVGM+FVRCR
Sbjct  412  AVMCDDELRRQLKFAADSALKRMSDNQFLDEVPVLMSGAGHDAMAISHLTKVGMIFVRCR  471

Query  203  GGISHSPEEHVLDDDVWAAGMAILAFLET  117
            GG+SHSPEEHVLDDDVWAAG+++LAFLET
Sbjct  472  GGVSHSPEEHVLDDDVWAAGLSVLAFLET  500


 Score = 63.5 bits (153),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTR+KVTVRG+QGHAGTVPM+MRQDPM A+AEL
Sbjct  252  QTRMKVTVRGSQGHAGTVPMSMRQDPMSAAAEL  284



>ref|XP_002869950.1| hypothetical protein ARALYDRAFT_914645 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46209.1| hypothetical protein ARALYDRAFT_914645 [Arabidopsis lyrata subsp. 
lyrata]
Length=529

 Score =   272 bits (695),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ YLS + +C   T++SLA SLVCTVGEISTWPSASNVIPGQV FTVD+R +DD G
Sbjct  348  CKNPKDYLSCNGQCNEDTIESLANSLVCTVGEISTWPSASNVIPGQVTFTVDLRTIDDVG  407

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            R+AI+++ S RM+++CDKR++ C IERKHDA+AV+ D +LSSQLKSAA +A  ++TGE  
Sbjct  408  RKAILHDLSTRMYKICDKRSLLCSIERKHDADAVMSDPQLSSQLKSAAQSALKKMTGE-V  466

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VPVLMSGAGHDAMAM+ LTKVGMLFVRCRGGISHSP EHVLDDD+ AAG+AIL FLE
Sbjct  467  QDEVPVLMSGAGHDAMAMAHLTKVGMLFVRCRGGISHSPAEHVLDDDIGAAGLAILEFLE  526

Query  119  T  117
            +
Sbjct  527  S  527


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTV+G+QGHAGTVPM++RQDPM  +AEL
Sbjct  308  QTRLKVTVKGSQGHAGTVPMSLRQDPMTGAAEL  340



>ref|XP_006468549.1| PREDICTED: allantoate deiminase-like [Citrus sinensis]
Length=472

 Score =   270 bits (691),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 158/181 (87%), Gaps = 1/181 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ +LSYD     ST++SL+ SLVCTVGEIS+WPSASNVIPG+V FTVD+RA+DD G
Sbjct  291  CKHPKDFLSYDGRSNCSTLESLSSSLVCTVGEISSWPSASNVIPGEVTFTVDLRAIDDAG  350

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            RE ++YE SN+++Q+C+KR++ C++ERKHDANAV+CD +LSSQLKSA++ A  R+TG  T
Sbjct  351  RETVLYELSNQLYQICEKRSVSCIVERKHDANAVMCDADLSSQLKSASYAALKRMTG-AT  409

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
              ++PV+MSGAGHDAMAMS LTKVGMLFVRCRGGISHSP EHVLDDDVWAAG+A+LAFLE
Sbjct  410  QHEIPVIMSGAGHDAMAMSHLTKVGMLFVRCRGGISHSPAEHVLDDDVWAAGLAVLAFLE  469

Query  119  T  117
            T
Sbjct  470  T  470


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTVRG+QGHAGTVPM+MRQDPM A+AEL
Sbjct  251  QTRLKVTVRGSQGHAGTVPMSMRQDPMTAAAEL  283



>ref|NP_193740.1| allantoate amidohydrolase [Arabidopsis thaliana]
 sp|O49434.2|AAH_ARATH RecName: Full=Allantoate deiminase; AltName: Full=Allantoate 
amidohydrolase; Short=AtAAH; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA16615.2| hyuC-like protein [Arabidopsis thaliana]
 emb|CAB79007.1| hyuC-like protein [Arabidopsis thaliana]
 gb|ABF57290.1| At4g20070 [Arabidopsis thaliana]
 gb|AEE84269.1| allantoate amidohydrolase [Arabidopsis thaliana]
Length=525

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 153/181 (85%), Gaps = 1/181 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ YLS + +C   TV+SLA SLVCTVGEISTWPSASNVIPGQV FTVD+R +DD G
Sbjct  344  CKNPKDYLSCNVQCNEDTVESLANSLVCTVGEISTWPSASNVIPGQVTFTVDLRTIDDVG  403

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            R+AI+++ S RM+Q+CDKR++ C IERKHDA+AV+ D +LS QLKSAA +A  ++TGE  
Sbjct  404  RKAILHDLSTRMYQICDKRSLLCSIERKHDADAVMSDPQLSLQLKSAAQSALKKMTGE-V  462

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VPVLMSGAGHDAMAM+ LTKVGMLFVRCRGGISHSP EHVLDDDV AAG+AIL FLE
Sbjct  463  QDEVPVLMSGAGHDAMAMAHLTKVGMLFVRCRGGISHSPAEHVLDDDVGAAGLAILEFLE  522

Query  119  T  117
            +
Sbjct  523  S  523


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTV+G+QGHAGTVPM+MRQDPM  +AEL
Sbjct  304  QTRLKVTVKGSQGHAGTVPMSMRQDPMTGAAEL  336



>ref|XP_009137035.1| PREDICTED: allantoate deiminase [Brassica rapa]
Length=527

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 151/181 (83%), Gaps = 1/181 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            C+ P+ YL+ + +C   T++SLA SLVCTVGEISTWPSASNVIPGQV FTVD+R +DD G
Sbjct  346  CRNPKEYLTCEGQCNEETIESLANSLVCTVGEISTWPSASNVIPGQVTFTVDLRTIDDVG  405

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            R AI+++ S RM+Q+CDKR++ C IERKHDA+AV+ D  LS QLKSAA +A  +ITGE  
Sbjct  406  RNAILHDLSTRMYQICDKRSLLCSIERKHDADAVISDPHLSLQLKSAAQSALKKITGE-V  464

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VPVLMSGAGHDAMA+S LTKVGMLFVRCRGGISHSP EHVLDDDV AAG+AIL FLE
Sbjct  465  QDEVPVLMSGAGHDAMALSYLTKVGMLFVRCRGGISHSPAEHVLDDDVGAAGLAILEFLE  524

Query  119  T  117
            +
Sbjct  525  S  525


 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTV+G+QGHAGTVPM++RQDPM  +AEL
Sbjct  306  QTRLKVTVKGSQGHAGTVPMSLRQDPMTGAAEL  338



>ref|XP_010536943.1| PREDICTED: allantoate deiminase [Tarenaya hassleriana]
Length=520

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 151/182 (83%), Gaps = 2/182 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDE-CQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDT  483
            CK P+ +LS D   C    ++SLA SLVCTVGEIS WPSASNVIPGQV FTVD+R +DD 
Sbjct  337  CKNPKDHLSCDGGICNGDMIESLASSLVCTVGEISAWPSASNVIPGQVTFTVDLRTIDDV  396

Query  482  GREAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGET  303
            GREAI+++ S RM+Q+CDKR++ C IERKHDANAV+ D EL+ QLKSAA TA  R+TGE 
Sbjct  397  GREAILHDLSTRMYQICDKRSLLCSIERKHDANAVISDPELTLQLKSAAQTALKRMTGE-  455

Query  302  TDDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFL  123
              D+VPVLMSGAGHDAMAMS LTKVGMLFVRCRGG+SHSP EHVLDDDV AAG+AILAFL
Sbjct  456  NQDEVPVLMSGAGHDAMAMSHLTKVGMLFVRCRGGVSHSPAEHVLDDDVGAAGLAILAFL  515

Query  122  ET  117
            E+
Sbjct  516  ES  517


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTV+G+QGHAGTVPM+MR+DP+  +AEL
Sbjct  297  QTRLKVTVKGSQGHAGTVPMSMRKDPLAGAAEL  329



>ref|XP_010439619.1| PREDICTED: allantoate deiminase-like [Camelina sativa]
Length=535

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 152/181 (84%), Gaps = 1/181 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ YLS + +C  +T++SLA SLVCTVGEISTWPSASNVIPGQV FTVD+R +DD G
Sbjct  354  CKNPKDYLSCNGQCNENTIESLANSLVCTVGEISTWPSASNVIPGQVTFTVDLRTIDDVG  413

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            R AI+++ S RM+++CDKR++ C IERKHDA+AV+ D  LSSQLKSAA +A  ++TGE  
Sbjct  414  RNAILHDLSTRMYKICDKRSLLCSIERKHDADAVMSDPHLSSQLKSAAQSALKKMTGE-V  472

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VPVLMSGAGHDAMAMS LTKVGMLFVRCRGGISHSP EHVLDDDV A G+AIL FLE
Sbjct  473  QDEVPVLMSGAGHDAMAMSYLTKVGMLFVRCRGGISHSPAEHVLDDDVGAVGLAILEFLE  532

Query  119  T  117
            +
Sbjct  533  S  533


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTV+G+QGHAGTVPM+MRQDPM  +AEL
Sbjct  314  QTRLKVTVKGSQGHAGTVPMSMRQDPMTGAAEL  346



>gb|AFK37421.1| unknown [Lotus japonicus]
Length=393

 Score =   266 bits (679),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 156/182 (86%), Gaps = 1/182 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK PE YLSYD  C  S+VKSL+ SLVCTVGEISTWPSASNVI GQV +T+DIRA+DD G
Sbjct  212  CKHPEEYLSYDGRCSDSSVKSLSSSLVCTVGEISTWPSASNVILGQVTYTMDIRAIDDLG  271

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA+IY+ SNR++Q+CD+R++ C+IE KH+A AV+CD  LSSQLKSAA++A  R+ G+  
Sbjct  272  REAVIYDLSNRIYQICDRRSVSCIIEHKHNAGAVICDSGLSSQLKSAAYSALKRMEGD-I  330

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             ++VP LMSGAGHDAMAMS LTKVGMLFVRCRGGISHSPEEHVLD+DVWAAG+A L+FLE
Sbjct  331  QEEVPTLMSGAGHDAMAMSHLTKVGMLFVRCRGGISHSPEEHVLDNDVWAAGLATLSFLE  390

Query  119  TL  114
             L
Sbjct  391  NL  392


 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            QTRLKVTVRG+QGHAGTVPM+MRQDPMV +AE
Sbjct  172  QTRLKVTVRGSQGHAGTVPMSMRQDPMVVAAE  203



>ref|XP_010434321.1| PREDICTED: allantoate deiminase-like [Camelina sativa]
Length=532

 Score =   269 bits (688),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 151/181 (83%), Gaps = 1/181 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ YLS + +C   T++SLA SLVCTVGEISTWPSASNVIPGQV FTVD+R +DD G
Sbjct  351  CKNPKGYLSCNGQCNEDTIESLANSLVCTVGEISTWPSASNVIPGQVTFTVDLRTIDDVG  410

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            R AI+++ S RM+++CDKR++ C IERKHDA+AV+ D  LSSQLKSAA +A  ++TGE  
Sbjct  411  RNAILHDLSTRMYKICDKRSLLCSIERKHDADAVMSDPHLSSQLKSAAQSALKKMTGE-V  469

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             ++VPVLMSGAGHDAMAMS LTKVGMLFVRCRGGISHSP EHVLDDDV A G+AIL FLE
Sbjct  470  QEEVPVLMSGAGHDAMAMSYLTKVGMLFVRCRGGISHSPAEHVLDDDVGAVGLAILEFLE  529

Query  119  T  117
            +
Sbjct  530  S  530


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTV+G+QGHAGTVPM+MRQDPM  +AEL
Sbjct  311  QTRLKVTVKGSQGHAGTVPMSMRQDPMTGAAEL  343



>ref|XP_006413904.1| hypothetical protein EUTSA_v10024702mg [Eutrema salsugineum]
 gb|ESQ55357.1| hypothetical protein EUTSA_v10024702mg [Eutrema salsugineum]
Length=610

 Score =   269 bits (688),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ YLS D +C   T++SLA SLVCTVGEISTWPSASNVIPGQV FTVD+R +DD G
Sbjct  429  CKNPKDYLSCDGQCNEDTIESLANSLVCTVGEISTWPSASNVIPGQVTFTVDLRTIDDVG  488

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            R+AI+++ S RM+Q+CDKR++ C IERKHDA+AV+ +  LS QLKSAA  A  ++TGE  
Sbjct  489  RKAILHDLSTRMYQICDKRSLLCSIERKHDADAVISNPNLSLQLKSAAQIALKKMTGE-I  547

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFL  123
             D+VPVLMSGAGHDAMAMS LTKVGMLFVRCRGGISHSP EHVLDDDV AAG+AIL FL
Sbjct  548  QDEVPVLMSGAGHDAMAMSHLTKVGMLFVRCRGGISHSPAEHVLDDDVGAAGLAILEFL  606


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTV+G+QGHAGTVPM++RQDPM  +AEL
Sbjct  389  QTRLKVTVKGSQGHAGTVPMSLRQDPMTGAAEL  421



>ref|XP_010449233.1| PREDICTED: allantoate deiminase [Camelina sativa]
Length=530

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 150/181 (83%), Gaps = 1/181 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ YLS + +C   T++SLA SLVCTVGEISTWPSASNVIPGQV FTVD+R +DD G
Sbjct  349  CKNPKDYLSCNGQCNEDTIESLANSLVCTVGEISTWPSASNVIPGQVTFTVDLRTIDDVG  408

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            R AI+++ S RM+++CDKR++ C IERKHDA+AV+ D +LS QLKSAA +A  ++TGE  
Sbjct  409  RNAILHDLSTRMYKICDKRSLLCSIERKHDADAVMSDPQLSLQLKSAAQSALKKMTGE-V  467

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VPVLMSGAGHDAMAM+ LTKVGMLFVRCRGGISHSP E VLDDDV AAG+ IL FLE
Sbjct  468  QDEVPVLMSGAGHDAMAMAHLTKVGMLFVRCRGGISHSPAEQVLDDDVGAAGLTILEFLE  527

Query  119  T  117
            +
Sbjct  528  S  528


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTV+G+QGHAGTVPM+MRQDPM  +AEL
Sbjct  309  QTRLKVTVKGSQGHAGTVPMSMRQDPMTGAAEL  341



>ref|XP_006413901.1| hypothetical protein EUTSA_v10025370mg [Eutrema salsugineum]
 gb|ESQ55354.1| hypothetical protein EUTSA_v10025370mg [Eutrema salsugineum]
Length=400

 Score =   261 bits (667),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 148/182 (81%), Gaps = 2/182 (1%)
 Frame = -1

Query  659  CKQPEYYLS-YDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDT  483
            CK P+ YLS  D +C   T++SLA SLVCTVGEISTWPSASNVIPGQV FTVD+R +DD 
Sbjct  207  CKNPKDYLSCGDGQCNEDTIESLANSLVCTVGEISTWPSASNVIPGQVTFTVDLRTIDDV  266

Query  482  GREAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGET  303
            GR+ I+++ S RM+Q+CDKR++ C IERKHDA+AV+ D  LS QLKSAA  A  ++TG+ 
Sbjct  267  GRKTILHDLSTRMYQICDKRSLLCSIERKHDADAVISDPHLSLQLKSAAQIALKKMTGD-  325

Query  302  TDDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFL  123
              D+VPVLMSGAGHDAMAMS LTKVGMLFVRCRGGISHSP E VLDDDV AAG+AIL FL
Sbjct  326  IQDEVPVLMSGAGHDAMAMSHLTKVGMLFVRCRGGISHSPAERVLDDDVGAAGLAILEFL  385

Query  122  ET  117
             +
Sbjct  386  HS  387


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTV+G+QGHAGTVPM++RQDPM  +AEL
Sbjct  167  QTRLKVTVKGSQGHAGTVPMSLRQDPMTGAAEL  199



>emb|CDY01635.1| BnaC07g36250D [Brassica napus]
Length=525

 Score =   257 bits (657),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 146/183 (80%), Gaps = 6/183 (3%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ YL+ D +C   T++SLA SLVCT GEISTWPSASNV      FTVD+R +DD G
Sbjct  349  CKNPKEYLTCDGQCNEETIESLANSLVCTAGEISTWPSASNV-----AFTVDLRTIDDVG  403

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            R AI+++ S RM+Q+CDKR++ C IERKHDA+AV+ D  LS QLKSAA +A  +ITGE  
Sbjct  404  RNAILHDLSTRMYQICDKRSLLCSIERKHDADAVISDPHLSLQLKSAAQSALKKITGEV-  462

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VPVLMSGAGHDAMAMS LTKVGMLFVRCRGGISHSP EHVLDDDV AAG+AIL FLE
Sbjct  463  QDEVPVLMSGAGHDAMAMSYLTKVGMLFVRCRGGISHSPAEHVLDDDVGAAGLAILEFLE  522

Query  119  TLL  111
            + L
Sbjct  523  SQL  525


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTV+G+QGHAGTVPM++RQDPM  +AEL
Sbjct  309  QTRLKVTVKGSQGHAGTVPMSLRQDPMTGAAEL  341



>emb|CDX98655.1| BnaA03g44400D [Brassica napus]
Length=519

 Score =   254 bits (649),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 145/181 (80%), Gaps = 6/181 (3%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ YL  + +C   TV+SLA SLVCTVGEISTWPSASNV      FTVD+R +DD G
Sbjct  343  CKNPKEYLICEGQCNEETVESLANSLVCTVGEISTWPSASNV-----TFTVDLRTIDDVG  397

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            R AI+++ S RM+Q+CDKR++ C IERKHDA+AV+ D  LS QLKSAA +A  +ITGE  
Sbjct  398  RNAILHDLSTRMYQICDKRSLLCSIERKHDADAVISDPHLSLQLKSAAQSALKKITGEV-  456

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VPVLMSGAGHDAMA+S LTKVGMLFVRCRGGISHSP EHVLDDDV AAG+AIL FLE
Sbjct  457  QDEVPVLMSGAGHDAMALSYLTKVGMLFVRCRGGISHSPAEHVLDDDVGAAGLAILEFLE  516

Query  119  T  117
            +
Sbjct  517  S  517


 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTV+G+QGHAGTVPM++RQDPM  +AEL
Sbjct  303  QTRLKVTVKGSQGHAGTVPMSLRQDPMTGAAEL  335



>ref|XP_010260694.1| PREDICTED: allantoate deiminase isoform X1 [Nelumbo nucifera]
Length=490

 Score =   245 bits (625),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 136/169 (80%), Gaps = 5/169 (3%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK PE ++SYD  C   T    A SLVCTVGEISTWPSASNVIPG+V FTVD+RA+DD  
Sbjct  313  CKHPENFISYDGHCNGFT----AESLVCTVGEISTWPSASNVIPGEVNFTVDLRAIDDMA  368

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            RE++++E +N+++Q CD+R++ CVIERKHDA AV+CD  LS QLKSAA++A   +  E  
Sbjct  369  RESVLFELANQIYQTCDRRSVSCVIERKHDAEAVICDPGLSLQLKSAAYSAMKIMVSE-I  427

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVW  153
             D+ PVLMSGAGHDAMAMS LTKVGMLFVRCRGGISHSP EHVLDDDVW
Sbjct  428  QDEAPVLMSGAGHDAMAMSHLTKVGMLFVRCRGGISHSPAEHVLDDDVW  476


 Score = 66.2 bits (160),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTVRG+QGHAGTVPM+MRQDPM ASAEL
Sbjct  273  QTRLKVTVRGSQGHAGTVPMSMRQDPMAASAEL  305



>ref|XP_009408250.1| PREDICTED: probable allantoate deiminase isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=399

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 140/180 (78%), Gaps = 2/180 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+  L+Y ++C +   +S +G LVCTVGEIS+WP ASNVIPGQV FTVDIRAMDD  
Sbjct  212  CKYPDRALTYKEQCGSYKKESFSG-LVCTVGEISSWPGASNVIPGQVNFTVDIRAMDDDD  270

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            R AI+ EFS +++Q+CD R + C IE KH A AV CD ELS QLK AAH+   +++    
Sbjct  271  RGAIVTEFSRQVYQICDNRMVNCTIEHKHTAEAVHCDSELSQQLKQAAHSTVKKMS-RKI  329

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VPVLMSGAGHDAMAMS LTKVGMLFVRCRGG+SHSP+E+V D+DVWAAG+ +L FL+
Sbjct  330  QDEVPVLMSGAGHDAMAMSHLTKVGMLFVRCRGGVSHSPDEYVSDNDVWAAGLVLLHFLD  389


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKV V G+QGHAGTVPM MRQD MVA+AEL
Sbjct  172  QTRLKVKVSGSQGHAGTVPMLMRQDSMVAAAEL  204



>ref|XP_011628473.1| PREDICTED: allantoate deiminase [Amborella trichopoda]
Length=508

 Score =   243 bits (621),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 144/181 (80%), Gaps = 1/181 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK PE  +++D E +    ++ AGS+VCTVG+IS+WPSASNVIPGQV F+VD+RA +D  
Sbjct  325  CKHPENKINHDRESKGFIKEAFAGSVVCTVGQISSWPSASNVIPGQVTFSVDVRASEDRA  384

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REAII E  N MHQ+C++R++ C +E KH+A A+ CD+ELS QLK+AA  A   I+G+  
Sbjct  385  REAIILELENEMHQICNRRSVSCFLELKHNAEAIRCDKELSLQLKNAAQIAVKSISGD-I  443

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D++P+LMSGAGHDAMA++ LTKVGMLFVRCRGGISHS  EHV++DDVWAA +A+L FL+
Sbjct  444  GDNIPILMSGAGHDAMAIAHLTKVGMLFVRCRGGISHSSAEHVMEDDVWAASLAVLEFLQ  503

Query  119  T  117
            T
Sbjct  504  T  504


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTR++VTV G+QGHAGTVPM+MR+DPM ASAEL
Sbjct  285  QTRIRVTVIGSQGHAGTVPMSMRRDPMAASAEL  317



>gb|ERN19684.1| hypothetical protein AMTR_s00062p00185230 [Amborella trichopoda]
Length=513

 Score =   243 bits (621),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 144/181 (80%), Gaps = 1/181 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK PE  +++D E +    ++ AGS+VCTVG+IS+WPSASNVIPGQV F+VD+RA +D  
Sbjct  330  CKHPENKINHDRESKGFIKEAFAGSVVCTVGQISSWPSASNVIPGQVTFSVDVRASEDRA  389

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REAII E  N MHQ+C++R++ C +E KH+A A+ CD+ELS QLK+AA  A   I+G+  
Sbjct  390  REAIILELENEMHQICNRRSVSCFLELKHNAEAIRCDKELSLQLKNAAQIAVKSISGD-I  448

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D++P+LMSGAGHDAMA++ LTKVGMLFVRCRGGISHS  EHV++DDVWAA +A+L FL+
Sbjct  449  GDNIPILMSGAGHDAMAIAHLTKVGMLFVRCRGGISHSSAEHVMEDDVWAASLAVLEFLQ  508

Query  119  T  117
            T
Sbjct  509  T  509


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTR++VTV G+QGHAGTVPM+MR+DPM ASAEL
Sbjct  290  QTRIRVTVIGSQGHAGTVPMSMRRDPMAASAEL  322



>ref|XP_009408248.1| PREDICTED: probable allantoate deiminase isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=493

 Score =   241 bits (615),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 140/180 (78%), Gaps = 2/180 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+  L+Y ++C +   +S +G LVCTVGEIS+WP ASNVIPGQV FTVDIRAMDD  
Sbjct  306  CKYPDRALTYKEQCGSYKKESFSG-LVCTVGEISSWPGASNVIPGQVNFTVDIRAMDDDD  364

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            R AI+ EFS +++Q+CD R + C IE KH A AV CD ELS QLK AAH+   +++    
Sbjct  365  RGAIVTEFSRQVYQICDNRMVNCTIEHKHTAEAVHCDSELSQQLKQAAHSTVKKMS-RKI  423

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VPVLMSGAGHDAMAMS LTKVGMLFVRCRGG+SHSP+E+V D+DVWAAG+ +L FL+
Sbjct  424  QDEVPVLMSGAGHDAMAMSHLTKVGMLFVRCRGGVSHSPDEYVSDNDVWAAGLVLLHFLD  483


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKV V G+QGHAGTVPM MRQD MVA+AEL
Sbjct  266  QTRLKVKVSGSQGHAGTVPMLMRQDSMVAAAEL  298



>ref|XP_009408249.1| PREDICTED: probable allantoate deiminase isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=492

 Score =   241 bits (615),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 140/180 (78%), Gaps = 2/180 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+  L+Y ++C +   +S +G LVCTVGEIS+WP ASNVIPGQV FTVDIRAMDD  
Sbjct  305  CKYPDRALTYKEQCGSYKKESFSG-LVCTVGEISSWPGASNVIPGQVNFTVDIRAMDDDD  363

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            R AI+ EFS +++Q+CD R + C IE KH A AV CD ELS QLK AAH+   +++    
Sbjct  364  RGAIVTEFSRQVYQICDNRMVNCTIEHKHTAEAVHCDSELSQQLKQAAHSTVKKMS-RKI  422

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             D+VPVLMSGAGHDAMAMS LTKVGMLFVRCRGG+SHSP+E+V D+DVWAAG+ +L FL+
Sbjct  423  QDEVPVLMSGAGHDAMAMSHLTKVGMLFVRCRGGVSHSPDEYVSDNDVWAAGLVLLHFLD  482


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKV V G+QGHAGTVPM MRQD MVA+AEL
Sbjct  265  QTRLKVKVSGSQGHAGTVPMLMRQDSMVAAAEL  297



>gb|ACN31546.1| unknown [Zea mays]
Length=415

 Score =   238 bits (606),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 138/181 (76%), Gaps = 2/181 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK+P   L+YD+EC   T +SLAG LVCTVGE++TWPSASNVIPGQV FTVDIRAMDD  
Sbjct  212  CKEPNSLLTYDEECSCFTEESLAG-LVCTVGELNTWPSASNVIPGQVNFTVDIRAMDDQV  270

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            RE I+  FS  + Q CD R + C +E KH A A  CD EL+SQLK AA +  + + G T 
Sbjct  271  RETIVTSFSRLVLQKCDDRLVDCKVEHKHSAAATHCDPELTSQLKRAARSTVSAMPGRTV  330

Query  299  -DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFL  123
               + PVLMSGAGHDAMAM+RLTK+GMLFVRCRGGISHSPEE V+D+DVWAAG+A+  F+
Sbjct  331  AAGETPVLMSGAGHDAMAMARLTKIGMLFVRCRGGISHSPEESVMDNDVWAAGLALFNFI  390

Query  122  E  120
            +
Sbjct  391  D  391


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKV V G+QGHAGTVPM +R+DPMVA+AEL
Sbjct  172  QTRLKVIVDGSQGHAGTVPMKLRRDPMVAAAEL  204



>ref|XP_002438812.1| hypothetical protein SORBIDRAFT_10g026590 [Sorghum bicolor]
 gb|EER90179.1| hypothetical protein SORBIDRAFT_10g026590 [Sorghum bicolor]
Length=506

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 138/182 (76%), Gaps = 3/182 (2%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK+P   L+YD+EC   T +SLAG LVCTVGE++TWPSASNVIPGQV FTVDIRAMDD  
Sbjct  305  CKEPNKLLTYDEECSCFTEESLAG-LVCTVGELNTWPSASNVIPGQVNFTVDIRAMDDQV  363

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGET-  303
            RE I+  FS  + Q CD R + C +E KH A A  CD EL+SQLK AA +  + + G T 
Sbjct  364  RETIVTSFSRLVLQKCDDRLVDCKVEHKHSAAATHCDPELTSQLKRAARSTVSTMPGRTA  423

Query  302  -TDDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAF  126
                + PVLMSGAGHDAMAM+RLTK+GMLFVRCRGGISHSPEE V+DDDVWAAG+A+  F
Sbjct  424  AAAGETPVLMSGAGHDAMAMARLTKIGMLFVRCRGGISHSPEESVMDDDVWAAGLALFNF  483

Query  125  LE  120
            ++
Sbjct  484  ID  485


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKV V G+QGHAGTVPM +R+DPMVA+AEL
Sbjct  265  QTRLKVIVDGSQGHAGTVPMKLRRDPMVAAAEL  297



>ref|XP_010914255.1| PREDICTED: probable allantoate deiminase isoform X2 [Elaeis guineensis]
Length=487

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 141/180 (78%), Gaps = 2/180 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+   +YD++C     +SLAG LVCTVGEIS WPSASNVIPGQV FTVDIRA+DD  
Sbjct  305  CKYPDKLFAYDEQCGFFEKESLAG-LVCTVGEISCWPSASNVIPGQVNFTVDIRAIDDEA  363

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            R++++ EFSN++++ C++R + C I+ KHDA A  CD EL+ QLK A  +A  ++  +  
Sbjct  364  RKSVVSEFSNQVYRKCEQRMVNCTIKHKHDAEAAHCDSELTLQLKHATSSALRKMPSD-I  422

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
              DVP+LMSGAGHDAMAMS LTKVGMLFVRCRGGISHSPEE VLDDDVWAAG+A+L FL+
Sbjct  423  HGDVPILMSGAGHDAMAMSHLTKVGMLFVRCRGGISHSPEESVLDDDVWAAGLALLQFLD  482


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKV V G QGHAGTVPM MRQD M A+AEL
Sbjct  265  QTRLKVEVSGAQGHAGTVPMLMRQDSMAAAAEL  297



>ref|XP_008809343.1| PREDICTED: probable allantoate deiminase isoform X4 [Phoenix 
dactylifera]
Length=487

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 139/180 (77%), Gaps = 2/180 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ +L+YD+ C     +S AG LVCTVGEIS WPSASNVIPGQV FTVDIRA+DD  
Sbjct  306  CKYPDKFLAYDEHCGFFGKESFAG-LVCTVGEISCWPSASNVIPGQVNFTVDIRAIDDEA  364

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            RE ++ EFSN++++ C++R + C IE KH+A A  CD  LS QLK A  +A  ++ G+  
Sbjct  365  RELVVSEFSNQVYRKCEERMVNCTIEHKHNAEAAHCDSGLSLQLKHATSSALGKMLGD-I  423

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
              DVP+LMSGAGHDAMAMS LTKVGMLFVRCRGGISHSPEE VLDDDVWAAG+A+L F +
Sbjct  424  HSDVPILMSGAGHDAMAMSHLTKVGMLFVRCRGGISHSPEESVLDDDVWAAGLALLHFFD  483


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKV V G QGHAGTVPM MRQDPM A+AEL
Sbjct  266  QTRLKVEVSGAQGHAGTVPMLMRQDPMAAAAEL  298



>ref|XP_008809341.1| PREDICTED: probable allantoate deiminase isoform X3 [Phoenix 
dactylifera]
Length=491

 Score =   238 bits (608),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 139/180 (77%), Gaps = 2/180 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ +L+YD+ C     +S AG LVCTVGEIS WPSASNVIPGQV FTVDIRA+DD  
Sbjct  306  CKYPDKFLAYDEHCGFFGKESFAG-LVCTVGEISCWPSASNVIPGQVNFTVDIRAIDDEA  364

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            RE ++ EFSN++++ C++R + C IE KH+A A  CD  LS QLK A  +A  ++ G+  
Sbjct  365  RELVVSEFSNQVYRKCEERMVNCTIEHKHNAEAAHCDSGLSLQLKHATSSALGKMLGD-I  423

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
              DVP+LMSGAGHDAMAMS LTKVGMLFVRCRGGISHSPEE VLDDDVWAAG+A+L F +
Sbjct  424  HSDVPILMSGAGHDAMAMSHLTKVGMLFVRCRGGISHSPEESVLDDDVWAAGLALLHFFD  483


 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKV V G QGHAGTVPM MRQDPM A+AEL
Sbjct  266  QTRLKVEVSGAQGHAGTVPMLMRQDPMAAAAEL  298



>ref|XP_008809339.1| PREDICTED: probable allantoate deiminase isoform X1 [Phoenix 
dactylifera]
Length=507

 Score =   238 bits (607),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 139/180 (77%), Gaps = 2/180 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ +L+YD+ C     +S AG LVCTVGEIS WPSASNVIPGQV FTVDIRA+DD  
Sbjct  306  CKYPDKFLAYDEHCGFFGKESFAG-LVCTVGEISCWPSASNVIPGQVNFTVDIRAIDDEA  364

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            RE ++ EFSN++++ C++R + C IE KH+A A  CD  LS QLK A  +A  ++ G+  
Sbjct  365  RELVVSEFSNQVYRKCEERMVNCTIEHKHNAEAAHCDSGLSLQLKHATSSALGKMLGD-I  423

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
              DVP+LMSGAGHDAMAMS LTKVGMLFVRCRGGISHSPEE VLDDDVWAAG+A+L F +
Sbjct  424  HSDVPILMSGAGHDAMAMSHLTKVGMLFVRCRGGISHSPEESVLDDDVWAAGLALLHFFD  483


 Score = 58.5 bits (140),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKV V G QGHAGTVPM MRQDPM A+AEL
Sbjct  266  QTRLKVEVSGAQGHAGTVPMLMRQDPMAAAAEL  298



>ref|XP_008809340.1| PREDICTED: probable allantoate deiminase isoform X2 [Phoenix 
dactylifera]
Length=506

 Score =   238 bits (607),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 139/180 (77%), Gaps = 2/180 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ +L+YD+ C     +S AG LVCTVGEIS WPSASNVIPGQV FTVDIRA+DD  
Sbjct  305  CKYPDKFLAYDEHCGFFGKESFAG-LVCTVGEISCWPSASNVIPGQVNFTVDIRAIDDEA  363

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            RE ++ EFSN++++ C++R + C IE KH+A A  CD  LS QLK A  +A  ++ G+  
Sbjct  364  RELVVSEFSNQVYRKCEERMVNCTIEHKHNAEAAHCDSGLSLQLKHATSSALGKMLGD-I  422

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
              DVP+LMSGAGHDAMAMS LTKVGMLFVRCRGGISHSPEE VLDDDVWAAG+A+L F +
Sbjct  423  HSDVPILMSGAGHDAMAMSHLTKVGMLFVRCRGGISHSPEESVLDDDVWAAGLALLHFFD  482


 Score = 58.5 bits (140),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKV V G QGHAGTVPM MRQDPM A+AEL
Sbjct  265  QTRLKVEVSGAQGHAGTVPMLMRQDPMAAAAEL  297



>ref|NP_001151245.1| metallopeptidase precursor [Zea mays]
 gb|ACF79000.1| unknown [Zea mays]
 gb|ACF86140.1| unknown [Zea mays]
 gb|ACG42112.1| metallopeptidase [Zea mays]
Length=505

 Score =   237 bits (605),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 138/181 (76%), Gaps = 2/181 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK+P   L+YD+EC   T +SLAG LVCTVGE++TWPSASNVIPGQV FTVDIRAMDD  
Sbjct  302  CKEPNSLLTYDEECSCFTEESLAG-LVCTVGELNTWPSASNVIPGQVNFTVDIRAMDDQV  360

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            RE I+  FS  + Q CD R + C +E KH A A  CD EL+SQLK AA +  + + G T 
Sbjct  361  RETIVTSFSRLVLQKCDDRLVDCKVEHKHSAAATHCDPELTSQLKRAARSTVSAMPGRTV  420

Query  299  -DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFL  123
               + PVLMSGAGHDAMAM+RLTK+GMLFVRCRGGISHSPEE V+D+DVWAAG+A+  F+
Sbjct  421  AAGETPVLMSGAGHDAMAMARLTKIGMLFVRCRGGISHSPEESVMDNDVWAAGLALFNFI  480

Query  122  E  120
            +
Sbjct  481  D  481


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKV V G+QGHAGTVPM +R+DPMVA+AEL
Sbjct  262  QTRLKVIVDGSQGHAGTVPMKLRRDPMVAAAEL  294



>ref|XP_004965622.1| PREDICTED: allantoate deiminase, chloroplastic-like isoform X2 
[Setaria italica]
Length=500

 Score =   235 bits (599),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 134/180 (74%), Gaps = 1/180 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK+P  +L+YD+EC   T +SLAG LVCTVGE+ TWPSASNVIPGQV FTVDIRAMDD  
Sbjct  300  CKEPNKFLTYDEECGCFTEESLAG-LVCTVGELLTWPSASNVIPGQVNFTVDIRAMDDKV  358

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            RE I+  FS  + Q CD R + C +E KH A A   D EL++QLK AA +    + G   
Sbjct  359  RETIVTSFSRLVLQRCDDRLVDCRVEHKHSAPATPSDPELTAQLKRAARSTVLAMPGHAA  418

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
              + PVLMSGAGHDAMAM+RLTK+GMLFVRCRGG+SHSPEE V DDDVWAAG+A+  F+E
Sbjct  419  AAETPVLMSGAGHDAMAMARLTKIGMLFVRCRGGVSHSPEESVTDDDVWAAGLALANFVE  478


 Score = 57.8 bits (138),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKV V G+QGHAGTVPM +R+DPMVA+AEL
Sbjct  260  QTRLKVIVDGSQGHAGTVPMKLRRDPMVAAAEL  292



>ref|XP_010914254.1| PREDICTED: probable allantoate deiminase isoform X1 [Elaeis guineensis]
Length=488

 Score =   234 bits (596),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 141/181 (78%), Gaps = 3/181 (2%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+   +YD++C     +SLAG LVCTVGEIS WPSASNVIPGQV FTVDIRA+DD  
Sbjct  305  CKYPDKLFAYDEQCGFFEKESLAG-LVCTVGEISCWPSASNVIPGQVNFTVDIRAIDDEA  363

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            R++++ EFSN++++ C++R + C I+ KHDA A  CD EL+ QLK A  +A  ++  +  
Sbjct  364  RKSVVSEFSNQVYRKCEQRMVNCTIKHKHDAEAAHCDSELTLQLKHATSSALRKMPSD-I  422

Query  299  DDDVPVLMSGAGHDAMAMSRLTK-VGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFL  123
              DVP+LMSGAGHDAMAMS LTK VGMLFVRCRGGISHSPEE VLDDDVWAAG+A+L FL
Sbjct  423  HGDVPILMSGAGHDAMAMSHLTKQVGMLFVRCRGGISHSPEESVLDDDVWAAGLALLQFL  482

Query  122  E  120
            +
Sbjct  483  D  483


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKV V G QGHAGTVPM MRQD M A+AEL
Sbjct  265  QTRLKVEVSGAQGHAGTVPMLMRQDSMAAAAEL  297



>ref|XP_004965621.1| PREDICTED: allantoate deiminase, chloroplastic-like isoform X1 
[Setaria italica]
Length=539

 Score =   233 bits (595),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 134/180 (74%), Gaps = 1/180 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK+P  +L+YD+EC   T +SLAG LVCTVGE+ TWPSASNVIPGQV FTVDIRAMDD  
Sbjct  339  CKEPNKFLTYDEECGCFTEESLAG-LVCTVGELLTWPSASNVIPGQVNFTVDIRAMDDKV  397

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            RE I+  FS  + Q CD R + C +E KH A A   D EL++QLK AA +    + G   
Sbjct  398  RETIVTSFSRLVLQRCDDRLVDCRVEHKHSAPATPSDPELTAQLKRAARSTVLAMPGHAA  457

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
              + PVLMSGAGHDAMAM+RLTK+GMLFVRCRGG+SHSPEE V DDDVWAAG+A+  F+E
Sbjct  458  AAETPVLMSGAGHDAMAMARLTKIGMLFVRCRGGVSHSPEESVTDDDVWAAGLALANFVE  517


 Score = 57.8 bits (138),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKV V G+QGHAGTVPM +R+DPMVA+AEL
Sbjct  299  QTRLKVIVDGSQGHAGTVPMKLRRDPMVAAAEL  331



>gb|EEE66180.1| hypothetical protein OsJ_22281 [Oryza sativa Japonica Group]
Length=491

 Score =   233 bits (595),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 139/187 (74%), Gaps = 13/187 (7%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK+P  +L+YD+EC   T +SLAG LVCTVGE+ TWPSASNVIPGQV FTVDIRAMDD  
Sbjct  297  CKEPNKFLTYDEECGCFTEESLAG-LVCTVGELLTWPSASNVIPGQVNFTVDIRAMDDKV  355

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHT-------AFT  321
            RE I+  FS  + Q CD R + C +E+KH A A  CD EL+S+L+ A  +        F 
Sbjct  356  RETIVTSFSRLVLQRCDDRLVDCAVEQKHAAAATPCDAELTSRLERATRSTISSMAAGFP  415

Query  320  RITGETTDDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGM  141
            R  GET     PVLMSGAGHDAMAM+RLTKVGMLFVRCRGG+SHSPEE V+DDDVWAAG+
Sbjct  416  RAGGET-----PVLMSGAGHDAMAMARLTKVGMLFVRCRGGVSHSPEESVMDDDVWAAGL  470

Query  140  AILAFLE  120
            A++ F++
Sbjct  471  ALVNFID  477


 Score = 58.2 bits (139),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKV + G+QGHAGTVPM +R+DPMVA+AEL
Sbjct  257  QTRLKVIINGSQGHAGTVPMKLRRDPMVAAAEL  289



>ref|XP_010240394.1| PREDICTED: probable allantoate deiminase isoform X1 [Brachypodium 
distachyon]
Length=495

 Score =   232 bits (592),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 138/189 (73%), Gaps = 10/189 (5%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK+P  +L+YD+EC   T +SLAG LVCTVGE++TWPSASNVIPGQV FTVDIRAMDD  
Sbjct  294  CKEPHRFLTYDEECGCFTEESLAG-LVCTVGELTTWPSASNVIPGQVNFTVDIRAMDDKV  352

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRIT----  312
            RE I+  FS  + Q CD R + C ++ KH A A  CD EL++QL+ AA +A +       
Sbjct  353  RETIVTSFSRIVLQRCDDRLVDCAVQHKHSAPATPCDPELTTQLELAARSALSNTMTSPG  412

Query  311  -----GETTDDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAA  147
                     +   PVLMSGAGHDAMAM+RLTKVGMLFVRCRGG+SHSPEE VLDDDVWAA
Sbjct  413  GGGGCSAEAERTPPVLMSGAGHDAMAMARLTKVGMLFVRCRGGVSHSPEESVLDDDVWAA  472

Query  146  GMAILAFLE  120
            G+A+L F+E
Sbjct  473  GLALLRFVE  481


 Score = 57.8 bits (138),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKV + G+QGHAGTVPM +R+DPMVA+AEL
Sbjct  254  QTRLKVIINGSQGHAGTVPMKLRRDPMVAAAEL  286



>ref|XP_010240400.1| PREDICTED: probable allantoate deiminase isoform X2 [Brachypodium 
distachyon]
Length=488

 Score =   233 bits (593),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/189 (61%), Positives = 138/189 (73%), Gaps = 10/189 (5%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK+P  +L+YD+EC   T +SLAG LVCTVGE++TWPSASNVIPGQV FTVDIRAMDD  
Sbjct  287  CKEPHRFLTYDEECGCFTEESLAG-LVCTVGELTTWPSASNVIPGQVNFTVDIRAMDDKV  345

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRIT----  312
            RE I+  FS  + Q CD R + C ++ KH A A  CD EL++QL+ AA +A +       
Sbjct  346  RETIVTSFSRIVLQRCDDRLVDCAVQHKHSAPATPCDPELTTQLELAARSALSNTMTSPG  405

Query  311  -----GETTDDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAA  147
                     +   PVLMSGAGHDAMAM+RLTKVGMLFVRCRGG+SHSPEE VLDDDVWAA
Sbjct  406  GGGGCSAEAERTPPVLMSGAGHDAMAMARLTKVGMLFVRCRGGVSHSPEESVLDDDVWAA  465

Query  146  GMAILAFLE  120
            G+A+L F+E
Sbjct  466  GLALLRFVE  474


 Score = 57.8 bits (138),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKV + G+QGHAGTVPM +R+DPMVA+AEL
Sbjct  247  QTRLKVIINGSQGHAGTVPMKLRRDPMVAAAEL  279



>ref|NP_001058304.1| Os06g0665500 [Oryza sativa Japonica Group]
 sp|Q655X8.1|AAH_ORYSJ RecName: Full=Probable allantoate deiminase; AltName: Full=Allantoate 
amidohydrolase; Short=OsAAH; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAD45389.1| putative N-carbamyl-L-amino acid amidohydrolase [Oryza sativa 
Japonica Group]
 dbj|BAF20218.1| Os06g0665500 [Oryza sativa Japonica Group]
 dbj|BAG93368.1| unnamed protein product [Oryza sativa Japonica Group]
Length=491

 Score =   231 bits (590),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 139/187 (74%), Gaps = 13/187 (7%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK+P  +L+YD+EC   T +SLAG LVCTVGE+ TWPSASNVIPGQV FTVDIRAMDD  
Sbjct  297  CKEPNKFLTYDEECGCFTEESLAG-LVCTVGELLTWPSASNVIPGQVNFTVDIRAMDDKV  355

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFT-------  321
            RE I+  FS  + Q CD R + C +E+KH A A  CD EL+S+L+ A  +  +       
Sbjct  356  RETIVTSFSRLVLQRCDDRLVDCAVEQKHAAAATPCDAELTSRLERATRSTISSMAAGVR  415

Query  320  RITGETTDDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGM  141
            R  GET     PVLMSGAGHDAMAM+RLTKVGMLFVRCRGG+SHSPEE V+DDDVWAAG+
Sbjct  416  RAGGET-----PVLMSGAGHDAMAMARLTKVGMLFVRCRGGVSHSPEESVMDDDVWAAGL  470

Query  140  AILAFLE  120
            A++ F++
Sbjct  471  ALVNFID  477


 Score = 58.2 bits (139),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKV + G+QGHAGTVPM +R+DPMVA+AEL
Sbjct  257  QTRLKVIINGSQGHAGTVPMKLRRDPMVAAAEL  289



>gb|EMT22145.1| Allantoate deiminase, chloroplastic [Aegilops tauschii]
Length=524

 Score =   231 bits (589),  Expect(2) = 8e-69, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 138/188 (73%), Gaps = 11/188 (6%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P  +L+YD+EC   T +SLAG LVCTVGE+ TWPSASNVIPGQV FTVDIRAMDD  
Sbjct  333  CKDPSRFLTYDEECGCFTEESLAG-LVCTVGELLTWPSASNVIPGQVNFTVDIRAMDDLV  391

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRIT----  312
            RE I+  FS  + Q CD R + C +E KH A A  CD EL++QLK A  +A + +     
Sbjct  392  RETIVASFSRIVMQRCDHRLVDCAVEHKHSAAATPCDPELTAQLKRATRSAVSAMAPGGH  451

Query  311  ----GETTDDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAG  144
                 E+T    PVLMSGAGHDAMAM+RLT+VGMLFVRCRGG+SHSPEEHV +DDVWAAG
Sbjct  452  GHAGAEST--ATPVLMSGAGHDAMAMARLTRVGMLFVRCRGGVSHSPEEHVAEDDVWAAG  509

Query  143  MAILAFLE  120
            +A+L FL+
Sbjct  510  LALLRFLD  517


 Score = 57.4 bits (137),  Expect(2) = 8e-69, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKV V G+QGHAGTVPM +R+DPMVA+AEL
Sbjct  293  QTRLKVIVDGSQGHAGTVPMKLRRDPMVAAAEL  325



>emb|CDP18200.1| unnamed protein product [Coffea canephora]
Length=149

 Score =   221 bits (562),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 117/137 (85%), Gaps = 1/137 (1%)
 Frame = -1

Query  521  VKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKS  342
            V FTVD+RA+DD GREA++YE S RMHQ+CD+R++FC I+RKHDANA VCD+ELS QL S
Sbjct  13   VTFTVDVRAIDDMGREAVLYELSKRMHQICDRRSVFCKIDRKHDANAAVCDKELSLQLSS  72

Query  341  AAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDD  162
            AA+ A  RI GE   D VP LMSGAGHDAMA+S LTKVGMLFVRCRGGISHSP EHVLDD
Sbjct  73   AAYAALKRIKGEAAID-VPALMSGAGHDAMAISHLTKVGMLFVRCRGGISHSPAEHVLDD  131

Query  161  DVWAAGMAILAFLETLL  111
            DVWA+GMA+LAFLET L
Sbjct  132  DVWASGMAVLAFLETAL  148



>dbj|BAK06888.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97556.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   226 bits (576),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 134/185 (72%), Gaps = 6/185 (3%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK+P  +L+YD++C   T +SLAG LVCTVGE+ TWPSASNVIPGQV FTVDIRAMDD  
Sbjct  302  CKEPSRFLTYDEDCGCFTEESLAG-LVCTVGELLTWPSASNVIPGQVNFTVDIRAMDDQV  360

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGET-  303
            RE I+  FS  + Q CD R + C +E KH A A  CD EL+++LK A   A + +     
Sbjct  361  RETIVASFSRIVMQRCDHRLVDCAVEHKHSAAATPCDPELTAELKRATRLAVSAMAPGVH  420

Query  302  ----TDDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAI  135
                     PVLMSGAGHDAMAM+RLT+VGMLFVRCRGG+SHSPEEHV +DD WAAG+A+
Sbjct  421  GHGHAGTATPVLMSGAGHDAMAMARLTRVGMLFVRCRGGVSHSPEEHVAEDDAWAAGVAL  480

Query  134  LAFLE  120
            L F+E
Sbjct  481  LRFVE  485


 Score = 57.4 bits (137),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKV V G+QGHAGTVPM +R+DPMVA+AEL
Sbjct  262  QTRLKVIVDGSQGHAGTVPMKLRRDPMVAAAEL  294



>pir||T04891 hyuC protein homolog F18F4.170 - Arabidopsis thaliana  (fragment)
Length=338

 Score =   220 bits (560),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 131/167 (78%), Gaps = 18/167 (11%)
 Frame = -1

Query  617  QTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQ  438
            ++ TV+SLA SLVCTVGEISTWPSASNVIPGQV FTVD+R +DD GR+AI+++ S RM+Q
Sbjct  188  ESDTVESLANSLVCTVGEISTWPSASNVIPGQVTFTVDLRTIDDVGRKAILHDLSTRMYQ  247

Query  437  LCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHD  258
            +CDKR++ C IERK               +KS   +A  ++TGE   D+VPVLMSGAGHD
Sbjct  248  ICDKRSLLCSIERK---------------VKSV--SALKKMTGE-VQDEVPVLMSGAGHD  289

Query  257  AMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLET  117
            AMAM+ LTKVGMLFVRCRGGISHSP EHVLDDDV AAG+AIL FLE+
Sbjct  290  AMAMAHLTKVGMLFVRCRGGISHSPAEHVLDDDVGAAGLAILEFLES  336


 Score = 61.6 bits (148),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTV+G+QGHAGTVPM+MRQDPM  +AEL
Sbjct  151  QTRLKVTVKGSQGHAGTVPMSMRQDPMTGAAEL  183



>gb|EEC81134.1| hypothetical protein OsI_24029 [Oryza sativa Indica Group]
Length=475

 Score =   221 bits (564),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 108/174 (62%), Positives = 129/174 (74%), Gaps = 3/174 (2%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK+P  +L+YD+EC   T +SLAG LVCTVGE+ TWPSASNVIPGQV FTVDIRAMDD  
Sbjct  297  CKEPNKFLTYDEECGCFTEESLAG-LVCTVGELLTWPSASNVIPGQVNFTVDIRAMDDKV  355

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITG--E  306
            RE I+  FS  + Q CD R + C +E+KH A A  CD EL+S+L+ A  +  + +     
Sbjct  356  RETIVTSFSRLVLQRCDDRLVDCAVEQKHAAAATPCDAELTSRLERATRSTISSMAAGVR  415

Query  305  TTDDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAG  144
                + PVLMSGAGHDAMAM+RLTKVGMLFVRCRGG+SHSPEE V+ DDVWAAG
Sbjct  416  RAGGETPVLMSGAGHDAMAMARLTKVGMLFVRCRGGVSHSPEESVMADDVWAAG  469


 Score = 57.8 bits (138),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKV + G+QGHAGTVPM +R+DPMVA+AEL
Sbjct  257  QTRLKVIINGSQGHAGTVPMKLRRDPMVAAAEL  289



>ref|XP_006657227.1| PREDICTED: probable allantoate deiminase-like [Oryza brachyantha]
Length=689

 Score =   207 bits (528),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 122/179 (68%), Gaps = 25/179 (14%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CKQP  +L+YD+EC   T +SLAG LVCTVGE+ TWPSASNVIPGQV FTVDIRAMDD  
Sbjct  309  CKQPNRFLNYDEECGCFTEESLAG-LVCTVGELLTWPSASNVIPGQVNFTVDIRAMDDKV  367

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            RE I+  FS  + Q CD R + C +E+K                            G  T
Sbjct  368  RETIVASFSRLVLQRCDDRLVDCAVEQKAAP------------------------PGRHT  403

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFL  123
              + PVLMSGAGHDAMAM+RLTKVGMLFVRCRGG+SHSPEE VLDDDVWAAG+A++ F+
Sbjct  404  GGETPVLMSGAGHDAMAMARLTKVGMLFVRCRGGVSHSPEESVLDDDVWAAGLALVNFI  462


 Score = 58.2 bits (139),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKV V G+QGHAGTVPM +R+DPMVA+AEL
Sbjct  269  QTRLKVIVSGSQGHAGTVPMKLRRDPMVAAAEL  301



>gb|KDO77267.1| hypothetical protein CISIN_1g015341mg [Citrus sinensis]
Length=381

 Score =   196 bits (499),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 124/150 (83%), Gaps = 1/150 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ +LSYD     ST++SL+ SLVCTVGEIS+WPSASNVIPG+V FTVD+RA+DD G
Sbjct  227  CKHPKDFLSYDGRSNCSTLESLSSSLVCTVGEISSWPSASNVIPGEVTFTVDLRAIDDAG  286

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            RE ++YE SN+++Q+C+KR++ C++ERKHDANAV+CD +LSSQLKSA++ A  R+TG  T
Sbjct  287  RETVLYELSNQLYQICEKRSVSCIVERKHDANAVMCDADLSSQLKSASYAALKRMTG-AT  345

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVR  210
              ++PV+MSGAGHDAMAMS LTKV  L  R
Sbjct  346  QHEIPVIMSGAGHDAMAMSHLTKVCSLLCR  375


 Score = 64.7 bits (156),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTVRG+QGHAGTVPM+MRQDPM A+AEL
Sbjct  187  QTRLKVTVRGSQGHAGTVPMSMRQDPMTAAAEL  219



>gb|ABX10796.1| putative allantoate amidohydrolase [Glycine max]
 gb|ABX10798.1| putative allantoate amidohydrolase [Glycine soja]
Length=195

 Score =   197 bits (500),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 115/143 (80%), Gaps = 6/143 (4%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK PE YLSYD  C  STVKSL+ SLVCTVGEISTWPSASNV      +TVDIRA+DD G
Sbjct  59   CKHPEEYLSYDGHCSDSTVKSLSSSLVCTVGEISTWPSASNV-----TYTVDIRAIDDLG  113

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA+IY+ S +++Q+CDKR++ C+IE KHDA AV+CD +LSSQLKSAA++A  ++ G+  
Sbjct  114  REAVIYDLSKQIYQICDKRSVSCIIEHKHDAGAVICDSDLSSQLKSAAYSALKKMEGD-I  172

Query  299  DDDVPVLMSGAGHDAMAMSRLTK  231
             D+VP LMSGAGHDAMA+S LTK
Sbjct  173  QDEVPTLMSGAGHDAMAISHLTK  195


 Score = 63.2 bits (152),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            QTRLKVTVRG+QGHAGTVPM+MRQDPM A+AE
Sbjct  19   QTRLKVTVRGSQGHAGTVPMSMRQDPMAAAAE  50



>gb|ABX10795.1| putative allantoate amidohydrolase [Glycine max]
 gb|ABX10797.1| putative allantoate amidohydrolase [Glycine soja]
Length=190

 Score =   196 bits (498),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 115/143 (80%), Gaps = 6/143 (4%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK PE YLSYD  C  STVKSL+ SLVCTVGEISTWPSASNV      +TVDIRA+DD G
Sbjct  54   CKHPEEYLSYDGHCSDSTVKSLSTSLVCTVGEISTWPSASNV-----TYTVDIRAIDDLG  108

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            REA+IY+ S +++Q+CDKR++ C+IE KHDA AV+CD +LSSQLKSAA++A  ++ G+  
Sbjct  109  REAVIYDLSKQIYQICDKRSVSCIIEHKHDAGAVICDSDLSSQLKSAAYSALKKMEGD-I  167

Query  299  DDDVPVLMSGAGHDAMAMSRLTK  231
             D+VP LMSGAGHDAMA+S LTK
Sbjct  168  QDEVPTLMSGAGHDAMAISHLTK  190



>ref|XP_001751276.1| predicted protein [Physcomitrella patens]
 gb|EDQ83593.1| predicted protein [Physcomitrella patens]
Length=459

 Score =   196 bits (498),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 132/201 (66%), Gaps = 13/201 (6%)
 Frame = -1

Query  659  CKQPEYYLSYD-DECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDT  483
            C  PE  +         ST  + AG++VCTVGEI +WP ASNVIPG+V FT+D+R+ DD+
Sbjct  259  CTHPEKGVGGSRGATAMSTAVNHAGAIVCTVGEIHSWPGASNVIPGEVMFTIDVRSKDDS  318

Query  482  GREAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTA--------  327
             RE  +    + + ++C KR + CVIERKH+ANA+ C   LS +L +AA TA        
Sbjct  319  NRETNVVRIESEIRKICRKRGVGCVIERKHEANAIGCAPGLSDRLNAAAFTAMRELPPFR  378

Query  326  --FTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVW  153
              FT +  E      P L+SGAGHDAMAM+ LT+VGMLF+RC GG+SHSP EHV DDD+W
Sbjct  379  NNFTAL--EDGGFTAPTLVSGAGHDAMAMASLTQVGMLFLRCTGGVSHSPAEHVQDDDIW  436

Query  152  AAGMAILAFLETLL*VLAQSK  90
            A  +A+L F+E +L  L+Q++
Sbjct  437  AGSLALLRFMEGVLGDLSQNQ  457


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 42/77 (55%), Gaps = 6/77 (8%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE----LDCIIGKPl*ttrvlsll*R*MPD  613
            QTRL V V G+QGHAGTVPM+MR+DPM+A+A+    ++ I   P                
Sbjct  219  QTRLAVRVEGSQGHAGTVPMSMRKDPMIAAAQSIVAIENICTHPEKGVGGSRGATAMSTA  278

Query  612  IN--GEISCRVSRLYCW  568
            +N  G I C V  ++ W
Sbjct  279  VNHAGAIVCTVGEIHSW  295



>ref|XP_001783993.1| predicted protein [Physcomitrella patens]
 gb|EDQ51218.1| predicted protein [Physcomitrella patens]
Length=455

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/192 (49%), Positives = 124/192 (65%), Gaps = 9/192 (5%)
 Frame = -1

Query  659  CKQPEYYLSYD-DECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDT  483
            C  PE  +         ST  + AG++VCTVGEI +WP ASNVIPG+V FT+D+R+ DD+
Sbjct  259  CTHPEKGVGGSRGATAMSTAVNHAGAIVCTVGEIHSWPGASNVIPGEVMFTIDVRSKDDS  318

Query  482  GREAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFT-----R  318
             RE  +      +H++C KR + C IERKH+ANA+ C   L+ +L +AA  A       R
Sbjct  319  DRETNVVRIEGGIHKICRKRGVRCSIERKHEANAIACAPGLNDRLHAAAQAAMKELPPFR  378

Query  317  ITGETTDDD---VPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAA  147
                  DD     P L+SGAGHDAMAM+ LT+VGMLF+RC GG+SHSP EHV DDD+WA 
Sbjct  379  NNVSALDDGGFTAPTLVSGAGHDAMAMASLTQVGMLFLRCTGGVSHSPAEHVQDDDIWAG  438

Query  146  GMAILAFLETLL  111
             +A+L F+E +L
Sbjct  439  SLALLHFMEGVL  450


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 42/77 (55%), Gaps = 6/77 (8%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE----LDCIIGKPl*ttrvlsll*R*MPD  613
            QTRL V V G+QGHAGTVPM+MR+DPM+A+A+    ++ I   P                
Sbjct  219  QTRLTVRVHGSQGHAGTVPMSMRKDPMIAAAQSIVSIENICTHPEKGVGGSRGATAMSTA  278

Query  612  IN--GEISCRVSRLYCW  568
            +N  G I C V  ++ W
Sbjct  279  VNHAGAIVCTVGEIHSW  295



>ref|XP_002986766.1| hypothetical protein SELMODRAFT_182622 [Selaginella moellendorffii]
 gb|EFJ12096.1| hypothetical protein SELMODRAFT_182622 [Selaginella moellendorffii]
Length=494

 Score =   185 bits (469),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 115/168 (68%), Gaps = 7/168 (4%)
 Frame = -1

Query  593  AGSLVCTVGEISTWPSASNVIPG-QVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNI  417
             G LVCTVGEI +WP ASNVIPG QV FT+D+RA DD+ RE I+ E    +  +C  R +
Sbjct  319  GGGLVCTVGEIFSWPGASNVIPGEQVAFTIDLRATDDSLREEIVGEVEESIRSICRGRGL  378

Query  416  FCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITG------ETTDDDVPVLMSGAGHDA  255
             C I++ H+A AV CD++L + LK+AA +    + G         DD VP LMSGAGHDA
Sbjct  379  SCTIDKMHEAKAVGCDKDLMASLKAAAESTVLEVPGGGGVDAPAADDLVPSLMSGAGHDA  438

Query  254  MAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETLL  111
            MAMS LTK+GMLFVRC+GGISHSP E V DDDV A+ +++L FL   L
Sbjct  439  MAMSHLTKIGMLFVRCKGGISHSPAESVSDDDVLASSLSLLHFLNNHL  486


 Score = 51.6 bits (122),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            QTRLKV + G QGHAGTVPMAMR+DPM  +A+
Sbjct  267  QTRLKVRLHGAQGHAGTVPMAMRKDPMPGAAQ  298



>ref|XP_002969520.1| hypothetical protein SELMODRAFT_91525 [Selaginella moellendorffii]
 gb|EFJ29608.1| hypothetical protein SELMODRAFT_91525 [Selaginella moellendorffii]
Length=494

 Score =   184 bits (467),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 115/168 (68%), Gaps = 7/168 (4%)
 Frame = -1

Query  593  AGSLVCTVGEISTWPSASNVIPG-QVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNI  417
             G LVCTVGEI +WP ASNVIPG QV FT+D+RA DD+ RE I+ E    +  +C  R +
Sbjct  319  GGRLVCTVGEIFSWPGASNVIPGEQVAFTIDLRATDDSLREEIVGEVEESIRSICRGRGL  378

Query  416  FCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITG------ETTDDDVPVLMSGAGHDA  255
             C I++ H+A AV CD++L + LK+AA +    + G         DD VP LMSGAGHDA
Sbjct  379  SCTIDKMHEAKAVGCDKDLMASLKAAAESTVLEVPGGGGVDAPAADDLVPSLMSGAGHDA  438

Query  254  MAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETLL  111
            MAMS LTK+GMLFVRC+GGISHSP E V DDDV A+ +++L FL   L
Sbjct  439  MAMSHLTKIGMLFVRCKGGISHSPAESVSDDDVLASSLSLLHFLNNHL  486


 Score = 52.0 bits (123),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            QTRLKV + G QGHAGTVPMAMR+DPM  +A+
Sbjct  267  QTRLKVRLHGAQGHAGTVPMAMRKDPMPGAAQ  298



>gb|KDO77266.1| hypothetical protein CISIN_1g015341mg [Citrus sinensis]
Length=366

 Score =   161 bits (408),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 110/150 (73%), Gaps = 16/150 (11%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P+ +LSYD     ST++SL+ SLVCTVGEIS+WPSASNVIPG+V FTVD+RA+DD G
Sbjct  227  CKHPKDFLSYDGRSNCSTLESLSSSLVCTVGEISSWPSASNVIPGEVTFTVDLRAIDDAG  286

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            RE ++YE SN+++Q+C+KR++ C++ERK               LKSA++ A  R+TG  T
Sbjct  287  RETVLYELSNQLYQICEKRSVSCIVERK---------------LKSASYAALKRMTG-AT  330

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVR  210
              ++PV+MSGAGHDAMAMS LTKV  L  R
Sbjct  331  QHEIPVIMSGAGHDAMAMSHLTKVCSLLCR  360


 Score = 64.7 bits (156),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTVRG+QGHAGTVPM+MRQDPM A+AEL
Sbjct  187  QTRLKVTVRGSQGHAGTVPMSMRQDPMTAAAEL  219



>gb|KJB48030.1| hypothetical protein B456_008G050700 [Gossypium raimondii]
Length=396

 Score =   134 bits (338),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P  +LS    C   T++SL+ SLVCTVGEISTWPSASNVIPGQV FTVD+RA+DD G
Sbjct  301  CKHPRDFLSSGGNCNEQTLESLSTSLVCTVGEISTWPSASNVIPGQVTFTVDLRAIDDVG  360

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERK  396
            REA++YE SN+M+++CD+R++ C+IERK
Sbjct  361  REAVVYELSNQMYKICDRRSVSCIIERK  388


 Score = 62.0 bits (149),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTR+KVTVRG+QGHAGTVPM+MR+DPM A+AEL
Sbjct  261  QTRMKVTVRGSQGHAGTVPMSMRRDPMAAAAEL  293



>gb|KJB48028.1| hypothetical protein B456_008G050700 [Gossypium raimondii]
Length=401

 Score =   134 bits (337),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P  +LS    C   T++SL+ SLVCTVGEISTWPSASNVIPGQV FTVD+RA+DD G
Sbjct  301  CKHPRDFLSSGGNCNEQTLESLSTSLVCTVGEISTWPSASNVIPGQVTFTVDLRAIDDVG  360

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERK  396
            REA++YE SN+M+++CD+R++ C+IERK
Sbjct  361  REAVVYELSNQMYKICDRRSVSCIIERK  388


 Score = 62.0 bits (149),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTR+KVTVRG+QGHAGTVPM+MR+DPM A+AEL
Sbjct  261  QTRMKVTVRGSQGHAGTVPMSMRRDPMAAAAEL  293



>ref|XP_010260695.1| PREDICTED: allantoate deiminase isoform X2 [Nelumbo nucifera]
Length=395

 Score =   120 bits (300),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 68/86 (79%), Gaps = 4/86 (5%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK PE ++SYD  C   T    A SLVCTVGEISTWPSASNVIPG+V FTVD+RA+DD  
Sbjct  313  CKHPENFISYDGHCNGFT----AESLVCTVGEISTWPSASNVIPGEVNFTVDLRAIDDMA  368

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIE  402
            RE++++E +N+++Q CD+R++ CVIE
Sbjct  369  RESVLFELANQIYQTCDRRSVSCVIE  394


 Score = 66.2 bits (160),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTVRG+QGHAGTVPM+MRQDPM ASAEL
Sbjct  273  QTRLKVTVRGSQGHAGTVPMSMRQDPMAASAEL  305



>ref|XP_002948874.1| hypothetical protein VOLCADRAFT_58608 [Volvox carteri f. nagariensis]
 gb|EFJ50254.1| hypothetical protein VOLCADRAFT_58608, partial [Volvox carteri 
f. nagariensis]
Length=365

 Score =   134 bits (338),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 95/156 (61%), Gaps = 21/156 (13%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
            +LVCTVGE+  WP ASNVI G   F+VDIR+  D  R   +      +   C +R++ C 
Sbjct  198  NLVCTVGEVQVWPGASNVISGHTGFSVDIRSKTDQMRNLAVARLLQAVETTCKRRDVACK  257

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSR-LTK  231
            + RKHDA AV+ D E    L+S                 VPVL+SGAGHDAMA++  + K
Sbjct  258  VNRKHDAAAVLSDPE---GLES-----------------VPVLVSGAGHDAMAIAEAIPK  297

Query  230  VGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFL  123
            +GM+FVRCRGG+SHSP EHV  +DV A+  A+ A+L
Sbjct  298  MGMMFVRCRGGVSHSPLEHVEPEDVTASTAALAAYL  333


 Score = 47.4 bits (111),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRL V V GTQGHAGTVPM  R+D + A+AEL
Sbjct  150  QTRLWVHVNGTQGHAGTVPMRGRRDALAAAAEL  182



>ref|XP_002507571.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68829.1| predicted protein [Micromonas sp. RCC299]
Length=479

 Score =   126 bits (316),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 92/176 (52%), Gaps = 20/176 (11%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LVCTVG +S WP +SNVIP    FTVD+R+  D+ R  ++         +C  R +    
Sbjct  296  LVCTVGAVSVWPGSSNVIPSSTNFTVDVRSKSDSDRNVVVEHVIEYAQHVCRTRGLMFSF  355

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPV-------------------  282
            +R HDA AV CD ++ +    +       + G     DV +                   
Sbjct  356  DRTHDAPAVDCDDQIINNFAESILHVTKDLIGTQDSADVAISELWSDSGSFNMKNTKYQH  415

Query  281  -LMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLET  117
             L SGAGHDA+A+S+   +GMLFVRC+ GISHSP+EH   +DV  AG  +L FL++
Sbjct  416  ALTSGAGHDALAISQACPIGMLFVRCKDGISHSPQEHSTPEDVAFAGRVLLDFLQS  471


 Score = 48.9 bits (115),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRL  TV GTQGHAGTVPM  R+D + ASA++
Sbjct  243  QTRLLFTVHGTQGHAGTVPMTERKDALAASADI  275



>gb|EMS60014.1| Allantoate deiminase, chloroplastic [Triticum urartu]
Length=402

 Score =   113 bits (283),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 64/88 (73%), Gaps = 1/88 (1%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            CK P  +L+YD+EC   T +SLAG LVCTVGE+ TWPSASNVIPGQV FTVDIRAMDD  
Sbjct  307  CKDPSRFLTYDEECGCFTEESLAG-LVCTVGELLTWPSASNVIPGQVNFTVDIRAMDDLV  365

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERK  396
            RE I+  FS  + Q CD R + C +E K
Sbjct  366  RETIVASFSRIVMQRCDHRLVDCAVEHK  393


 Score = 58.2 bits (139),  Expect(2) = 8e-34, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKV V G+QGHAGTVPM +R+DPMVA+AEL
Sbjct  267  QTRLKVIVDGSQGHAGTVPMKLRRDPMVAAAEL  299



>ref|WP_034845163.1| allantoate amidohydrolase [Inquilinus limosus]
 gb|KGM31693.1| allantoate amidohydrolase [Inquilinus limosus MP06]
Length=418

 Score =   123 bits (309),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 95/159 (60%), Gaps = 16/159 (10%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            +V TVG++   P A NVIPG V+FT+DIRA DD  R A + E +  +  +   R +   +
Sbjct  268  VVATVGQLDVQPGAVNVIPGAVRFTIDIRAPDDADRLAAMAEMTAALEGIARGRGVELAL  327

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPV--LMSGAGHDAMAMSRLTK  231
            ER HDA AV CD  L ++L++A      R  G      +P   L SGAGHDAMAM+ LT 
Sbjct  328  ERYHDAGAVRCDEALMARLETA-----IRRHG------LPARRLPSGAGHDAMAMAALTP  376

Query  230  VGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            V MLF+RCRGGISH+P E +  +D   A +A+   L+ L
Sbjct  377  VAMLFLRCRGGISHNPAESIAVED---ADLAVRVLLDLL  412


 Score = 39.3 bits (90),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
             R   TVRG  GHAGTVPM +R D + A+A +
Sbjct  223  ARYNATVRGMAGHAGTVPMDLRHDALAAAASM  254



>gb|KIE63294.1| allantoate amidohydrolase [Komagataeibacter intermedius AF2]
 dbj|GAN85790.1| amidohydrolase/allantoate amidohydrolase [Komagataeibacter intermedius 
TF2]
Length=416

 Score =   124 bits (310),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 93/160 (58%), Gaps = 8/160 (5%)
 Frame = -1

Query  602  KSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKR  423
            ++ A  LV TVG +   P A+NV+PG+V FT+D+RA  D  R+    E      Q+ D+R
Sbjct  257  RAGADGLVATVGSLDVMPGAANVVPGEVVFTIDVRAGTDATRDRAAAEILEEARQVADRR  316

Query  422  NIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMS  243
             +   +  + D +A  CD  L++ ++ A H        + T    P+L+SGAGHDAM M+
Sbjct  317  GLEMDVALQQDLDATPCDPALTALMELAVH--------DVTHAPAPLLVSGAGHDAMIMA  368

Query  242  RLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFL  123
             L  V MLF+RC GGISH+P E V DDD  AA  A++ F+
Sbjct  369  HLAPVSMLFIRCAGGISHNPAESVTDDDTDAALRAMITFI  408


 Score = 38.9 bits (89),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q R +VT+RG  GHAGTV M +R+D +  +A++
Sbjct  216  QYRYRVTLRGMAGHAGTVAMKLRRDALAGAADI  248



>ref|WP_039732860.1| allantoate amidohydrolase [Komagataeibacter intermedius]
Length=424

 Score =   124 bits (310),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 93/160 (58%), Gaps = 8/160 (5%)
 Frame = -1

Query  602  KSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKR  423
            ++ A  LV TVG +   P A+NV+PG+V FT+D+RA  D  R+    E      Q+ D+R
Sbjct  265  RAGADGLVATVGSLDVMPGAANVVPGEVVFTIDVRAGTDATRDRAAAEILEEARQVADRR  324

Query  422  NIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMS  243
             +   +  + D +A  CD  L++ ++ A H        + T    P+L+SGAGHDAM M+
Sbjct  325  GLEMDVALQQDLDATPCDPALTALMELAVH--------DVTHAPAPLLVSGAGHDAMIMA  376

Query  242  RLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFL  123
             L  V MLF+RC GGISH+P E V DDD  AA  A++ F+
Sbjct  377  HLAPVSMLFIRCAGGISHNPAESVTDDDTDAALRAMITFI  416


 Score = 38.9 bits (89),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q R +VT+RG  GHAGTV M +R+D +  +A++
Sbjct  224  QYRYRVTLRGMAGHAGTVAMKLRRDALAGAADI  256



>ref|WP_018391035.1| allantoate amidohydrolase [Ancylobacter sp. FA202]
Length=426

 Score =   121 bits (304),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 92/161 (57%), Gaps = 9/161 (6%)
 Frame = -1

Query  602  KSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKR  423
            ++ A  +V TVG +   P + NVIP +V FTVD+R+  D  R A +  F    H++ ++R
Sbjct  259  RAGADGMVATVGRVHVEPGSVNVIPARVVFTVDLRSASDASRRAALTRFEADAHRIAEQR  318

Query  422  NIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMS  243
             +  VI   H+   V C R++  +L  A  +   R          P+L SGAGHD  AM+
Sbjct  319  GLGVVISAFHEVATVPCYRDIQRRLGDAVASLGLR---------APLLPSGAGHDGQAMA  369

Query  242  RLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
            +L  VGMLFVRC+GGISH+P E+   +D+  A  A++ F+E
Sbjct  370  KLCPVGMLFVRCKGGISHNPAEYASPEDMGMAAAALIRFIE  410


 Score = 40.8 bits (94),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            +RL VTV G  GHAGTVPM +R+D +  +AE+
Sbjct  219  SRLSVTVTGEAGHAGTVPMRLRRDALSGAAEM  250



>ref|WP_013166520.1| allantoate amidohydrolase [Starkeya novella]
 gb|ADH89016.1| amidase, hydantoinase/carbamoylase family [Starkeya novella DSM 
506]
Length=426

 Score =   119 bits (297),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 88/156 (56%), Gaps = 9/156 (6%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             +V TVG +   P + NVIP +V FTVD+R+  D  R   +  F    H++ D+R++  V
Sbjct  264  GMVATVGRMHIDPGSINVIPARVTFTVDLRSGSDMSRREALERFEREAHRIADQRHLGVV  323

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKV  228
            I   H+   V C R+L  +L++A      R          P+L SGAGHD  AM  L  V
Sbjct  324  ISAFHEVTTVPCYRDLQLRLRNAVADLGHR---------APLLPSGAGHDGQAMVNLCPV  374

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
            GMLFVRC+GGISH+P E+   +D+  A  A++ F+E
Sbjct  375  GMLFVRCKGGISHNPAEYASPEDMGLAAAALIRFIE  410


 Score = 41.2 bits (95),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            +RL VTV G  GHAGTVPM MR+D +  +AE+
Sbjct  219  SRLSVTVTGEAGHAGTVPMRMRRDALPGAAEM  250



>ref|WP_044056798.1| allantoate amidohydrolase [Alteromonas australica]
 gb|AIF98622.1| allantoate amidohydrolase [Alteromonas australica]
Length=416

 Score =   115 bits (287),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 89/171 (52%), Gaps = 15/171 (9%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            C   E  L+ +   Q          +V TVG+I   P+  NVI G+  F++DIR+ DD  
Sbjct  242  CASAEMLLAVESISQQRA------GVVATVGKIENAPNGVNVISGKTVFSLDIRSEDDNL  295

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            R+A++ E   +   +   RN+   IE+ H A AV+CD  L + L             E +
Sbjct  296  RDAVLAEILQKFEHIAALRNVKLEIEQTHSAPAVLCDEALKAALVKGV---------EAS  346

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAA  147
            +    +L SGAGHDAMAM+ L  V MLF RC+GGISH P E +   DV A+
Sbjct  347  NIPAKILASGAGHDAMAMAELCPVAMLFTRCKGGISHHPAESITHQDVEAS  397


 Score = 44.7 bits (104),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            R  + V+G  GHAGTVPM+MR D + ASAE+
Sbjct  217  RFNINVQGMAGHAGTVPMSMRHDALCASAEM  247



>gb|EGD59653.1| allantoate amidohydrolase [Novosphingobium nitrogenifigens DSM 
19370]
Length=407

 Score =   119 bits (299),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 91/157 (58%), Gaps = 9/157 (6%)
 Frame = -1

Query  593  AGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIF  414
            A  LV TVG I   P A+NVIPG+V+FTVDIRA ++  R+         +  + D+R + 
Sbjct  256  ASDLVATVGRIEAMPGAANVIPGEVRFTVDIRAGENAHRDRAAKAILAALRAVADRRGLG  315

Query  413  CVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLT  234
              IE+ HD  A  CD +L+++L++A   A     G  +      L+SGAGHDAM M+ L 
Sbjct  316  IAIEQVHDLAASPCDADLAARLETALVAA-----GHPSRR----LVSGAGHDAMVMASLA  366

Query  233  KVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFL  123
               MLF+RCR GISH+P EHV   D  AA   +L F+
Sbjct  367  PTAMLFIRCREGISHNPAEHVDPADAQAALAVMLGFI  403


 Score = 39.7 bits (91),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q RL VTV GT GHAGT  M +R+D +  +AE+
Sbjct  212  QLRLSVTVAGTAGHAGTTSMPLRRDALAGAAEM  244



>ref|WP_018075493.1| allantoate amidohydrolase [Novosphingobium nitrogenifigens]
Length=405

 Score =   119 bits (299),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 91/157 (58%), Gaps = 9/157 (6%)
 Frame = -1

Query  593  AGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIF  414
            A  LV TVG I   P A+NVIPG+V+FTVDIRA ++  R+         +  + D+R + 
Sbjct  254  ASDLVATVGRIEAMPGAANVIPGEVRFTVDIRAGENAHRDRAAKAILAALRAVADRRGLG  313

Query  413  CVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLT  234
              IE+ HD  A  CD +L+++L++A   A     G  +      L+SGAGHDAM M+ L 
Sbjct  314  IAIEQVHDLAASPCDADLAARLETALVAA-----GHPSRR----LVSGAGHDAMVMASLA  364

Query  233  KVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFL  123
               MLF+RCR GISH+P EHV   D  AA   +L F+
Sbjct  365  PTAMLFIRCREGISHNPAEHVDPADAQAALAVMLGFI  401


 Score = 39.7 bits (91),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q RL VTV GT GHAGT  M +R+D +  +AE+
Sbjct  210  QLRLSVTVAGTAGHAGTTSMPLRRDALAGAAEM  242



>ref|WP_044447014.1| allantoate amidohydrolase [Alteromonas australica]
 gb|AJP43642.1| allantoate amidohydrolase [Alteromonas australica]
Length=416

 Score =   114 bits (284),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/171 (37%), Positives = 89/171 (52%), Gaps = 15/171 (9%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTG  480
            C   E  L+ +   Q          +V TVG+I   P+  NVI G+  F++DIR+ DD  
Sbjct  242  CASAEMLLAVESISQQRA------GVVATVGKIENAPNGVNVISGKTVFSLDIRSEDDNL  295

Query  479  REAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETT  300
            R+A++ E   +   +   RN+   IE+ H A AV+CD  L + L             E +
Sbjct  296  RDAVLAEILQKFEHIAALRNVKLEIEQTHSAPAVLCDEALKAALVKGV---------EAS  346

Query  299  DDDVPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAA  147
            +    +L SGAGHDAMAM+ +  V MLF RC+GGISH P E +   DV A+
Sbjct  347  NIPAKILASGAGHDAMAMAEICPVAMLFTRCKGGISHHPAESITHQDVEAS  397


 Score = 44.7 bits (104),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            R  + V+G  GHAGTVPM+MR D + ASAE+
Sbjct  217  RFNINVQGMAGHAGTVPMSMRHDALCASAEM  247



>ref|WP_032095087.1| MULTISPECIES: allantoate amidohydrolase [Alteromonas]
Length=411

 Score =   114 bits (284),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 89/157 (57%), Gaps = 9/157 (6%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            +V TVG+I   P+  NVI G+ +F++D+R+ DD  R+A + E   +  ++  KRN+   +
Sbjct  261  VVATVGKIDNMPNGVNVISGKTRFSLDVRSEDDALRDAALAEIMQQFGEIGAKRNVKLSV  320

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            E+ H A AV CD +L   L             E +D    +L SGAGHDAMAM+ +  V 
Sbjct  321  EQTHAAPAVQCDEDLKQALVRGV---------ELSDIKPRILASGAGHDAMAMADICPVA  371

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            MLF RC+GGISH P E + + DV A+   +   +E L
Sbjct  372  MLFTRCKGGISHHPGESIKESDVEASLSVLFKSIENL  408


 Score = 44.3 bits (103),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            R  +T+ G  GHAGTVPM+MR D + ASAE+
Sbjct  217  RFTITIEGMAGHAGTVPMSMRYDALAASAEM  247



>ref|WP_023850475.1| hypothetical protein [Rhodobacteraceae bacterium PD-2]
 gb|ETA51701.1| hypothetical protein P279_12640 [Rhodobacteraceae bacterium PD-2]
Length=409

 Score =   113 bits (283),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 84/155 (54%), Gaps = 12/155 (8%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             +V TVG++   P A NVIPG+  FTVD+R+ D   + A        + ++  +R +   
Sbjct  259  GVVATVGQLDCRPGAINVIPGEAAFTVDMRSGDPARQAAARTALDRALEEIAGRRGLTLT  318

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKV  228
            +E+        CD  L +QL +A               + P++ SGAGHDA+AMSR+  V
Sbjct  319  VEQLSHVAPTTCDPTLLAQLAAAVGA------------EAPIMESGAGHDAIAMSRIAPV  366

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFL  123
            GMLFV CRGGISH P EHV   DV AA  A+  F+
Sbjct  367  GMLFVACRGGISHDPAEHVEPADVSAALQALRRFV  401


 Score = 44.7 bits (104),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 2/37 (5%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCII  670
            QTRL VT+ G  GHAGTVPM MR+D +  +AE  C++
Sbjct  215  QTRLSVTLLGAAGHAGTVPMRMRRDALAGAAE--CVL  249



>ref|WP_044538498.1| allantoate amidohydrolase [Bradyrhizobium sp. LTSP885]
 gb|KJC46842.1| allantoate amidohydrolase [Bradyrhizobium sp. LTSP885]
Length=418

 Score =   116 bits (291),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 89/165 (54%), Gaps = 13/165 (8%)
 Frame = -1

Query  602  KSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKR  423
            K+ A  LV TVG I   P A+NVIPG+V FT+DIRA  D  R+  + +   R+  +  +R
Sbjct  261  KTDASGLVGTVGYIGAMPGATNVIPGKVSFTMDIRAPGDMHRKRAVADIVRRIEAIAKRR  320

Query  422  NIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPV--LMSGAGHDAMA  249
            ++   I+  H+  +V C   L SQ           I G    +   V  L SGAGHD MA
Sbjct  321  DLALQIDVTHENRSVPCALWLQSQ-----------IAGAVAAEGYAVFELPSGAGHDGMA  369

Query  248  MSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            M  +  +GM+FVRCRGG+SH+P EHV  DD       +L F+E  
Sbjct  370  MVDIADIGMIFVRCRGGVSHNPAEHVEPDDADTGARVLLRFIENF  414


 Score = 41.2 bits (95),  Expect(2) = 9e-30, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 26/36 (72%), Gaps = 2/36 (6%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCII  670
            TRL  ++ G  GHAGTVPMA+R+D +  +AE  CI+
Sbjct  221  TRLAASLAGVAGHAGTVPMALRRDALSGAAE--CIV  254



>ref|WP_037523298.1| allantoate amidohydrolase [Sphingomonas wittichii]
Length=418

 Score =   122 bits (307),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 91/163 (56%), Gaps = 9/163 (6%)
 Frame = -1

Query  602  KSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKR  423
            +   G LV TVG ++  P A NV+PGQV F++D+R+ D+  R A   +  + +  L D+R
Sbjct  259  REAGGDLVATVGRMTVGPGAVNVVPGQVDFSIDVRSGDEAARNAAAEQIIDEIAGLSDRR  318

Query  422  NIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMS  243
            N+   IER  D  A  CD +L   L  A            T   V  L+SGAGHDAM MS
Sbjct  319  NLQFNIERVQDLPASPCDPKLMGLLGEAI---------AETGHPVRRLVSGAGHDAMVMS  369

Query  242  RLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
             L    MLF+RC+ GISH+P E V  +D  AA  A+LAF+E L
Sbjct  370  ALCPTAMLFIRCKDGISHNPAESVTGEDADAALKAMLAFIEKL  412


 Score = 34.7 bits (78),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            Q R +VT+ G  GHAGT  M +R+D +  +AE
Sbjct  218  QLRYQVTIHGRAGHAGTNAMHLRRDALAGAAE  249



>ref|WP_013784605.1| allantoate amidohydrolase [Alteromonas sp. SN2]
 gb|AEF03673.1| allantoate amidohydrolase [Alteromonas sp. SN2]
Length=410

 Score =   113 bits (282),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 91/152 (60%), Gaps = 12/152 (8%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            +V TVG+I   P+  NVI G+ +F++DIR+ +D  R+A + E   +++ +   RN+   I
Sbjct  261  VVATVGKIENAPNGVNVISGRCQFSLDIRSEEDPLRDAALAEILQKINDIAVLRNVELKI  320

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVP-VLMSGAGHDAMAMSRLTKV  228
            E+ H A AV CD  L + L          + G T    VP VL SGAGHDAMAM+ +  V
Sbjct  321  EQTHSAPAVHCDSALQNTL----------LKGVTEAGIVPKVLASGAGHDAMAMAEICPV  370

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAIL  132
             MLF RC+GGISH P E +  DDV AA +A++
Sbjct  371  AMLFTRCKGGISHHPAESITTDDV-AASLAVM  401


 Score = 44.3 bits (103),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            R  +TV G  GHAGTVPM+MR D + ASAE+
Sbjct  217  RFSLTVTGMAGHAGTVPMSMRHDALCASAEM  247



>ref|XP_011398581.1| Allantoate deiminase [Auxenochlorella protothecoides]
 gb|KFM25685.1| Allantoate deiminase [Auxenochlorella protothecoides]
Length=491

 Score =   112 bits (279),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 94/189 (50%), Gaps = 45/189 (24%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQV-----KFTVDIRAMDDTGREAIIYEFSNRMHQLCDKR  423
             LVCTVG ++ WP ASNVIPG+V     + ++DIR+  D+ REA + E    +  +C +R
Sbjct  286  GLVCTVGTLALWPGASNVIPGRVLEGSVQLSMDIRSRSDSEREAKVRESVAALEGVCARR  345

Query  422  NIFCVIERKHDANAVVCDRELSSQL----------------KSAAHTAFTRITGETTDDD  291
             + C  E +H A AV+ D  ++  L                +  A        GE  D++
Sbjct  346  RLDCEWELRHQAPAVLADEGVTQALMAAVAASAGLTDAILAEGLAPNTPANADGEGADEE  405

Query  290  ------------------------VPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSP  183
                                       L+SGAGHDA  M+RLT++GMLFVRCR G+SHSP
Sbjct  406  PSHGSPPAAHAPADGGGAAFAAAVAGPLVSGAGHDAAEMARLTRMGMLFVRCRAGVSHSP  465

Query  182  EEHVLDDDV  156
             E+V  DDV
Sbjct  466  LEYVAPDDV  474


 Score = 45.4 bits (106),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q RL + + G+QGHAGTVPMA+R+DP+  +AE+
Sbjct  236  QARLAMRLAGSQGHAGTVPMALRRDPLPGAAEV  268



>ref|WP_018181698.1| hypothetical protein [Kaistia granuli]
Length=429

 Score =   108 bits (270),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 87/159 (55%), Gaps = 11/159 (7%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
            +LV TVGEI   P ASNVIP +V+ ++D+RA  D  R   +    +   +    R +   
Sbjct  273  ALVATVGEIEALPGASNVIPAEVRLSLDVRAASDEARREAVAAILSLARKTEAVRQVALT  332

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKV  228
             E   +     C R + + ++  A    +R+ G+        L+SGAGHD ++M RL + 
Sbjct  333  FETVLEKPVAACGRRMMAAIQEGA----SRVMGKPAQ----TLLSGAGHDGLSMVRLCEY  384

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETLL  111
            GM+FVRCRGGISH+P E V  DD+   G A+   +ET+L
Sbjct  385  GMIFVRCRGGISHNPAEFVTIDDM---GAAVEGLVETIL  420


 Score = 47.8 bits (112),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 31/38 (82%), Gaps = 2/38 (5%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCIIG  667
            Q+R ++ +RG  GHAGTVPMAMR+D +VA++EL  I+G
Sbjct  226  QSRHRIRIRGEAGHAGTVPMAMRRDALVAASEL--IVG  261



>ref|WP_007917264.1| amidase [Ktedonobacter racemifer]
 gb|EFH85179.1| amidase, hydantoinase/carbamoylase family [Ktedonobacter racemifer 
DSM 44963]
Length=422

 Score =   115 bits (289),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 90/158 (57%), Gaps = 13/158 (8%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             LV TVG++   P ASNVIPG+V  ++DIR  DDT R+    +   R+ ++C +R I   
Sbjct  265  GLVATVGQLQVQPGASNVIPGEVTLSLDIRHEDDTKRDLYADQLRERVDRICRERGITLA  324

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLM--SGAGHDAMAMSRLT  234
             +    +  V C   L  + + A             ++  PV M  SGAGHDA+ MS LT
Sbjct  325  WQPVQRSPTVSCAPSLIKRWRQA-----------LLEEKYPVFMLPSGAGHDAVTMSTLT  373

Query  233  KVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
             + MLFVRC+GGISH P E VL++DV AA +A+  FL+
Sbjct  374  DIAMLFVRCKGGISHHPAESVLEEDVAAAIVALERFLK  411


 Score = 40.4 bits (93),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q R+ VT +G  GHAGT+PM  R D + A+AE 
Sbjct  220  QQRILVTFKGEAGHAGTLPMKQRHDALCAAAEF  252



>ref|WP_037019426.1| allantoate amidohydrolase [Rhizobiales bacterium YIM 77505]
Length=416

 Score =   114 bits (284),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 87/156 (56%), Gaps = 9/156 (6%)
 Frame = -1

Query  581  VCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVIE  402
            V TVG     P A NVIP +V FT+D+RA DD  R A++ E    +  + D+R +   IE
Sbjct  264  VATVGVAEVLPGAVNVIPARVDFTLDLRAPDDAVRRALVAEVGRELQAIADRRGLSLAIE  323

Query  401  RKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVGM  222
               D+ A   D +L + L+ AA T    ++G       P L SGAGHDA+AM+ L    M
Sbjct  324  PFMDSPATPMDPKLMAVLEEAAAT----VSGPA-----PRLPSGAGHDAVAMATLAPAAM  374

Query  221  LFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            LFVRC+GGISH+P E + + D   A   ++  +E L
Sbjct  375  LFVRCKGGISHNPAESITESDAEVAVRVLIDAIERL  410


 Score = 42.0 bits (97),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            TR +  V G  GHAGTVPMAMR+D + A+AE+
Sbjct  218  TRARAFVAGEAGHAGTVPMAMRRDALAAAAEM  249



>ref|WP_029356018.1| allantoate amidohydrolase [Bosea sp. 117]
Length=426

 Score =   113 bits (283),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 84/156 (54%), Gaps = 9/156 (6%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             +V TVG +   P A NVIP +V FT+D+R+  D  R   +  F    H++ D R +  V
Sbjct  264  GMVATVGRVHVDPGAVNVIPSRVVFTIDLRSPSDLSRRDALTRFEREAHKIADHRGLGVV  323

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKV  228
            I   H+   V C R+L  +L +A  +   R            L SGAGHD  AMS L  +
Sbjct  324  ISAFHEVATVPCYRDLQMRLGNAVASLGHRAV---------TLPSGAGHDGQAMSHLCPI  374

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
            GMLFVRCRGG+SH+P E+    D+  A  A++ F+E
Sbjct  375  GMLFVRCRGGVSHNPAEYASPSDMGLAVGALVRFIE  410


 Score = 42.0 bits (97),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            +RL VTV G  GHAGTVPM +R D ++ +AE+
Sbjct  219  SRLSVTVTGEAGHAGTVPMRLRHDALLGAAEM  250



>ref|WP_039999451.1| allantoate amidohydrolase [Gluconacetobacter sp. SXCC-1]
Length=423

 Score =   115 bits (287),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 86/158 (54%), Gaps = 8/158 (5%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             LV TVG +   P A+NV+PG+V  ++D+RA  + GR+  + +        C +R +   
Sbjct  269  GLVATVGSLDVVPGAANVVPGEVVLSLDVRAGSNAGRDQAVADILQAARHTCAQRGLEMD  328

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKV  228
            I  + D +A  CD  L+  ++ A         G  T    PVL+SGAGHDAM M+ L  V
Sbjct  329  ITLQQDLDATPCDGRLTELMEQA--------VGSVTGAPAPVLVSGAGHDAMIMAHLAPV  380

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
             MLF+RC GGISH+P E V   D  AA  A++ F+  L
Sbjct  381  SMLFIRCAGGISHNPAESVTPADTDAAFRALITFIGLL  418


 Score = 40.0 bits (92),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q R ++T+RG  GHAGTV MA+R+D +  +A++
Sbjct  223  QQRYRITLRGMAGHAGTVAMALRRDALAGAADI  255



>gb|EGG76053.1| Allantoate deiminase [Gluconacetobacter sp. SXCC-1]
Length=419

 Score =   114 bits (286),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 86/158 (54%), Gaps = 8/158 (5%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             LV TVG +   P A+NV+PG+V  ++D+RA  + GR+  + +        C +R +   
Sbjct  265  GLVATVGSLDVVPGAANVVPGEVVLSLDVRAGSNAGRDQAVADILQAARHTCAQRGLEMD  324

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKV  228
            I  + D +A  CD  L+  ++ A         G  T    PVL+SGAGHDAM M+ L  V
Sbjct  325  ITLQQDLDATPCDGRLTELMEQA--------VGSVTGAPAPVLVSGAGHDAMIMAHLAPV  376

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
             MLF+RC GGISH+P E V   D  AA  A++ F+  L
Sbjct  377  SMLFIRCAGGISHNPAESVTPADTDAAFRALITFIGLL  414


 Score = 40.0 bits (92),  Expect(2) = 8e-29, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q R ++T+RG  GHAGTV MA+R+D +  +A++
Sbjct  219  QQRYRITLRGMAGHAGTVAMALRRDALAGAADI  251



>ref|WP_018307755.1| allantoate amidohydrolase [Acetobacter aceti]
Length=437

 Score =   116 bits (290),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 91/155 (59%), Gaps = 8/155 (5%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             LV TVG + TWP  +NV+PG V FT+D+RA  +T R+  +  F   + ++ ++R +   
Sbjct  275  GLVATVGLLRTWPGVANVVPGDVTFTIDVRAGTNTTRDRTVDVFLAALKEIAERRGVEIE  334

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKV  228
            I  + + +   CD  L + ++    TA   +TGE       VL+SGAGHDAM MSRL  +
Sbjct  335  IIPRENLDPSPCDPHLMTLME----TAVQDVTGEPAR----VLVSGAGHDAMIMSRLAPM  386

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFL  123
             MLF+RC  GISH+P E VL  DV  A +A+  F+
Sbjct  387  AMLFIRCEKGISHNPAEAVLPADVGEAVIALTRFV  421


 Score = 38.5 bits (88),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q R ++ V G  GHAGT+ M++RQD + A+AE+
Sbjct  227  QRRFEIRVHGMAGHAGTMAMSLRQDALTAAAEM  259



>dbj|GAN58440.1| amidohydrolase/allantoate amidohydrolase [Acetobacter aceti NBRC 
14818]
Length=441

 Score =   116 bits (290),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 91/155 (59%), Gaps = 8/155 (5%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             LV TVG + TWP  +NV+PG V FT+D+RA  +T R+  +  F   + ++ ++R +   
Sbjct  279  GLVATVGLLRTWPGVANVVPGDVTFTIDVRAGTNTTRDRTVDVFLAALKEIAERRGVEIE  338

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKV  228
            I  + + +   CD  L + ++    TA   +TGE       VL+SGAGHDAM MSRL  +
Sbjct  339  IIPRENLDPSPCDPHLMTLME----TAVQDVTGEPAR----VLVSGAGHDAMIMSRLAPM  390

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFL  123
             MLF+RC  GISH+P E VL  DV  A +A+  F+
Sbjct  391  AMLFIRCEKGISHNPAEAVLPADVGEAVIALTRFV  425


 Score = 38.5 bits (88),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q R ++ V G  GHAGT+ M++RQD + A+AE+
Sbjct  231  QRRFEIRVHGMAGHAGTMAMSLRQDALTAAAEM  263



>dbj|GAN70979.1| amidohydrolase/N-carbamoyl-L-amino acid hydrolase [Acetobacter 
syzygii 9H-2]
Length=431

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 92/157 (59%), Gaps = 8/157 (5%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG++   P ASNV+PGQ  F++DIRA     R+    E    +H +  +R I   +
Sbjct  270  LVATVGQLCVGPGASNVVPGQATFSLDIRAGTAQVRDKAAAEICAALHTIAQQRGITLAL  329

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            ER++D     CD +L+ +L     T+  R+TG T       L+SGAGHDAM M+ LT V 
Sbjct  330  ERQNDLPPTPCDPDLTERLA----TSVARVTGHTARR----LVSGAGHDAMVMAALTPVC  381

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            M+F+RC+ GISH+P E V  DD   A + +L F+ TL
Sbjct  382  MVFIRCKEGISHNPAEAVRHDDAQQALLVMLDFIRTL  418



>ref|WP_044330471.1| allantoate amidohydrolase [Sphingomonas sp. WHSC-8]
 gb|AJP71102.1| allantoate amidohydrolase [Sphingomonas sp. WHSC-8]
Length=411

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 91/161 (57%), Gaps = 11/161 (7%)
 Frame = -1

Query  593  AGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIF  414
            A  LV TVG++   P A NVIPGQV FT+DIRA D   R+A      +R+H + D R++ 
Sbjct  255  ASDLVATVGKLDVAPGAGNVIPGQVTFTLDIRAGDQARRDAAAEAILDRIHAIADIRHVD  314

Query  413  CVIERKHDANAVVCDRELSSQLK-SAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRL  237
              I+R +D  A  CD  LS  L+ S A       +          L+SGAGHDAM ++ L
Sbjct  315  FDIQRTNDLAAAPCDGRLSGLLEASVAALGIAPFS----------LVSGAGHDAMILAAL  364

Query  236  TKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
                MLF+RCRGG+SH+P EHV  +D   A   +L FL+ L
Sbjct  365  CPTAMLFIRCRGGVSHNPAEHVAPEDAEIALQVMLGFLDRL  405



>ref|WP_026870833.1| allantoate amidohydrolase [Inquilinus limosus]
Length=411

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 92/159 (58%), Gaps = 16/159 (10%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            +V TVG++   P A NVIPG V+FT+DIRA DD  R A + E +  +  +   R +   +
Sbjct  261  VVATVGQLDVQPGAVNVIPGAVRFTIDIRAPDDADRLAAMAELTAALEGIARGRGVELTL  320

Query  404  ERKHDANAVVCDRELSSQLKSA--AHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTK  231
            +R HD  AV CD  L  +L++A   H    R            L SGAGHDAMAM+ LT 
Sbjct  321  DRYHDGGAVRCDPALMEKLETAIRRHGLPAR-----------RLPSGAGHDAMAMAALTP  369

Query  230  VGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            VGMLF+RCRGGISH+P E +  +D   A +A+   L+ L
Sbjct  370  VGMLFLRCRGGISHNPAESITVED---ADLAVRVLLDLL  405



>ref|WP_044587468.1| allantoate amidohydrolase [Bradyrhizobium sp. LTSPM299]
 gb|KJC60861.1| allantoate amidohydrolase [Bradyrhizobium sp. LTSPM299]
Length=419

 Score =   112 bits (281),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 87/165 (53%), Gaps = 13/165 (8%)
 Frame = -1

Query  602  KSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKR  423
            K+ A  LV TVG I   P A+NVIPG+V FT+DIRA  D  R+  + +   R+  +  +R
Sbjct  261  KTDASGLVGTVGYIGAMPGATNVIPGKVSFTMDIRAPSDMHRKRAVADIVRRIEAIAKRR  320

Query  422  NIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPV--LMSGAGHDAMA  249
             +   I+  H+  +V C   L SQ           I G    +   V  L SGAGHD MA
Sbjct  321  ELALQIDVTHENRSVPCAPWLQSQ-----------IAGAVAAEGYAVFELPSGAGHDGMA  369

Query  248  MSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            M  +  +GM+FVRCRGG+SH+P EHV   D       +L F+E  
Sbjct  370  MVDIADIGMIFVRCRGGVSHNPAEHVELADADTGARVLLRFIENF  414


 Score = 40.8 bits (94),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 25/36 (69%), Gaps = 2/36 (6%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCII  670
            TRL   + G  GHAGTVPMA+R+D +  +AE  CI+
Sbjct  221  TRLAANLTGVAGHAGTVPMALRRDALSGAAE--CIV  254



>ref|WP_034931655.1| allantoate amidohydrolase [Komagataeibacter rhaeticus]
 gb|KDU94419.1| allantoate amidohydrolase [Komagataeibacter rhaeticus AF1]
Length=423

 Score =   113 bits (283),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 85/158 (54%), Gaps = 8/158 (5%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             LV TVG +   P A+NV+PG+V  ++D+RA  + GR+  + +        C  R +   
Sbjct  269  GLVATVGSLDVVPGAANVVPGEVVLSLDVRAGSNAGRDQAVADILKAARHTCALRGLEMD  328

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKV  228
            I  + D +A  CD  L+  ++ A         G  T    PVL+SGAGHDAM M+ L  V
Sbjct  329  ITLQQDLDATPCDGRLTELMEQA--------VGSVTGAPAPVLVSGAGHDAMIMAHLAPV  380

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
             MLF+RC GGISH+P E V   D  AA  A++ F+  L
Sbjct  381  SMLFIRCAGGISHNPAESVTPADTDAAFRALITFIGLL  418


 Score = 40.4 bits (93),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q R ++T+RG  GHAGTV MA+R+D +  +A++
Sbjct  223  QQRYRITLRGMAGHAGTVAMALRRDALAGAADI  255



>ref|WP_024511318.1| allantoate amidohydrolase [Bradyrhizobium sp. ARR65]
Length=422

 Score =   114 bits (284),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 88/159 (55%), Gaps = 9/159 (6%)
 Frame = -1

Query  590  GSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFC  411
            G LV TVG I   P A+NVIPG+V FT+D+RA  D  R   + +   R+ ++  +R +  
Sbjct  266  GGLVGTVGYIHASPGATNVIPGEVSFTIDMRAPTDMHRRRAVTDVVRRIEEIAKRRELGL  325

Query  410  VIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTK  231
             I+  H+     C   L +++  A       I+GE     V  L SGAGHD MAM  +  
Sbjct  326  QIDVTHENRTAPCAPWLRARIADA-------ISGEGFR--VFELPSGAGHDGMAMIDIAD  376

Query  230  VGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            VGMLFVRCRGGISH P+EHV   DV A    +L F+E  
Sbjct  377  VGMLFVRCRGGISHHPDEHVELADVDAGARVLLRFVENF  415


 Score = 39.7 bits (91),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCI  673
            TRL   + G  GHAGTVPMA+R+D +  +AE  CI
Sbjct  222  TRLAARLTGMAGHAGTVPMALRRDALAGAAE--CI  254



>ref|WP_006115346.1| allantoate amidohydrolase [Acetobacter pomorum]
 gb|EGE49021.1| Hydantoin utilization protein C [Acetobacter pomorum DM001]
Length=441

 Score =   113 bits (282),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 93/157 (59%), Gaps = 8/157 (5%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG++S  P A N++PG V+F++D+RA  +  R       ++ + ++  KR +   +
Sbjct  287  LVATVGQMSVKPGAPNIVPGWVEFSIDVRAGTEDVRNTAAETLTHALQEISQKRGVEMQL  346

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
              +HD +A  C+ +LS+ L ++ HT    +TG+T       L+SGAGHDAM M+ L  V 
Sbjct  347  TLQHDLSATQCNPQLSNILAASIHT----VTGQTAYP----LVSGAGHDAMIMAALAPVC  398

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            MLF+RC  GISH+P E V D DV  A   +  F++ +
Sbjct  399  MLFIRCEKGISHNPAEAVQDQDVETALRVMCDFIQNI  435


 Score = 40.0 bits (92),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPM  700
            Q R KVT++G  GHAGT+PM +RQD +
Sbjct  240  QYRFKVTMKGMAGHAGTLPMHLRQDAL  266



>gb|KGB25587.1| N-carbamoyl-L-amino acid hydrolase [Acetobacter pomorum]
Length=424

 Score =   113 bits (282),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 93/157 (59%), Gaps = 8/157 (5%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG++S  P A N++PG V+F++D+RA  +  R       ++ + ++  KR +   +
Sbjct  270  LVATVGQMSVKPGAPNIVPGWVEFSIDVRAGTEDVRNTAAETLTHALQEISQKRGVEMQL  329

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
              +HD +A  C+ +LS+ L ++ HT    +TG+T       L+SGAGHDAM M+ L  V 
Sbjct  330  TLQHDLSATQCNPQLSNILAASIHT----VTGQTAYP----LVSGAGHDAMIMAALAPVC  381

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            MLF+RC  GISH+P E V D DV  A   +  F++ +
Sbjct  382  MLFIRCEKGISHNPAEAVQDQDVETALRVMCDFIQNI  418


 Score = 40.0 bits (92),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPM  700
            Q R KVT++G  GHAGT+PM +RQD +
Sbjct  223  QYRFKVTMKGMAGHAGTLPMHLRQDAL  249



>emb|CCT58240.1| N-carbamyl-L-amino acid amidohydrolase [Acetobacter pasteurianus 
386B]
Length=424

 Score =   113 bits (282),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 95/169 (56%), Gaps = 8/169 (5%)
 Frame = -1

Query  620  CQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMH  441
            C     +S    LV TVG++S  P A N++PG V+F++D+RA  +  R       +  +H
Sbjct  258  CIEKIAQSGPDDLVATVGQMSVKPGAPNIVPGWVEFSIDVRAGTENVRNKAAETITQALH  317

Query  440  QLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGH  261
            ++  KR +   +  +HD +A  C+ +LS+ L ++       +TG+        L+SGAGH
Sbjct  318  EISQKRGVEMELALQHDLSATPCNPQLSNVLAASIQA----VTGQPAYK----LVSGAGH  369

Query  260  DAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            DAM M+ LT V MLF+RC  GISH+P E V D+DV  A   +  F++ +
Sbjct  370  DAMIMAALTPVCMLFIRCEKGISHNPAEAVQDEDVETALRVMCDFIQNI  418


 Score = 39.7 bits (91),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQD  706
            Q R KVT++G  GHAGT+PM +RQD
Sbjct  223  QYRFKVTMKGMAGHAGTLPMHLRQD  247



>ref|WP_003624336.1| N-carbamoyl-L-amino-acid hydrolase [Acetobacter pasteurianus]
 dbj|GAB27928.1| N-carbamoyl-L-amino-acid hydrolase [Acetobacter pasteurianus 
NBRC 101655]
Length=441

 Score =   113 bits (282),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 95/169 (56%), Gaps = 8/169 (5%)
 Frame = -1

Query  620  CQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMH  441
            C     +S    LV TVG++S  P A N++PG V+F++D+RA  +  R       +  +H
Sbjct  275  CIEKIAQSGPDDLVATVGQMSVKPGAPNIVPGWVEFSIDVRAGTENVRNKAAETITQALH  334

Query  440  QLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGH  261
            ++  KR +   +  +HD +A  C+ +LS+ L ++       +TG+        L+SGAGH
Sbjct  335  EISQKRGVEMELALQHDLSATPCNPQLSNVLAASIQA----VTGQPAYK----LVSGAGH  386

Query  260  DAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            DAM M+ LT V MLF+RC  GISH+P E V D+DV  A   +  F++ +
Sbjct  387  DAMIMAALTPVCMLFIRCEKGISHNPAEAVQDEDVETALRVMCDFIQNI  435


 Score = 39.7 bits (91),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQD  706
            Q R KVT++G  GHAGT+PM +RQD
Sbjct  240  QYRFKVTMKGMAGHAGTLPMHLRQD  264



>ref|WP_012812933.1| allantoate amidohydrolase [Acetobacter pasteurianus]
 dbj|BAH99429.1| N-carbamyl-L-amino acid amidohydrolase [Acetobacter pasteurianus 
IFO 3283-01]
 dbj|BAI02482.1| N-carbamyl-L-amino acid amidohydrolase [Acetobacter pasteurianus 
IFO 3283-03]
 dbj|BAI05528.1| N-carbamyl-L-amino acid amidohydrolase [Acetobacter pasteurianus 
IFO 3283-07]
 dbj|BAI08577.1| N-carbamyl-L-amino acid amidohydrolase [Acetobacter pasteurianus 
IFO 3283-22]
 dbj|BAI11625.1| N-carbamyl-L-amino acid amidohydrolase [Acetobacter pasteurianus 
IFO 3283-26]
 dbj|BAI14671.1| N-carbamyl-L-amino acid amidohydrolase [Acetobacter pasteurianus 
IFO 3283-32]
 dbj|BAI17717.1| N-carbamyl-L-amino acid amidohydrolase [Acetobacter pasteurianus 
IFO 3283-01-42C]
 dbj|BAI20701.1| N-carbamyl-L-amino acid amidohydrolase [Acetobacter pasteurianus 
IFO 3283-12]
Length=441

 Score =   113 bits (282),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 95/169 (56%), Gaps = 8/169 (5%)
 Frame = -1

Query  620  CQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMH  441
            C     +S    LV TVG++S  P A N++PG V+F++D+RA  +  R       +  +H
Sbjct  275  CIEKIAQSGPDDLVATVGQMSVKPGAPNIVPGWVEFSIDVRAGTENVRNKAAETITQALH  334

Query  440  QLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGH  261
            ++  KR +   +  +HD +A  C+ +LS+ L ++       +TG+        L+SGAGH
Sbjct  335  EISQKRGVEMELALQHDLSATPCNPQLSNVLAASIQA----VTGQPAYK----LVSGAGH  386

Query  260  DAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            DAM M+ LT V MLF+RC  GISH+P E V D+DV  A   +  F++ +
Sbjct  387  DAMIMAALTPVCMLFIRCEKGISHNPAEAVQDEDVETALRVMCDFIQNI  435


 Score = 39.7 bits (91),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQD  706
            Q R KVT++G  GHAGT+PM +RQD
Sbjct  240  QYRFKVTMKGMAGHAGTLPMHLRQD  264



>ref|WP_013653000.1| allantoate amidohydrolase [Polymorphum gilvum]
 gb|ADZ70682.1| Amidase, hydantoinase/carbamoylase family [Polymorphum gilvum 
SL003B-26A1]
Length=422

 Score =   107 bits (268),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 85/160 (53%), Gaps = 9/160 (6%)
 Frame = -1

Query  593  AGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIF  414
            A SLV TVG I   P A NVIPG+V  T+DIRA  D  R   I        ++  +R   
Sbjct  264  ADSLVATVGRIEARPGAVNVIPGEVHMTLDIRAAADAPRLEAIAALREEARRIGARRGCV  323

Query  413  CVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLT  234
              +E+ HD    V  R  +  L+  A  A   +  E        LMSGAGHD  AM+ L 
Sbjct  324  FALEQYHD----VGTRPCAPHLQDTAAAALQELGLEPLR-----LMSGAGHDGQAMAALC  374

Query  233  KVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
             +GM+FVRCRGGISH+P E V D D+  A  A++ ++E L
Sbjct  375  DIGMMFVRCRGGISHNPLESVSDADMGLAVEALVRWIEHL  414


 Score = 45.1 bits (105),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            +R  VTVRG  GHAGTVPM +R D + A+AE 
Sbjct  220  SRFNVTVRGEAGHAGTVPMELRHDALAAAAEF  251



>emb|CCD00529.1| N-carbamoyl-L-amino acid hydrolase (fragment) [Azospirillum brasilense 
Sp245]
Length=219

 Score =   107 bits (266),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 83/147 (56%), Gaps = 17/147 (12%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGRE----AIIYEFSNRMHQLCDKRN  420
             LV TVG I   P A NVIPG+  FT+D+RA +D+ R     AI+ +F      +  +R 
Sbjct  64   GLVATVGRIEVKPGAVNVIPGEAAFTLDVRAPEDSVRRDACAAILADFEG----IAARRG  119

Query  419  IFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSR  240
            +   +E  HDANA  C   +  Q+++A   A  R         +P L SGAGHDAMA + 
Sbjct  120  VELAVETTHDANAAPCSPGIRRQIEAAVIRAGVR--------PLP-LPSGAGHDAMAFAG  170

Query  239  LTKVGMLFVRCRGGISHSPEEHVLDDD  159
            +  +GMLFVRC GGISH+P E +  +D
Sbjct  171  VLPMGMLFVRCAGGISHNPAESITVED  197


 Score = 45.4 bits (106),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            TR  V +RG  GHAGTVPMA+R+D +VA+AE+
Sbjct  19   TRFAVRLRGMAGHAGTVPMALRRDALVAAAEM  50



>ref|WP_004449887.1| allantoate amidohydrolase [Acetobacter pasteurianus]
 dbj|GAB31589.1| N-carbamoyl-L-amino-acid hydrolase [Acetobacter pasteurianus 
subsp. pasteurianus LMG 1262 = NBRC 106471]
Length=441

 Score =   112 bits (280),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 95/169 (56%), Gaps = 8/169 (5%)
 Frame = -1

Query  620  CQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMH  441
            C     +S    LV TVG++S  P A N++PG V+F++D+RA  +  R       +  +H
Sbjct  275  CIEKIAQSGPDDLVATVGQMSVKPGAPNIVPGWVEFSIDVRAGTENVRNKAAETITQALH  334

Query  440  QLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGH  261
            ++  KR +   +  +HD +A  C+ +LS+ L ++       +TG+        L+SGAGH
Sbjct  335  EISQKRGVEMELALQHDLSATPCNPQLSNVLAASIQA----VTGQPAYK----LVSGAGH  386

Query  260  DAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            DAM M+ LT V MLF+RC  GISH+P E V D+DV  A   +  F++ +
Sbjct  387  DAMIMAALTPVCMLFMRCEKGISHNPAEAVQDEDVETALRVMCDFIQNI  435


 Score = 39.7 bits (91),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQD  706
            Q R KVT++G  GHAGT+PM +RQD
Sbjct  240  QYRFKVTMKGMAGHAGTLPMHLRQD  264



>ref|WP_029329455.1| allantoate amidohydrolase [Komagataeibacter oboediens]
Length=424

 Score =   112 bits (281),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 88/155 (57%), Gaps = 8/155 (5%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             LV TVG +   P A+NV+PG+V  T+D+RA  D  R+           Q+ ++R +   
Sbjct  270  GLVATVGSLDVMPGAANVVPGEVVLTIDVRAGTDATRDRAAAAILEEARQVAERRGLEMD  329

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKV  228
            +  + D +A  CD  L++ ++ A H        + T    P+L+SGAGHDAM M+ L  V
Sbjct  330  VALQQDLDATPCDPALTALMEQAVH--------DVTHAPAPLLVSGAGHDAMIMAHLAPV  381

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFL  123
             MLF+RC GGISH+P E V DDD  AA  A++ F+
Sbjct  382  SMLFIRCAGGISHNPAESVTDDDTDAALRAMITFI  416


 Score = 39.3 bits (90),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 27/40 (68%), Gaps = 4/40 (10%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL----DCI  673
            Q R +VT+RG  GHAGTV M +R+D +  +A++    +CI
Sbjct  224  QYRYRVTLRGMAGHAGTVAMKLRRDALAGAADIILAAECI  263



>ref|WP_027135007.1| allantoate amidohydrolase [Geminicoccus roseus]
Length=414

 Score =   111 bits (278),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 81/159 (51%), Gaps = 13/159 (8%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG I   P A NVIPG+   T+DIRA +D  R + + E    + ++   R + C I
Sbjct  260  LVGTVGRIDAQPGAVNVIPGRALLTLDIRAPNDGLRSSAVEEIVQAIRRIAAARGLGCTI  319

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPV--LMSGAGHDAMAMSRLTK  231
             R+HD  A  C   L   L  A              + +PV  L SGAGHD MAM+    
Sbjct  320  GREHDQPAATCAPRLQRWLAQALRA-----------EGLPVKYLSSGAGHDTMAMAGFCP  368

Query  230  VGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
             GMLFVRC+GGISH+P E +  DD   A   +L  L  L
Sbjct  369  AGMLFVRCKGGISHNPLESITIDDAGTAARVVLRVLRDL  407


 Score = 40.4 bits (93),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q+RL V + G  GHAGTVPMA R+D +  +AE+
Sbjct  214  QSRLAVVLDGMAGHAGTVPMAHRRDALAGAAEV  246



>ref|WP_041247455.1| allantoate amidohydrolase [Komagataeibacter medellinensis]
Length=423

 Score =   113 bits (283),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 83/147 (56%), Gaps = 8/147 (5%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             LV TVG +   P A+NV+PG+V  ++D+RA  +  R+  + E  +   Q+C  R +   
Sbjct  269  GLVATVGSLDVVPGAANVVPGEVVMSLDVRAGTNAARDMAVAEILDIARQICRARGLEID  328

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKV  228
            +  K D +A  CD  L++ ++ AA        G  T    P+L+SGAGHDAM M+ L  V
Sbjct  329  MTLKQDLDATPCDARLTALMEQAA--------GSVTGMPAPLLVSGAGHDAMIMAHLVPV  380

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAA  147
             MLF+RC GGISH+P E V   D  AA
Sbjct  381  SMLFIRCAGGISHNPAESVTQADTEAA  407


 Score = 38.1 bits (87),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q R  + +RG  GHAGTV MA+R+D +  +AE+
Sbjct  223  QQRYSLVLRGMAGHAGTVAMALRRDALAGAAEI  255



>ref|WP_016843100.1| hypothetical protein, partial [Bradyrhizobium elkanii]
Length=277

 Score =   112 bits (279),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 87/162 (54%), Gaps = 17/162 (10%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             LV TVG ++  P A+NVIPG+V FT+DIR+ +D  R+  + +   ++  +  +R +   
Sbjct  121  GLVGTVGYVNAMPGATNVIPGKVSFTMDIRSQNDMHRKRAVADTVRQIEAIAKRRELALQ  180

Query  407  IERKHDANAVVCDRELSSQLKSA----AHTAFTRITGETTDDDVPVLMSGAGHDAMAMSR  240
            I+  H+  +V C   L SQ+  A     H AF              L SGAGHD MAM  
Sbjct  181  IDVTHENRSVPCAPWLKSQIAEAVAAEGHAAFE-------------LPSGAGHDGMAMVD  227

Query  239  LTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            +  +GM+FVRCRGGISH+P EHV   D       +L F+E  
Sbjct  228  VADIGMIFVRCRGGISHNPAEHVELADADTGARVLLRFVENF  269


 Score = 39.7 bits (91),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 2/36 (6%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCII  670
            TRL  ++ G  GHAGTVPM +R+D +  +AE  CI+
Sbjct  76   TRLAASLTGVAGHAGTVPMPLRRDALAGAAE--CIV  109



>ref|WP_028339443.1| allantoate amidohydrolase [Bradyrhizobium elkanii]
Length=423

 Score =   111 bits (278),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 87/162 (54%), Gaps = 17/162 (10%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             LV TVG ++  P A+NVIPG+V FT+DIR+ +D  R+  + +   ++  +  +R +   
Sbjct  267  GLVGTVGYVNAMPGATNVIPGKVSFTMDIRSQNDMHRKRAVADIVRQIEAIAKRRELALQ  326

Query  407  IERKHDANAVVCDRELSSQLKSA----AHTAFTRITGETTDDDVPVLMSGAGHDAMAMSR  240
            I+  H+  +V C   L +Q+  A     H AF              L SGAGHD MAM  
Sbjct  327  IDVTHENRSVPCAPWLKTQIAEAVAAEGHAAFE-------------LPSGAGHDGMAMVD  373

Query  239  LTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            +  +GM+FVRCRGGISH+P EHV   D       +L F+E  
Sbjct  374  VADIGMIFVRCRGGISHNPAEHVELADADTGARVLLRFVENF  415


 Score = 40.0 bits (92),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 2/36 (6%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCII  670
            TRL  ++ G  GHAGTVPM +R+D +  +AE  CI+
Sbjct  222  TRLAASLTGVAGHAGTVPMKLRRDALAGAAE--CIV  255



>ref|WP_005859514.1| N-carbamoyl-L-amino acid amidohydrolase [Sagittula stellata]
 gb|EBA07846.1| N-carbamoyl-L-amino acid amidohydrolase [Sagittula stellata E-37]
Length=409

 Score =   107 bits (266),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 86/155 (55%), Gaps = 12/155 (8%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             +V TVG++   P A NVIPG+V FTVD+R+ +   +     E    + ++  +R +   
Sbjct  259  GVVATVGQLDCRPGAINVIPGEVAFTVDMRSGNPARQAVARTELDRALEEIAGRRGLTLT  318

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKV  228
            +E+        CD  L +QL +A  T            + P++ SGAGHDA+AMSR+  V
Sbjct  319  VEQLSHVPPTTCDPALLAQLAAAVGT------------EAPIMESGAGHDAIAMSRIAPV  366

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFL  123
            GMLFV CRGGISH P EHV   DV AA  A+  F+
Sbjct  367  GMLFVACRGGISHDPAEHVEPADVSAALQALRRFV  401


 Score = 45.1 bits (105),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 27/37 (73%), Gaps = 2/37 (5%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCII  670
            QTRL VT+ G  GHAGTVPM MR+D +  +A  DC++
Sbjct  215  QTRLSVTLLGAAGHAGTVPMRMRRDALAGAA--DCVL  249



>dbj|BAK85109.1| allantoate amidohydrolase [Komagataeibacter medellinensis NBRC 
3288]
Length=420

 Score =   113 bits (283),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 83/147 (56%), Gaps = 8/147 (5%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             LV TVG +   P A+NV+PG+V  ++D+RA  +  R+  + E  +   Q+C  R +   
Sbjct  266  GLVATVGSLDVVPGAANVVPGEVVMSLDVRAGTNAARDMAVAEILDIARQICRARGLEID  325

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKV  228
            +  K D +A  CD  L++ ++ AA        G  T    P+L+SGAGHDAM M+ L  V
Sbjct  326  MTLKQDLDATPCDARLTALMEQAA--------GSVTGMPAPLLVSGAGHDAMIMAHLVPV  377

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAA  147
             MLF+RC GGISH+P E V   D  AA
Sbjct  378  SMLFIRCAGGISHNPAESVTQADTEAA  404


 Score = 38.1 bits (87),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q R  + +RG  GHAGTV MA+R+D +  +AE+
Sbjct  220  QQRYSLVLRGMAGHAGTVAMALRRDALAGAAEI  252



>dbj|GAN98451.1| amidohydrolase/allantoate amidohydrolase [Komagataeibacter xylinus 
NBRC 13693]
Length=416

 Score =   112 bits (281),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 88/155 (57%), Gaps = 8/155 (5%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             LV TVG +   P A+NV+PG+V  T+D+RA  D  R+           Q+ ++R +   
Sbjct  262  GLVATVGSLDVMPGAANVVPGEVVLTIDVRAGTDATRDRAAAAILEEARQVAERRGLEMD  321

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKV  228
            +  + D +A  CD  L++ ++ A H        + T    P+L+SGAGHDAM M+ L  V
Sbjct  322  VALQQDLDATPCDPALTALMEQAVH--------DVTHAPAPLLVSGAGHDAMIMAHLAPV  373

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFL  123
             MLF+RC GGISH+P E V DDD  AA  A++ F+
Sbjct  374  SMLFIRCAGGISHNPAESVTDDDTDAALRAMITFI  408


 Score = 38.9 bits (89),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q R +VT+RG  GHAGTV M +R+D +  +A++
Sbjct  216  QYRYRVTLRGMAGHAGTVAMKLRRDALAGAADI  248



>ref|WP_018270389.1| allantoate amidohydrolase [Bradyrhizobium elkanii]
Length=419

 Score =   112 bits (279),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 87/162 (54%), Gaps = 17/162 (10%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             LV TVG ++  P A+NVIPG+V FT+DIR+ +D  R+  + +   ++  +  +R +   
Sbjct  263  GLVGTVGYVNAMPGATNVIPGKVSFTMDIRSQNDMHRKRAVADTVRQIEAIAKRRELALQ  322

Query  407  IERKHDANAVVCDRELSSQLKSA----AHTAFTRITGETTDDDVPVLMSGAGHDAMAMSR  240
            I+  H+  +V C   L SQ+  A     H AF              L SGAGHD MAM  
Sbjct  323  IDVTHENRSVPCAPWLKSQIAEAVAAEGHAAFE-------------LPSGAGHDGMAMVD  369

Query  239  LTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            +  +GM+FVRCRGGISH+P EHV   D       +L F+E  
Sbjct  370  VADIGMIFVRCRGGISHNPAEHVELADADTGARVLLRFVENF  411


 Score = 39.7 bits (91),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 2/36 (6%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCII  670
            TRL  ++ G  GHAGTVPM +R+D +  +AE  CI+
Sbjct  218  TRLAASLTGVAGHAGTVPMPLRRDALAGAAE--CIV  251



>ref|WP_019090352.1| allantoate amidohydrolase [Acetobacter pasteurianus]
Length=441

 Score =   112 bits (279),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 94/169 (56%), Gaps = 8/169 (5%)
 Frame = -1

Query  620  CQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMH  441
            C     +S    LV TVG ++  P A N++PG V+F++D+RA   + R       +N + 
Sbjct  275  CIEKIAQSGPDDLVATVGHMTVKPGAPNIVPGWVEFSIDVRAGTKSVRNKAAETLTNALQ  334

Query  440  QLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGH  261
            ++  KR +   +  +HD +A  C+ +LS+ L ++  T    +TG+        L+SGAGH
Sbjct  335  EISQKRGVKMELALQHDLSATPCNPQLSNILATSIQT----VTGQPAY----ALVSGAGH  386

Query  260  DAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            DAM M+ LT V MLF+RC  GISH+P E V D DV  A   +  F++ +
Sbjct  387  DAMIMAALTPVCMLFIRCEKGISHNPAEAVRDQDVETALRVMCDFIQNI  435


 Score = 39.7 bits (91),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQD  706
            Q R KVT++G  GHAGT+PM +RQD
Sbjct  240  QYRFKVTMKGMAGHAGTLPMHLRQD  264



>ref|WP_039216178.1| allantoate amidohydrolase [Alteromonas marina]
 gb|KHT57771.1| allantoate amidohydrolase [Alteromonas marina]
Length=414

 Score =   108 bits (271),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 89/152 (59%), Gaps = 12/152 (8%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            +V TVG+I   P+  NVI G+ +F++DIR+ DD  R++++ E   +   +   R +    
Sbjct  264  VVATVGKIENAPNGVNVISGRTRFSLDIRSEDDDLRDSVLAEILQKFDDIAQSRQVVLTR  323

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVP-VLMSGAGHDAMAMSRLTKV  228
            E+ H A AV CD    SQLK A       + G       P +L SGAGHDAMA++ ++ V
Sbjct  324  EQTHSAPAVHCD----SQLKDAL------VRGVEESGIAPRILASGAGHDAMAIADISPV  373

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAIL  132
             MLF RC+GGISH P E +  DDV AA +++L
Sbjct  374  AMLFTRCKGGISHHPAESITGDDV-AASLSVL  404


 Score = 42.7 bits (99),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            R    V G  GHAGTVPM+MR+D + ASAE+
Sbjct  220  RFNFMVEGMAGHAGTVPMSMRRDALCASAEM  250



>gb|ADM10348.1| N-carbamoyl-L-amino acid amidohydrolase [Parvularcula bermudensis 
HTCC2503]
Length=428

 Score =   109 bits (272),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 85/156 (54%), Gaps = 9/156 (6%)
 Frame = -1

Query  581  VCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVIE  402
            V TVG +   P ASNVIPG  + T+DIRA     R+ +    +  + ++ D+R +    E
Sbjct  276  VATVGRLEIRPGASNVIPGAAELTIDIRAETTELRDDLTARIAAAIERIADRRQVSASHE  335

Query  401  RKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVGM  222
               D     CD +L+ +L +A       +TG+        L SGAGHDAM M+R   + M
Sbjct  336  TVQDLPGTACDPDLTERLSAA----IVSVTGQDLQ-----LSSGAGHDAMVMARACPIAM  386

Query  221  LFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            +FVRCRGGISH P+E+V + DV AA  A+   L  L
Sbjct  387  MFVRCRGGISHHPDEYVEEADVAAAITALGQLLSDL  422


 Score = 42.4 bits (98),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q RL+V V G  GHAGTVPM++R D + A+AE+
Sbjct  224  QRRLRVHVGGKAGHAGTVPMSLRTDALTAAAEI  256



>emb|CDP18199.1| unnamed protein product [Coffea canephora]
Length=375

 Score = 87.0 bits (214),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQ  522
            CKQPE YLSYD EC+ S V+SL+GSLVCTVGEIS+WPSASNVIPGQ
Sbjct  318  CKQPEQYLSYDGECRASEVQSLSGSLVCTVGEISSWPSASNVIPGQ  363


 Score = 64.3 bits (155),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTVRG+QGHAGTVPM MRQDPMVA+AE+
Sbjct  278  QTRLKVTVRGSQGHAGTVPMNMRQDPMVAAAEI  310



>ref|WP_028170521.1| allantoate amidohydrolase [Bradyrhizobium japonicum]
 gb|AJA61896.1| allantoate amidohydrolase [Bradyrhizobium japonicum]
Length=424

 Score =   111 bits (278),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 86/160 (54%), Gaps = 9/160 (6%)
 Frame = -1

Query  593  AGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIF  414
            AG LV TVG I   P A+NVIPG+V FT+D+RA  D  R+  + +   ++  +  +RN+ 
Sbjct  264  AGGLVGTVGYIQARPGATNVIPGEVSFTIDMRAPTDMHRKRAVADVVRQIEAIAKRRNLA  323

Query  413  CVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLT  234
              ++  H+     C   L  Q+  A       I  E     V  L SGAGHD MAM  + 
Sbjct  324  LQLDVTHENRTAPCAPWLKDQIAQA-------IAAEGAS--VFELPSGAGHDGMAMIDIA  374

Query  233  KVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
             VGM+FVRCRGGISH P+EHV   DV A    +L  +E  
Sbjct  375  DVGMIFVRCRGGISHHPDEHVELADVDAGARVLLRVIENF  414


 Score = 39.7 bits (91),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCI  673
            TRL   + G  GHAGTVPMA+R+D +  +AE  CI
Sbjct  221  TRLAARLTGMAGHAGTVPMALRRDALAGAAE--CI  253



>dbj|GAN79857.1| amidohydrolase/hydantoinase/carbamoylase family amidase [Acidocella 
aminolytica 101 = DSM 11237]
Length=417

 Score =   110 bits (274),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 85/162 (52%), Gaps = 11/162 (7%)
 Frame = -1

Query  593  AGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIF  414
            A  +V TVG ++  P   NVIPG+  F+VD+RA     R+    +F   +  LCD+R I 
Sbjct  254  AAQIVGTVGALTARPGVGNVIPGECVFSVDLRASSTAARDQTEQDFRTGLAALCDRRGIT  313

Query  413  CVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPV-LMSGAGHDAMAMSRL  237
              ++R       +CD    + L  A           T  +  P  L SGAGHDAM++S L
Sbjct  314  HEVKRIQQLAPCLCDNHAQTLLAEAI----------TAQNQRPYPLASGAGHDAMSLSTL  363

Query  236  TKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETLL  111
              V MLF+RCR GISH+P EHV   DV  A   IL FL+ L+
Sbjct  364  CPVAMLFIRCRAGISHNPAEHVDAADVDIAARVILEFLDRLV  405


 Score = 41.2 bits (95),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCIIGK  664
            QTRL VT+ G   HAGT PM +R+D + A+AE   ++ K
Sbjct  212  QTRLAVTLTGMANHAGTTPMPLRKDALTAAAEAILLVEK  250



>ref|WP_039279170.1| allantoate amidohydrolase [Novosphingobium malaysiense]
 gb|KHK93300.1| allantoate amidohydrolase [Novosphingobium malaysiense]
Length=443

 Score =   114 bits (284),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 86/157 (55%), Gaps = 9/157 (6%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            +V TVG I   P A NVIPG V FT+D+R+  +  R+ +      R+ ++ + R++   +
Sbjct  286  VVATVGMIEAMPGAPNVIPGAVHFTIDVRSGKEERRDRVAKAILARLSEIAEARDLDIAV  345

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            ER HD  A  CD EL   +  A   A            V  L+SGAGHDAM M+ L    
Sbjct  346  ERIHDLPASPCDAELMDLMDEALIGA---------GQPVRRLVSGAGHDAMNMAALCPTA  396

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            MLF+RC+GG+SH+P EHV  +D   A   +L F+E L
Sbjct  397  MLFIRCKGGVSHNPAEHVDPEDAEIALQVMLGFIERL  433


 Score = 37.4 bits (85),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q R  VTV+G  GHAGT  M +R+DP+  +A +
Sbjct  239  QLRYAVTVKGMAGHAGTTAMRLRRDPLAGAAAM  271



>ref|WP_026790146.1| allantoate amidohydrolase [Pleomorphomonas oryzae]
Length=425

 Score =   105 bits (262),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 88/178 (49%), Gaps = 13/178 (7%)
 Frame = -1

Query  647  EYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAI  468
            E  LS +D  +       A  +V TVG ++  P A NVIP +V FT+DIRA  D  R A 
Sbjct  250  EMMLSIEDVARAGN----AHQMVATVGRLAAKPGAVNVIPAEVVFTLDIRADADAPRLAA  305

Query  467  IYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDV  288
            I E   R   +  +R +   +E+ +++    C   L      AA        GE      
Sbjct  306  IAELETRFRAVAARRGVTVTMEKFYESPTTPCAPRLQEAFVGAARDLNL---GERR----  358

Query  287  PVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
              L SGAGHD  AM  LT VGMLFVRCR GISH+P E    DD+  A  A++  +E L
Sbjct  359  --LASGAGHDGHAMHHLTDVGMLFVRCRSGISHNPAEFATIDDMGLAVEALIKAVERL  414


 Score = 45.8 bits (107),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q+R  +TV G  GHAGTVPMA+R+D + A+AE+
Sbjct  219  QSRFSITVMGEAGHAGTVPMALRRDALAATAEM  251



>dbj|BAL08835.1| hypothetical protein BJ6T_35610 [Bradyrhizobium japonicum USDA 
6]
Length=408

 Score =   111 bits (278),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 86/160 (54%), Gaps = 9/160 (6%)
 Frame = -1

Query  593  AGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIF  414
            AG LV TVG I   P A+NVIPG+V FT+D+RA  D  R+  + +   ++  +  +RN+ 
Sbjct  248  AGGLVGTVGYIQARPGATNVIPGEVSFTIDMRAPTDMHRKRAVADVVRQIEAIAKRRNLA  307

Query  413  CVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLT  234
              ++  H+     C   L  Q+  A       I  E     V  L SGAGHD MAM  + 
Sbjct  308  LQLDVTHENRTAPCAPWLKDQIAQA-------IAAEGAS--VFELPSGAGHDGMAMIDIA  358

Query  233  KVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
             VGM+FVRCRGGISH P+EHV   DV A    +L  +E  
Sbjct  359  DVGMIFVRCRGGISHHPDEHVELADVDAGARVLLRVIENF  398


 Score = 39.7 bits (91),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCI  673
            TRL   + G  GHAGTVPMA+R+D +  +AE  CI
Sbjct  205  TRLAARLTGMAGHAGTVPMALRRDALAGAAE--CI  237



>ref|WP_043645604.1| allantoate amidohydrolase, partial [Caenispirillum salinarum]
Length=399

 Score =   115 bits (287),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 82/149 (55%), Gaps = 13/149 (9%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             +V TVG +   P A NV+PG+V+FTVD+RA +D  RE+ + +   R+  +  +R +   
Sbjct  258  GVVATVGALEVAPGAVNVVPGRVRFTVDLRAAEDAARESALEDLRGRLQMIAARRGLTLA  317

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPV--LMSGAGHDAMAMSRLT  234
             E  H+  A  C   L+  L  A             D  +P   LMSGAGHDAMAM+ L 
Sbjct  318  AETLHENAACPCSPSLTDLLAEA-----------VEDQGLPAHRLMSGAGHDAMAMADLC  366

Query  233  KVGMLFVRCRGGISHSPEEHVLDDDVWAA  147
             V MLFVRC GG+SH+P E V  +DV  A
Sbjct  367  DVAMLFVRCAGGVSHNPAESVTAEDVAVA  395


 Score = 35.8 bits (81),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            TRL   + G  GHAGTVPM  R+D +  +AE
Sbjct  215  TRLAFALGGEAGHAGTVPMEARRDALAGAAE  245



>ref|WP_043332840.1| hypothetical protein [Cobetia marina]
 gb|KGA02679.1| hypothetical protein KP05_04705 [Cobetia marina]
Length=434

 Score =   111 bits (278),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 97/187 (52%), Gaps = 15/187 (8%)
 Frame = -1

Query  659  CKQPEYYLSYDD---ECQTSTVKSLAG-SLVCTVGEISTWPSASNVIPGQVKFTVDIRAM  492
            C   E+ L+ +    + Q      +A  SLV TVG     P A NVIPG    ++DIRA+
Sbjct  253  CAAAEWILAVESLARDVQAGKRADMADHSLVATVGCCELRPGAVNVIPGGAALSLDIRAL  312

Query  491  DDTGREAIIYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRIT  312
            DD  R+  + E  N  H++  +R +    E+ H A+AV CD  L   + +          
Sbjct  313  DDAQRDRALDELLNEAHRIAARRGLTFHCEQTHAADAVACDEGLMQAVDA----------  362

Query  311  GETTDDDVPV-LMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAI  135
            G       P  L SGAGHDAMA+S L  VGMLF+RC  GISH P E V +DDV  A  A+
Sbjct  363  GIAATGQAPFRLPSGAGHDAMAVSHLCPVGMLFLRCERGISHHPLEAVTEDDVAKALAAL  422

Query  134  LAFLETL  114
            +A +E +
Sbjct  423  IASIEAV  429


 Score = 39.3 bits (90),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 20/30 (67%), Gaps = 0/30 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            R  V   G  GHAGT PMA+RQD + A+AE
Sbjct  228  RFAVNFVGQAGHAGTTPMALRQDALCAAAE  257



>gb|EKV29225.1| N-carbamoyl-L-amino acid hydrolase [Caenispirillum salinarum 
AK4]
Length=419

 Score =   115 bits (287),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 82/149 (55%), Gaps = 13/149 (9%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             +V TVG +   P A NV+PG+V+FTVD+RA +D  RE+ + +   R+  +  +R +   
Sbjct  258  GVVATVGALEVAPGAVNVVPGRVRFTVDLRAAEDAARESALEDLRGRLQMIAARRGLTLA  317

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPV--LMSGAGHDAMAMSRLT  234
             E  H+  A  C   L+  L  A             D  +P   LMSGAGHDAMAM+ L 
Sbjct  318  AETLHENAACPCSPSLTDLLAEA-----------VEDQGLPAHRLMSGAGHDAMAMADLC  366

Query  233  KVGMLFVRCRGGISHSPEEHVLDDDVWAA  147
             V MLFVRC GG+SH+P E V  +DV  A
Sbjct  367  DVAMLFVRCAGGVSHNPAESVTAEDVAVA  395


 Score = 35.8 bits (81),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            TRL   + G  GHAGTVPM  R+D +  +AE
Sbjct  215  TRLAFALGGEAGHAGTVPMEARRDALAGAAE  245



>ref|WP_026783474.1| allantoate amidohydrolase [Pleomorphomonas koreensis]
Length=419

 Score =   103 bits (257),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 93/176 (53%), Gaps = 18/176 (10%)
 Frame = -1

Query  647  EYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAI  468
            E  L+ +D  +    +  A  +V TVG I+  P A NVIP +V FT+DIRA  D  R A 
Sbjct  244  EMMLAIEDVAR----RGAAHQMVATVGRIAARPGAVNVIPAEVAFTLDIRADADAPRHAA  299

Query  467  IYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRI-TGETTDDD  291
            I E   R+  +   R +   +E+  ++    C    +++L+ A   A   +  G+     
Sbjct  300  IAELEARLLTIATGRKVSARMEKFFESPTTPC----AARLQEAFAAALGDLGLGQRR---  352

Query  290  VPVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFL  123
               L SGAGHD  AM  LT VGMLFVRCRGGISH+P E    DD+   G+A+ A +
Sbjct  353  ---LASGAGHDGHAMHHLTDVGMLFVRCRGGISHNPAEFAAVDDM---GLAVEALV  402


 Score = 47.4 bits (111),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q+R  +TV G  GHAGTVPMA+R+D + ASAE+
Sbjct  213  QSRFNITVTGEAGHAGTVPMALRRDALAASAEM  245



>gb|ERF83069.1| hydantoinase/carbamoylase family amidase [Bradyrhizobium sp. 
DFCI-1]
Length=419

 Score =   111 bits (277),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 86/162 (53%), Gaps = 17/162 (10%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             LV TVG I+  P A+NVIPG+V FT+DIR+  D  R+  + +   ++  +  +R +   
Sbjct  263  GLVGTVGYINAMPGATNVIPGKVSFTMDIRSQSDMHRKRAVADIVRQIEAIAKRRELALQ  322

Query  407  IERKHDANAVVCDRELSSQLKSA----AHTAFTRITGETTDDDVPVLMSGAGHDAMAMSR  240
            I+  H+  +V C   L +Q+  A     HT F              L SGAGHD MAM  
Sbjct  323  IDVTHENRSVPCAPWLKAQIAEAVAAEGHTVFE-------------LPSGAGHDGMAMVD  369

Query  239  LTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            +  +GM+FVRCRGGISH+P EHV   D       +L F+E  
Sbjct  370  VADIGMIFVRCRGGISHNPAEHVELADADTGARVLLRFVENF  411


 Score = 39.7 bits (91),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 2/36 (6%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCII  670
            TRL  ++ G  GHAGTVPM +R+D +  +AE  CI+
Sbjct  218  TRLAASLTGFAGHAGTVPMPLRRDALAGAAE--CIV  251



>ref|WP_035650405.1| allantoate amidohydrolase [Bradyrhizobium sp. DFCI-1]
Length=423

 Score =   111 bits (277),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 86/162 (53%), Gaps = 17/162 (10%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             LV TVG I+  P A+NVIPG+V FT+DIR+  D  R+  + +   ++  +  +R +   
Sbjct  267  GLVGTVGYINAMPGATNVIPGKVSFTMDIRSQSDMHRKRAVADIVRQIEAIAKRRELALQ  326

Query  407  IERKHDANAVVCDRELSSQLKSA----AHTAFTRITGETTDDDVPVLMSGAGHDAMAMSR  240
            I+  H+  +V C   L +Q+  A     HT F              L SGAGHD MAM  
Sbjct  327  IDVTHENRSVPCAPWLKAQIAEAVAAEGHTVFE-------------LPSGAGHDGMAMVD  373

Query  239  LTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            +  +GM+FVRCRGGISH+P EHV   D       +L F+E  
Sbjct  374  VADIGMIFVRCRGGISHNPAEHVELADADTGARVLLRFVENF  415


 Score = 39.7 bits (91),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 2/36 (6%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCII  670
            TRL  ++ G  GHAGTVPM +R+D +  +AE  CI+
Sbjct  222  TRLAASLTGFAGHAGTVPMPLRRDALAGAAE--CIV  255



>ref|WP_029587081.1| allantoate amidohydrolase [Bradyrhizobium sp. URHD0069]
Length=414

 Score =   111 bits (277),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 93/178 (52%), Gaps = 14/178 (8%)
 Frame = -1

Query  647  EYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAI  468
            E  ++ ++ C+T       G  V TVG I   P A+NVIPGQV FT+D+RA+ D  R   
Sbjct  244  ECIVAIEEFCRTDR-----GGSVGTVGYIHAMPGATNVIPGQVSFTIDLRAVSDAHRNLA  298

Query  467  IYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDV  288
            + +   ++  +  +R +   ++  H+   V C   L +Q+  A       ITGE     V
Sbjct  299  VADIVRKIEDIARRRKLLLQVDVTHENRTVPCAPWLKAQVSEA-------ITGEGYR--V  349

Query  287  PVLMSGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
              L SGAGHD MAM  +  V M+FVRCRGGISH P+EHV   D  A    +L  +E  
Sbjct  350  FELPSGAGHDGMAMIDIADVAMVFVRCRGGISHHPDEHVDVADADAGARVLLRLIENF  407


 Score = 39.7 bits (91),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 2/36 (6%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCII  670
            TRL  ++ G  GHAGTVPM +R+D +  +AE  CI+
Sbjct  214  TRLAASLTGMAGHAGTVPMLLRRDALAGAAE--CIV  247



>ref|WP_038098309.1| allantoate amidohydrolase [Thioalkalivibrio sp. HK1]
Length=423

 Score =   107 bits (268),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 84/158 (53%), Gaps = 9/158 (6%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
            S V TVG + T P A NVIPG V+F++D+RA  D  R A + E      ++ ++R +   
Sbjct  269  SSVGTVGILHTLPGAVNVIPGTVEFSLDVRAESDASRHAALSEIDKAFGEIAERRGVSIT  328

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKV  228
                H+ +A  C   L  +L  A          +     V  L SGAGHDAMA++RLT V
Sbjct  329  KTMTHEGDACQCAPWLMHRLAQAV---------QAEGISVRELPSGAGHDAMAVARLTDV  379

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            GMLFVRC  GISH P E + + D   A   +L FLE+ 
Sbjct  380  GMLFVRCLEGISHHPAESMSEADAQVASKVLLRFLESF  417


 Score = 43.1 bits (100),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            TR +V V G  GHAGTVPM +R+D +VASAE
Sbjct  225  TRFQVKVVGQAGHAGTVPMRLRRDALVASAE  255



>ref|WP_029073666.1| allantoate amidohydrolase [Kaistia adipata]
Length=424

 Score =   106 bits (264),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 93/172 (54%), Gaps = 18/172 (10%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGRE---AIIYEFSNRMHQLCDKRNI  417
            SLV TVGEI   P ASNVIP +V+ ++D+RA  D  R    A I  F+ +   +   R +
Sbjct  268  SLVATVGEIEALPGASNVIPAEVRLSLDVRAATDEARRDAVATILSFARKTEAV---RQV  324

Query  416  FCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRL  237
                E   +     C   + + ++  A    +R+ G+        L+SGAGHD ++M+ L
Sbjct  325  ALTFETVLEKPVATCGPRMMAAIQEGA----SRVMGKPAQQ----LLSGAGHDGLSMAHL  376

Query  236  TKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETLL*VLAQSKYPR  81
             + GM+FVRCRGGISH+P E V  DD+   G A+   +E +L  LA+ +  R
Sbjct  377  AEYGMMFVRCRGGISHNPAEFVTVDDM---GAAVEGLVEAIL-ALARQEAAR  424


 Score = 44.3 bits (103),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 30/38 (79%), Gaps = 2/38 (5%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCIIG  667
            Q+R ++ ++G  GHAGTVPM MR+D +VA++EL  I+G
Sbjct  221  QSRHRIRIKGEAGHAGTVPMPMRRDALVAASEL--IVG  256



>ref|WP_038934664.1| allantoate amidohydrolase [Bradyrhizobium japonicum]
Length=424

 Score =   110 bits (276),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 86/160 (54%), Gaps = 9/160 (6%)
 Frame = -1

Query  593  AGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIF  414
            AG LV TVG I   P A+NVIPG+V FT+D+RA  D  R+  + +   ++  +  +RN+ 
Sbjct  264  AGGLVGTVGYIQARPGATNVIPGEVSFTIDMRAPTDMHRKRAVADVVRQIEAIAKRRNLA  323

Query  413  CVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLT  234
              ++  H+     C   L  Q+  A       I  E     V  L SGAGHD MAM  + 
Sbjct  324  LQLDVTHENRTAPCAPWLKDQIAQA-------IAAEGAS--VFELPSGAGHDGMAMIDIA  374

Query  233  KVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
             VGM+FVRCRGGISH P+EHV   DV A    +L  +E  
Sbjct  375  DVGMIFVRCRGGISHHPDEHVELADVDAGARVLLRAIENF  414


 Score = 39.7 bits (91),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCI  673
            TRL   + G  GHAGTVPMA+R+D +  +AE  CI
Sbjct  221  TRLAARLTGMAGHAGTVPMALRRDALAGAAE--CI  253



>ref|WP_008993392.1| allantoate amidohydrolase [Novosphingobium sp. Rr 2-17]
 gb|EIZ81034.1| allantoate amidohydrolase [Novosphingobium sp. Rr 2-17]
Length=415

 Score =   113 bits (282),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 84/156 (54%), Gaps = 9/156 (6%)
 Frame = -1

Query  581  VCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVIE  402
            V TVG I   P A+NVIPG+V FT+D+R+  +  R A+      R+ ++ D R++   +E
Sbjct  263  VATVGVIEASPGAANVIPGEVHFTIDVRSATEARRNAVAEAILERIAEIADARDLDFAVE  322

Query  401  RKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVGM  222
            R HD  A  CD  L   +  A   A            V  L+SGAGHDAM M+ L    M
Sbjct  323  RIHDLAASPCDPALMDLMDEALIAA---------GQPVRRLVSGAGHDAMNMAALCPTAM  373

Query  221  LFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            LF+RC GGISH+P EHV   DV  A   +L FL  L
Sbjct  374  LFIRCAGGISHNPAEHVDPADVEIALNVMLGFLHRL  409


 Score = 37.4 bits (85),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q R  VTV+G  GHAGT  M +R+DP+  +A +
Sbjct  215  QLRYAVTVKGMAGHAGTTAMRLRRDPLAGAAAM  247



>ref|WP_014998038.1| allantoate amidohydrolase [Alteromonas macleodii]
 gb|AFT78034.1| allantoate amidohydrolase [Alteromonas macleodii str. 'Black 
Sea 11']
Length=414

 Score =   106 bits (265),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 88/152 (58%), Gaps = 12/152 (8%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            +V TVG+I   P+  NVI G+ +F++DIR+ DD  R++++ E   +   +   R I    
Sbjct  264  VVATVGKIENAPNGVNVISGRTRFSLDIRSEDDELRDSVLAEILQKFDAIAHARQITLTR  323

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVP-VLMSGAGHDAMAMSRLTKV  228
            E+ H A AV CD    SQLK A       + G       P VL SGAGHDAMA++ +  V
Sbjct  324  EQTHSAPAVHCD----SQLKEAL------VRGVKESGIKPRVLASGAGHDAMAIADICPV  373

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAIL  132
             MLF RC+GGISH P E +  DDV AA +++L
Sbjct  374  AMLFTRCKGGISHHPAESITIDDV-AASLSVL  404


 Score = 43.9 bits (102),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            R   +V G  GHAGTVPM+MR+D + ASAE+
Sbjct  220  RFNFSVEGMAGHAGTVPMSMRRDALCASAEM  250



>ref|WP_024016109.1| allantoate amidohydrolase [Alteromonas macleodii]
 gb|AGP81500.1| allantoate amidohydrolase [Alteromonas macleodii str. 'Aegean 
Sea MED64']
Length=411

 Score =   105 bits (261),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 87/152 (57%), Gaps = 12/152 (8%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            +V TVG+I   P+  NVI G+ +F++DIR+ D+  R++++ E   +   +   R I    
Sbjct  261  VVATVGKIENAPNGVNVISGRTRFSLDIRSEDNDLRDSVLAEILQKFDDIAKARQITLSR  320

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVP-VLMSGAGHDAMAMSRLTKV  228
            E+ H A AV CD  L   L          I G    + +P VL SGAGHDAMA++ +  V
Sbjct  321  EQTHSAPAVHCDPHLKQAL----------IRGVEESEILPRVLASGAGHDAMAIADICPV  370

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAIL  132
             MLF RC+GGISH P E +  DDV AA +++L
Sbjct  371  AMLFTRCKGGISHHPAESITLDDV-AASLSVL  401


 Score = 45.1 bits (105),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            R   TV G  GHAGTVPM+MR+D + ASAE+
Sbjct  217  RFNFTVEGMAGHAGTVPMSMRKDALCASAEM  247



>ref|WP_014978988.1| allantoate amidohydrolase [Alteromonas macleodii]
 gb|AFT95029.1| allantoate amidohydrolase [Alteromonas macleodii str. 'Balearic 
Sea AD45']
Length=414

 Score =   106 bits (264),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 88/152 (58%), Gaps = 12/152 (8%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            +V TVG+I   P+  NVI G+ +F++DIR+ DD  R++++ E   +   +   R I    
Sbjct  264  VVATVGKIENAPNGVNVISGRTRFSLDIRSEDDELRDSVLAEILQKFDAIAHARQITLTQ  323

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVP-VLMSGAGHDAMAMSRLTKV  228
            E+ H A AV CD    SQLK A       + G       P VL SGAGHDAMA++ +  V
Sbjct  324  EQTHSAPAVHCD----SQLKEAL------VRGVEESGIKPRVLASGAGHDAMAIADICPV  373

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAIL  132
             MLF RC+GGISH P E +  DDV AA +++L
Sbjct  374  AMLFTRCKGGISHHPAESITIDDV-AASLSVL  404


 Score = 43.9 bits (102),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            R   +V G  GHAGTVPM+MR+D + ASAE+
Sbjct  220  RFNFSVEGMAGHAGTVPMSMRRDALCASAEM  250



>ref|WP_012518076.1| allantoate amidohydrolase [Alteromonas macleodii]
 gb|AEA97743.1| allantoate amidohydrolase [Alteromonas macleodii str. 'Deep ecotype']
Length=411

 Score =   105 bits (261),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 87/152 (57%), Gaps = 12/152 (8%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            +V TVG+I   P+  NVI G+ +F++DIR+ D+  R++++ E   +   +   R I    
Sbjct  261  VVATVGKIENAPNGVNVISGRTRFSLDIRSEDNDLRDSVLAEILQKFDDIAKARQITLSR  320

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVP-VLMSGAGHDAMAMSRLTKV  228
            E+ H A AV CD  L   L          I G    + +P VL SGAGHDAMA++ +  V
Sbjct  321  EQTHSAPAVHCDPHLKQAL----------IRGVEESEILPRVLASGAGHDAMAIADICPV  370

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAIL  132
             MLF RC+GGISH P E +  DDV AA +++L
Sbjct  371  AMLFTRCKGGISHHPAESITLDDV-AASLSVL  401


 Score = 45.1 bits (105),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            R   TV G  GHAGTVPM+MR+D + ASAE+
Sbjct  217  RFNFTVEGMAGHAGTVPMSMRKDALCASAEM  247



>ref|WP_014976208.1| allantoate amidohydrolase [Alteromonas macleodii]
 gb|AFT74153.1| allantoate amidohydrolase [Alteromonas macleodii str. 'English 
Channel 673']
Length=414

 Score =   106 bits (264),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 87/151 (58%), Gaps = 10/151 (7%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            +V TVG+I   P+  NVI G+ +F++DIR+ DD  R++++ E   +   +   R I    
Sbjct  264  VVATVGKIENAPNGVNVISGRTRFSLDIRSEDDELRDSVLAEILQKFDAIAHARQITLTR  323

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            E+ H A AV CD    SQLK A          E +     VL SGAGHDAMA++ +  V 
Sbjct  324  EQTHSAPAVHCD----SQLKEALVRGV-----EESGIKPRVLASGAGHDAMAIADICPVA  374

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAIL  132
            MLF RC+GGISH P E +  DDV AA +++L
Sbjct  375  MLFTRCKGGISHHPAESITIDDV-AASLSVL  404


 Score = 43.9 bits (102),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            R   +V G  GHAGTVPM+MR+D + ASAE+
Sbjct  220  RFNFSVEGMAGHAGTVPMSMRRDALCASAEM  250



>ref|WP_024580744.1| MULTISPECIES: allantoate amidohydrolase [Bradyrhizobium]
 gb|KIU46337.1| allantoate amidohydrolase [Bradyrhizobium elkanii]
Length=420

 Score =   110 bits (275),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 87/162 (54%), Gaps = 17/162 (10%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             LV TVG I   P A+NVIPG+V FT+DIR+  D  R+  + +   ++  +  +R +   
Sbjct  267  GLVGTVGYIDAMPGATNVIPGKVSFTMDIRSQSDMHRKRAVADIVRQVEAIARRRELGLQ  326

Query  407  IERKHDANAVVCDRELSSQLKSA----AHTAFTRITGETTDDDVPVLMSGAGHDAMAMSR  240
            I+  H+  +V C   L +QL +A     H  F              L SGAGHD MAM  
Sbjct  327  IDVTHENRSVPCAPWLKTQLAAAVAAEGHAVFE-------------LPSGAGHDGMAMVD  373

Query  239  LTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            +  +GM+FVRCRGG+SH+P EHV  +D     + +L F+E  
Sbjct  374  VADIGMIFVRCRGGVSHNPAEHVALEDANTGALVLLRFVENF  415


 Score = 39.7 bits (91),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (67%), Gaps = 2/36 (6%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCII  670
            TRL   + G  GHAGTVPM +R+D +  +AE  CI+
Sbjct  222  TRLAANLTGVAGHAGTVPMPLRRDALAGAAE--CIV  255



>ref|WP_039227177.1| allantoate amidohydrolase [Alteromonas macleodii]
 gb|KHT53059.1| allantoate amidohydrolase [Alteromonas macleodii]
Length=414

 Score =   106 bits (264),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 87/151 (58%), Gaps = 10/151 (7%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            +V TVG+I   P+  NVI G+ +F++DIR+ DD  R++++ E   +   +   R I    
Sbjct  264  VVATVGKIENAPNGVNVISGRTRFSLDIRSEDDELRDSVLAEILQKFDAIAHARQITLTR  323

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            E+ H A AV CD    SQLK A          E +     VL SGAGHDAMA++ +  V 
Sbjct  324  EQTHSAPAVHCD----SQLKEALVRGV-----EESGIKPRVLASGAGHDAMAIADICPVA  374

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAIL  132
            MLF RC+GGISH P E +  DDV AA +++L
Sbjct  375  MLFTRCKGGISHHPAESITIDDV-AASLSVL  404


 Score = 43.9 bits (102),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            R   +V G  GHAGTVPM+MR+D + ASAE+
Sbjct  220  RFNFSVEGMAGHAGTVPMSMRRDALCASAEM  250



>ref|XP_006413903.1| hypothetical protein EUTSA_v10024702mg [Eutrema salsugineum]
 gb|ESQ55356.1| hypothetical protein EUTSA_v10024702mg [Eutrema salsugineum]
Length=536

 Score = 75.5 bits (184),  Expect(3) = 2e-27, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = -1

Query  659  CKQPEYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQ  522
            CK P+ YLS D +C   T++SLA SLVCTVGEISTWPSASNVIPGQ
Sbjct  457  CKNPKDYLSCDGQCNEDTIESLANSLVCTVGEISTWPSASNVIPGQ  502


 Score = 60.8 bits (146),  Expect(3) = 2e-27, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTRLKVTV+G+QGHAGTVPM++RQDPM  +AEL
Sbjct  417  QTRLKVTVKGSQGHAGTVPMSLRQDPMTGAAEL  449


 Score = 33.9 bits (76),  Expect(3) = 2e-27, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 19/35 (54%), Gaps = 0/35 (0%)
 Frame = -2

Query  484  QDEKLSSMNFRTACISYATSATFFVSLNASTMQMQ  380
            QD +L SM ++  C  Y T   F   L  STMQMQ
Sbjct  502  QDARLFSMIYQLGCTRYVTKDRFCAPLRESTMQMQ  536



>ref|WP_035690370.1| allantoate amidohydrolase [Bradyrhizobium elkanii]
Length=422

 Score =   109 bits (273),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 85/159 (53%), Gaps = 9/159 (6%)
 Frame = -1

Query  590  GSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFC  411
            G LV TVG I   P A+NVIPG+V FT+DIRA  D  R+  + +   ++  +  +R +  
Sbjct  269  GGLVGTVGYIDALPGATNVIPGKVSFTIDIRAPTDMHRKRAVADIVRQIEAIAKRRGLAL  328

Query  410  VIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTK  231
             ++  H+   V C   L +Q+  A       + GE     V  L SGAGHD MAM  +  
Sbjct  329  QLDVTHENRTVPCAPWLKAQVAEA-------VAGEGYA--VFELPSGAGHDGMAMIDVAD  379

Query  230  VGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            V MLFVRCRGGISH P+EHV   D  A    +L  +E  
Sbjct  380  VAMLFVRCRGGISHHPDEHVELADADAGARVLLRLIENF  418


 Score = 40.4 bits (93),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCI  673
            TRL   + G  GHAGTVPMA+R+D +  +AE  CI
Sbjct  225  TRLAAKITGMAGHAGTVPMALRRDALAGAAE--CI  257



>ref|WP_014949087.1| allantoate amidohydrolase [Alteromonas macleodii]
 gb|AFS36982.1| allantoate amidohydrolase [Alteromonas macleodii ATCC 27126]
 gb|KHT61280.1| allantoate amidohydrolase [Alteromonas macleodii]
Length=414

 Score =   106 bits (264),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 87/151 (58%), Gaps = 10/151 (7%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            +V TVG+I   P+  NVI G+ +F++DIR+ DD  R++++ E   +   +   R I    
Sbjct  264  VVATVGKIENAPNGVNVISGRTRFSLDIRSEDDELRDSVLAEILQKFDAIAHARQITLTR  323

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            E+ H A AV CD    SQLK A          E +     VL SGAGHDAMA++ +  V 
Sbjct  324  EQTHSAPAVHCD----SQLKEALVRGV-----EESGIKPRVLASGAGHDAMAIADICPVA  374

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAIL  132
            MLF RC+GGISH P E +  DDV AA +++L
Sbjct  375  MLFTRCKGGISHHPAESITIDDV-AASLSVL  404


 Score = 43.9 bits (102),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            R   +V G  GHAGTVPM+MR+D + ASAE+
Sbjct  220  RFNFSVEGMAGHAGTVPMSMRRDALCASAEM  250



>ref|WP_041959304.1| allantoate amidohydrolase [Bradyrhizobium japonicum]
 gb|KGT75245.1| allantoate amidohydrolase [Bradyrhizobium japonicum]
Length=424

 Score =   110 bits (274),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 85/160 (53%), Gaps = 9/160 (6%)
 Frame = -1

Query  593  AGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIF  414
            AG LV TVG I   P A+NVIPG+V FT+D+RA  D  R+  + +   ++  +  +RN+ 
Sbjct  264  AGGLVGTVGYIQARPGATNVIPGEVSFTIDMRAPTDMHRKRAVADVVRQIEAIAKRRNLA  323

Query  413  CVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLT  234
              ++  H+     C   L  Q+  A       I  E     V  L SGAGHD MAM  + 
Sbjct  324  LQLDVTHENRTAPCAPWLKDQIAQA-------IAAEGAS--VFELPSGAGHDGMAMIDIA  374

Query  233  KVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
             VGM+FVRCRGGISH P+EHV   D  A    +L  +E  
Sbjct  375  DVGMIFVRCRGGISHHPDEHVELADADAGARVLLRVIENF  414


 Score = 39.7 bits (91),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCIIG  667
            TRL   + G  GHAGTVPMA+R+D +  +AE  CI G
Sbjct  221  TRLAARLTGMAGHAGTVPMALRRDALAGAAE--CIGG  255



>ref|WP_028334435.1| allantoate amidohydrolase [Bradyrhizobium elkanii]
Length=423

 Score =   110 bits (276),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 88/162 (54%), Gaps = 17/162 (10%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             LV TVG ++  P A+NVIPG+V FT+DIR+ +D  R+  + +   ++  +  +R++   
Sbjct  267  GLVGTVGYVNAMPGATNVIPGKVSFTMDIRSQNDMHRKRAVADIVRQIEAIAKRRDLALQ  326

Query  407  IERKHDANAVVCDRELSSQLKSA----AHTAFTRITGETTDDDVPVLMSGAGHDAMAMSR  240
            I+  H+  +V C   L SQ+  A     + AF              L SGAGHD MAM  
Sbjct  327  IDVTHENRSVPCAPWLKSQIAEAVAAEGYAAFE-------------LPSGAGHDGMAMVD  373

Query  239  LTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            +  +GM+FVRCRGGISH+P EHV   D       +L F+E  
Sbjct  374  VADIGMIFVRCRGGISHNPAEHVELADADTGARVLLRFVENF  415


 Score = 38.9 bits (89),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (67%), Gaps = 2/36 (6%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCII  670
            TRL   + G  GHAGTVPM +R+D +  +AE  CI+
Sbjct  222  TRLAARLTGVAGHAGTVPMKLRRDALAGAAE--CIV  255



>ref|WP_037446856.1| hypothetical protein [Skermanella stibiiresistens]
 gb|EWY41940.1| peptidase M20 [Skermanella stibiiresistens SB22]
Length=589

 Score =   110 bits (274),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 80/142 (56%), Gaps = 9/142 (6%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG+I   P A NVIPG  +FT+DIR+ DD  R   +   +     + ++R +   I
Sbjct  436  LVATVGKIEAMPGAINVIPGGTRFTIDIRSPDDAMRMTALDAMATGFQTIAERRGLTVAI  495

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            E+ H+A A  C   L +Q+ ++          E       +L SGAGHDAMA++ L  VG
Sbjct  496  EKGHEAPATACHPALIAQISASV---------ERFGVTPRLLPSGAGHDAMAVASLCPVG  546

Query  224  MLFVRCRGGISHSPEEHVLDDD  159
            MLF RCRGG+SH+P E +  +D
Sbjct  547  MLFTRCRGGVSHNPAESITVED  568


 Score = 40.0 bits (92),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            +R  VTV G  GHAGTVPM +R D +  +AE+
Sbjct  391  SRFTVTVTGMAGHAGTVPMNLRHDALAGTAEM  422



>ref|WP_014250122.1| allantoate amidohydrolase [Azospirillum lipoferum]
 emb|CBS91300.1| N-carbamoyl-L-amino acid hydrolase (L-carbamoylase) [Azospirillum 
lipoferum 4B]
Length=420

 Score =   103 bits (258),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 83/157 (53%), Gaps = 9/157 (6%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG I   P A+NVIPG+V+FT+D+RA  D  R   +     R+  + D R +    
Sbjct  266  LVGTVGRIEASPGATNVIPGKVRFTIDLRADRDPLRLERVGAVRARLESIADARGVAIGF  325

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            E  H++ AV C   L +Q  +AA              D P L SGAGHDAMA++ LT + 
Sbjct  326  ETLHESPAVACHPALMAQFAAAATAEGL---------DAPELPSGAGHDAMAVAALTDIA  376

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            MLFVRC  GISH+P E +   D  A    +  F+E  
Sbjct  377  MLFVRCERGISHNPAERITAADAEAGARVLARFVENF  413


 Score = 45.8 bits (107),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            TRL VTV G  GHAGTVPM +R+D + ASAE+
Sbjct  221  TRLAVTVEGMAGHAGTVPMTLRRDALAASAEM  252



>ref|WP_041535635.1| hypothetical protein, partial [Parvularcula bermudensis]
Length=412

 Score =   107 bits (267),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 81/145 (56%), Gaps = 9/145 (6%)
 Frame = -1

Query  581  VCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVIE  402
            V TVG +   P ASNVIPG  + T+DIRA     R+ +    +  + ++ D+R +    E
Sbjct  276  VATVGRLEIRPGASNVIPGAAELTIDIRAETTELRDDLTARIAAAIERIADRRQVSASHE  335

Query  401  RKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVGM  222
               D     CD +L+ +L +A       +TG+        L SGAGHDAM M+R   + M
Sbjct  336  TVQDLPGTACDPDLTERLSAA----IVSVTGQDLQ-----LSSGAGHDAMVMARACPIAM  386

Query  221  LFVRCRGGISHSPEEHVLDDDVWAA  147
            +FVRCRGGISH P+E+V + DV AA
Sbjct  387  MFVRCRGGISHHPDEYVEEADVAAA  411


 Score = 42.0 bits (97),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q RL+V V G  GHAGTVPM++R D + A+AE+
Sbjct  224  QRRLRVHVGGKAGHAGTVPMSLRTDALTAAAEI  256



>ref|WP_019084783.1| allantoate amidohydrolase [Komagataeibacter europaeus]
Length=423

 Score =   110 bits (274),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 85/155 (55%), Gaps = 8/155 (5%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             LV TVG +   P A+NV+PG V FT+D+RA  +  R+    E  +    +  +R +   
Sbjct  269  GLVATVGSLDVMPGAANVVPGDVVFTIDVRAGTNATRDRAAREILDMARDVAARRGLEMD  328

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKV  228
            +  + D +A  CD  L+  ++ A          + T    PVL+SGAGHDAM M+ L  V
Sbjct  329  VALQQDLDATPCDPVLTDLMEQAVR--------DVTHAPAPVLVSGAGHDAMIMAHLAPV  380

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFL  123
             MLF+RC GGISH+P E V D D  AA  A++ F+
Sbjct  381  SMLFIRCAGGISHNPAESVTDADTDAALRAMITFI  415


 Score = 39.7 bits (91),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q R +VT+RG  GHAGTV M +R+D +  +AE+
Sbjct  223  QHRYRVTLRGMAGHAGTVAMKLRRDALAGAAEI  255



>ref|WP_026019539.1| allantoate amidohydrolase [Komagataeibacter europaeus]
Length=423

 Score =   110 bits (274),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 85/155 (55%), Gaps = 8/155 (5%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             LV TVG +   P A+NV+PG V FT+D+RA  +  R+    E  +    +  +R +   
Sbjct  269  GLVATVGSLDVMPGAANVVPGDVVFTIDVRAGTNATRDRAAREILDMARDVAARRGLEMD  328

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKV  228
            +  + D +A  CD  L+  ++ A          + T    PVL+SGAGHDAM M+ L  V
Sbjct  329  VALQQDLDATPCDPVLTDLMEQAVR--------DVTHAPAPVLVSGAGHDAMIMAHLAPV  380

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFL  123
             MLF+RC GGISH+P E V D D  AA  A++ F+
Sbjct  381  SMLFIRCAGGISHNPAESVTDADTDAALRAMITFI  415


 Score = 39.7 bits (91),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q R +VT+RG  GHAGTV M +R+D +  +AE+
Sbjct  223  QHRYRVTLRGMAGHAGTVAMKLRRDALAGAAEI  255



>ref|WP_025254850.1| allantoate amidohydrolase [Alteromonas sp. ALT199]
 gb|EXF48473.1| amidase, hydantoinase/carbamoylase family [Alteromonas sp. ALT199]
Length=414

 Score =   107 bits (267),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 89/153 (58%), Gaps = 14/153 (9%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            +V TVG+I   P+  NVI G+ +F++DIR+ DD  R++++ E   +   +   R I    
Sbjct  264  VVATVGKIENAPNGVNVISGRTRFSLDIRSEDDDLRDSVLAEILQKFDDIARARQITLTQ  323

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVP--VLMSGAGHDAMAMSRLTK  231
            E+ H A AV CD +L   L          I G T +  +P  +L SGAGHDAMA++ +  
Sbjct  324  EQTHSAPAVHCDNQLKEAL----------IRG-TKESGIPPRILASGAGHDAMAIADICP  372

Query  230  VGMLFVRCRGGISHSPEEHVLDDDVWAAGMAIL  132
            V MLF RC+GGISH P E +  +DV AA +++L
Sbjct  373  VAMLFTRCKGGISHHPAESITGEDV-AASLSVL  404


 Score = 42.0 bits (97),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            R   T  G  GHAGTVPM+MR D + ASAE+
Sbjct  220  RFNFTAEGMAGHAGTVPMSMRLDALCASAEM  250



>ref|WP_007416480.1| amidase [Pedosphaera parvula]
 gb|EEF59481.1| amidase, hydantoinase/carbamoylase family [bacterium Ellin514]
Length=420

 Score =   109 bits (273),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 86/158 (54%), Gaps = 9/158 (6%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             LV TVG+I   P ASNVIPG V  ++DIR   D  R++      +   Q+  KR +   
Sbjct  259  GLVATVGQIDARPGASNVIPGTVILSIDIRHQVDATRDSATARLQDLAGQIGYKRGVTMD  318

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKV  228
             E  H+  +V C R+L++ L  AA      +T      ++P   SGAGHDA  M  +T V
Sbjct  319  WELVHEVQSVPCSRDLTAALGKAARQHLVEVT------ELP---SGAGHDAAVMGEITPV  369

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
             MLFVRC+GGISH+P E V  DDV  A   +  F+ +L
Sbjct  370  AMLFVRCKGGISHNPAESVEVDDVRVAIAVMNDFILSL  407


 Score = 40.0 bits (92),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTR+ V   G  GHAGT PM +R+D + A+AE 
Sbjct  214  QTRVNVQFTGLAGHAGTTPMNLRKDALAAAAEF  246



>ref|WP_035773888.1| allantoate amidohydrolase [Asaia astilbis]
Length=416

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 93/155 (60%), Gaps = 8/155 (5%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG +S    A N++PG+V  T+DIRA+    RE +  +  + +  LC +R+I   I
Sbjct  264  LVTTVGWVSVENGAPNIVPGRVVLTIDIRAVTPGVREDVAQQIGDTLQTLCIRRHIGLEI  323

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            ER  D    +CD+ L++ LK A   +    +G T     P+L+S AGHDAM M+ L  + 
Sbjct  324  ERIQDLKGALCDKRLNTLLKQAIEQS----SGTTP----PLLLSQAGHDAMIMAHLAPMT  375

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
            MLF+RC+ GISH+P E V D DV AA  A++ F+E
Sbjct  376  MLFIRCKDGISHNPAESVDDADVEAAHQAMVTFVE  410



>ref|WP_019241899.1| hypothetical protein [Bacillus massilioanorexius]
Length=414

 Score =   106 bits (265),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 86/147 (59%), Gaps = 11/147 (7%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG++   P ASNVIP  VK T+DIR +D T +E+ I+E      ++C  R +    
Sbjct  263  LVATVGKLLVHPGASNVIPSLVKGTLDIRDIDKTRKESAIHEILIESKKICKSRGLQITF  322

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPV-LMSGAGHDAMAMSRLTKV  228
            E+  +A+ VVC    S +  S    A  +  G       P+ L SGAGHDAMAM+ +T+V
Sbjct  323  EKVMEADPVVC----SDRFNSIIEAAIIQSGGN------PIKLFSGAGHDAMAMADITEV  372

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAA  147
             M+FVRC+ G+SH P+E V  +DV A 
Sbjct  373  AMIFVRCKDGLSHHPDECVTVEDVEAG  399


 Score = 42.7 bits (99),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            TR    + G  GHAGTVP+ +RQD +V +AEL
Sbjct  218  TRFSFEIEGKAGHAGTVPIELRQDALVGAAEL  249



>ref|WP_024953308.1| hypothetical protein [Cobetia crustatorum]
Length=433

 Score =   110 bits (274),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 88/158 (56%), Gaps = 9/158 (6%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
            SLV TVG     P A NVIPG+   ++DIRA+DD  R+  + E  +   ++  +R I   
Sbjct  276  SLVATVGCCELRPGAVNVIPGRAALSLDIRALDDAQRDQALDELLSTAQRIAQRRGISVS  335

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKV  228
             ++ H A+AV CD    +QL  A  T        +T      L SGAGHDAMA+S L  V
Sbjct  336  HQQTHAADAVACD----AQLMQAIDTGIA-----STGQPAFRLPSGAGHDAMAISHLCPV  386

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            GMLFVRC  GISH P E V + DV  A  A++A +E L
Sbjct  387  GMLFVRCEHGISHHPLESVTEADVARALSALIASIEAL  424


 Score = 39.3 bits (90),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 17/30 (57%), Positives = 20/30 (67%), Gaps = 0/30 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            R  V   G  GHAGT PMA+RQD + A+AE
Sbjct  223  RFTVNFVGQAGHAGTTPMALRQDALCAAAE  252



>dbj|GAN97207.1| amidohydrolase/allantoate amidohydrolase [Komagataeibacter europaeus 
NBRC 3261]
Length=416

 Score =   109 bits (273),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 85/155 (55%), Gaps = 8/155 (5%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             LV TVG +   P A+NV+PG V FT+D+RA  +  R+    E  +    +  +R +   
Sbjct  262  GLVATVGSLDVMPGAANVVPGDVVFTIDVRAGTNATRDRAAREILDMARDVAARRGLEMD  321

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKV  228
            +  + D +A  CD  L+  ++ A          + T    PVL+SGAGHDAM M+ L  V
Sbjct  322  VALQQDLDATPCDPVLTDLMEQAVR--------DVTHAPAPVLVSGAGHDAMIMAHLAPV  373

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFL  123
             MLF+RC GGISH+P E V D D  AA  A++ F+
Sbjct  374  SMLFIRCAGGISHNPAESVTDADTDAALRAMITFI  408


 Score = 39.7 bits (91),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q R +VT+RG  GHAGTV M +R+D +  +AE+
Sbjct  216  QHRYRVTLRGMAGHAGTVAMKLRRDALAGAAEI  248



>ref|WP_027705824.1| hypothetical protein [Zymobacter palmae]
Length=419

 Score =   111 bits (278),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 92/157 (59%), Gaps = 9/157 (6%)
 Frame = -1

Query  581  VCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVIE  402
            V TVG++ T   A NV+PG V+F+VDIRA DD  R+    E +     +   R +     
Sbjct  258  VATVGKLDTVAGAVNVVPGLVRFSVDIRAQDDALRDQAWAEITAAFESIGAARRVAFSNR  317

Query  401  RKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPV-LMSGAGHDAMAMSRLTKVG  225
              H A AV C    + +L+SA       +TGE      P+ L+SGAGHDAMAM+ LT VG
Sbjct  318  ETHCAAAVGC----APELQSAIARGIRSVTGEKE----PLRLVSGAGHDAMAMANLTDVG  369

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            MLF+RC GGISH P+E VL++DV  A  A++A +  L
Sbjct  370  MLFLRCAGGISHHPDESVLEEDVALAIDAMVATVSAL  406


 Score = 37.7 bits (86),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 19/30 (63%), Gaps = 0/30 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAE  685
            R  V   G  GHAGT PM MRQD + A++E
Sbjct  214  RFDVECAGHAGHAGTTPMTMRQDALCAASE  243



>ref|WP_028156669.1| allantoate amidohydrolase [Bradyrhizobium japonicum]
Length=422

 Score =   109 bits (273),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 86/160 (54%), Gaps = 9/160 (6%)
 Frame = -1

Query  593  AGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIF  414
            AG LV TVG I   P A+NVIPG+V FT+D+RA  D  R+  + +   ++  +  +R++ 
Sbjct  262  AGGLVGTVGYIQARPGATNVIPGEVSFTIDMRAPTDMQRKRAVADVVRQIEAIAKRRHLA  321

Query  413  CVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLT  234
              ++  H+     C   L  Q+  A       I  E T   V  L SGAGHD MAM  + 
Sbjct  322  LQLDVTHENRTAPCAPWLKDQIAQA-------IAAEGTS--VFELPSGAGHDGMAMIDIA  372

Query  233  KVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
             VGM+FVRCRGGISH P+EHV   D  A    +L  +E  
Sbjct  373  DVGMIFVRCRGGISHHPDEHVELADADAGARVLLRVIENF  412


 Score = 39.7 bits (91),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCI  673
            TRL   + G  GHAGTVPMA+R+D +  +AE  CI
Sbjct  219  TRLAARLTGMAGHAGTVPMALRRDALAGAAE--CI  251



>gb|AGP77713.1| allantoate amidohydrolase [Alteromonas macleodii str. 'English 
Channel 615']
Length=411

 Score =   104 bits (259),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 86/152 (57%), Gaps = 12/152 (8%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            +V TVG+I   P+  NVI G+ +F++DIR+ D+  R++++ E   +   +   R I    
Sbjct  261  VVATVGKIENAPNGVNVISGRTRFSLDIRSEDNGLRDSVLAEILQKFDDIAKARQITLSR  320

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVP-VLMSGAGHDAMAMSRLTKV  228
            E+ H A AV CD  L   L          I G      +P VL SGAGHDAMA++ +  V
Sbjct  321  EQTHSAPAVHCDPHLKQAL----------IRGVEESGILPRVLASGAGHDAMAIADICPV  370

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAIL  132
             MLF RC+GGISH P E +  DDV AA +++L
Sbjct  371  AMLFTRCKGGISHHPAESITLDDV-AASLSVL  401


 Score = 45.1 bits (105),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            R   TV G  GHAGTVPM+MR+D + ASAE+
Sbjct  217  RFNFTVEGMAGHAGTVPMSMRKDALCASAEM  247



>ref|WP_015066873.1| allantoate amidohydrolase [Alteromonas macleodii]
 gb|AFV85131.1| allantoate amidohydrolase [Alteromonas macleodii AltDE1]
 gb|AGP85269.1| allantoate amidohydrolase [Alteromonas macleodii str. 'Ionian 
Sea U4']
 gb|AGP89395.1| allantoate amidohydrolase [Alteromonas macleodii str. 'Ionian 
Sea U7']
 gb|AGP93267.1| allantoate amidohydrolase [Alteromonas macleodii str. 'Ionian 
Sea U8']
 gb|AGP97142.1| allantoate amidohydrolase [Alteromonas macleodii str. 'Ionian 
Sea UM7']
 gb|AGQ01486.1| allantoate amidohydrolase [Alteromonas macleodii str. 'Ionian 
Sea UM4b']
Length=411

 Score =   103 bits (258),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 86/152 (57%), Gaps = 12/152 (8%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            +V TVG+I   P+  NVI G+ +F++DIR+ D+  R++++ E   +   +   R I    
Sbjct  261  VVATVGKIENAPNGVNVISGRTRFSLDIRSEDNDLRDSVLAEILQKFDDIAKARQITLSR  320

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVP-VLMSGAGHDAMAMSRLTKV  228
            E+ H A AV CD  L   L          I G      +P VL SGAGHDAMA++ +  V
Sbjct  321  EQTHSAPAVHCDPHLKQAL----------IRGVEESGILPRVLASGAGHDAMAIADICPV  370

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAIL  132
             MLF RC+GGISH P E +  DDV AA +++L
Sbjct  371  AMLFTRCKGGISHHPAESITLDDV-AASLSVL  401


 Score = 45.1 bits (105),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            R   TV G  GHAGTVPM+MR+D + ASAE+
Sbjct  217  RFNFTVEGMAGHAGTVPMSMRKDALCASAEM  247



>ref|WP_038388099.1| allantoate amidohydrolase [Bradyrhizobium elkanii]
Length=423

 Score =   109 bits (273),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 90/167 (54%), Gaps = 17/167 (10%)
 Frame = -1

Query  602  KSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKR  423
            KS    LV TVG ++  P A+NVIPG+V FT+DIR+ +D  R+  + +   ++  +  +R
Sbjct  262  KSDEQGLVGTVGYVNAMPGATNVIPGKVSFTMDIRSQNDMHRKRAVADIVRQIEAIAKRR  321

Query  422  NIFCVIERKHDANAVVCDRELSSQLKSA----AHTAFTRITGETTDDDVPVLMSGAGHDA  255
            ++   I+  H+  +V C   L +Q+  A     + AF              L SGAGHD 
Sbjct  322  DLALQIDVTHENRSVPCALWLKTQIAEAVAAEGYAAFE-------------LPSGAGHDG  368

Query  254  MAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            MAM  +  +GM+FVRCRGGISH+P EHV   D       +L F+E  
Sbjct  369  MAMVDVADIGMIFVRCRGGISHNPAEHVELADADTGARVLLRFVENF  415


 Score = 39.3 bits (90),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCI  673
            TRL  ++ G  GHAGTVPM +R+D +  +AE  CI
Sbjct  222  TRLAASLTGVAGHAGTVPMPLRRDALAGAAE--CI  254



>ref|WP_045585323.1| allantoate amidohydrolase [Azospirillum thiophilum]
 gb|KJR62598.1| allantoate amidohydrolase [Azospirillum thiophilum]
Length=423

 Score =   110 bits (276),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 82/155 (53%), Gaps = 9/155 (6%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG I   P A+NVI G+V+FT+D+RA  D  R   +     R+  + D R +    
Sbjct  271  LVGTVGRIEASPGATNVIAGKVRFTIDLRADRDPLRLERVGAVRARLEAIADARGVAIAF  330

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            E  H++ AV C   L +Q  +AA              D P L SGAGHDAMA++ LT + 
Sbjct  331  ETLHESPAVACHPALMAQFSAAA---------SAEGLDAPELPSGAGHDAMAVAALTGIA  381

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
            MLFVRC  GISH+P E +   D  A    +  F+E
Sbjct  382  MLFVRCERGISHNPAERITAADAEAGARVLARFVE  416


 Score = 38.1 bits (87),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            TRL V+V G  GHAGTVPM +R+D + A+AE+
Sbjct  226  TRLAVSVEGMAGHAGTVPMTLRRDALAAAAEM  257



>ref|WP_023944582.1| deacylase [Gluconobacter frateurii]
 dbj|GAD10779.1| deacylase [Gluconobacter frateurii NBRC 103465]
Length=411

 Score =   110 bits (276),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 91/157 (58%), Gaps = 8/157 (5%)
 Frame = -1

Query  590  GSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFC  411
            G+ + TVG++   P+ SNVIPG V F++D+RA  D  R +++ E    + Q+ ++R +  
Sbjct  259  GNQMATVGQMDIAPNTSNVIPGDVWFSLDMRAASDDVRNSLVQEIHADIRQIAERRGLDV  318

Query  410  VIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTK  231
                  +  A  C  E+  Q  SA      ++TG+      P L+SGAGHD+M M+    
Sbjct  319  SFTAPQELAASACSPEIMGQFASA----IEKVTGQPA----PQLLSGAGHDSMVMTGFCP  370

Query  230  VGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
            +GMLF+R  GG+SH P+E VL +DV  A  A+LAF++
Sbjct  371  MGMLFIRSPGGLSHHPDETVLVEDVELAHRALLAFVK  407


 Score = 37.7 bits (86),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCIIGK  664
            QTR +V V+G   HAGT PM +R+D +  +AE+   + K
Sbjct  214  QTRQRVVVKGQADHAGTTPMLLRRDALAGAAEMILAVEK  252



>ref|WP_023978281.1| MULTISPECIES: allantoate amidohydrolase [Asaia]
 gb|ETC98985.1| allantoate amidohydrolase [Asaia sp. SF2.1]
Length=412

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 89/157 (57%), Gaps = 8/157 (5%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG ++    A N++PG+V  T+DIRA+    RE+   E S+ +  +C +R I   I
Sbjct  260  LVTTVGWLTVENGAPNIVPGKVALTIDIRAVTPGVRESAAQEVSDTLQAICTRRRIRLDI  319

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            ER  D    +CD  L+S L  A          E      P+L+S AGHDAM M+ L  + 
Sbjct  320  ERIQDLAGALCDERLTSLLGRAVE--------ERQGTTPPMLLSQAGHDAMIMANLAPMT  371

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            MLF+RC+GGISH+P E V D DV AA  A++ F+  L
Sbjct  372  MLFIRCKGGISHNPAESVDDADVEAAHQALVTFVTRL  408



>ref|WP_041090521.1| hydantoinase [Jeotgalibacillus soli Cunha et al. 2012]
 gb|KIL44605.1| hypothetical protein KP78_35690 [Jeotgalibacillus soli Cunha 
et al. 2012]
Length=415

 Score =   104 bits (260),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 79/135 (59%), Gaps = 9/135 (7%)
 Frame = -1

Query  581  VCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVIE  402
            V T+G+++ +P  +N+IP  V+FT+DIR ++   R  +I +   ++  +C  R +   IE
Sbjct  268  VGTIGKMAVFPGGNNIIPESVEFTLDIRDIELVRRNNVIQKIEEKIKHVCKSRGLEYEIE  327

Query  401  RKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVGM  222
            R  D   V C   L   L+ AA +              PV++SGAGHDAM ++++T +GM
Sbjct  328  RFVDEKPVKCSENLVDSLREAASSIGIA---------APVMVSGAGHDAMLLAKITDIGM  378

Query  221  LFVRCRGGISHSPEE  177
            +FVRCR GISH P+E
Sbjct  379  VFVRCRDGISHQPKE  393


 Score = 43.9 bits (102),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            + LKV ++G  GHAGTVPM +R+DP++ +AE+
Sbjct  220  SWLKVRLKGEAGHAGTVPMNLRRDPLIGTAEV  251



>ref|WP_010507608.1| allantoate amidohydrolase [Komagataeibacter europaeus]
Length=423

 Score =   108 bits (271),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 85/155 (55%), Gaps = 8/155 (5%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             LV TVG +   P A+NV+PG V FT+D+RA  +  R+    E  +    +  +R +   
Sbjct  269  GLVATVGSLDVMPGAANVVPGDVVFTIDVRAGTNATRDRAAREILDMARDVAARRGLEMD  328

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKV  228
            +  + D +A  CD  L+  ++ A          + T    PVL+SGAGHDAM M+ +  V
Sbjct  329  VALQQDLDATPCDPVLTDLMEQAVR--------DVTHAPAPVLVSGAGHDAMIMAHMAPV  380

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFL  123
             MLF+RC GGISH+P E V D D  AA  A++ F+
Sbjct  381  SMLFIRCAGGISHNPAESVTDADTDAALRAMITFI  415


 Score = 39.7 bits (91),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q R +VT+RG  GHAGTV M +R+D +  +AE+
Sbjct  223  QHRYRVTLRGMAGHAGTVAMKLRRDALAGAAEI  255



>ref|WP_011252850.1| allantoate amidohydrolase [Gluconobacter oxydans]
 gb|AAW61058.1| N-carbamyl-L-amino acid amidohydrolase [Gluconobacter oxydans 
621H]
Length=411

 Score =   105 bits (262),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 62/160 (39%), Positives = 87/160 (54%), Gaps = 8/160 (5%)
 Frame = -1

Query  599  SLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRN  420
            S  G+ V TVG+I   P+ SNVIPG+V+F++D+RA  +  R+A+       +  + D+R 
Sbjct  256  SGGGTQVATVGQIDVTPNTSNVIPGEVRFSLDMRAETNEARDAMADAIRTDLRAIADRRG  315

Query  419  IFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSR  240
            +    +      A  C  EL   L  A     T +TG         L+SGAGHDAM M  
Sbjct  316  LRITFDTPQYLPAAACAPELVEGLARA----VTSVTGRPAQR----LLSGAGHDAMTMVD  367

Query  239  LTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
            L  +GMLF+R  GG+SH P+E V   DV  A  A+LAF++
Sbjct  368  LCPMGMLFIRSPGGLSHHPDETVRVGDVDLAHRALLAFVK  407


 Score = 43.1 bits (100),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTR +VTV G   HAGT PM MRQD + A+AE+
Sbjct  214  QTRQRVTVTGQSDHAGTTPMTMRQDALAAAAEM  246



>gb|AHI24598.1| allantoate amidohydrolase [Komagataeibacter xylinus E25]
Length=416

 Score =   108 bits (270),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 85/155 (55%), Gaps = 8/155 (5%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             LV TVG +   P A+NV+PG V FT+D+RA  +  R+    E  +    +  +R +   
Sbjct  262  GLVATVGSLDVMPGAANVVPGDVVFTIDVRAGTNATRDRAAREILDIARDVAARRGLEMD  321

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKV  228
            +  + D +A  CD EL+  ++ A          + T     VL+SGAGHDAM M+ L  V
Sbjct  322  VALQQDLDATPCDPELTDLMEQAVR--------DVTHAPATVLVSGAGHDAMIMAHLAPV  373

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFL  123
             MLF+RC GGISH+P E V D D  AA  A++ F+
Sbjct  374  SMLFIRCAGGISHNPAESVTDADTDAALRAMITFI  408


 Score = 39.7 bits (91),  Expect(2) = 7e-27, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q R +VT+RG  GHAGTV M +R+D +  +AE+
Sbjct  216  QHRYRVTLRGMAGHAGTVAMKLRRDALAGAAEI  248



>ref|WP_024816379.1| allantoate amidohydrolase [Methylopila sp. 73B]
Length=407

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 85/158 (54%), Gaps = 9/158 (6%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             LV TVG +   P  +NVIPG V FTVD+RA  D  R + +      +  +   R +   
Sbjct  254  GLVATVGRLMVEPGGANVIPGHVAFTVDVRAPQDNQRFSTLKRIEESIVAIASTRGLGVS  313

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKV  228
            IER H+  A +CDR L  ++ +A          E    +   L SGAGHDAM MSR+  +
Sbjct  314  IERIHEEPAALCDRALQDRIDAAI---------EAQRYEPLRLASGAGHDAMVMSRIAPI  364

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            GM+FVRCR G+SH P+EH    DV A   A+L  L++ 
Sbjct  365  GMIFVRCRAGLSHHPDEHAEPRDVDAGARALLHVLKSF  402



>gb|KDD76601.1| hypothetical protein H632_c166p1 [Helicosporidium sp. ATCC 50920]
Length=236

 Score =   114 bits (286),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 89/164 (54%), Gaps = 9/164 (5%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LVCTVG +   P ASNVI G+V+ T+D+R+ DD  R + +         LCD R + C +
Sbjct  61   LVCTVGSLQPHPDASNVIAGRVRLTLDVRSDDDAVRRSALDRIRRASEALCDARGVSCTL  120

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDD------VPVLMSGAGHDAMAMS  243
             + H+A+AV  D  +   L  AA  A     G   + +      VP L SGAGHDAMA++
Sbjct  121  MQVHEADAVSMDPGVREVLSEAAKRAVQATRGADGESESLAPIVVPTLTSGAGHDAMALA  180

Query  242  RLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETLL  111
             +    MLFVR R G+SHSP EHV   DV    +   A  ETL+
Sbjct  181  PVFPSAMLFVRDREGVSHSPLEHVEGKDV---AVGARALFETLV  221



>ref|WP_007104588.1| hydantoin utilization protein C [Glaciecola polaris]
 dbj|GAC32803.1| hydantoin utilization protein C [Glaciecola polaris LMG 21857]
Length=409

 Score =   103 bits (258),  Expect(2) = 8e-27, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 84/155 (54%), Gaps = 9/155 (6%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            +V TVG++     A NVI G   F++DIR++DDT R+  +     ++H +  KR I   I
Sbjct  260  IVATVGQLKCLSGAVNVISGATTFSLDIRSIDDTLRDETLSLIMEQLHSIAAKRRIHMDI  319

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
               H A AV CD EL  QL +A          E        L SGAGHD MA++++  V 
Sbjct  320  AATHQALAVKCDDELQRQLLTAC---------EKNKMPPFTLSSGAGHDTMALAKICPVA  370

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
            MLF+RC  G+SH P E V  +D+ AA   + AF+E
Sbjct  371  MLFMRCEKGLSHHPGEAVDVNDIEAALKVMFAFIE  405


 Score = 44.7 bits (104),  Expect(2) = 8e-27, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCII  670
            R  +T++G  GHAGTVPM MRQD + A++E+  +I
Sbjct  217  RFAITLKGLAGHAGTVPMPMRQDALAAASEMILVI  251



>ref|WP_041111684.1| allantoate amidohydrolase [Gluconobacter oxydans]
 gb|AHK71280.1| N-carbamoyl-L-amino acid hydrolase AmaB [Gluconobacter oxydans 
DSM 3504]
Length=411

 Score =   105 bits (262),  Expect(2) = 8e-27, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 85/154 (55%), Gaps = 8/154 (5%)
 Frame = -1

Query  581  VCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVIE  402
            V TVG+I   P+ SNVIPG+V+F++D+RA  +  R+A+       +  + D+R +    +
Sbjct  262  VATVGQIDVTPNTSNVIPGEVRFSLDMRAETNEARDAMADAIRTDLRAIADRRGLRITFD  321

Query  401  RKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVGM  222
                  A  C  EL   L  A     T +TG         L+SGAGHDAMAM  L  +GM
Sbjct  322  TPQYLPAAACAPELVEGLARA----VTSVTGRPAQR----LLSGAGHDAMAMVDLCPMGM  373

Query  221  LFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLE  120
            LF+R  GG+SH P+E V   DV  A  A+LAF++
Sbjct  374  LFIRSPGGLSHHPDETVRVGDVDLAHRALLAFVK  407


 Score = 42.7 bits (99),  Expect(2) = 8e-27, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            QTR +VTV G   HAGT PM MRQD + A+AE+
Sbjct  214  QTRQRVTVTGQSDHAGTTPMTMRQDALTAAAEM  246



>ref|WP_025437681.1| allantoate amidohydrolase [Komagataeibacter xylinus]
Length=423

 Score =   108 bits (270),  Expect(2) = 8e-27, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 85/155 (55%), Gaps = 8/155 (5%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             LV TVG +   P A+NV+PG V FT+D+RA  +  R+    E  +    +  +R +   
Sbjct  269  GLVATVGSLDVMPGAANVVPGDVVFTIDVRAGTNATRDRAAREILDIARDVAARRGLEMD  328

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKV  228
            +  + D +A  CD EL+  ++ A          + T     VL+SGAGHDAM M+ L  V
Sbjct  329  VALQQDLDATPCDPELTDLMEQAVR--------DVTHAPATVLVSGAGHDAMIMAHLAPV  380

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFL  123
             MLF+RC GGISH+P E V D D  AA  A++ F+
Sbjct  381  SMLFIRCAGGISHNPAESVTDADTDAALRAMITFI  415


 Score = 39.7 bits (91),  Expect(2) = 8e-27, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q R +VT+RG  GHAGTV M +R+D +  +AE+
Sbjct  223  QHRYRVTLRGMAGHAGTVAMKLRRDALAGAAEI  255



>emb|CDG40691.1| N-carbamoyl-L-amino acid hydrolase [Asaia platycodi SF2.1]
Length=428

 Score =   117 bits (293),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 89/157 (57%), Gaps = 8/157 (5%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG ++    A N++PG+V  T+DIRA+    RE+   E S+ +  +C +R I   I
Sbjct  276  LVTTVGWLTVENGAPNIVPGKVALTIDIRAVTPGVRESAAQEVSDTLQAICTRRRIRLDI  335

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            ER  D    +CD  L+S L  A          E      P+L+S AGHDAM M+ L  + 
Sbjct  336  ERIQDLAGALCDERLTSLLGRAVE--------ERQGTTPPMLLSQAGHDAMIMANLAPMT  387

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            MLF+RC+GGISH+P E V D DV AA  A++ F+  L
Sbjct  388  MLFIRCKGGISHNPAESVDDADVEAAHQALVTFVTRL  424



>ref|WP_036474329.1| hydantoinase [Nesterenkonia sp. AN1]
 gb|EXF25680.1| hydantoinase [Nesterenkonia sp. AN1]
Length=419

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 84/144 (58%), Gaps = 8/144 (6%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             ++ TVG++ T P A NV+PG+V+F++D+RA  DT R++   E    +   C +R +  V
Sbjct  264  GVIATVGQLDTRPGAVNVVPGEVEFSLDLRAESDTLRDSAWDEIHAALSGFCTQRRLELV  323

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKV  228
            IE  H A  V C   L   L +           ET D D   L S AGHDAMAM+ +T++
Sbjct  324  IEEIHSAPTVSCSPRLRQALAAG--------VAETGDHDPITLYSRAGHDAMAMAAVTEI  375

Query  227  GMLFVRCRGGISHSPEEHVLDDDV  156
            GMLF RC  GISH PEE+VL+ DV
Sbjct  376  GMLFTRCEDGISHHPEENVLEADV  399



>gb|AHY53199.1| N-carbamoyl-L-amino acid hydrolase [Bradyrhizobium japonicum 
SEMIA 5079]
Length=486

 Score =   108 bits (269),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 85/160 (53%), Gaps = 9/160 (6%)
 Frame = -1

Query  593  AGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIF  414
            AG LV TVG I   P A+NVIPG+V FT+D+RA  D  R+  + +   ++  +  +R++ 
Sbjct  325  AGGLVGTVGYIQARPGATNVIPGEVSFTIDMRAATDMHRKRAVADVVRQIEAIAKRRHLA  384

Query  413  CVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLT  234
              ++  H+     C   L  Q+  A       I  E     V  L SGAGHD MAM  + 
Sbjct  385  LQLDVTHENRTAPCAPWLKDQIAQA-------IAAEGAS--VFELPSGAGHDGMAMIDIA  435

Query  233  KVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
             VGM+FVRCRGGISH P+EHV   D  A    +L  +E  
Sbjct  436  DVGMIFVRCRGGISHHPDEHVELADADAGARVLLRVIENF  475


 Score = 39.7 bits (91),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCI  673
            TRL   + G  GHAGTVPMA+R+D +  +AE  CI
Sbjct  282  TRLAARLTGMAGHAGTVPMALRRDALAGAAE--CI  314



>ref|WP_038966724.1| allantoate amidohydrolase [Bradyrhizobium sp. CCBAU 41267]
Length=424

 Score =   105 bits (263),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 83/159 (52%), Gaps = 9/159 (6%)
 Frame = -1

Query  590  GSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFC  411
            G LV TVG I   P A+NVIPG+V FT+D+RA  D  R+  + +   ++  +  +R +  
Sbjct  265  GGLVGTVGYIQARPGATNVIPGEVSFTIDMRAPTDMHRKRAVADVVRQIEAIAKRRQLAL  324

Query  410  VIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTK  231
             ++  H+     C   L  Q+  A       +       D+P   SGAGHD MAM  +  
Sbjct  325  QLDVTHENRTAPCASWLKDQIAQAIAAEGVSVF------DLP---SGAGHDGMAMIDIAD  375

Query  230  VGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            VGM+FVRCRGG+SH P+EHV   D  A    +L  +E  
Sbjct  376  VGMIFVRCRGGVSHHPDEHVELADADAGARVLLRVIENF  414


 Score = 42.0 bits (97),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 25/35 (71%), Gaps = 2/35 (6%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCI  673
            TRL V + G  GHAGTVPMA+R+D +  +AE  CI
Sbjct  221  TRLAVRLNGMAGHAGTVPMALRRDALTGAAE--CI  253



>ref|WP_011088888.1| allantoate amidohydrolase [Bradyrhizobium diazoefficiens]
 ref|NP_772787.1| allantoate amidohydrolase [Bradyrhizobium diazoefficiens USDA 
110]
 dbj|BAC51412.1| bll6147 [Bradyrhizobium diazoefficiens USDA 110]
Length=430

 Score =   105 bits (263),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 83/159 (52%), Gaps = 9/159 (6%)
 Frame = -1

Query  590  GSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFC  411
            G LV TVG I   P A+NVIPG+V FT+D+RA  D  R+  + +   ++  +  +R +  
Sbjct  271  GGLVGTVGYIQARPGATNVIPGEVSFTIDMRAPTDMHRKRAVADVVRQIEAIAKRRQLAL  330

Query  410  VIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTK  231
             ++  H+     C   L  Q+  A       +       D+P   SGAGHD MAM  +  
Sbjct  331  QLDVTHENRTAPCASWLKDQIAQAIAAEGVSVF------DLP---SGAGHDGMAMIDIAD  381

Query  230  VGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            VGM+FVRCRGG+SH P+EHV   D  A    +L  +E  
Sbjct  382  VGMIFVRCRGGVSHHPDEHVELADADAGARVLLRVIENF  420


 Score = 42.0 bits (97),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 25/35 (71%), Gaps = 2/35 (6%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCI  673
            TRL V + G  GHAGTVPMA+R+D +  +AE  CI
Sbjct  227  TRLAVRLNGMAGHAGTVPMALRRDALTGAAE--CI  259



>ref|WP_039157600.1| allantoate amidohydrolase [Bradyrhizobium japonicum]
Length=425

 Score =   108 bits (269),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 85/160 (53%), Gaps = 9/160 (6%)
 Frame = -1

Query  593  AGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIF  414
            AG LV TVG I   P A+NVIPG+V FT+D+RA  D  R+  + +   ++  +  +R++ 
Sbjct  264  AGGLVGTVGYIQARPGATNVIPGEVSFTIDMRAATDMHRKRAVADVVRQIEAIAKRRHLA  323

Query  413  CVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLT  234
              ++  H+     C   L  Q+  A       I  E     V  L SGAGHD MAM  + 
Sbjct  324  LQLDVTHENRTAPCAPWLKDQIAQA-------IAAEGAS--VFELPSGAGHDGMAMIDIA  374

Query  233  KVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
             VGM+FVRCRGGISH P+EHV   D  A    +L  +E  
Sbjct  375  DVGMIFVRCRGGISHHPDEHVELADADAGARVLLRVIENF  414


 Score = 39.7 bits (91),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCI  673
            TRL   + G  GHAGTVPMA+R+D +  +AE  CI
Sbjct  221  TRLAARLTGMAGHAGTVPMALRRDALAGAAE--CI  253



>gb|AJQ93433.1| acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase 
and related deacylase [Gynuella sunshinyii YC6258]
Length=416

 Score =   108 bits (270),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 86/158 (54%), Gaps = 12/158 (8%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             +V TVG IS  P A NVIPG+V+ ++DIR+ DD  R+  + +       LC +R +   
Sbjct  266  GIVATVGRISAAPGAVNVIPGRVELSLDIRSEDDQLRDQALADIEGAAQALCQRRGLEIS  325

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKV  228
              + H A AV CD +L++ L SA      R            L SGAGHDAM M+++  +
Sbjct  326  WTQIHSAAAVQCDPQLTNLLASAIGEPAHR------------LPSGAGHDAMVMAQICPM  373

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
             MLF+RC  GISH P E + + D+  A MA+  FL  L
Sbjct  374  AMLFMRCEKGISHHPAEAITESDLAEALMAMHRFLPQL  411


 Score = 39.3 bits (90),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCII  670
            R  + + G  GHAGTVPM +RQD ++ +AEL  +I
Sbjct  224  RFNIELCGMAGHAGTVPMELRQDALMGAAELMQVI  258



>ref|WP_024343296.1| allantoate amidohydrolase [Bradyrhizobium japonicum]
Length=423

 Score =   110 bits (275),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 82/159 (52%), Gaps = 9/159 (6%)
 Frame = -1

Query  590  GSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFC  411
            G LV TVG I   P A+NVIPGQV FT+D+RA  D  R+  + E   ++  +  +R +  
Sbjct  265  GGLVGTVGHIQAKPGATNVIPGQVSFTIDMRAPTDGHRKRAVTEIVRQIEAIAKRRRLAL  324

Query  410  VIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTK  231
             ++  H+     C   L  Q+  A          E     V  L SGAGHD MAM  +  
Sbjct  325  QLDVTHENRTAPCAPWLQQQIAQAI---------EAEGFSVFELPSGAGHDGMAMIDIAD  375

Query  230  VGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            VGM+FVRCRGGISH P+EHV   D  A    +L  +E  
Sbjct  376  VGMIFVRCRGGISHHPDEHVELADADAGARVLLRVIENF  414


 Score = 37.4 bits (85),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 23/35 (66%), Gaps = 2/35 (6%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCI  673
            TRL   + G  GHAGTVPM +R+D +  +AE  CI
Sbjct  221  TRLAARLTGMAGHAGTVPMPLRRDALAGAAE--CI  253



>gb|ESQ79076.1| hypothetical protein AEYBE204_11670 [Asticcacaulis sp. YBE204]
Length=342

 Score =   107 bits (268),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 86/157 (55%), Gaps = 8/157 (5%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG ++  P+A NV+PG+V FT+D+RA  +  R+        ++ Q+  KR      
Sbjct  189  LVATVGRMTVGPNAPNVVPGEVVFTIDVRAGTEAPRDQAADAILQQIQQIAAKRGTPAST  248

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
               HD  A  CD+ +  +L        +R   + T      ++SGAGHDAMA + +T   
Sbjct  249  RLIHDLPAAPCDKSMMEKL--------SRAVADVTGQAARPIVSGAGHDAMAFAGITPTA  300

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            MLF+RC+ GISH+P E V   DV  A  A+LAF++ L
Sbjct  301  MLFIRCKDGISHNPLEAVDPADVDLAFRAMLAFVQDL  337


 Score = 40.0 bits (92),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q R +VTV G  GHAGT  MA+R+D + A AE+
Sbjct  142  QKRFEVTVTGVAGHAGTNSMALRKDALTAGAEM  174



>ref|WP_044616225.1| allantoate amidohydrolase [Gynuella sunshinyii]
Length=418

 Score =   108 bits (270),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 86/158 (54%), Gaps = 12/158 (8%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
             +V TVG IS  P A NVIPG+V+ ++DIR+ DD  R+  + +       LC +R +   
Sbjct  268  GIVATVGRISAAPGAVNVIPGRVELSLDIRSEDDQLRDQALADIEGAAQALCQRRGLEIS  327

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKV  228
              + H A AV CD +L++ L SA      R            L SGAGHDAM M+++  +
Sbjct  328  WTQIHSAAAVQCDPQLTNLLASAIGEPAHR------------LPSGAGHDAMVMAQICPM  375

Query  227  GMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
             MLF+RC  GISH P E + + D+  A MA+  FL  L
Sbjct  376  AMLFMRCEKGISHHPAEAITESDLAEALMAMHRFLPQL  413


 Score = 39.3 bits (90),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCII  670
            R  + + G  GHAGTVPM +RQD ++ +AEL  +I
Sbjct  226  RFNIELCGMAGHAGTVPMELRQDALMGAAELMQVI  260



>ref|WP_045123696.1| allantoate amidohydrolase, partial [Yersinia pestis]
 gb|KJG82472.1| allantoate amidohydrolase, partial [Yersinia pestis subsp. microtus 
bv. Ulegeica]
Length=421

 Score =   106 bits (264),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 85/158 (54%), Gaps = 12/158 (8%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG ++  P A NVIPGQV+ T+DIR  +D G   ++         +  +R I    
Sbjct  268  LVATVGTLTCLPGAVNVIPGQVRLTLDIRGPNDRGVNDLLTRLLAEAEAIATRRGITFAA  327

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            E  +   A  CD    S L+     + +++ G         L SGAGHDA+AM+    VG
Sbjct  328  EGFYRIKATACD----SALQQCISQSISQVQGRCL-----ALPSGAGHDAIAMAECWPVG  378

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETLL  111
            MLFVRC+GG+SH P+E V   DV    +AI A+LE +L
Sbjct  379  MLFVRCKGGVSHHPDESVTSSDV---AVAIQAYLEAVL  413


 Score = 41.6 bits (96),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 23/36 (64%), Gaps = 0/36 (0%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCII  670
            +RL+    G  GHAGTVPM  RQD +  +AE  C++
Sbjct  222  SRLQCQFTGLAGHAGTVPMGQRQDALAGAAEWMCVV  257



>ref|WP_035372394.1| allantoate amidohydrolase, partial [Acetobacter okinawensis]
Length=387

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 90/157 (57%), Gaps = 8/157 (5%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG++   P ASNV+PG V F++DIRA     R+    +    +  + D R +   I
Sbjct  239  LVATVGQLHVGPGASNVVPGHVTFSLDIRAGTADVRDRAATKIRTALQDIADTRGVALRI  298

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            E ++D     CD EL+++L     T+  RITG+        L+SGAGHDAM M+ LT V 
Sbjct  299  ELQNDLAPTPCDPELTARLA----TSVARITGQPAHR----LVSGAGHDAMVMAALTPVC  350

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            MLF+RC  GISH+P E V  DD   A + +L F++ L
Sbjct  351  MLFLRCHKGISHNPAEAVRHDDAHTALLVMLDFIQAL  387



>ref|WP_043149779.1| allantoate amidohydrolase [Sphingobium sp. Ant17]
 gb|EXS71214.1| allantoate amidohydrolase [Sphingobium sp. Ant17]
Length=420

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 86/157 (55%), Gaps = 9/157 (6%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG ++  P A+NV+PG+V FTVD+R+  D  R+A   E    +H +   R +  V 
Sbjct  271  LVATVGRMTVMPGATNVVPGRVDFTVDVRSGSDAERDAATGEILAALHAIATSRGVTVVA  330

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            E      A  CD  L  +L +A            T  +   L+SGAGHDAM M+ L    
Sbjct  331  EETQMLAASPCDPALIDRLAAAV---------AATGQEPRCLVSGAGHDAMVMAALAPTA  381

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            MLF+RC GGISH+P E V++ DV  A  A+L F+E L
Sbjct  382  MLFIRCTGGISHNPAEDVIEADVEQALAAMLTFIEGL  418



>ref|WP_042446589.1| allantoate amidohydrolase [Azospirillum lipoferum]
Length=418

 Score =   102 bits (253),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 87/158 (55%), Gaps = 11/158 (7%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG I   P A+NVIPG+V+FT+D+RA  D  R   +     R+  + D R +    
Sbjct  266  LVGTVGRIEASPGATNVIPGKVRFTIDLRADRDPLRLERVGAVRARLEAIADARGVAIGF  325

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            E  H++ AV C   L +Q  +AA              D P L SGAGHDAMA++ LT + 
Sbjct  326  ETLHESPAVACHPALMAQFAAAAAAEGL---------DAPELPSGAGHDAMAVAALTGIA  376

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILA-FLETL  114
            MLFVRC  GISH+P E +   D   AG+ +LA F+E  
Sbjct  377  MLFVRCERGISHNPAERITAADAE-AGVRVLARFVENF  413


 Score = 45.4 bits (106),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            TRL VTV G  GHAGTVPM +R+D + ASAE+
Sbjct  221  TRLAVTVDGMAGHAGTVPMTLRRDALAASAEM  252



>ref|WP_031230786.1| allantoate amidohydrolase [Asticcacaulis sp. YBE204]
Length=451

 Score =   107 bits (268),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 86/157 (55%), Gaps = 8/157 (5%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG ++  P+A NV+PG+V FT+D+RA  +  R+        ++ Q+  KR      
Sbjct  298  LVATVGRMTVGPNAPNVVPGEVVFTIDVRAGTEAPRDQAADAILQQIQQIAAKRGTPAST  357

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
               HD  A  CD+ +  +L        +R   + T      ++SGAGHDAMA + +T   
Sbjct  358  RLIHDLPAAPCDKSMMEKL--------SRAVADVTGQAARPIVSGAGHDAMAFAGITPTA  409

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            MLF+RC+ GISH+P E V   DV  A  A+LAF++ L
Sbjct  410  MLFIRCKDGISHNPLEAVDPADVDLAFRAMLAFVQDL  446


 Score = 39.7 bits (91),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q R +VTV G  GHAGT  MA+R+D + A AE+
Sbjct  251  QKRFEVTVTGVAGHAGTNSMALRKDALTAGAEM  283



>dbj|BAI76499.1| allantoate amidohydrolase [Azospirillum sp. B510]
Length=424

 Score =   102 bits (254),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 87/158 (55%), Gaps = 11/158 (7%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG I   P A+NVIPG+V+FT+D+RA  D  R   +     R+  + D R +    
Sbjct  272  LVGTVGRIEASPGATNVIPGKVRFTIDLRADRDPLRLERVGAVRARLEAIADARGVAIGF  331

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            E  H++ AV C   L +Q  +AA              D P L SGAGHDAMA++ LT + 
Sbjct  332  ETLHESPAVACHPALMAQFAAAAAAEGL---------DAPELPSGAGHDAMAVAALTGIA  382

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILA-FLETL  114
            MLFVRC  GISH+P E +   D   AG+ +LA F+E  
Sbjct  383  MLFVRCERGISHNPAERITAADAE-AGVRVLARFVENF  419


 Score = 45.1 bits (105),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            TRL VTV G  GHAGTVPM +R+D + ASAE+
Sbjct  227  TRLAVTVDGMAGHAGTVPMTLRRDALAASAEM  258



>ref|WP_042787242.1| allantoate amidohydrolase [Acetobacter aceti]
 gb|KDE20385.1| allantoate amidohydrolase [Acetobacter aceti 1023]
Length=441

 Score =   110 bits (276),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/169 (35%), Positives = 97/169 (57%), Gaps = 8/169 (5%)
 Frame = -1

Query  620  CQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMH  441
            C     +S    LV TVG++   P A N++PG V+F++D+RA  ++ R A   + ++ + 
Sbjct  275  CIEKIAQSGPDDLVATVGQMRVKPGAPNIVPGWVEFSIDVRAGTESVRNAAAEKITHALQ  334

Query  440  QLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGH  261
            ++  KR++   +  +HD +A  C+ +L + L ++  T    +TG+        L+SGAGH
Sbjct  335  EISQKRDVDMTLTLQHDLSATPCNPQLGAILAASIQT----VTGQPAYS----LVSGAGH  386

Query  260  DAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            DAM M+ L  V MLF+RC  GISH+P E V D+DV  A   +  F++ +
Sbjct  387  DAMIMAALAPVCMLFIRCERGISHNPAEAVQDEDVETALRVMCDFIQNI  435


 Score = 36.6 bits (83),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQD  706
            Q R +V ++G  GHAGT+PM +RQD
Sbjct  240  QYRFQVVMKGMAGHAGTLPMHLRQD  264



>ref|WP_028395750.1| hydantoinase [Bacillus sp. FJAT-14578]
Length=412

 Score =   107 bits (266),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 91/153 (59%), Gaps = 12/153 (8%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
            SLV TVG++S     SNVIPG V+ T+DIR++DD  R   + +       +C +R + C 
Sbjct  262  SLVATVGKLSVQQGTSNVIPGLVEGTLDIRSIDDERRLIALNQIIKECKSICQRRGLICE  321

Query  407  IERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLM-SGAGHDAMAMSRLTK  231
              +  ++ A VC R   + ++S       +          P+ M SGAGHDAMA++ +T+
Sbjct  322  FTKIMESFATVCSRRFINVIESVLANHGMK----------PIQMVSGAGHDAMAIADITE  371

Query  230  VGMLFVRCRGGISHSPEEHVLDDDVWAAGMAIL  132
            +GM+FVRC+ G+SH P+E+V  DD+  AG+++L
Sbjct  372  IGMIFVRCKDGLSHHPDEYVAPDDM-KAGVSVL  403


 Score = 40.4 bits (93),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            +R +  V G  GHAGT+PM MR+D +V +AE+
Sbjct  218  SRYQFRVEGLAGHAGTIPMNMRKDALVGAAEM  249



>ref|WP_038905612.1| allantoate amidohydrolase, partial [Yersinia pestis]
Length=421

 Score =   106 bits (264),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 85/158 (54%), Gaps = 12/158 (8%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG ++  P A NVIPGQV+ T+DIR  +D G   ++         +  +R I    
Sbjct  268  LVATVGTLTCLPGAVNVIPGQVRLTLDIRGPNDRGVNDLLTRLLAEAEAIATRRGITFAA  327

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            E  +   A  CD    S L+     + +++ G         L SGAGHDA+AM+    VG
Sbjct  328  EGFYRIKATACD----SALQQCISQSISQVQGRCL-----ALPSGAGHDAIAMAECWPVG  378

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETLL  111
            MLFVRC+GG+SH P+E V   DV    +AI A+LE +L
Sbjct  379  MLFVRCKGGVSHHPDESVTSSDV---AVAIQAYLEAVL  413


 Score = 40.8 bits (94),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCII  670
            RL+    G  GHAGTVPM  RQD +  +AE  C++
Sbjct  223  RLQCQFTGLAGHAGTVPMGQRQDALAGAAEWMCVV  257



>ref|WP_016255928.1| allantoate amidohydrolase, partial [Yersinia pestis]
Length=428

 Score =   105 bits (263),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 85/158 (54%), Gaps = 12/158 (8%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG ++  P A NVIPGQV+ T+DIR  +D G   ++         +  +R I    
Sbjct  268  LVATVGTLTCLPGAVNVIPGQVRLTLDIRGPNDRGVNDLLTRLLAEAEAIATRRGITFAA  327

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            E  +   A  CD    S L+     + +++ G         L SGAGHDA+AM+    VG
Sbjct  328  EGFYRIKATACD----SALQQCISQSISQVQGRCL-----ALPSGAGHDAIAMAECWPVG  378

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETLL  111
            MLFVRC+GG+SH P+E V   DV    +AI A+LE +L
Sbjct  379  MLFVRCKGGVSHHPDESVTSSDV---AVAIQAYLEAVL  413


 Score = 40.8 bits (94),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCII  670
            RL+    G  GHAGTVPM  RQD +  +AE  C++
Sbjct  223  RLQCQFTGLAGHAGTVPMGQRQDALAGAAEWMCVV  257



>gb|AAS60949.1| putative amino acid hydrolase [Yersinia pestis biovar Microtus 
str. 91001]
Length=434

 Score =   105 bits (263),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 85/158 (54%), Gaps = 12/158 (8%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG ++  P A NVIPGQV+ T+DIR  +D G   ++         +  +R I    
Sbjct  269  LVATVGTLTCLPGAVNVIPGQVRLTLDIRGPNDRGVNDLLTRLLAEAEAIATRRGITFAA  328

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            E  +   A  CD    S L+     + +++ G         L SGAGHDA+AM+    VG
Sbjct  329  EGFYRIKATACD----SALQQCISQSISQVQGRCL-----ALPSGAGHDAIAMAECWPVG  379

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETLL  111
            MLFVRC+GG+SH P+E V   DV    +AI A+LE +L
Sbjct  380  MLFVRCKGGVSHHPDESVTSSDV---AVAIQAYLEAVL  414


 Score = 40.8 bits (94),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCII  670
            RL+    G  GHAGTVPM  RQD +  +AE  C++
Sbjct  224  RLQCQFTGLAGHAGTVPMGQRQDALAGAAEWMCVV  258



>gb|AAM84520.1|AE013696_13 putative N-carbamyl-L-amino acid amidohydrolase [Yersinia pestis 
KIM10+]
Length=431

 Score =   105 bits (263),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 85/158 (54%), Gaps = 12/158 (8%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG ++  P A NVIPGQV+ T+DIR  +D G   ++         +  +R I    
Sbjct  269  LVATVGTLTCLPGAVNVIPGQVRLTLDIRGPNDRGVNDLLTRLLAEAEAIATRRGITFAA  328

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            E  +   A  CD    S L+     + +++ G         L SGAGHDA+AM+    VG
Sbjct  329  EGFYRIKATACD----SALQQCISQSISQVQGRCL-----ALPSGAGHDAIAMAECWPVG  379

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETLL  111
            MLFVRC+GG+SH P+E V   DV    +AI A+LE +L
Sbjct  380  MLFVRCKGGVSHHPDESVTSSDV---AVAIQAYLEAVL  414


 Score = 40.8 bits (94),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCII  670
            RL+    G  GHAGTVPM  RQD +  +AE  C++
Sbjct  224  RLQCQFTGLAGHAGTVPMGQRQDALAGAAEWMCVV  258



>ref|WP_016588400.1| allantoate amidohydrolase, partial [Yersinia pestis]
Length=429

 Score =   105 bits (263),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 85/158 (54%), Gaps = 12/158 (8%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG ++  P A NVIPGQV+ T+DIR  +D G   ++         +  +R I    
Sbjct  268  LVATVGTLTCLPGAVNVIPGQVRLTLDIRGPNDRGVNDLLTRLLAEAEAIATRRGITFAA  327

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            E  +   A  CD    S L+     + +++ G         L SGAGHDA+AM+    VG
Sbjct  328  EGFYRIKATACD----SALQQCISQSISQVQGRCL-----ALPSGAGHDAIAMAECWPVG  378

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETLL  111
            MLFVRC+GG+SH P+E V   DV    +AI A+LE +L
Sbjct  379  MLFVRCKGGVSHHPDESVTSSDV---AVAIQAYLEAVL  413


 Score = 40.8 bits (94),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCII  670
            RL+    G  GHAGTVPM  RQD +  +AE  C++
Sbjct  223  RLQCQFTGLAGHAGTVPMGQRQDALAGAAEWMCVV  257



>ref|WP_033849543.1| allantoate amidohydrolase [Yersinia sp. WP-931205]
Length=427

 Score =   107 bits (267),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 86/158 (54%), Gaps = 12/158 (8%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG ++  P A NVIPGQV+ T+DIR  +D G   ++         +  +R I    
Sbjct  268  LVATVGTLTCLPGAVNVIPGQVRLTLDIRGPNDRGVNDLLTRLLAEAEAIATRRGITFAA  327

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            E  +  NA  CD    S L+     + +++ G         L SGAGHDA+AM+    VG
Sbjct  328  EGFYRINATACD----SALQQCISQSISKVQGRCL-----ALPSGAGHDAIAMAECWPVG  378

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETLL  111
            MLFVRC+GG+SH P+E V   DV    +AI A+LE +L
Sbjct  379  MLFVRCKGGVSHHPDESVTCSDV---AVAIQAYLEAVL  413


 Score = 39.7 bits (91),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 21/35 (60%), Gaps = 0/35 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCII  670
            RL+    G  GHAGTVPM  RQD +  +AE  C +
Sbjct  223  RLQCQFTGLAGHAGTVPMGQRQDALAGAAEWVCAV  257



>ref|WP_002231082.1| allantoate amidohydrolase [Yersinia pestis]
 gb|EEO88939.1| putative amino acid hydrolase [Yersinia pestis Pestoides A]
 gb|AJJ14148.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis]
 gb|AJK14009.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
str. Pestoides B]
Length=433

 Score =   105 bits (263),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 85/158 (54%), Gaps = 12/158 (8%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG ++  P A NVIPGQV+ T+DIR  +D G   ++         +  +R I    
Sbjct  268  LVATVGTLTCLPGAVNVIPGQVRLTLDIRGPNDRGVNDLLTRLLAEAEAIATRRGITFAA  327

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            E  +   A  CD    S L+     + +++ G         L SGAGHDA+AM+    VG
Sbjct  328  EGFYRIKATACD----SALQQCISQSISQVQGRCL-----ALPSGAGHDAIAMAECWPVG  378

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETLL  111
            MLFVRC+GG+SH P+E V   DV    +AI A+LE +L
Sbjct  379  MLFVRCKGGVSHHPDESVTSSDV---AVAIQAYLEAVL  413


 Score = 40.8 bits (94),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCII  670
            RL+    G  GHAGTVPM  RQD +  +AE  C++
Sbjct  223  RLQCQFTGLAGHAGTVPMGQRQDALAGAAEWMCVV  257



>ref|WP_002208729.1| allantoate amidohydrolase [Yersinia pestis]
 ref|YP_002348151.1| allantoate amidohydrolase [Yersinia pestis CO92]
 emb|CAL21843.1| putative amino acid hydrolase [Yersinia pestis CO92]
 gb|EDM41395.1| putative amino acid hydrolase [Yersinia pestis CA88-4125]
 gb|EDR34663.1| amidase, hydantoinase/carbamoylase family [Yersinia pestis biovar 
Orientalis str. IP275]
 gb|EDR38770.1| amidase, hydantoinase/carbamoylase family [Yersinia pestis biovar 
Orientalis str. F1991016]
 gb|EDR42274.1| amidase, hydantoinase/carbamoylase family [Yersinia pestis biovar 
Antiqua str. E1979001]
 gb|EDR56554.1| amidase, hydantoinase/carbamoylase family [Yersinia pestis biovar 
Orientalis str. MG05-1020]
 gb|EDR67748.1| amidase, hydantoinase/carbamoylase family [Yersinia pestis biovar 
Mediaevalis str. K1973002]
 gb|EEO79904.1| putative amino acid hydrolase [Yersinia pestis biovar Orientalis 
str. India 195]
 gb|EEO85273.1| putative amino acid hydrolase [Yersinia pestis biovar Orientalis 
str. PEXU2]
 gb|ACY59750.1| N-carbamoyl-L-amino acid amidohydrolase [Yersinia pestis D106004]
 gb|ACY63510.1| N-carbamoyl-L-amino acid amidohydrolase [Yersinia pestis D182038]
 gb|EFA48700.1| allantoate amidohydrolase [Yersinia pestis KIM D27]
 gb|ADE65765.1| N-carbamoyl-L-amino acid amidohydrolase [Yersinia pestis Z176003]
 gb|ADW00013.1| putative amino acid hydrolase [Yersinia pestis biovar Medievalis 
str. Harbin 35]
 gb|AEL72593.1| allantoate amidohydrolase [Yersinia pestis A1122]
 gb|EIQ85752.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-01]
 gb|EIQ85918.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-02]
 gb|EIQ86123.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-03]
 gb|EIQ98976.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-04]
 gb|EIQ99989.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-05]
 gb|EIR03412.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-06]
 gb|EIR14264.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-07]
 gb|EIR15035.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-08]
 gb|EIR16753.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-09]
 gb|EIR28509.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-10]
 gb|EIR29756.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-11]
 gb|EIR30679.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-12]
 gb|EIR42987.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-13]
 gb|EIR44377.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-15]
 gb|EIR44405.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-14]
 gb|EIR57191.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-16]
 gb|EIR57355.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-19]
 gb|EIR62001.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-25]
 gb|EIR71631.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-29]
 gb|EIR72936.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-34]
 gb|EIR73855.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-32]
 gb|EIR84638.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-36]
 gb|EIR87443.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-42]
 gb|EIR89668.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-45]
 gb|EIS01367.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-46]
 gb|EIS01479.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-47]
 gb|EIS01911.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-48]
 gb|EIS14676.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-52]
 gb|EIS15682.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-53]
 gb|EIS19510.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-54]
 gb|EIS27121.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-55]
 gb|EIS28951.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-56]
 gb|EIS38126.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-58]
 gb|EIS40724.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-60]
 gb|EIS41767.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-59]
 gb|EIS53434.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-61]
 gb|EIS53915.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-63]
 gb|EIS56385.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-64]
 gb|EIS65105.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-65]
 gb|EIS68877.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-66]
 gb|EIS74326.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-71]
 gb|EIS76104.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-72]
 gb|EIS84867.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-76]
 gb|EIS88011.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-88]
 gb|EIS91878.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-89]
 gb|EIS96248.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-90]
 gb|EIT02942.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-91]
 gb|EIT11470.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-93]
 gb|EIT12145.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-92]
 gb|EIT12577.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-94]
 gb|EIT24048.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-95]
 gb|EIT26779.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-96]
 gb|EIT28201.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-98]
 gb|EIT39291.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-99]
 gb|EIT42255.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-100]
 gb|EIT43080.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-101]
 gb|EIT53683.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-102]
 gb|EIT54297.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-103]
 gb|EIT56670.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
PY-113]
 gb|EKS44332.1| allantoate amidohydrolase [Yersinia pestis INS]
 gb|ERP81667.1| allantoate amidohydrolase [Yersinia pestis 113]
 gb|ERP85097.1| allantoate amidohydrolase [Yersinia pestis 9]
 gb|KFB58628.1| allantoate amidohydrolase [Yersinia pestis subsp. pestis]
 gb|KGA52415.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis]
 gb|AJI92423.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis]
 gb|AJK08758.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis]
 gb|AJJ50389.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis]
 gb|AJJ75655.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
A1122]
 gb|AJJ33547.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis]
 gb|AJJ88275.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis 
CO92]
 gb|AJJ44667.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis]
 gb|AKB88872.1| amidase, hydantoinase/carbamoylase family protein [Yersinia pestis]
Length=430

 Score =   105 bits (263),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 85/158 (54%), Gaps = 12/158 (8%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG ++  P A NVIPGQV+ T+DIR  +D G   ++         +  +R I    
Sbjct  268  LVATVGTLTCLPGAVNVIPGQVRLTLDIRGPNDRGVNDLLTRLLAEAEAIATRRGITFAA  327

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            E  +   A  CD    S L+     + +++ G         L SGAGHDA+AM+    VG
Sbjct  328  EGFYRIKATACD----SALQQCISQSISQVQGRCL-----ALPSGAGHDAIAMAECWPVG  378

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETLL  111
            MLFVRC+GG+SH P+E V   DV    +AI A+LE +L
Sbjct  379  MLFVRCKGGVSHHPDESVTSSDV---AVAIQAYLEAVL  413


 Score = 40.8 bits (94),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCII  670
            RL+    G  GHAGTVPM  RQD +  +AE  C++
Sbjct  223  RLQCQFTGLAGHAGTVPMGQRQDALAGAAEWMCVV  257



>ref|WP_019122255.1| hypothetical protein [Brevibacillus massiliensis]
Length=414

 Score =   105 bits (263),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 88/151 (58%), Gaps = 9/151 (6%)
 Frame = -1

Query  581  VCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVIE  402
            V TVG+I+ +P   NVIPG V+F+VDIR  D+  R+A I +    + ++C +R +   ++
Sbjct  266  VGTVGKIAAYPGGQNVIPGTVEFSVDIRDTDEGRRDAAISQIQAAVDEVCKRRGLTAEVK  325

Query  401  RKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVGM  222
                A   +C  ++ + ++ AA        G T     P L+SGAGHDAM ++ +  +GM
Sbjct  326  VNERAKPTLCSEQVMAAMERAAGA-----LGLTP----PKLVSGAGHDAMCLAEIADMGM  376

Query  221  LFVRCRGGISHSPEEHVLDDDVWAAGMAILA  129
            +FVRC  GISH+P+E+   +D+ A    +LA
Sbjct  377  IFVRCLDGISHNPKEYASQEDITAGTEVLLA  407


 Score = 41.2 bits (95),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = -3

Query  771  LKVTVRGTQGHAGTVPMAMRQDPMVASAELDCIIGK  664
            L + + G  GHAGTVPM MR+DPM  +AE+   I K
Sbjct  220  LNIKLHGMAGHAGTVPMNMRRDPMSGAAEVILAIEK  255



>ref|WP_016603951.1| allantoate amidohydrolase, partial [Yersinia pestis]
Length=423

 Score =   105 bits (263),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 85/158 (54%), Gaps = 12/158 (8%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG ++  P A NVIPGQV+ T+DIR  +D G   ++         +  +R I    
Sbjct  268  LVATVGTLTCLPGAVNVIPGQVRLTLDIRGPNDRGVNDLLTRLLAEAEAIATRRGITFAA  327

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            E  +   A  CD    S L+     + +++ G         L SGAGHDA+AM+    VG
Sbjct  328  EGFYRIKATACD----SALQQCISQSISQVQGRCL-----ALPSGAGHDAIAMAECWPVG  378

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETLL  111
            MLFVRC+GG+SH P+E V   DV    +AI A+LE +L
Sbjct  379  MLFVRCKGGVSHHPDESVTSSDV---AVAIQAYLEAVL  413


 Score = 40.8 bits (94),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCII  670
            RL+    G  GHAGTVPM  RQD +  +AE  C++
Sbjct  223  RLQCQFTGLAGHAGTVPMGQRQDALAGAAEWMCVV  257



>gb|ADG06712.1| amidase, hydantoinase/carbamoylase family [Kyrpidia tusciae DSM 
2912]
Length=427

 Score =   110 bits (276),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 100/181 (55%), Gaps = 22/181 (12%)
 Frame = -1

Query  647  EYYLSYDDECQTSTVKSLAGSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAI  468
            E  L+ D+  + S       S V TVG +  +P +SNVIPG+V+ T+D+R++DD  R  +
Sbjct  246  EIILAVDEAARESP------STVATVGNLQVFPGSSNVIPGRVEGTLDVRSLDDEERRRV  299

Query  467  IYEFSNRMHQLCDKRNIFCVIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDV  288
              +   R   + +  ++    E   D  AV C    S +L +AA  A T           
Sbjct  300  FRQICQRAEGIAENGSLSFCCEVVLDTPAVEC----SPRLMAAAAEAITH-------HGY  348

Query  287  PVLM--SGAGHDAMAMSRLTKVGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            P L   SGAGHDA+AM+ LT+VGM+FVRCRGG+SH PEE+V  +D+    + +  FLE +
Sbjct  349  PPLFIPSGAGHDALAMADLTEVGMIFVRCRGGVSHHPEEYVEPEDIE---IGVSVFLEAV  405

Query  113  L  111
            L
Sbjct  406  L  406


 Score = 35.8 bits (81),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 21/32 (66%), Gaps = 0/32 (0%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
             R +  V G  GHAGTVPM  R+D +V +AE+
Sbjct  216  VRGRFQVEGLAGHAGTVPMDARRDALVGAAEI  247



>ref|WP_042872342.1| allantoate amidohydrolase [Dickeya sp. NCPPB 569]
Length=421

 Score =   108 bits (271),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 89/157 (57%), Gaps = 12/157 (8%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG +   P A+NVIPG+V+ T+DIR  DDT  +A++         +  +R      
Sbjct  273  LVATVGTLQCLPGAANVIPGEVRLTLDIRGPDDTPLDALLQRLLTLAQDIAMQRGCIFSA  332

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            E  +   A  CD +L  +L +A      ++ GE       +L SGAGHDA+A++    VG
Sbjct  333  EEYYRIAATRCDDKLLQRLSAA----VMQVQGENL-----LLPSGAGHDAIAIAERWPVG  383

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            MLF+RC+GGISH P+E VL DDV     A+ A L+T+
Sbjct  384  MLFMRCKGGISHHPDESVLTDDV---AQALRALLQTV  417


 Score = 38.1 bits (87),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASA  688
            RL  T  G  GHAGTVPM+ RQD + A+A
Sbjct  228  RLNCTFTGHAGHAGTVPMSQRQDALAAAA  256



>ref|WP_016676248.1| allantoate amidohydrolase, partial [Yersinia pestis]
Length=400

 Score =   105 bits (262),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 85/158 (54%), Gaps = 12/158 (8%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG ++  P A NVIPGQV+ T+DIR  +D G   ++         +  +R I    
Sbjct  238  LVATVGTLTCLPGAVNVIPGQVRLTLDIRGPNDRGVNDLLTRLLAEAEAIATRRGITFAA  297

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            E  +   A  CD    S L+     + +++ G         L SGAGHDA+AM+    VG
Sbjct  298  EGFYRIKATACD----SALQQCISQSISQVQGRCL-----ALPSGAGHDAIAMAECWPVG  348

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETLL  111
            MLFVRC+GG+SH P+E V   DV    +AI A+LE +L
Sbjct  349  MLFVRCKGGVSHHPDESVTSSDV---AVAIQAYLEAVL  383


 Score = 41.2 bits (95),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCII  670
            RL+    G  GHAGTVPM  RQD +  +AE  C++
Sbjct  193  RLQCQFTGLAGHAGTVPMGQRQDALAGAAEWMCVV  227



>gb|ETO50142.1| allantoate amidohydrolase [Yersinia pestis S3]
 gb|ETO50553.1| allantoate amidohydrolase [Yersinia pestis 24H]
Length=377

 Score =   105 bits (263),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 85/158 (54%), Gaps = 12/158 (8%)
 Frame = -1

Query  584  LVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCVI  405
            LV TVG ++  P A NVIPGQV+ T+DIR  +D G   ++         +  +R I    
Sbjct  215  LVATVGTLTCLPGAVNVIPGQVRLTLDIRGPNDRGVNDLLTRLLAEAEAIATRRGITFAA  274

Query  404  ERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTKVG  225
            E  +   A  CD    S L+     + +++ G         L SGAGHDA+AM+    VG
Sbjct  275  EGFYRIKATACD----SALQQCISQSISQVQGRCL-----ALPSGAGHDAIAMAECWPVG  325

Query  224  MLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETLL  111
            MLFVRC+GG+SH P+E V   DV    +AI A+LE +L
Sbjct  326  MLFVRCKGGVSHHPDESVTSSDV---AVAIQAYLEAVL  360


 Score = 40.8 bits (94),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -3

Query  774  RLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCII  670
            RL+    G  GHAGTVPM  RQD +  +AE  C++
Sbjct  170  RLQCQFTGLAGHAGTVPMGQRQDALAGAAEWMCVV  204



>ref|WP_036007776.1| allantoate amidohydrolase [Bradyrhizobium yuanmingense]
Length=418

 Score =   107 bits (266),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 82/159 (52%), Gaps = 9/159 (6%)
 Frame = -1

Query  590  GSLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFC  411
            G LV TVG I   P A+NVIPG+V FT+D+RA  D  R+  + +   ++  +  +R +  
Sbjct  264  GDLVGTVGYIQARPGATNVIPGEVSFTIDMRAPTDMHRKRAVADVVRQIEAIAKRRQLAL  323

Query  410  VIERKHDANAVVCDRELSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSRLTK  231
             ++  H+     C   L  Q+  A          E     V  L SGAGHD MAM  +  
Sbjct  324  QLDVTHENRTAPCAPWLKQQIAQAI---------EAEGFSVFELPSGAGHDGMAMIDIAD  374

Query  230  VGMLFVRCRGGISHSPEEHVLDDDVWAAGMAILAFLETL  114
            VGM+FVRCRGGISH P+EHV   D  A    +L  +E  
Sbjct  375  VGMIFVRCRGGISHHPDEHVALADADAGARVLLRVIENF  413


 Score = 39.3 bits (90),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 24/35 (69%), Gaps = 2/35 (6%)
 Frame = -3

Query  777  TRLKVTVRGTQGHAGTVPMAMRQDPMVASAELDCI  673
            TRL   + G  GHAGTVPMA+R+D +  +AE  CI
Sbjct  220  TRLAARLTGMAGHAGTVPMALRRDALAGAAE--CI  252



>ref|WP_004439892.1| hydantoinase [Bacillus smithii]
 gb|EHL72248.1| hydantoinase/carbamoylase family amidase [Bacillus smithii 7_3_47FAA]
Length=412

 Score =   103 bits (257),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/148 (37%), Positives = 84/148 (57%), Gaps = 17/148 (11%)
 Frame = -1

Query  587  SLVCTVGEISTWPSASNVIPGQVKFTVDIRAMDDTGREAIIYEFSNRMHQLCDKRNIFCV  408
            SLV TVG+I+ +P ASNVIPG V+ T+D+R++DD  R   +         +  +R + C 
Sbjct  262  SLVATVGKIAIFPGASNVIPGLVEGTLDVRSVDDGTRMTALNRIFEECEHIAKRRGLICE  321

Query  407  IERKHDANAVVCDRE----LSSQLKSAAHTAFTRITGETTDDDVPVLMSGAGHDAMAMSR  240
              +  ++ AV+C       +SS LK     +               L+SGAGHDAMA++ 
Sbjct  322  FTKVMESPAVICSSRFIDVISSVLKEYKMKSVQ-------------LVSGAGHDAMALAS  368

Query  239  LTKVGMLFVRCRGGISHSPEEHVLDDDV  156
            +T +GM+FVRC+ G+SH P+E V  +D+
Sbjct  369  ITDIGMIFVRCKNGLSHHPDEFVAAEDI  396


 Score = 43.1 bits (100),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -3

Query  780  QTRLKVTVRGTQGHAGTVPMAMRQDPMVASAEL  682
            Q+R K  V G  GHAGTVP+++R+D +V +AE+
Sbjct  217  QSRYKFRVEGLTGHAGTVPLSLRKDALVGTAEM  249



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1559042875252