BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig14005

Length=777
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004241982.1|  PREDICTED: histone-lysine N-methyltransferas...    388   3e-123   Solanum lycopersicum
ref|XP_011081855.1|  PREDICTED: uncharacterized protein LOC105164786    390   8e-123   Sesamum indicum [beniseed]
ref|XP_009785592.1|  PREDICTED: histone-lysine N-methyltransferas...    386   9e-123   Nicotiana sylvestris
ref|XP_006361159.1|  PREDICTED: uncharacterized protein LOC102599225    386   1e-122   Solanum tuberosum [potatoes]
ref|XP_009626896.1|  PREDICTED: histone-lysine N-methyltransferas...    386   1e-122   Nicotiana tomentosiformis
ref|XP_009626893.1|  PREDICTED: histone-lysine N-methyltransferas...    386   2e-122   Nicotiana tomentosiformis
ref|XP_009785591.1|  PREDICTED: histone-lysine N-methyltransferas...    386   2e-122   Nicotiana sylvestris
ref|XP_006359220.1|  PREDICTED: histone-lysine N-methyltransferas...    369   9e-119   
ref|XP_009600586.1|  PREDICTED: histone-lysine N-methyltransferas...    372   1e-117   Nicotiana tomentosiformis
gb|EYU21899.1|  hypothetical protein MIMGU_mgv1a021585mg                374   5e-117   Erythranthe guttata [common monkey flower]
ref|XP_009798600.1|  PREDICTED: histone-lysine N-methyltransferas...    370   6e-117   Nicotiana sylvestris
ref|XP_004246167.2|  PREDICTED: histone-lysine N-methyltransferas...    369   2e-116   Solanum lycopersicum
ref|XP_006838522.1|  PREDICTED: histone-lysine N-methyltransferas...    362   4e-113   Amborella trichopoda
ref|XP_008238503.1|  PREDICTED: uncharacterized protein LOC103337130    361   7e-113   Prunus mume [ume]
ref|XP_010246087.1|  PREDICTED: uncharacterized protein LOC104589...    361   8e-113   Nelumbo nucifera [Indian lotus]
ref|XP_010246093.1|  PREDICTED: uncharacterized protein LOC104589...    360   1e-112   Nelumbo nucifera [Indian lotus]
ref|XP_007210417.1|  hypothetical protein PRUPE_ppa000541mg             360   2e-112   
ref|XP_008812955.1|  PREDICTED: histone-lysine N-methyltransferas...    357   2e-112   Phoenix dactylifera
ref|XP_010646790.1|  PREDICTED: histone-lysine N-methyltransferas...    359   3e-112   Vitis vinifera
ref|XP_010938533.1|  PREDICTED: histone-lysine N-methyltransferas...    359   3e-112   Elaeis guineensis
ref|XP_002531219.1|  histone-lysine n-methyltransferase, suvh, pu...    342   5e-112   
emb|CAN76871.1|  hypothetical protein VITISV_038835                     358   9e-112   Vitis vinifera
gb|KDO57056.1|  hypothetical protein CISIN_1g048157mg                   356   9e-112   Citrus sinensis [apfelsine]
ref|XP_006440180.1|  hypothetical protein CICLE_v100233292mg            347   1e-111   
ref|XP_006477091.1|  PREDICTED: histone-lysine N-methyltransferas...    355   2e-111   Citrus sinensis [apfelsine]
ref|XP_009412217.1|  PREDICTED: histone-lysine N-methyltransferas...    353   5e-110   
ref|XP_007039695.1|  SU(VAR)3-9, putative                               350   7e-110   
ref|XP_010104844.1|  Histone-lysine N-methyltransferase, H3 lysin...    351   3e-109   
ref|XP_010531690.1|  PREDICTED: histone-lysine N-methyltransferas...    347   7e-109   Tarenaya hassleriana [spider flower]
gb|KEH27478.1|  histone-lysine N-methyltransferase, suvh protein        346   3e-107   Medicago truncatula
ref|XP_011031970.1|  PREDICTED: histone-lysine N-methyltransferas...    343   6e-107   Populus euphratica
gb|KJB51780.1|  hypothetical protein B456_008G231400                    341   1e-106   Gossypium raimondii
emb|CBI29505.3|  unnamed protein product                                329   4e-106   Vitis vinifera
ref|XP_003611386.1|  Histone-lysine N-methyltransferase, H3 lysin...    343   4e-106   Medicago truncatula
ref|XP_008340758.1|  PREDICTED: histone-lysine N-methyltransferas...    335   7e-106   
ref|XP_011650376.1|  PREDICTED: histone-lysine N-methyltransferas...    340   1e-105   Cucumis sativus [cucumbers]
ref|XP_008386441.1|  PREDICTED: histone-lysine N-methyltransferas...    332   1e-105   
ref|XP_006385561.1|  hypothetical protein POPTR_0003s08130g             339   1e-105   
ref|XP_010672907.1|  PREDICTED: histone-lysine N-methyltransferas...    340   2e-105   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG00035.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    340   3e-105   Gossypium arboreum [tree cotton]
ref|XP_010919768.1|  PREDICTED: histone-lysine N-methyltransferas...    335   3e-105   Elaeis guineensis
ref|XP_008448779.1|  PREDICTED: histone-lysine N-methyltransferas...    338   3e-105   Cucumis melo [Oriental melon]
ref|XP_012070093.1|  PREDICTED: histone-lysine N-methyltransferas...    339   3e-105   Jatropha curcas
gb|KJB25462.1|  hypothetical protein B456_004G192900                    339   5e-105   Gossypium raimondii
ref|XP_004511737.1|  PREDICTED: histone-lysine N-methyltransferas...    339   7e-105   Cicer arietinum [garbanzo]
gb|EPS61767.1|  hypothetical protein M569_13026                         338   9e-105   Genlisea aurea
ref|XP_010258733.1|  PREDICTED: LOW QUALITY PROTEIN: histone-lysi...    339   1e-104   Nelumbo nucifera [Indian lotus]
emb|CDP08342.1|  unnamed protein product                                337   2e-104   Coffea canephora [robusta coffee]
emb|CDX89510.1|  BnaC04g35290D                                          329   1e-103   
ref|XP_006590581.1|  PREDICTED: histone-lysine N-methyltransferas...    336   2e-103   Glycine max [soybeans]
ref|XP_010055419.1|  PREDICTED: uncharacterized protein LOC104443628    335   2e-103   
gb|KHN34893.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    335   2e-103   Glycine soja [wild soybean]
ref|XP_009140380.1|  PREDICTED: histone-lysine N-methyltransferas...    327   2e-102   Brassica rapa
gb|KHG16641.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    331   2e-102   Gossypium arboreum [tree cotton]
ref|XP_010677133.1|  PREDICTED: histone-lysine N-methyltransferas...    327   3e-102   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010672910.1|  PREDICTED: histone-lysine N-methyltransferas...    331   5e-102   
gb|KHN42656.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    331   9e-102   Glycine soja [wild soybean]
ref|XP_003517399.2|  PREDICTED: histone-lysine N-methyltransferas...    331   9e-102   Glycine max [soybeans]
ref|XP_006293363.1|  hypothetical protein CARUB_v10022678mg             324   2e-101   Capsella rubella
ref|XP_009367580.1|  PREDICTED: histone-lysine N-methyltransferas...    330   2e-101   Pyrus x bretschneideri [bai li]
ref|XP_009367581.1|  PREDICTED: histone-lysine N-methyltransferas...    329   3e-101   Pyrus x bretschneideri [bai li]
emb|CDY25627.1|  BnaA04g13190D                                          322   6e-101   Brassica napus [oilseed rape]
ref|XP_010417031.1|  PREDICTED: histone-lysine N-methyltransferas...    323   1e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010429207.1|  PREDICTED: histone-lysine N-methyltransferas...    322   2e-100   
ref|XP_010429206.1|  PREDICTED: histone-lysine N-methyltransferas...    322   2e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010472268.1|  PREDICTED: histone-lysine N-methyltransferas...    321   4e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010472269.1|  PREDICTED: histone-lysine N-methyltransferas...    322   6e-100   Camelina sativa [gold-of-pleasure]
ref|XP_006410675.1|  hypothetical protein EUTSA_v10016339mg             318   8e-100   
ref|XP_002879534.1|  hypothetical protein ARALYDRAFT_902613             320   1e-99    Arabidopsis lyrata subsp. lyrata
ref|XP_010472267.1|  PREDICTED: histone-lysine N-methyltransferas...    321   1e-99    Camelina sativa [gold-of-pleasure]
ref|XP_004300536.1|  PREDICTED: histone-lysine N-methyltransferas...    325   2e-99    Fragaria vesca subsp. vesca
ref|XP_006404732.1|  hypothetical protein EUTSA_v10000700mg             318   3e-99    
ref|XP_008786195.1|  PREDICTED: histone-lysine N-methyltransferas...    317   6e-99    Phoenix dactylifera
gb|KEH28682.1|  histone-lysine N-methyltransferase, suvh protein        321   9e-99    Medicago truncatula
ref|XP_006293777.1|  hypothetical protein CARUB_v10022753mg             313   4e-98    Capsella rubella
ref|XP_010509646.1|  PREDICTED: histone-lysine N-methyltransferas...    311   4e-98    Camelina sativa [gold-of-pleasure]
gb|KDO52049.1|  hypothetical protein CISIN_1g047072mg                   310   4e-98    Citrus sinensis [apfelsine]
ref|XP_009378414.1|  PREDICTED: uncharacterized protein LOC103966914    322   1e-97    
ref|XP_010692065.1|  PREDICTED: uncharacterized protein LOC104905282    320   8e-97    
ref|XP_010505017.1|  PREDICTED: histone-lysine N-methyltransferas...    307   1e-96    Camelina sativa [gold-of-pleasure]
emb|CBI38579.3|  unnamed protein product                                305   1e-96    Vitis vinifera
gb|EMT10007.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    311   5e-95    
gb|EYU30751.1|  hypothetical protein MIMGU_mgv1a006459mg                297   1e-94    Erythranthe guttata [common monkey flower]
ref|XP_010412879.1|  PREDICTED: histone-lysine N-methyltransferas...    289   2e-94    Camelina sativa [gold-of-pleasure]
ref|XP_010662241.1|  PREDICTED: histone-lysine N-methyltransferas...    308   3e-94    Vitis vinifera
gb|AAL38815.1|  putative mammalian MHC III region protein G9a           305   4e-94    Arabidopsis thaliana [mouse-ear cress]
ref|NP_850030.1|  histone-lysine N-methyltransferase, H3 lysine-9...    305   4e-94    Arabidopsis thaliana [mouse-ear cress]
gb|AAD15582.1|  similar to mammalian MHC III region protein G9a         305   5e-94    Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ96303.1|  predicted protein                                      310   8e-94    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_181061.1|  histone-lysine N-methyltransferase, H3 lysine-9...    304   1e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010238096.1|  PREDICTED: uncharacterized protein LOC100825032    310   1e-93    
ref|XP_002880456.1|  predicted protein                                  303   3e-93    Arabidopsis lyrata subsp. lyrata
emb|CDY31670.1|  BnaA05g08770D                                          300   6e-93    Brassica napus [oilseed rape]
ref|XP_009143694.1|  PREDICTED: histone-lysine N-methyltransferas...    300   7e-93    Brassica rapa
gb|EEC83539.1|  hypothetical protein OsI_29152                          296   8e-93    Oryza sativa Indica Group [Indian rice]
ref|XP_007156589.1|  hypothetical protein PHAVU_002G001600g             307   9e-93    Phaseolus vulgaris [French bean]
emb|CBI38560.3|  unnamed protein product                                291   2e-92    Vitis vinifera
emb|CDX84255.1|  BnaC04g10170D                                          299   3e-92    
ref|XP_009593421.1|  PREDICTED: histone-lysine N-methyltransferas...    296   7e-92    Nicotiana tomentosiformis
ref|XP_009787520.1|  PREDICTED: histone-lysine N-methyltransferas...    295   2e-91    Nicotiana sylvestris
ref|NP_001053458.1|  Os04g0544100                                       298   3e-91    
ref|XP_004956663.1|  PREDICTED: uncharacterized protein LOC101783431    303   3e-91    Setaria italica
ref|XP_006477569.1|  PREDICTED: histone-lysine N-methyltransferas...    280   4e-91    Citrus sinensis [apfelsine]
gb|EMT23957.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    303   5e-91    
gb|EMS48020.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    303   5e-91    Triticum urartu
tpg|DAA36620.1|  TPA: putative histone-lysine N-methyltransferase...    298   7e-91    
gb|EAZ31512.1|  hypothetical protein OsJ_15653                          298   2e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010236682.1|  PREDICTED: histone-lysine N-methyltransferas...    300   3e-90    
ref|NP_001105193.1|  SET domain-containing protein SET104               296   3e-90    
emb|CDP04777.1|  unnamed protein product                                285   5e-90    Coffea canephora [robusta coffee]
gb|EYU20164.1|  hypothetical protein MIMGU_mgv1a020163mg                295   5e-90    Erythranthe guttata [common monkey flower]
ref|XP_009596759.1|  PREDICTED: histone-lysine N-methyltransferas...    296   6e-90    
ref|XP_004956427.1|  PREDICTED: histone-lysine N-methyltransferas...    296   6e-90    Setaria italica
gb|EEE68645.1|  hypothetical protein OsJ_27218                          298   7e-90    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001061753.1|  Os08g0400200                                       300   9e-90    
ref|XP_010318184.1|  PREDICTED: histone-lysine N-methyltransferas...    293   9e-90    
dbj|BAC98666.1|  putative histone-lysine N-methyltransferase            299   1e-89    Oryza sativa Japonica Group [Japonica rice]
gb|EEC77735.1|  hypothetical protein OsI_16848                          299   1e-89    Oryza sativa Indica Group [Indian rice]
ref|XP_003581482.1|  PREDICTED: histone-lysine N-methyltransferas...    295   1e-89    Brachypodium distachyon [annual false brome]
ref|XP_006440177.1|  hypothetical protein CICLE_v10022382mg             275   2e-89    
ref|XP_006653632.1|  PREDICTED: histone-lysine N-methyltransferas...    293   4e-89    Oryza brachyantha
dbj|BAK00408.1|  predicted protein                                      295   4e-89    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002277774.1|  PREDICTED: histone-lysine N-methyltransferas...    293   4e-89    Vitis vinifera
ref|XP_002448260.1|  hypothetical protein SORBIDRAFT_06g024160          294   5e-89    Sorghum bicolor [broomcorn]
ref|XP_010318182.1|  PREDICTED: histone-lysine N-methyltransferas...    291   1e-88    Solanum lycopersicum
gb|EMT18003.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    293   2e-88    
gb|EMS56150.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    292   5e-88    Triticum urartu
ref|XP_002460113.1|  hypothetical protein SORBIDRAFT_02g022936          294   9e-88    Sorghum bicolor [broomcorn]
ref|XP_004953299.1|  PREDICTED: histone-lysine N-methyltransferas...    288   1e-87    Setaria italica
ref|XP_008670146.1|  PREDICTED: uncharacterized protein LOC103647...    293   1e-87    
ref|XP_008670145.1|  PREDICTED: uncharacterized protein LOC103647...    293   1e-87    Zea mays [maize]
tpg|DAA39955.1|  TPA: putative histone-lysine N-methyltransferase...    293   1e-87    
ref|XP_006660109.1|  PREDICTED: uncharacterized protein LOC102710145    293   4e-87    Oryza brachyantha
ref|XP_009140381.1|  PREDICTED: histone-lysine N-methyltransferas...    285   6e-87    Brassica rapa
ref|XP_007038240.1|  SU(VAR)3-9, putative                               284   2e-86    
ref|XP_003604410.1|  Histone-lysine N-methyltransferase, H3 lysin...    276   3e-86    
gb|EEE61358.1|  hypothetical protein OsJ_15501                          272   3e-86    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006660567.1|  PREDICTED: histone-lysine N-methyltransferas...    286   9e-86    
emb|CAN80078.1|  hypothetical protein VITISV_029999                     285   2e-85    Vitis vinifera
ref|XP_006827872.1|  PREDICTED: histone-lysine N-methyltransferas...    280   5e-85    Amborella trichopoda
ref|XP_002445459.1|  hypothetical protein SORBIDRAFT_07g019863          273   1e-84    
emb|CDM87039.1|  unnamed protein product                                276   2e-84    Triticum aestivum [Canadian hard winter wheat]
emb|CDM87041.1|  unnamed protein product                                276   3e-84    Triticum aestivum [Canadian hard winter wheat]
ref|XP_002444303.1|  hypothetical protein SORBIDRAFT_07g019860          284   3e-84    Sorghum bicolor [broomcorn]
ref|XP_011076448.1|  PREDICTED: histone-lysine N-methyltransferas...    280   7e-84    Sesamum indicum [beniseed]
ref|XP_011076447.1|  PREDICTED: histone-lysine N-methyltransferas...    280   9e-84    
gb|EEC84442.1|  hypothetical protein OsI_31060                          278   4e-83    Oryza sativa Indica Group [Indian rice]
ref|NP_001062989.1|  Os09g0362900                                       278   5e-83    
ref|XP_004974671.1|  PREDICTED: uncharacterized protein LOC101771013    279   1e-82    Setaria italica
ref|XP_010104848.1|  Histone-lysine N-methyltransferase, H3 lysin...    263   2e-82    
ref|XP_003576441.1|  PREDICTED: uncharacterized protein LOC100843697    276   3e-82    Brachypodium distachyon [annual false brome]
ref|XP_010318185.1|  PREDICTED: histone-lysine N-methyltransferas...    273   5e-82    
ref|XP_006366727.1|  PREDICTED: histone-lysine N-methyltransferas...    275   6e-82    
gb|EMT10878.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    275   1e-81    
ref|XP_006648891.1|  PREDICTED: histone-lysine N-methyltransferas...    270   1e-81    Oryza brachyantha
ref|XP_002452826.1|  hypothetical protein SORBIDRAFT_04g033260          271   3e-81    Sorghum bicolor [broomcorn]
ref|XP_006366728.1|  PREDICTED: histone-lysine N-methyltransferas...    266   1e-80    
ref|XP_006366735.1|  PREDICTED: histone-lysine N-methyltransferas...    268   3e-80    
ref|XP_006827942.1|  PREDICTED: histone-lysine N-methyltransferas...    265   2e-79    Amborella trichopoda
ref|XP_006827874.1|  PREDICTED: histone-lysine N-methyltransferas...    265   2e-79    Amborella trichopoda
dbj|BAK05250.1|  predicted protein                                      248   3e-78    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002444302.1|  hypothetical protein SORBIDRAFT_07g019850          263   3e-77    
emb|CAN74696.1|  hypothetical protein VITISV_024649                     261   1e-76    Vitis vinifera
gb|KJB19630.1|  hypothetical protein B456_003G111600                    255   1e-75    Gossypium raimondii
gb|KJB19628.1|  hypothetical protein B456_003G111600                    255   3e-75    Gossypium raimondii
gb|KJB19627.1|  hypothetical protein B456_003G111600                    255   6e-75    Gossypium raimondii
gb|EMS57938.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    259   8e-75    Triticum urartu
gb|EMT25277.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    259   1e-74    
ref|XP_008671801.1|  PREDICTED: wall-associated receptor kinase 2...    235   4e-71    Zea mays [maize]
ref|XP_008664717.1|  PREDICTED: uncharacterized protein LOC103643...    246   4e-71    Zea mays [maize]
gb|KDP22486.1|  hypothetical protein JCGZ_26317                         229   1e-70    Jatropha curcas
ref|XP_008664718.1|  PREDICTED: uncharacterized protein LOC103643...    243   6e-70    
ref|XP_012090520.1|  PREDICTED: histone-lysine N-methyltransferas...    236   2e-69    
gb|KDP22485.1|  hypothetical protein JCGZ_26316                         236   2e-69    Jatropha curcas
ref|XP_002511028.1|  histone-lysine n-methyltransferase, suvh, pu...    236   2e-69    Ricinus communis
tpg|DAA49168.1|  TPA: putative histone-lysine N-methyltransferase...    226   3e-69    
ref|XP_004516278.1|  PREDICTED: histone-lysine N-methyltransferas...    234   5e-69    
ref|XP_012090774.1|  PREDICTED: LOW QUALITY PROTEIN: histone-lysi...    230   1e-67    Jatropha curcas
ref|XP_002979834.1|  hypothetical protein SELMODRAFT_111454             229   3e-67    
ref|XP_008368926.1|  PREDICTED: histone-lysine N-methyltransferas...    222   4e-67    
ref|XP_002976443.1|  hypothetical protein SELMODRAFT_104841             229   5e-67    
ref|XP_001753516.1|  histone methyltransferase Su3-9 group              209   5e-60    
ref|XP_010038409.1|  PREDICTED: histone-lysine N-methyltransferas...    210   5e-59    
gb|KHG01895.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    194   8e-58    Gossypium arboreum [tree cotton]
gb|EPS57959.1|  hypothetical protein M569_16858                         196   5e-57    Genlisea aurea
gb|KEH22374.1|  histone-lysine N-methyltransferase, suvh protein        201   6e-57    Medicago truncatula
ref|XP_001785269.1|  histone methyltransferase Su3-9 group              196   1e-56    
gb|ERN01547.1|  hypothetical protein AMTR_s00002p00271340               198   4e-56    Amborella trichopoda
ref|XP_010660678.1|  PREDICTED: histone-lysine N-methyltransferas...    201   6e-56    Vitis vinifera
ref|XP_010453502.1|  PREDICTED: histone-lysine N-methyltransferas...    191   1e-55    
ref|XP_002301759.2|  hypothetical protein POPTR_0002s23900g             192   1e-55    
gb|EYU20735.1|  hypothetical protein MIMGU_mgv1a005143mg                197   2e-55    Erythranthe guttata [common monkey flower]
ref|XP_007204245.1|  hypothetical protein PRUPE_ppa002266mg             200   2e-55    Prunus persica
ref|XP_011621748.1|  PREDICTED: histone-lysine N-methyltransferas...    197   2e-55    
gb|ERN19324.1|  hypothetical protein AMTR_s00069p00076340               195   5e-55    Amborella trichopoda
ref|XP_006385875.1|  hypothetical protein POPTR_0003s16130g             189   8e-55    
ref|XP_002511029.1|  histone-lysine n-methyltransferase, suvh, pu...    197   8e-55    Ricinus communis
ref|XP_007157737.1|  hypothetical protein PHAVU_002G094200g             198   9e-55    Phaseolus vulgaris [French bean]
gb|KHN46847.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    188   9e-55    Glycine soja [wild soybean]
ref|XP_009355081.1|  PREDICTED: histone-lysine N-methyltransferas...    198   9e-55    Pyrus x bretschneideri [bai li]
ref|XP_008242105.1|  PREDICTED: histone-lysine N-methyltransferas...    197   1e-54    Prunus mume [ume]
ref|XP_008375400.1|  PREDICTED: histone-lysine N-methyltransferas...    197   1e-54    
ref|XP_008245334.1|  PREDICTED: histone-lysine N-methyltransferas...    197   1e-54    Prunus mume [ume]
ref|XP_008346233.1|  PREDICTED: histone-lysine N-methyltransferas...    196   4e-54    Malus domestica [apple tree]
ref|XP_010249237.1|  PREDICTED: histone-lysine N-methyltransferas...    196   5e-54    Nelumbo nucifera [Indian lotus]
ref|XP_007220227.1|  hypothetical protein PRUPE_ppa002185mg             196   5e-54    Prunus persica
ref|XP_011628410.1|  PREDICTED: histone-lysine N-methyltransferas...    195   9e-54    
gb|KHN10157.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    192   1e-53    Glycine soja [wild soybean]
ref|XP_008810792.1|  PREDICTED: histone-lysine N-methyltransferas...    195   1e-53    Phoenix dactylifera
ref|XP_004970316.1|  PREDICTED: histone-lysine N-methyltransferas...    195   1e-53    Setaria italica
gb|KHN09548.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    191   2e-53    Glycine soja [wild soybean]
gb|KHN10323.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    191   2e-53    Glycine soja [wild soybean]
ref|XP_010682641.1|  PREDICTED: histone-lysine N-methyltransferas...    195   3e-53    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003556861.1|  PREDICTED: histone-lysine N-methyltransferas...    191   4e-53    Glycine max [soybeans]
ref|XP_007133570.1|  hypothetical protein PHAVU_011G190200g             192   5e-53    Phaseolus vulgaris [French bean]
ref|XP_004516550.1|  PREDICTED: histone-lysine N-methyltransferas...    193   6e-53    
ref|XP_002525581.1|  histone-lysine n-methyltransferase, suvh, pu...    192   6e-53    Ricinus communis
ref|XP_003546685.1|  PREDICTED: histone-lysine N-methyltransferas...    192   7e-53    Glycine max [soybeans]
ref|XP_006287619.1|  hypothetical protein CARUB_v10000831mg             189   8e-53    Capsella rubella
ref|XP_011098970.1|  PREDICTED: histone-lysine N-methyltransferas...    192   1e-52    
ref|XP_002273935.1|  PREDICTED: histone-lysine N-methyltransferas...    192   1e-52    Vitis vinifera
gb|KEH22454.1|  histone-lysine N-methyltransferase, suvh protein        189   1e-52    Medicago truncatula
ref|XP_003542785.2|  PREDICTED: histone-lysine N-methyltransferas...    192   1e-52    
ref|XP_006594267.1|  PREDICTED: histone-lysine N-methyltransferas...    192   1e-52    Glycine max [soybeans]
ref|XP_010067647.1|  PREDICTED: histone-lysine N-methyltransferas...    191   2e-52    Eucalyptus grandis [rose gum]
ref|XP_009413964.1|  PREDICTED: histone-lysine N-methyltransferas...    191   2e-52    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009413963.1|  PREDICTED: histone-lysine N-methyltransferas...    191   3e-52    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_012068760.1|  PREDICTED: histone-lysine N-methyltransferas...    191   3e-52    Jatropha curcas
emb|CBI29255.3|  unnamed protein product                                188   3e-52    Vitis vinifera
ref|XP_011024754.1|  PREDICTED: histone-lysine N-methyltransferas...    191   3e-52    Populus euphratica
ref|XP_010492182.1|  PREDICTED: histone-lysine N-methyltransferas...    190   3e-52    Camelina sativa [gold-of-pleasure]
ref|XP_006598996.1|  PREDICTED: histone-lysine N-methyltransferas...    191   3e-52    Glycine max [soybeans]
ref|XP_004516520.1|  PREDICTED: histone-lysine N-methyltransferas...    191   3e-52    
ref|XP_006399899.1|  hypothetical protein EUTSA_v10012985mg             190   4e-52    
ref|XP_010249238.1|  PREDICTED: histone-lysine N-methyltransferas...    191   4e-52    Nelumbo nucifera [Indian lotus]
ref|XP_010249235.1|  PREDICTED: histone-lysine N-methyltransferas...    191   4e-52    Nelumbo nucifera [Indian lotus]
ref|XP_006373665.1|  hypothetical protein POPTR_0016s02600g             190   5e-52    
ref|XP_010420016.1|  PREDICTED: histone-lysine N-methyltransferas...    190   5e-52    Camelina sativa [gold-of-pleasure]
ref|XP_003548493.1|  PREDICTED: histone-lysine N-methyltransferas...    190   6e-52    Glycine max [soybeans]
ref|XP_010315899.1|  PREDICTED: histone-lysine N-methyltransferas...    189   8e-52    Solanum lycopersicum
ref|XP_012067355.1|  PREDICTED: histone-lysine N-methyltransferas...    190   8e-52    Jatropha curcas
ref|XP_012067353.1|  PREDICTED: histone-lysine N-methyltransferas...    190   9e-52    Jatropha curcas
ref|XP_010657293.1|  PREDICTED: histone-lysine N-methyltransferas...    189   1e-51    Vitis vinifera
ref|XP_012067354.1|  PREDICTED: histone-lysine N-methyltransferas...    190   1e-51    Jatropha curcas
ref|XP_010657284.1|  PREDICTED: histone-lysine N-methyltransferas...    188   1e-51    
ref|XP_002963315.1|  hypothetical protein SELMODRAFT_79965              186   1e-51    
gb|KJB31593.1|  hypothetical protein B456_005G196900                    191   2e-51    Gossypium raimondii
gb|KJB31592.1|  hypothetical protein B456_005G196900                    191   2e-51    Gossypium raimondii
ref|XP_010908513.1|  PREDICTED: histone-lysine N-methyltransferas...    188   2e-51    Elaeis guineensis
ref|XP_002512666.1|  histone-lysine n-methyltransferase, suvh, pu...    182   2e-51    
ref|XP_008792425.1|  PREDICTED: histone-lysine N-methyltransferas...    188   2e-51    
ref|XP_007145458.1|  hypothetical protein PHAVU_007G240900g             186   3e-51    Phaseolus vulgaris [French bean]
ref|XP_004304345.1|  PREDICTED: histone-lysine N-methyltransferas...    188   3e-51    Fragaria vesca subsp. vesca
ref|XP_012066384.1|  PREDICTED: histone-lysine N-methyltransferas...    188   3e-51    
gb|KHN06910.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    188   3e-51    Glycine soja [wild soybean]
ref|XP_002871593.1|  hypothetical protein ARALYDRAFT_488222             187   3e-51    
gb|KDP46771.1|  hypothetical protein JCGZ_06559                         188   3e-51    Jatropha curcas
ref|XP_010068638.1|  PREDICTED: histone-lysine N-methyltransferas...    188   3e-51    Eucalyptus grandis [rose gum]
gb|KCW64295.1|  hypothetical protein EUGRSUZ_G01930                     188   3e-51    Eucalyptus grandis [rose gum]
ref|XP_010551947.1|  PREDICTED: histone-lysine N-methyltransferas...    187   4e-51    Tarenaya hassleriana [spider flower]
ref|XP_007223286.1|  hypothetical protein PRUPE_ppa005549mg             184   4e-51    
ref|XP_010551944.1|  PREDICTED: histone-lysine N-methyltransferas...    187   4e-51    Tarenaya hassleriana [spider flower]
gb|KEH19208.1|  histone-lysine N-methyltransferase                      187   5e-51    Medicago truncatula
ref|XP_007032028.1|  SET domain protein                                 187   5e-51    
gb|AAT47547.1|  SET domain protein                                      183   5e-51    Triticum aestivum [Canadian hard winter wheat]
pdb|4QEN|A  Chain A, Crystal Structure Of Kryptonite In Complex W...    186   5e-51    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009378806.1|  PREDICTED: histone-lysine N-methyltransferas...    187   7e-51    Pyrus x bretschneideri [bai li]
gb|AAO17392.1|  SET domain histone methyltransferase SUVH4              186   7e-51    Arabidopsis thaliana [mouse-ear cress]
ref|NP_196900.1|  histone-lysine N-methyltransferase, H3 lysine-9...    186   8e-51    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006338811.1|  PREDICTED: histone-lysine N-methyltransferas...    187   8e-51    Solanum tuberosum [potatoes]
ref|XP_006604199.1|  PREDICTED: histone-lysine N-methyltransferas...    187   9e-51    Glycine max [soybeans]
ref|XP_003522868.1|  PREDICTED: histone-lysine N-methyltransferas...    187   9e-51    Glycine max [soybeans]
ref|XP_002456515.1|  hypothetical protein SORBIDRAFT_03g037660          187   9e-51    Sorghum bicolor [broomcorn]
gb|KJB46163.1|  hypothetical protein B456_007G350900                    187   9e-51    Gossypium raimondii
ref|XP_002278728.1|  PREDICTED: histone-lysine N-methyltransferas...    187   1e-50    Vitis vinifera
gb|KDO57379.1|  hypothetical protein CISIN_1g008407mg                   185   1e-50    Citrus sinensis [apfelsine]
emb|CDP16741.1|  unnamed protein product                                186   1e-50    Coffea canephora [robusta coffee]
ref|XP_008390202.1|  PREDICTED: histone-lysine N-methyltransferas...    186   1e-50    
ref|XP_008390201.1|  PREDICTED: histone-lysine N-methyltransferas...    186   2e-50    
gb|KHG24298.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    187   2e-50    
ref|XP_009402448.1|  PREDICTED: histone-lysine N-methyltransferas...    186   2e-50    
gb|KEH32911.1|  histone-lysine N-methyltransferase                      186   2e-50    
emb|CDX78549.1|  BnaA03g04610D                                          185   2e-50    
gb|KHG20805.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    186   2e-50    
ref|XP_003622797.1|  Histone-lysine N-methyltransferase, H3 lysin...    184   2e-50    
ref|XP_006481990.1|  PREDICTED: histone-lysine N-methyltransferas...    186   3e-50    
ref|XP_006430451.1|  hypothetical protein CICLE_v10013410mg             186   3e-50    
ref|XP_008369632.1|  PREDICTED: histone-lysine N-methyltransferas...    185   3e-50    
ref|XP_004492282.1|  PREDICTED: histone-lysine N-methyltransferas...    184   3e-50    
gb|AES79015.2|  SET-domain protein lysine methyltransferase famil...    184   3e-50    
ref|XP_011041327.1|  PREDICTED: histone-lysine N-methyltransferas...    185   3e-50    
ref|XP_006654577.1|  PREDICTED: histone-lysine N-methyltransferas...    185   3e-50    
ref|XP_009131370.1|  PREDICTED: histone-lysine N-methyltransferas...    184   3e-50    
ref|NP_001055903.1|  Os05g0490700                                       185   4e-50    
ref|XP_010922133.1|  PREDICTED: histone-lysine N-methyltransferas...    185   4e-50    
emb|CDP18981.1|  unnamed protein product                                184   5e-50    
ref|XP_010927781.1|  PREDICTED: histone-lysine N-methyltransferas...    185   5e-50    
gb|AES80724.2|  histone-lysine N-methyltransferase, suvh protein        185   5e-50    
ref|XP_006432316.1|  hypothetical protein CICLE_v10000524mg             184   5e-50    
gb|KDO47766.1|  hypothetical protein CISIN_1g006089mg                   184   6e-50    
ref|XP_008449991.1|  PREDICTED: histone-lysine N-methyltransferas...    184   7e-50    
ref|XP_008790686.1|  PREDICTED: histone-lysine N-methyltransferas...    184   7e-50    
ref|NP_001105103.1|  LOC541980                                          184   7e-50    
ref|XP_009599650.1|  PREDICTED: histone-lysine N-methyltransferas...    184   7e-50    
ref|XP_007145455.1|  hypothetical protein PHAVU_007G240800g             182   9e-50    
ref|XP_011651591.1|  PREDICTED: histone-lysine N-methyltransferas...    184   9e-50    
ref|XP_002974605.1|  hypothetical protein SELMODRAFT_232379             183   9e-50    
ref|XP_010682904.1|  PREDICTED: histone-lysine N-methyltransferas...    184   1e-49    
ref|XP_004955821.1|  PREDICTED: histone-lysine N-methyltransferas...    184   1e-49    
ref|XP_008812115.1|  PREDICTED: histone-lysine N-methyltransferas...    184   1e-49    
gb|AAK28969.1|AF344447_1  SUVH4                                         183   1e-49    
ref|XP_009800277.1|  PREDICTED: histone-lysine N-methyltransferas...    183   1e-49    
emb|CDX70530.1|  BnaC03g06140D                                          182   1e-49    
ref|XP_007216995.1|  hypothetical protein PRUPE_ppa002574mg             183   1e-49    
ref|XP_006832937.1|  PREDICTED: histone-lysine N-methyltransferas...    183   2e-49    
gb|KJB76300.1|  hypothetical protein B456_012G082600                    183   2e-49    
ref|NP_001146568.1|  uncharacterized protein LOC100280164               184   2e-49    
tpg|DAA60043.1|  TPA: putative histone-lysine N-methyltransferase...    184   2e-49    
ref|XP_008362081.1|  PREDICTED: histone-lysine N-methyltransferas...    179   2e-49    
gb|EMT31327.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    186   2e-49    
ref|XP_008222410.1|  PREDICTED: histone-lysine N-methyltransferas...    182   3e-49    
ref|XP_004493077.1|  PREDICTED: histone-lysine N-methyltransferas...    183   3e-49    
ref|XP_004961670.1|  PREDICTED: histone-lysine N-methyltransferas...    182   3e-49    
ref|XP_004295500.1|  PREDICTED: histone-lysine N-methyltransferas...    178   3e-49    
ref|XP_011020881.1|  PREDICTED: histone-lysine N-methyltransferas...    182   4e-49    
ref|XP_009412778.1|  PREDICTED: histone-lysine N-methyltransferas...    182   4e-49    
ref|XP_011020882.1|  PREDICTED: histone-lysine N-methyltransferas...    182   4e-49    
ref|XP_011020878.1|  PREDICTED: histone-lysine N-methyltransferas...    182   4e-49    
gb|KCW73571.1|  hypothetical protein EUGRSUZ_E02125                     172   4e-49    
ref|XP_004963803.1|  PREDICTED: histone-lysine N-methyltransferas...    181   5e-49    
ref|XP_006644882.1|  PREDICTED: histone-lysine N-methyltransferas...    182   5e-49    
ref|XP_008351096.1|  PREDICTED: histone-lysine N-methyltransferas...    173   5e-49    
ref|XP_009359881.1|  PREDICTED: histone-lysine N-methyltransferas...    182   6e-49    
ref|XP_001627377.1|  predicted protein                                  171   6e-49    
ref|XP_007221189.1|  hypothetical protein PRUPE_ppa021683mg             179   7e-49    
ref|XP_010056744.1|  PREDICTED: histone-lysine N-methyltransferas...    172   7e-49    
ref|XP_010540062.1|  PREDICTED: histone-lysine N-methyltransferas...    181   8e-49    
ref|XP_006662703.1|  PREDICTED: histone-lysine N-methyltransferas...    181   9e-49    
ref|XP_010694671.1|  PREDICTED: histone-lysine N-methyltransferas...    181   9e-49    
ref|XP_006380952.1|  hypothetical protein POPTR_0006s02840g             181   1e-48    
ref|XP_006665135.1|  PREDICTED: histone-lysine N-methyltransferas...    181   1e-48    
ref|XP_002441025.1|  hypothetical protein SORBIDRAFT_09g019060          181   1e-48    
ref|XP_004298233.1|  PREDICTED: histone-lysine N-methyltransferas...    177   1e-48    
ref|XP_007148768.1|  hypothetical protein PHAVU_005G012600g             181   1e-48    
ref|NP_001068229.1|  Os11g0602200                                       181   1e-48    
ref|XP_006289738.1|  hypothetical protein CARUB_v10003306mg             181   1e-48    
dbj|BAK03921.1|  predicted protein                                      180   2e-48    
ref|XP_007010662.1|  SU(VAR)3-9, putative                               180   3e-48    
ref|XP_008387456.1|  PREDICTED: histone-lysine N-methyltransferas...    180   3e-48    
gb|AAK28975.1|AF344453_1  SET1                                          181   3e-48    
ref|NP_001105205.1|  SET domain protein SDG111                          179   3e-48    
gb|EEE52696.1|  hypothetical protein OsJ_35096                          177   3e-48    
gb|ACN26493.1|  unknown                                                 179   3e-48    
ref|XP_008648289.1|  PREDICTED: SET domain protein SDG111 isoform X1    179   3e-48    
ref|XP_004493303.1|  PREDICTED: histone-lysine N-methyltransferas...    179   3e-48    
emb|CBX25223.1|  hypothetical_protein                                   179   4e-48    
gb|EMT00374.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    181   5e-48    
ref|XP_010228218.1|  PREDICTED: histone-lysine N-methyltransferas...    180   5e-48    
ref|XP_009378048.1|  PREDICTED: histone-lysine N-methyltransferas...    179   5e-48    
ref|XP_003577855.1|  PREDICTED: histone-lysine N-methyltransferas...    179   5e-48    
gb|KJB60356.1|  hypothetical protein B456_009G301500                    179   6e-48    
ref|XP_008231238.1|  PREDICTED: histone-lysine N-methyltransferas...    178   6e-48    
ref|XP_008794904.1|  PREDICTED: histone-lysine N-methyltransferas...    179   6e-48    
ref|XP_002459560.1|  hypothetical protein SORBIDRAFT_02g006620          179   6e-48    
ref|XP_008231237.1|  PREDICTED: histone-lysine N-methyltransferas...    179   6e-48    
ref|XP_008794905.1|  PREDICTED: histone-lysine N-methyltransferas...    179   7e-48    
ref|XP_008794907.1|  PREDICTED: histone-lysine N-methyltransferas...    179   8e-48    
gb|ACG45582.1|  histone-lysine N-methyltransferase, H3 lysine-9 s...    178   8e-48    
ref|NP_001105189.1|  LOC542085                                          178   8e-48    
gb|AFW82359.1|  putative histone-lysine N-methyltransferase famil...    178   9e-48    
gb|EAZ17301.1|  hypothetical protein OsJ_32823                          177   9e-48    
ref|XP_012088720.1|  PREDICTED: uncharacterized protein LOC105647305    179   9e-48    
gb|EMT27876.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    178   1e-47    
emb|CBX25408.1|  hypothetical_protein                                   177   1e-47    
ref|XP_006301095.1|  hypothetical protein CARUB_v10021489mg             177   1e-47    
gb|EAY82148.1|  hypothetical protein OsI_37343                          177   2e-47    
ref|XP_003624859.1|  Histone-lysine N-methyltransferase, H3 lysin...    177   2e-47    
ref|XP_004964989.1|  PREDICTED: histone-lysine N-methyltransferas...    178   2e-47    
gb|KJB75021.1|  hypothetical protein B456_012G020600                    177   2e-47    
ref|XP_006446928.1|  hypothetical protein CICLE_v10016275mg             169   2e-47    
ref|XP_002446071.1|  hypothetical protein SORBIDRAFT_06g001340          177   3e-47    
gb|EAZ13903.1|  hypothetical protein OsJ_03828                          177   3e-47    
emb|CDY11129.1|  BnaC06g23810D                                          177   3e-47    
ref|XP_009105964.1|  PREDICTED: histone-lysine N-methyltransferas...    177   3e-47    
ref|XP_010233246.1|  PREDICTED: histone-lysine N-methyltransferas...    174   3e-47    
ref|NP_001044590.1|  Os01g0811300                                       177   3e-47    
dbj|BAK07224.1|  predicted protein                                      177   4e-47    
gb|EMS67094.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    176   4e-47    
gb|EAY76229.1|  hypothetical protein OsI_04165                          177   4e-47    
ref|XP_009345189.1|  PREDICTED: histone-lysine N-methyltransferas...    176   5e-47    
ref|XP_006645268.1|  PREDICTED: histone-lysine N-methyltransferas...    176   5e-47    
ref|XP_006398950.1|  hypothetical protein EUTSA_v10012854mg             176   5e-47    
ref|XP_010031050.1|  PREDICTED: histone-lysine N-methyltransferas...    176   5e-47    
ref|XP_010471360.1|  PREDICTED: histone-lysine N-methyltransferas...    176   6e-47    
ref|XP_004310138.2|  PREDICTED: histone-lysine N-methyltransferas...    176   6e-47    
ref|XP_002873176.1|  hypothetical protein ARALYDRAFT_487281             176   6e-47    
gb|EEC67596.1|  hypothetical protein OsI_34964                          176   7e-47    
ref|XP_004304567.1|  PREDICTED: histone-lysine N-methyltransferas...    176   7e-47    
emb|CDY61331.1|  BnaC06g43300D                                          176   7e-47    
ref|XP_010452396.1|  PREDICTED: histone-lysine N-methyltransferas...    175   8e-47    
ref|XP_002441295.1|  hypothetical protein SORBIDRAFT_09g024010          176   8e-47    
dbj|BAJ90346.1|  predicted protein                                      176   8e-47    
ref|XP_010100032.1|  Histone-lysine N-methyltransferase, H3 lysin...    173   9e-47    
gb|KEH26476.1|  histone-lysine N-methyltransferase, suvh protein        176   9e-47    
ref|XP_004977452.1|  PREDICTED: histone-lysine N-methyltransferas...    175   9e-47    
ref|XP_010423514.1|  PREDICTED: histone-lysine N-methyltransferas...    175   9e-47    
ref|XP_011040692.1|  PREDICTED: histone-lysine N-methyltransferas...    175   1e-46    
ref|XP_009377641.1|  PREDICTED: histone-lysine N-methyltransferas...    175   1e-46    
ref|XP_006398951.1|  hypothetical protein EUTSA_v10015751mg             175   1e-46    
gb|EMT14567.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    176   1e-46    
gb|KHG09941.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    175   2e-46    
ref|XP_008379740.1|  PREDICTED: histone-lysine N-methyltransferas...    175   2e-46    
emb|CDP14340.1|  unnamed protein product                                175   2e-46    
gb|KEH20246.1|  histone-lysine N-methyltransferase, suvh protein,...    175   2e-46    
ref|XP_009105582.1|  PREDICTED: histone-lysine N-methyltransferas...    170   2e-46    
gb|ABA91349.2|  YDG/SRA domain containing protein                       174   3e-46    
gb|EMS45781.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    168   3e-46    
emb|CDX96449.1|  BnaA07g30600D                                          174   3e-46    
ref|XP_011073728.1|  PREDICTED: histone-lysine N-methyltransferas...    174   3e-46    
ref|XP_004956073.1|  PREDICTED: histone-lysine N-methyltransferas...    174   3e-46    
ref|XP_006390593.1|  hypothetical protein EUTSA_v10018201mg             174   3e-46    
ref|XP_006658509.1|  PREDICTED: histone-lysine N-methyltransferas...    172   4e-46    
ref|XP_003565778.1|  PREDICTED: histone-lysine N-methyltransferas...    174   4e-46    
ref|XP_002459773.1|  hypothetical protein SORBIDRAFT_02g010210          174   4e-46    
gb|EAZ39600.1|  hypothetical protein OsJ_24035                          173   4e-46    
ref|XP_006576757.1|  PREDICTED: histone-lysine N-methyltransferas...    174   4e-46    
gb|EAZ03669.1|  hypothetical protein OsI_25806                          173   4e-46    
ref|XP_010251776.1|  PREDICTED: histone-lysine N-methyltransferas...    174   5e-46    
ref|NP_001059503.1|  Os07g0435900                                       173   5e-46    
ref|XP_004134031.1|  PREDICTED: histone-lysine N-methyltransferas...    173   5e-46    
ref|XP_002887472.1|  hypothetical protein ARALYDRAFT_895166             173   5e-46    
ref|XP_008438443.1|  PREDICTED: histone-lysine N-methyltransferas...    173   5e-46    
ref|NP_196113.1|  histone-lysine N-methyltransferase, H3 lysine-9...    173   5e-46    
ref|NP_565056.1|  histone-lysine N-methyltransferase, H3 lysine-9...    173   6e-46    
tpg|DAA56024.1|  TPA: putative histone-lysine N-methyltransferase...    173   6e-46    
ref|XP_008651237.1|  PREDICTED: putative histone-lysine N-methylt...    173   6e-46    
gb|AAK28968.1|AF344446_1  SUVH3                                         173   6e-46    
ref|XP_011079236.1|  PREDICTED: histone-lysine N-methyltransferas...    173   6e-46    
gb|EEE52363.1|  hypothetical protein OsJ_34427                          172   7e-46    
ref|XP_004249103.1|  PREDICTED: histone-lysine N-methyltransferas...    173   7e-46    
ref|XP_003564983.1|  PREDICTED: histone-lysine N-methyltransferas...    173   8e-46    
ref|XP_010543637.1|  PREDICTED: histone-lysine N-methyltransferas...    173   8e-46    
gb|EMT28609.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    167   8e-46    
gb|EEC68444.1|  hypothetical protein OsI_36654                          171   8e-46    
ref|XP_008392516.1|  PREDICTED: histone-lysine N-methyltransferas...    172   9e-46    
ref|XP_003624506.1|  Histone-lysine N-methyltransferase, H3 lysin...    174   9e-46    
ref|XP_010111329.1|  Histone-lysine N-methyltransferase, H3 lysin...    172   1e-45    
gb|EMS55885.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    173   1e-45    
ref|XP_011091359.1|  PREDICTED: histone-lysine N-methyltransferas...    172   1e-45    
ref|XP_008670073.1|  PREDICTED: histone-lysine N-methyltransferas...    172   1e-45    
gb|AAT47546.1|  SET domain protein                                      172   1e-45    
emb|CDX68245.1|  BnaA07g22850D                                          172   2e-45    
ref|XP_007204614.1|  hypothetical protein PRUPE_ppa002428mg             172   2e-45    
emb|CDY11319.1|  BnaA03g01550D                                          171   2e-45    
ref|XP_010491024.1|  PREDICTED: histone-lysine N-methyltransferas...    171   2e-45    
ref|XP_007219600.1|  hypothetical protein PRUPE_ppa023039mg             171   2e-45    
ref|XP_003577097.1|  PREDICTED: histone-lysine N-methyltransferas...    171   2e-45    
gb|EYU32604.1|  hypothetical protein MIMGU_mgv1a002504mg                171   2e-45    
ref|XP_010918849.1|  PREDICTED: histone-lysine N-methyltransferas...    171   3e-45    
ref|XP_007153112.1|  hypothetical protein PHAVU_003G007700g             171   3e-45    
gb|EYU43777.1|  hypothetical protein MIMGU_mgv1a002557mg                171   3e-45    
ref|XP_007161852.1|  hypothetical protein PHAVU_001G103400g             171   3e-45    
gb|KEH26471.1|  histone-lysine N-methyltransferase, suvh protein        171   3e-45    
gb|KCW62523.1|  hypothetical protein EUGRSUZ_G00011                     162   3e-45    
gb|KEH20245.1|  histone-lysine N-methyltransferase, suvh protein,...    171   4e-45    
ref|XP_006364759.1|  PREDICTED: histone-lysine N-methyltransferas...    171   4e-45    
ref|XP_009592261.1|  PREDICTED: histone-lysine N-methyltransferas...    171   4e-45    
ref|XP_004509600.1|  PREDICTED: probable histone-lysine N-methylt...    171   4e-45    
emb|CDX80930.1|  BnaC03g01840D                                          171   4e-45    
ref|XP_008240616.1|  PREDICTED: histone-lysine N-methyltransferas...    171   4e-45    
ref|XP_004292255.1|  PREDICTED: histone-lysine N-methyltransferas...    171   4e-45    
ref|XP_006342680.1|  PREDICTED: probable histone-lysine N-methylt...    171   5e-45    
ref|XP_003563196.1|  PREDICTED: histone-lysine N-methyltransferas...    171   5e-45    
gb|EMS66201.1|  Histone-lysine N-methyltransferase, H3 lysine-9, ...    170   5e-45    
ref|XP_011034626.1|  PREDICTED: histone-lysine N-methyltransferas...    170   6e-45    
dbj|BAK07491.1|  predicted protein                                      170   6e-45    
ref|XP_002303967.1|  Histone-lysine N-methyltransferase family pr...    170   6e-45    
ref|XP_002456885.1|  hypothetical protein SORBIDRAFT_03g044580          170   6e-45    
dbj|BAK01121.1|  predicted protein                                      170   6e-45    
ref|XP_010416089.1|  PREDICTED: histone-lysine N-methyltransferas...    170   7e-45    
ref|XP_002880619.1|  hypothetical protein ARALYDRAFT_344061             169   7e-45    
ref|XP_006468896.1|  PREDICTED: histone-lysine N-methyltransferas...    170   7e-45    
emb|CDY59935.1|  BnaC06g43880D                                          170   7e-45    
gb|EMT20679.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    171   8e-45    
gb|KHN34575.1|  Histone-lysine N-methyltransferase, H3 lysine-9 s...    170   8e-45    
emb|CDM85859.1|  unnamed protein product                                169   9e-45    
ref|XP_011070040.1|  PREDICTED: histone-lysine N-methyltransferas...    170   1e-44    
ref|XP_004980111.1|  PREDICTED: histone-lysine N-methyltransferas...    169   1e-44    
gb|KHM99040.1|  Putative histone-lysine N-methyltransferase, H3 l...    169   1e-44    
ref|XP_006368654.1|  hypothetical protein POPTR_0001s07390g             169   1e-44    
ref|XP_004971141.1|  PREDICTED: histone-lysine N-methyltransferas...    169   1e-44    
ref|XP_003556615.1|  PREDICTED: probable histone-lysine N-methylt...    169   2e-44    
gb|EYU20838.1|  hypothetical protein MIMGU_mgv1a002144mg                169   2e-44    
ref|XP_004144645.1|  PREDICTED: histone-lysine N-methyltransferas...    169   2e-44    
ref|XP_003637253.1|  Histone-lysine N-methyltransferase SETDB1          164   2e-44    
ref|XP_002878789.1|  predicted protein                                  168   3e-44    
ref|XP_009130849.1|  PREDICTED: histone-lysine N-methyltransferas...    168   4e-44    
gb|KEH20298.1|  histone-lysine N-methyltransferase, suvh protein,...    168   4e-44    
ref|XP_009122547.1|  PREDICTED: histone-lysine N-methyltransferas...    167   4e-44    
gb|EAY98515.1|  hypothetical protein OsI_20427                          168   4e-44    



>ref|XP_004241982.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Solanum lycopersicum]
Length=1055

 Score =   388 bits (996),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 202/219 (92%), Gaps = 2/219 (1%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             +KC+CAV+NGGE+PYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQ+GIK+ LEIFKT 
Sbjct  839   KKCSCAVKNGGEIPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQHGIKVPLEIFKTN  898

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
             SRGWGVR+LTSIPSGTFICEY GELLEDKEAE+RIGSDEYLFDIG NYSDCS+N S Q  
Sbjct  899   SRGWGVRALTSIPSGTFICEYVGELLEDKEAEQRIGSDEYLFDIGQNYSDCSVNSSRQ-A  957

Query  379   TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
               SE VEE G+TIDAA+YGN+GRFINHSCSPNLYAQ+VLYD++D+K+PHIMLFA +NI P
Sbjct  958   EVSEVVEE-GYTIDAAQYGNIGRFINHSCSPNLYAQSVLYDHEDKKMPHIMLFAADNIPP  1016

Query  199   LRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             L EL+YHYNY+VDQV DS GNIKVK+CFCGS+EC+GR+Y
Sbjct  1017  LAELSYHYNYSVDQVHDSKGNIKVKKCFCGSSECSGRMY  1055



>ref|XP_011081855.1| PREDICTED: uncharacterized protein LOC105164786 [Sesamum indicum]
 ref|XP_011081856.1| PREDICTED: uncharacterized protein LOC105164786 [Sesamum indicum]
Length=1226

 Score =   390 bits (1001),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 173/219 (79%), Positives = 201/219 (92%), Gaps = 1/219 (0%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             +KC CAVRNGGE+PYNRNGA+VE KPLVYECGPHCKCPP+CYNRVSQ GIK QLEIFKTE
Sbjct  1009  KKCRCAVRNGGEIPYNRNGALVETKPLVYECGPHCKCPPACYNRVSQRGIKFQLEIFKTE  1068

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
             SRGWGVR LTSIPSG+FICEYAGELLEDKEAE++IG+DEYLFDIG NY D S+  S  + 
Sbjct  1069  SRGWGVRPLTSIPSGSFICEYAGELLEDKEAEQKIGNDEYLFDIGQNYGDSSLK-SEDQA  1127

Query  379   TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
             +S E +EEVG+TIDAA+YGN+GRFINHSC PNLYAQNV+YD+DDRK+PH+MLFA++NI P
Sbjct  1128  SSVEHIEEVGYTIDAAQYGNIGRFINHSCLPNLYAQNVIYDHDDRKMPHVMLFAMDNIPP  1187

Query  199   LRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             L+ELTYHYNY+VDQ+RDS GNIKVK+C+CG+AECTGR+Y
Sbjct  1188  LQELTYHYNYSVDQIRDSDGNIKVKKCYCGTAECTGRMY  1226



>ref|XP_009785592.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like isoform X2 [Nicotiana sylvestris]
Length=1051

 Score =   386 bits (992),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 201/219 (92%), Gaps = 1/219 (0%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             ++C+CAV+NGGE+PYNRNGAIVEVKPLVYECGP CKCPPSCYNRV Q+GIKI LEIFKT 
Sbjct  834   KRCSCAVKNGGEIPYNRNGAIVEVKPLVYECGPSCKCPPSCYNRVGQHGIKIPLEIFKTN  893

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
             SRGWGVR+LTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG NYSDCS+N S Q  
Sbjct  894   SRGWGVRALTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGQNYSDCSVNSSTQ-A  952

Query  379   TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
               SE VEE G+TIDAA+ GNVGRFINHSCSPNLYAQNVLYD++D+K+PHIM FA +NI P
Sbjct  953   ELSEVVEEGGYTIDAAQCGNVGRFINHSCSPNLYAQNVLYDHEDKKMPHIMFFAADNIPP  1012

Query  199   LRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             L EL+YHYNY+VDQVRDS+GNIKVK+C+CGS+EC+GR+Y
Sbjct  1013  LAELSYHYNYSVDQVRDSNGNIKVKKCYCGSSECSGRMY  1051



>ref|XP_006361159.1| PREDICTED: uncharacterized protein LOC102599225 [Solanum tuberosum]
Length=1064

 Score =   386 bits (992),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 202/219 (92%), Gaps = 2/219 (1%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             +KC+CAV+NGGE+PYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQ+GIK+ LEIFKT 
Sbjct  848   KKCSCAVKNGGEIPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQHGIKVPLEIFKTN  907

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
             SRGWGVR+LTSIPSGTFICEY GELLEDKEAE+RIGSDEYLFDIG NYSDCS+N S Q  
Sbjct  908   SRGWGVRALTSIPSGTFICEYVGELLEDKEAEQRIGSDEYLFDIGQNYSDCSVNSSRQ-A  966

Query  379   TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
               SE VEE G+TIDAA+YGN+GRFINHSCSPNLYAQ+VLYD++D+K+PHIMLFA +NI P
Sbjct  967   ELSEVVEE-GYTIDAAQYGNIGRFINHSCSPNLYAQSVLYDHEDKKMPHIMLFAADNIPP  1025

Query  199   LRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             L EL+YHYNY+VDQV DS GNIKVK+CFCGS+EC+GR+Y
Sbjct  1026  LAELSYHYNYSVDQVHDSKGNIKVKKCFCGSSECSGRMY  1064



>ref|XP_009626896.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like isoform X2 [Nicotiana tomentosiformis]
Length=1052

 Score =   386 bits (991),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 200/219 (91%), Gaps = 1/219 (0%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             +KC+CAV+NGGE+PYNRNGAIVEVKPLVYECGP CKCPPSCYNRV Q+GIKI LEIFKT 
Sbjct  835   KKCSCAVKNGGEIPYNRNGAIVEVKPLVYECGPSCKCPPSCYNRVGQHGIKIPLEIFKTN  894

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
             SRGWGVR+LTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG NYSDCS+N S Q  
Sbjct  895   SRGWGVRALTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGQNYSDCSVNSSAQ-A  953

Query  379   TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
               SE VEE G+TIDAA+ GNVGRFINHSCSPNLYAQNVLYD++D+K+PHIM FA +NI P
Sbjct  954   ELSEVVEEGGYTIDAAQCGNVGRFINHSCSPNLYAQNVLYDHEDKKMPHIMFFAADNIPP  1013

Query  199   LRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             L EL+YHYNY+VDQV DS+GNIKVK+C+CGS+EC+GR+Y
Sbjct  1014  LAELSYHYNYSVDQVHDSNGNIKVKKCYCGSSECSGRMY  1052



>ref|XP_009626893.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009626894.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009626895.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like isoform X1 [Nicotiana tomentosiformis]
Length=1085

 Score =   386 bits (992),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 200/219 (91%), Gaps = 1/219 (0%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             +KC+CAV+NGGE+PYNRNGAIVEVKPLVYECGP CKCPPSCYNRV Q+GIKI LEIFKT 
Sbjct  868   KKCSCAVKNGGEIPYNRNGAIVEVKPLVYECGPSCKCPPSCYNRVGQHGIKIPLEIFKTN  927

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
             SRGWGVR+LTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG NYSDCS+N S Q  
Sbjct  928   SRGWGVRALTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGQNYSDCSVNSSAQ-A  986

Query  379   TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
               SE VEE G+TIDAA+ GNVGRFINHSCSPNLYAQNVLYD++D+K+PHIM FA +NI P
Sbjct  987   ELSEVVEEGGYTIDAAQCGNVGRFINHSCSPNLYAQNVLYDHEDKKMPHIMFFAADNIPP  1046

Query  199   LRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             L EL+YHYNY+VDQV DS+GNIKVK+C+CGS+EC+GR+Y
Sbjct  1047  LAELSYHYNYSVDQVHDSNGNIKVKKCYCGSSECSGRMY  1085



>ref|XP_009785591.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like isoform X1 [Nicotiana sylvestris]
Length=1084

 Score =   386 bits (992),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 201/219 (92%), Gaps = 1/219 (0%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             ++C+CAV+NGGE+PYNRNGAIVEVKPLVYECGP CKCPPSCYNRV Q+GIKI LEIFKT 
Sbjct  867   KRCSCAVKNGGEIPYNRNGAIVEVKPLVYECGPSCKCPPSCYNRVGQHGIKIPLEIFKTN  926

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
             SRGWGVR+LTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG NYSDCS+N S Q  
Sbjct  927   SRGWGVRALTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGQNYSDCSVNSSTQ-A  985

Query  379   TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
               SE VEE G+TIDAA+ GNVGRFINHSCSPNLYAQNVLYD++D+K+PHIM FA +NI P
Sbjct  986   ELSEVVEEGGYTIDAAQCGNVGRFINHSCSPNLYAQNVLYDHEDKKMPHIMFFAADNIPP  1045

Query  199   LRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             L EL+YHYNY+VDQVRDS+GNIKVK+C+CGS+EC+GR+Y
Sbjct  1046  LAELSYHYNYSVDQVRDSNGNIKVKKCYCGSSECSGRMY  1084



>ref|XP_006359220.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH5-like [Solanum tuberosum]
Length=769

 Score =   369 bits (947),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 169/219 (77%), Positives = 194/219 (89%), Gaps = 1/219 (0%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            ++C+CAV+NGGE+PYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQ+GIKI LEIFKT+
Sbjct  552  KRCSCAVKNGGEIPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQHGIKIPLEIFKTD  611

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
            +RGWGVR+LTSI SGTFICEY G+LLED EAERRIG DEYLFDIG NY   + N SGQ  
Sbjct  612  TRGWGVRALTSISSGTFICEYTGQLLEDTEAERRIGMDEYLFDIGQNYGGYTANSSGQ-A  670

Query  379  TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
              +E VEE G+TIDAA YGNVGRFINHSCSPNLYAQNV+YD+ D++VPHIMLFA +NI P
Sbjct  671  NQNELVEEGGYTIDAARYGNVGRFINHSCSPNLYAQNVVYDHKDKRVPHIMLFAADNIPP  730

Query  199  LRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            L+EL+YHYNY VDQV DS G IKVK+CFCGS++C+GR+Y
Sbjct  731  LKELSYHYNYVVDQVYDSGGKIKVKRCFCGSSDCSGRMY  769



>ref|XP_009600586.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH1-like [Nicotiana tomentosiformis]
 ref|XP_009600587.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH1-like [Nicotiana tomentosiformis]
Length=1023

 Score =   372 bits (956),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 170/219 (78%), Positives = 199/219 (91%), Gaps = 1/219 (0%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             ++C+CAV+NGGE+PYNRNGAIVEVKPLVYECGP CKCPPSCYNRVSQ GIKI LEIFKT+
Sbjct  806   KRCSCAVKNGGEIPYNRNGAIVEVKPLVYECGPFCKCPPSCYNRVSQRGIKIPLEIFKTD  865

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
             +RGWGVR++TSI SGTFICEYAGE+LED+EAE+RIGSDEYLFDIG NYSDC+ N SGQ  
Sbjct  866   TRGWGVRAVTSISSGTFICEYAGEILEDREAEQRIGSDEYLFDIGKNYSDCTDNSSGQ-A  924

Query  379   TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
               +E  +E G+TIDAA YGNVGRFINHSCSPNLYAQNV+YD++D+K+PHIMLFA +NI P
Sbjct  925   DLNELADEGGYTIDAAHYGNVGRFINHSCSPNLYAQNVVYDHEDKKMPHIMLFAADNIPP  984

Query  199   LRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             L+EL+YHYNY+VDQV DS G IKVK+CFCGS++CTGR+Y
Sbjct  985   LKELSYHYNYSVDQVYDSDGKIKVKRCFCGSSDCTGRMY  1023



>gb|EYU21899.1| hypothetical protein MIMGU_mgv1a021585mg [Erythranthe guttata]
Length=1181

 Score =   374 bits (959),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 170/220 (77%), Positives = 193/220 (88%), Gaps = 7/220 (3%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             +KC CAV+NGGE+PYNRNGA+VE KPLVYECGPHCKCPPSCYNRV Q GIK +LEIFKTE
Sbjct  968   RKCRCAVKNGGEIPYNRNGALVETKPLVYECGPHCKCPPSCYNRVGQRGIKFRLEIFKTE  1027

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDC-SINPSGQK  383
             SRGWGVR LTSIPSG+FICEY GELLEDKEAERR+GSDEYLFDIG NYSDC S+ P  Q 
Sbjct  1028  SRGWGVRPLTSIPSGSFICEYVGELLEDKEAERRVGSDEYLFDIGQNYSDCPSLKPEEQH  1087

Query  382   CTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENIS  203
                    EE G+TIDAA YGNVGRFINHSCSPNLYAQNV++D+DDRK+PH+MLFA+ENI 
Sbjct  1088  S------EESGYTIDAAHYGNVGRFINHSCSPNLYAQNVIHDHDDRKMPHVMLFAMENIP  1141

Query  202   PLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             PL+ELTYHYNY+V Q+ D +GNIKVK+C+CG+A CTGR+Y
Sbjct  1142  PLQELTYHYNYSVGQISDPNGNIKVKKCYCGTAACTGRMY  1181



>ref|XP_009798600.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH5-like [Nicotiana sylvestris]
 ref|XP_009798601.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH5-like [Nicotiana sylvestris]
Length=1014

 Score =   370 bits (950),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 168/219 (77%), Positives = 197/219 (90%), Gaps = 1/219 (0%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             ++C+CAV+NGGE+PYNRNGAIVEVKPLVYECGP CKCPPSCYNRVSQ+GIKI LEIFKT+
Sbjct  797   KRCSCAVKNGGEIPYNRNGAIVEVKPLVYECGPLCKCPPSCYNRVSQHGIKIPLEIFKTD  856

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
             +RGWGVR++TSI SGTFICEY GE+LED+EAE+RIGSDEYLFDIG NYSDC+ N SGQ  
Sbjct  857   TRGWGVRAVTSISSGTFICEYVGEILEDREAEQRIGSDEYLFDIGKNYSDCTANSSGQ-A  915

Query  379   TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
               +E  +E G TIDAA YGN+GRFINHSCSPNLYAQNV+YD++D+K+PHIMLFA +NI P
Sbjct  916   DLNELADEGGFTIDAAHYGNIGRFINHSCSPNLYAQNVVYDHEDKKMPHIMLFAADNIPP  975

Query  199   LRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             L+EL+YHYNY VDQV DS G IKVK+CFCGS++CTGR+Y
Sbjct  976   LKELSYHYNYAVDQVYDSDGKIKVKRCFCGSSDCTGRMY  1014



>ref|XP_004246167.2| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH8-like [Solanum lycopersicum]
 ref|XP_010325518.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH8-like [Solanum lycopersicum]
Length=1037

 Score =   369 bits (948),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 169/219 (77%), Positives = 194/219 (89%), Gaps = 1/219 (0%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             ++C+CAV+NGGE+PYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQ+GIKI LEIFKT+
Sbjct  820   ERCSCAVKNGGEIPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQHGIKIPLEIFKTD  879

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
             +RGWGVR+LTSI SGTFICEY G+LLED EAERRIG DEYLFDIG NY   + N SGQ  
Sbjct  880   TRGWGVRALTSISSGTFICEYTGQLLEDTEAERRIGMDEYLFDIGQNYGGYTANSSGQ-A  938

Query  379   TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
               +E VEE G+TIDAA YGNVGRFINHSCSPNLYAQNV+YD+ D++VPHIMLFA +NI P
Sbjct  939   NQNELVEEGGYTIDAARYGNVGRFINHSCSPNLYAQNVVYDHKDKRVPHIMLFAADNIPP  998

Query  199   LRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             L+EL+YHYNY VDQV DS G IKVK+CFCGS++C+GR+Y
Sbjct  999   LKELSYHYNYVVDQVYDSDGKIKVKRCFCGSSDCSGRMY  1037



>ref|XP_006838522.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4 [Amborella trichopoda]
 gb|ERN01091.1| hypothetical protein AMTR_s00002p00188950 [Amborella trichopoda]
Length=1153

 Score =   362 bits (930),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 166/226 (73%), Positives = 192/226 (85%), Gaps = 7/226 (3%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             + CACAV+NGGELP+NRNGAIVE KP+VYECGP C+CP +C+NRVSQ+GIK  LEIFKTE
Sbjct  928   ETCACAVKNGGELPFNRNGAIVEAKPIVYECGPKCRCPLTCHNRVSQHGIKFPLEIFKTE  987

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD-------CSI  401
             +RGWGVRS+ SIPSG+FICEY GELL D EAE+R G+DEYLFDIGHNYSD        ++
Sbjct  988   NRGWGVRSMISIPSGSFICEYTGELLRDTEAEQRTGNDEYLFDIGHNYSDHALWDGLSTL  1047

Query  400   NPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
              P  Q  T+ + VE+VG+TIDAAEYGNVGRFINHSCSPNLYAQNVLYD+ D+ +PHIMLF
Sbjct  1048  IPDMQLSTACDVVEDVGYTIDAAEYGNVGRFINHSCSPNLYAQNVLYDHHDKTMPHIMLF  1107

Query  220   AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             A ENI PL+ELTYHYNYT+DQVRDS GNIK K C+CGS EC+GRLY
Sbjct  1108  AAENIPPLQELTYHYNYTLDQVRDSDGNIKKKDCYCGSHECSGRLY  1153



>ref|XP_008238503.1| PREDICTED: uncharacterized protein LOC103337130 [Prunus mume]
 ref|XP_008238504.1| PREDICTED: uncharacterized protein LOC103337130 [Prunus mume]
Length=1119

 Score =   361 bits (927),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 172/226 (76%), Positives = 190/226 (84%), Gaps = 8/226 (4%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             +KC+CAV NGGE+PYN NGAIVEVKPLVYECGP CKCPPSCYNRVSQ GIK  LEIFKTE
Sbjct  895   EKCSCAVNNGGEIPYNFNGAIVEVKPLVYECGPSCKCPPSCYNRVSQRGIKFPLEIFKTE  954

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCS-------I  401
             SRGWGVRSL SIPSG+FICEY GELLEDKEAE R G+DEYLFDIG+NY+D S       +
Sbjct  955   SRGWGVRSLNSIPSGSFICEYIGELLEDKEAEERTGNDEYLFDIGNNYNDGSLWDGLSTL  1014

Query  400   NPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
              P  Q  +S E V + G TIDAA+YGNVGRF+NHSCSPNLYAQNVLYD+DD ++PHIM F
Sbjct  1015  MPDAQ-SSSYEVVGDGGFTIDAAQYGNVGRFVNHSCSPNLYAQNVLYDHDDTRIPHIMFF  1073

Query  220   AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             A ENI PL+ELTYHYNY +DQVRDS GNIK K C+CGSAECTGRLY
Sbjct  1074  AAENIPPLQELTYHYNYMIDQVRDSDGNIKKKSCYCGSAECTGRLY  1119



>ref|XP_010246087.1| PREDICTED: uncharacterized protein LOC104589448 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010246090.1| PREDICTED: uncharacterized protein LOC104589448 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010246091.1| PREDICTED: uncharacterized protein LOC104589448 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010246092.1| PREDICTED: uncharacterized protein LOC104589448 isoform X1 [Nelumbo 
nucifera]
Length=1118

 Score =   361 bits (927),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 167/226 (74%), Positives = 193/226 (85%), Gaps = 8/226 (4%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             +KC CAV+NGGE+P+N NGAIVE KPLVYECGP CKCPPSC+NRVSQ+GIK QLEIFKT+
Sbjct  894   EKCFCAVKNGGEIPFNYNGAIVEAKPLVYECGPSCKCPPSCHNRVSQHGIKFQLEIFKTK  953

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD-------CSI  401
             ++GWGVRSLTSIPSG+FICEY GELLEDKEAE+R  +DEYLFDIGHNY+D        ++
Sbjct  954   TKGWGVRSLTSIPSGSFICEYTGELLEDKEAEQRTNNDEYLFDIGHNYNDHTLWDGLSTL  1013

Query  400   NPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
              P  Q  +SSE VE+VG TIDAA YGN+GRF+NHSCSPN YAQNVLYD+DD+++PHIMLF
Sbjct  1014  VPDLQ-TSSSEVVEDVGFTIDAALYGNIGRFVNHSCSPNCYAQNVLYDHDDKRMPHIMLF  1072

Query  220   AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             A ENI PL+ELTYHYNY +DQV DS GNIK K C+CGS ECTGRLY
Sbjct  1073  AAENIPPLQELTYHYNYMIDQVHDSDGNIKKKNCYCGSHECTGRLY  1118



>ref|XP_010246093.1| PREDICTED: uncharacterized protein LOC104589448 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010246094.1| PREDICTED: uncharacterized protein LOC104589448 isoform X2 [Nelumbo 
nucifera]
Length=1102

 Score =   360 bits (925),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/226 (74%), Positives = 193/226 (85%), Gaps = 8/226 (4%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             +KC CAV+NGGE+P+N NGAIVE KPLVYECGP CKCPPSC+NRVSQ+GIK QLEIFKT+
Sbjct  878   EKCFCAVKNGGEIPFNYNGAIVEAKPLVYECGPSCKCPPSCHNRVSQHGIKFQLEIFKTK  937

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD-------CSI  401
             ++GWGVRSLTSIPSG+FICEY GELLEDKEAE+R  +DEYLFDIGHNY+D        ++
Sbjct  938   TKGWGVRSLTSIPSGSFICEYTGELLEDKEAEQRTNNDEYLFDIGHNYNDHTLWDGLSTL  997

Query  400   NPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
              P  Q  +SSE VE+VG TIDAA YGN+GRF+NHSCSPN YAQNVLYD+DD+++PHIMLF
Sbjct  998   VPDLQ-TSSSEVVEDVGFTIDAALYGNIGRFVNHSCSPNCYAQNVLYDHDDKRMPHIMLF  1056

Query  220   AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             A ENI PL+ELTYHYNY +DQV DS GNIK K C+CGS ECTGRLY
Sbjct  1057  AAENIPPLQELTYHYNYMIDQVHDSDGNIKKKNCYCGSHECTGRLY  1102



>ref|XP_007210417.1| hypothetical protein PRUPE_ppa000541mg [Prunus persica]
 gb|EMJ11616.1| hypothetical protein PRUPE_ppa000541mg [Prunus persica]
Length=1107

 Score =   360 bits (924),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 171/226 (76%), Positives = 189/226 (84%), Gaps = 8/226 (4%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             +KC+CAV NGGE+PYN NGAIVEVKPLVYECGP CKCPPSCYNRVSQ GIK  LEIFKTE
Sbjct  883   EKCSCAVNNGGEIPYNFNGAIVEVKPLVYECGPSCKCPPSCYNRVSQRGIKFPLEIFKTE  942

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCS-------I  401
             SRGWGVRSL SIPSG+FICEY GELLEDKEAE R G+DEYLFDIG+NY+D S       +
Sbjct  943   SRGWGVRSLNSIPSGSFICEYIGELLEDKEAEERTGNDEYLFDIGNNYNDSSLWDGLSTL  1002

Query  400   NPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
              P  Q  +S E V + G TIDAA+YGNVGRF+NHSCSPNLYAQNVLYD+DD ++PHIM F
Sbjct  1003  MPDAQ-SSSYEVVGDGGFTIDAAQYGNVGRFVNHSCSPNLYAQNVLYDHDDTRIPHIMFF  1061

Query  220   AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             A ENI PL+ELTYHYNY +DQVRDS GNIK K C+CGS ECTGRLY
Sbjct  1062  AAENIPPLQELTYHYNYMIDQVRDSDGNIKKKSCYCGSPECTGRLY  1107



>ref|XP_008812955.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Phoenix dactylifera]
Length=948

 Score =   357 bits (916),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 165/225 (73%), Positives = 191/225 (85%), Gaps = 8/225 (4%)
 Frame = -3

Query  736  KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
            KCACAV+NGGE+P+N NGAIV+ KPLV+ECGP C+CPPSC+NRVSQ+GI IQLEIFKT S
Sbjct  725  KCACAVKNGGEIPFNFNGAIVQAKPLVFECGPSCRCPPSCHNRVSQHGINIQLEIFKTRS  784

Query  556  RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSIN-------  398
            RGWGVRS+ SIPSG+FICEY GELL+D EAERR  +DEYLFDIGHNY D S+        
Sbjct  785  RGWGVRSINSIPSGSFICEYVGELLQDTEAERR-NNDEYLFDIGHNYDDQSLWEGLPSLI  843

Query  397  PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
            P  Q  ++ E VE+VG TIDAA+YGNVGRFINHSCSPNLYAQNVLYD+DD+++PHIM FA
Sbjct  844  PGLQSSSNCETVEDVGFTIDAAKYGNVGRFINHSCSPNLYAQNVLYDHDDKRMPHIMFFA  903

Query  217  VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             +NI PL+ELTYHYNY +DQVRDS GNIK K C+CGSAEC+GRLY
Sbjct  904  ADNIPPLQELTYHYNYMLDQVRDSEGNIKRKDCYCGSAECSGRLY  948



>ref|XP_010646790.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH8-like [Vitis vinifera]
Length=1090

 Score =   359 bits (922),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 194/225 (86%), Gaps = 7/225 (3%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             +KC+CAV+NGGE+PYN NGAIVE KPLVYEC P CKC  SC+NRVSQ+GIK QLEIFKT 
Sbjct  867   EKCSCAVKNGGEIPYNYNGAIVEAKPLVYECSPSCKCSRSCHNRVSQHGIKFQLEIFKTV  926

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD------CSIN  398
             SRGWGVRSLTSIPSG+FICEY GELLEDKEAE+R G+DEYLFDIGHNY++       ++ 
Sbjct  927   SRGWGVRSLTSIPSGSFICEYIGELLEDKEAEQRTGNDEYLFDIGHNYNEILWDGISTLM  986

Query  397   PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
             P  Q  +S E VE+ G TIDAA+YGNVGRFINHSCSPNLYAQNVLYD+D++++PHIMLFA
Sbjct  987   PDAQ-LSSCEVVEDAGFTIDAAQYGNVGRFINHSCSPNLYAQNVLYDHDNKRIPHIMLFA  1045

Query  217   VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
              ENI PL+ELTYHYNYT+DQVRDS+GNIK K C+CGS ECTGR+Y
Sbjct  1046  AENIPPLQELTYHYNYTIDQVRDSNGNIKKKSCYCGSDECTGRMY  1090



>ref|XP_010938533.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Elaeis guineensis]
Length=1093

 Score =   359 bits (922),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 167/225 (74%), Positives = 191/225 (85%), Gaps = 8/225 (4%)
 Frame = -3

Query  736   KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
             KCACAV+NGGE+P+N NGAIV+ KPLVYECGP C+CPPSC+NRVSQ+GI IQLEIFKT S
Sbjct  870   KCACAVKNGGEIPFNFNGAIVQAKPLVYECGPSCRCPPSCHNRVSQHGINIQLEIFKTVS  929

Query  556   RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSIN-------  398
             RGWGVRSL SIPSG+FICEY GELL+D EAE+R  +DEYLFDIGHNY D S+        
Sbjct  930   RGWGVRSLNSIPSGSFICEYVGELLQDTEAEQR-NNDEYLFDIGHNYDDQSLWEGLPTLI  988

Query  397   PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
             P  Q  ++ E VE+VG TIDAAEYGNVGRFINHSCSPNLYAQNVLYD+DD+++PHIM FA
Sbjct  989   PGLQSSSNCETVEDVGFTIDAAEYGNVGRFINHSCSPNLYAQNVLYDHDDKRMPHIMFFA  1048

Query  217   VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
              +NI PL+ELTYHYNY +DQVRDS GNIK K C+CGSAEC+GRLY
Sbjct  1049  ADNIPPLQELTYHYNYMIDQVRDSDGNIKQKDCYCGSAECSGRLY  1093



>ref|XP_002531219.1| histone-lysine n-methyltransferase, suvh, putative [Ricinus communis]
 gb|EEF31155.1| histone-lysine n-methyltransferase, suvh, putative [Ricinus communis]
Length=455

 Score =   342 bits (877),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 164/222 (74%), Positives = 189/222 (85%), Gaps = 4/222 (2%)
 Frame = -3

Query  736  KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
            +C+C  +NGGE+P+N NGAIVE KPLVYECGP CKCPPSCYNRV+Q+GIKI LEIFKTES
Sbjct  234  ECSCVAKNGGEIPFNHNGAIVEAKPLVYECGPSCKCPPSCYNRVTQHGIKIHLEIFKTES  293

Query  556  RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD----CSINPSG  389
            RGWGVRSL SIPSG+FICEY GELLE+KEAE+R G+DEYLFDIG+N SD     S   S 
Sbjct  294  RGWGVRSLNSIPSGSFICEYVGELLEEKEAEQRAGNDEYLFDIGNNSSDLWDGLSNLISE  353

Query  388  QKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVEN  209
               +S E VEE   TIDAA+YGNVGRF+NHSCSPNLYAQNVLYD++D++VPHIMLFA EN
Sbjct  354  THSSSCEVVEESCFTIDAAKYGNVGRFVNHSCSPNLYAQNVLYDHEDKRVPHIMLFAAEN  413

Query  208  ISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            I PL+ELTYHYNYT+D+V DS GNIK K C+CGS+ECTGR+Y
Sbjct  414  IPPLQELTYHYNYTIDEVFDSDGNIKKKSCYCGSSECTGRMY  455



>emb|CAN76871.1| hypothetical protein VITISV_038835 [Vitis vinifera]
Length=1126

 Score =   358 bits (920),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 194/225 (86%), Gaps = 7/225 (3%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             +KC+CAV+NGGE+PYN NGAIVE KPLVYEC P CKC  SC+NRVSQ+GIK QLEIFKT 
Sbjct  903   EKCSCAVKNGGEIPYNYNGAIVEAKPLVYECXPSCKCSRSCHNRVSQHGIKFQLEIFKTV  962

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD------CSIN  398
             SRGWGVRSLTSIPSG+FICEY GELLEDKEAE+R G+DEYLFDIGHNY++       ++ 
Sbjct  963   SRGWGVRSLTSIPSGSFICEYIGELLEDKEAEQRTGNDEYLFDIGHNYNEILWDGISTLM  1022

Query  397   PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
             P  Q  +S E VE+ G TIDAA+YGNVGRFINHSCSPNLYAQNVLYD+D++++PHIMLFA
Sbjct  1023  PDAQX-SSCEVVEDAGFTIDAAQYGNVGRFINHSCSPNLYAQNVLYDHDNKRIPHIMLFA  1081

Query  217   VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
              ENI PL+ELTYHYNYT+DQVRDS+GNIK K C+CGS ECTGR+Y
Sbjct  1082  AENIPPLQELTYHYNYTIDQVRDSNGNIKKKSCYCGSDECTGRMY  1126



>gb|KDO57056.1| hypothetical protein CISIN_1g048157mg [Citrus sinensis]
Length=982

 Score =   356 bits (913),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 169/225 (75%), Positives = 189/225 (84%), Gaps = 8/225 (4%)
 Frame = -3

Query  736  KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
            KCAC  +NGGELPYN NGAIV+ KPLVYECGP CKCPPSCYNRVSQ GIK QLEIFKTE+
Sbjct  759  KCACVAKNGGELPYNHNGAIVQAKPLVYECGPSCKCPPSCYNRVSQQGIKFQLEIFKTEA  818

Query  556  RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCS-------IN  398
            RGWGVRSL SIPSG+FICEYAGELLE+KEAERR  +DEYLFDIG+NY+D S       + 
Sbjct  819  RGWGVRSLNSIPSGSFICEYAGELLEEKEAERRTSNDEYLFDIGNNYNDGSLWGGLSNVM  878

Query  397  PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
            P     +S   VE+ G TIDA EYGNVGRF+NHSCSPNLYAQNVLYD++D+++PHIMLFA
Sbjct  879  PDA-PSSSCGVVEDGGFTIDAVEYGNVGRFVNHSCSPNLYAQNVLYDHEDKRMPHIMLFA  937

Query  217  VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             ENI PL+ELTYHYNY +DQV DSSGNIK K CFCGS+ECTGRLY
Sbjct  938  AENIPPLQELTYHYNYVIDQVYDSSGNIKKKSCFCGSSECTGRLY  982



>ref|XP_006440180.1| hypothetical protein CICLE_v100233292mg, partial [Citrus clementina]
 gb|ESR53420.1| hypothetical protein CICLE_v100233292mg, partial [Citrus clementina]
Length=656

 Score =   347 bits (890),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 167/225 (74%), Positives = 186/225 (83%), Gaps = 8/225 (4%)
 Frame = -3

Query  736  KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
            KCAC  +NGGELPYN NGAIV+ KPLVYEC P CKCPPSCYNRVSQ GIK QLEIFKTE+
Sbjct  433  KCACVAKNGGELPYNHNGAIVQAKPLVYECRPSCKCPPSCYNRVSQQGIKFQLEIFKTEA  492

Query  556  RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCS-------IN  398
            RGWGVRSL SIPSG+FICEYAGELLE+KEAERR  +DEYLFDIG+ YSD S       + 
Sbjct  493  RGWGVRSLNSIPSGSFICEYAGELLEEKEAERRTSNDEYLFDIGNKYSDGSLWGGLSNVM  552

Query  397  PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
            P     +S   VE+ G TIDA EYGNVGRF+NHSCSPNLYAQNVLYD++D+++PHIMLFA
Sbjct  553  PDA-PSSSCGVVEDGGFTIDAVEYGNVGRFVNHSCSPNLYAQNVLYDHEDKRMPHIMLFA  611

Query  217  VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             ENI PL+ELTYHYNY +DQV D SGNIK K CFCGS+ECTGRLY
Sbjct  612  AENIPPLQELTYHYNYVIDQVYDLSGNIKKKSCFCGSSECTGRLY  656



>ref|XP_006477091.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like isoform X1 [Citrus sinensis]
 ref|XP_006477092.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like isoform X2 [Citrus sinensis]
 ref|XP_006477093.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like isoform X3 [Citrus sinensis]
Length=1006

 Score =   355 bits (912),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 169/225 (75%), Positives = 189/225 (84%), Gaps = 8/225 (4%)
 Frame = -3

Query  736   KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
             KCAC  +NGGELPYN NGAIV+ KPLVYECGP CKCPPSCYNRVSQ GIK QLEIFKTE+
Sbjct  783   KCACVAKNGGELPYNHNGAIVQAKPLVYECGPSCKCPPSCYNRVSQQGIKFQLEIFKTEA  842

Query  556   RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCS-------IN  398
             RGWGVRSL SIPSG+FICEYAGELLE+KEAERR  +DEYLFDIG+NY+D S       + 
Sbjct  843   RGWGVRSLNSIPSGSFICEYAGELLEEKEAERRTSNDEYLFDIGNNYNDGSLWGGLSNVM  902

Query  397   PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
             P     +S   VE+ G TIDA EYGNVGRF+NHSCSPNLYAQNVLYD++D+++PHIMLFA
Sbjct  903   PDA-PLSSCGVVEDGGFTIDAVEYGNVGRFVNHSCSPNLYAQNVLYDHEDKRMPHIMLFA  961

Query  217   VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
              ENI PL+ELTYHYNY +DQV DSSGNIK K CFCGS+ECTGRLY
Sbjct  962   AENIPPLQELTYHYNYVIDQVYDSSGNIKKKSCFCGSSECTGRLY  1006



>ref|XP_009412217.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4-like [Musa acuminata subsp. malaccensis]
 ref|XP_009412218.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4-like [Musa acuminata subsp. malaccensis]
Length=1055

 Score =   353 bits (905),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 163/225 (72%), Positives = 192/225 (85%), Gaps = 8/225 (4%)
 Frame = -3

Query  736   KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
             +CACAV+NGGE+P+N NGAIV+ KPL+YECGP CKCP SC+NRVSQ+GI+I LEIF+T++
Sbjct  832   RCACAVKNGGEIPFNFNGAIVQAKPLLYECGPSCKCPSSCHNRVSQHGIQIPLEIFRTKT  891

Query  556   RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD-------CSIN  398
             RGWGVRSL SIPSG+FICEY GELL+DKEAE+R  +DEYLFDIGHNY D        S+ 
Sbjct  892   RGWGVRSLYSIPSGSFICEYIGELLQDKEAEKR-SNDEYLFDIGHNYDDHSLWEGLPSLI  950

Query  397   PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
             P  +  +  E V++VG TIDAAEYGNVGRFINHSCSPNLYAQNVLYD+DD++VPHIMLFA
Sbjct  951   PGLKTSSQRETVDDVGFTIDAAEYGNVGRFINHSCSPNLYAQNVLYDHDDKRVPHIMLFA  1010

Query  217   VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
              ENI PL+ELTYHYNY++DQVRD+ GNIK K C+CGS ECTGRLY
Sbjct  1011  AENIPPLQELTYHYNYSLDQVRDADGNIKQKDCYCGSPECTGRLY  1055



>ref|XP_007039695.1| SU(VAR)3-9, putative [Theobroma cacao]
 gb|EOY24196.1| SU(VAR)3-9, putative [Theobroma cacao]
Length=928

 Score =   350 bits (897),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 165/224 (74%), Positives = 188/224 (84%), Gaps = 6/224 (3%)
 Frame = -3

Query  736  KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
            KC+CA++NGGE+PYN NGAIVE K LVYECGP CKCP SCYNRVSQ GIK QLEIFKTES
Sbjct  705  KCSCAMKNGGEIPYNHNGAIVEAKRLVYECGPTCKCPASCYNRVSQRGIKFQLEIFKTES  764

Query  556  RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKCT  377
            RGWGVRSL SIPSG+FICEYAGELLED+EAE R G+DEYLFDIG+NYS+ S+        
Sbjct  765  RGWGVRSLNSIPSGSFICEYAGELLEDREAEERTGNDEYLFDIGNNYSESSLWDGLSTLM  824

Query  376  SS------EQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
                    + V++ G TIDAA++GNVGRFINHSCSPNLYAQNVLYD+DDR++PHIMLFA 
Sbjct  825  PDVHSSVCQVVQDSGFTIDAAQHGNVGRFINHSCSPNLYAQNVLYDHDDRRIPHIMLFAA  884

Query  214  ENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            ENI PL+ELTYHYNY +DQVRD +GNIK K C+CGS+ECTGRLY
Sbjct  885  ENIPPLQELTYHYNYMIDQVRDENGNIKKKFCYCGSSECTGRLY  928



>ref|XP_010104844.1| Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 
[Morus notabilis]
 gb|EXC02080.1| Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 
[Morus notabilis]
Length=1090

 Score =   351 bits (900),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 164/225 (73%), Positives = 185/225 (82%), Gaps = 7/225 (3%)
 Frame = -3

Query  736   KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
             KCACAV+NGGE+P+N NGAIVEVKPLVYECGP C+CPPSC NRVSQ+GIK QLEIFKT+ 
Sbjct  866   KCACAVKNGGEIPFNHNGAIVEVKPLVYECGPSCRCPPSCPNRVSQHGIKFQLEIFKTKD  925

Query  556   RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD-------CSIN  398
             RGWGVRSL  IPSG+FICEY GE L DKEAE R G+DEYLFDIG+NY+D        ++ 
Sbjct  926   RGWGVRSLNFIPSGSFICEYLGEFLSDKEAEARTGNDEYLFDIGNNYNDNTLWEGLSTLM  985

Query  397   PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
             PS    +     +  G TIDAAEYGNVGRFINHSC+PNLYAQNVLYD++D+++PHIMLFA
Sbjct  986   PSSVSASDEIVEDSEGFTIDAAEYGNVGRFINHSCTPNLYAQNVLYDHEDKRIPHIMLFA  1045

Query  217   VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
              ENI PL ELTYHYNY VDQVRDS+GNIK K CFCGS ECTGRLY
Sbjct  1046  AENIRPLEELTYHYNYVVDQVRDSNGNIKKKSCFCGSHECTGRLY  1090



>ref|XP_010531690.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Tarenaya hassleriana]
Length=920

 Score =   347 bits (890),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 160/227 (70%), Positives = 189/227 (83%), Gaps = 7/227 (3%)
 Frame = -3

Query  742  FQKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKT  563
             +KC+C V+NGG +PYNR+GAIVE  PLVYECGP CKCPPSCYNRV+Q GIK QLEIFKT
Sbjct  694  LRKCSCVVQNGGGIPYNRDGAIVEAIPLVYECGPTCKCPPSCYNRVTQCGIKFQLEIFKT  753

Query  562  ESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD------CSI  401
            ESRGWGVRSL SIPSG+FICEYAGELLEDKEAERR G+DEYLFDIG+NY +        +
Sbjct  754  ESRGWGVRSLNSIPSGSFICEYAGELLEDKEAERRTGNDEYLFDIGNNYDNSLRDGISEL  813

Query  400  NPSGQKCTSSEQVEE-VGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIML  224
             P     +S + V+E +G TIDAA YGNVGRFINHSCSPNLYAQNVL+D++D ++PH+M 
Sbjct  814  MPKMHPSSSVQAVDESIGFTIDAARYGNVGRFINHSCSPNLYAQNVLFDHNDTRIPHVMF  873

Query  223  FAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            FA++NI PL+ELTYHYNY + QVRDS+GNIK K C+CGS++C GRLY
Sbjct  874  FAMDNIPPLQELTYHYNYVIGQVRDSNGNIKRKDCYCGSSDCVGRLY  920



>gb|KEH27478.1| histone-lysine N-methyltransferase, suvh protein [Medicago truncatula]
Length=1089

 Score =   346 bits (887),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 187/225 (83%), Gaps = 6/225 (3%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             +KC+C ++NGGE+P+N NGAIVE KPLVYECGP C+CPP+CYNRVSQ GI IQLEIFKT+
Sbjct  865   EKCSCVLKNGGEIPFNHNGAIVEAKPLVYECGPKCECPPTCYNRVSQLGINIQLEIFKTK  924

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPS----  392
             S GWGVRSL SIPSG+FICEY GE+LEDKEAE+R G+DEYLFDIG+N ++ ++       
Sbjct  925   SMGWGVRSLNSIPSGSFICEYIGEVLEDKEAEQRTGNDEYLFDIGNNKNNSNLWDGLSNL  984

Query  391   --GQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
                   +SSE V +VG TIDAA++GNVGRFINHSCSPNLYAQNVLYD+ D +VPH+MLFA
Sbjct  985   LPDSHLSSSEVVNDVGFTIDAAQFGNVGRFINHSCSPNLYAQNVLYDHHDNRVPHVMLFA  1044

Query  217   VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
              ENI PL+ELTY YNYT+DQVRDS G IK K CFCGS ECTGRLY
Sbjct  1045  AENIPPLQELTYDYNYTIDQVRDSDGKIKKKYCFCGSVECTGRLY  1089



>ref|XP_011031970.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Populus euphratica]
Length=997

 Score =   343 bits (880),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 186/226 (82%), Gaps = 8/226 (4%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            +KC C V+NGG +PYN NGAIVE KPLVYECGP CKCPPSCYNRVSQ+GIK QLEIFKTE
Sbjct  773  RKCPCLVKNGGGIPYNYNGAIVEAKPLVYECGPSCKCPPSCYNRVSQHGIKFQLEIFKTE  832

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCS-------I  401
            SRGWG RSL SIPSG+FICEYAGELLE+KEAE+R G+DEYLFDIG+ ++D S       +
Sbjct  833  SRGWGARSLNSIPSGSFICEYAGELLEEKEAEQRTGNDEYLFDIGNQFNDNSLWDGLLTL  892

Query  400  NPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
             P  Q     E V+  G TIDAA+ GN+GRFINHSCSPNLYAQNVLYD+DD+++PHIM F
Sbjct  893  MPEAQPDAVVE-VQNSGFTIDAAQCGNLGRFINHSCSPNLYAQNVLYDHDDKRIPHIMFF  951

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            AVENI PL+ELTYHYNY +DQV DS+GNIK K C CGS ECTGR+Y
Sbjct  952  AVENIPPLQELTYHYNYMIDQVFDSNGNIKKKSCHCGSPECTGRMY  997



>gb|KJB51780.1| hypothetical protein B456_008G231400 [Gossypium raimondii]
 gb|KJB51781.1| hypothetical protein B456_008G231400 [Gossypium raimondii]
Length=919

 Score =   341 bits (874),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/224 (71%), Positives = 184/224 (82%), Gaps = 6/224 (3%)
 Frame = -3

Query  736  KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
            KC+C +RNGG++PYN NGAIVE KPLVYECGP CKCP SCYNRVSQ+GIK Q EIFKT+S
Sbjct  696  KCSCVMRNGGQIPYNHNGAIVETKPLVYECGPTCKCPASCYNRVSQHGIKFQFEIFKTKS  755

Query  556  RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPS-----  392
             GWGVRSL SIPSG+FICEYAGELLED+EAE+R G DEYLFDIG+ YSD S+        
Sbjct  756  TGWGVRSLNSIPSGSFICEYAGELLEDREAEKRTGKDEYLFDIGNKYSDSSLWDDLSTLI  815

Query  391  -GQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
               + +  + V E G TIDAA +GN+GRFINHSCSPNLYAQNVLYD+DD+++PHIMLFA 
Sbjct  816  HDSRSSFRQVVPECGFTIDAARFGNMGRFINHSCSPNLYAQNVLYDHDDKRIPHIMLFAA  875

Query  214  ENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            ENI PL+ELTYHYNY +DQV D SG+I+ K C CGS++CTGRLY
Sbjct  876  ENIPPLQELTYHYNYMIDQVHDESGDIRKKVCCCGSSKCTGRLY  919



>emb|CBI29505.3| unnamed protein product [Vitis vinifera]
Length=526

 Score =   329 bits (844),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 158/219 (72%), Positives = 179/219 (82%), Gaps = 20/219 (9%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            +KC+CAV+NGGE+PYN NGAIVE KPLVYEC P CKC  SC+NRVSQ+GIK QLEIFKT 
Sbjct  328  EKCSCAVKNGGEIPYNYNGAIVEAKPLVYECSPSCKCSRSCHNRVSQHGIKFQLEIFKTV  387

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
            SRGWGVRSLTSIPSG+FICEY GELLEDKEAE+R G+DEY                    
Sbjct  388  SRGWGVRSLTSIPSGSFICEYIGELLEDKEAEQRTGNDEYF-------------------  428

Query  379  TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
             S E VE+ G TIDAA+YGNVGRFINHSCSPNLYAQNVLYD+D++++PHIMLFA ENI P
Sbjct  429  -SCEVVEDAGFTIDAAQYGNVGRFINHSCSPNLYAQNVLYDHDNKRIPHIMLFAAENIPP  487

Query  199  LRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            L+ELTYHYNYT+DQVRDS+GNIK K C+CGS ECTGR+Y
Sbjct  488  LQELTYHYNYTIDQVRDSNGNIKKKSCYCGSDECTGRMY  526



>ref|XP_003611386.1| Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 
[Medicago truncatula]
 gb|AES94344.1| histone-lysine N-methyltransferase, suvh protein [Medicago truncatula]
Length=1091

 Score =   343 bits (879),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 159/225 (71%), Positives = 186/225 (83%), Gaps = 6/225 (3%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             +KC+C ++NGGE+P+N NGAIVE KPLVYECGP C+CPP+CYNRVSQ GI IQLEIFKT+
Sbjct  865   EKCSCVLKNGGEIPFNHNGAIVEAKPLVYECGPKCECPPTCYNRVSQLGINIQLEIFKTK  924

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPS----  392
             S GWGVRSL SIPSG+FICEY GE+LEDKEAE+R G+DEYLFDIG+N ++ ++       
Sbjct  925   SMGWGVRSLNSIPSGSFICEYIGEVLEDKEAEQRTGNDEYLFDIGNNKNNSNLWDGLSNL  984

Query  391   --GQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
                   +SSE V +VG TIDAA++GNVGRFINHSCSPNLYAQNVLYD+ D +VPH+MLFA
Sbjct  985   LPDSHLSSSEVVNDVGFTIDAAQFGNVGRFINHSCSPNLYAQNVLYDHHDNRVPHVMLFA  1044

Query  217   VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
              ENI PL+ELTY YNYT+DQVRDS G IK K CFCGS ECTG LY
Sbjct  1045  AENIPPLQELTYDYNYTIDQVRDSDGKIKKKYCFCGSVECTGFLY  1089



>ref|XP_008340758.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Malus domestica]
Length=731

 Score =   335 bits (858),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 157/226 (69%), Positives = 187/226 (83%), Gaps = 8/226 (4%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            +KC+CAV+NGGE+PYN +GAIVEVKPLVYECGP CKCPPSCYNRV Q+GIK QL+IFKTE
Sbjct  507  EKCSCAVQNGGEIPYNFDGAIVEVKPLVYECGPSCKCPPSCYNRVXQHGIKFQLQIFKTE  566

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD-------CSI  401
            SRGWG+RSL  IPSG+FICEY GELLE+ +AE RIG DEYLFDIG+NY+D        ++
Sbjct  567  SRGWGLRSLNYIPSGSFICEYMGELLEEDKAEERIGYDEYLFDIGNNYNDNNLWDELSTL  626

Query  400  NPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
             P     +S E V++   TIDAA YGNVGRFINHSCSPNLYAQ+VLYD++D ++PHIM F
Sbjct  627  VPDAL-SSSFEVVDDGKFTIDAANYGNVGRFINHSCSPNLYAQDVLYDHNDNRIPHIMFF  685

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            A E+I P++ELTYHYNYT+D V DS+GNIK K C+CGS +CTGRLY
Sbjct  686  AAEDIPPMQELTYHYNYTIDSVYDSNGNIKKKNCYCGSLDCTGRLY  731



>ref|XP_011650376.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6 [Cucumis sativus]
 gb|KGN55824.1| hypothetical protein Csa_3G017180 [Cucumis sativus]
Length=992

 Score =   340 bits (871),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/226 (70%), Positives = 187/226 (83%), Gaps = 8/226 (4%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            ++C C V NGGE+P+N NGAIVE K LVYECGP CKCPPSC+NRVSQ+GIK QLEIFKT+
Sbjct  768  ERCYCVVLNGGEIPFNHNGAIVEAKALVYECGPSCKCPPSCHNRVSQHGIKFQLEIFKTK  827

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCS-------I  401
            SRGWGVRSL SIPSG+FICEY GELLEDKEA++R G+DEYLFDIG+NYSD S       +
Sbjct  828  SRGWGVRSLNSIPSGSFICEYIGELLEDKEADQRTGNDEYLFDIGNNYSDNSLWDGLSTL  887

Query  400  NPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
             P  Q   + + VE+   TIDAA YGN+GRFINHSC+PNLYAQNVLYD++D+++PHIM F
Sbjct  888  LPDAQ-ANACDIVEDGSFTIDAASYGNIGRFINHSCTPNLYAQNVLYDHEDKRIPHIMFF  946

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            A ENI PL+EL+YHYNY +DQVRDS GNIK K+C CGSAECTG +Y
Sbjct  947  AAENIPPLQELSYHYNYMMDQVRDSEGNIKKKRCHCGSAECTGWMY  992



>ref|XP_008386441.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Malus domestica]
Length=674

 Score =   332 bits (852),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 170/226 (75%), Positives = 186/226 (82%), Gaps = 8/226 (4%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            +KC+CAV NGGE+PYN NGAIVE K LVYECGP CKCPPSCYNRVSQ GIK QLEIFKTE
Sbjct  450  EKCSCAVENGGEIPYNFNGAIVEAKSLVYECGPSCKCPPSCYNRVSQRGIKFQLEIFKTE  509

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCS-------I  401
            SRGWGVRSL SIPSG+FICEY GELLE+KEAE R G+DEYLFDIG+NYSD S       +
Sbjct  510  SRGWGVRSLNSIPSGSFICEYIGELLEEKEAEERTGNDEYLFDIGNNYSDNSLWDGLSIL  569

Query  400  NPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
             P  Q  +S   V E G TIDA EYGNVGRFINHSCSPNLYAQNVLYD+DD ++PHIM F
Sbjct  570  MPDAQS-SSHGVVGEGGFTIDAVEYGNVGRFINHSCSPNLYAQNVLYDHDDTRIPHIMFF  628

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            A ENI PL+ELTYHYNY +DQVRDS+G IK K C+CGS ECTGRLY
Sbjct  629  AAENIPPLQELTYHYNYMIDQVRDSNGKIKKKSCYCGSPECTGRLY  674



>ref|XP_006385561.1| hypothetical protein POPTR_0003s08130g [Populus trichocarpa]
 gb|ERP63358.1| hypothetical protein POPTR_0003s08130g [Populus trichocarpa]
Length=976

 Score =   339 bits (870),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 162/226 (72%), Positives = 185/226 (82%), Gaps = 8/226 (4%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            +KC C  +NGG +PYN NGAIVE KPLVYECGP CKCPP CYNRVSQ+GIK QLEIFKTE
Sbjct  752  RKCPCLEKNGGGIPYNYNGAIVEAKPLVYECGPSCKCPPLCYNRVSQHGIKFQLEIFKTE  811

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCS-------I  401
            SRGWGVRSL SIPSG+FICEYAGE+LE+KEAE+R G+DEYLFDIG+ ++D S       +
Sbjct  812  SRGWGVRSLNSIPSGSFICEYAGEVLEEKEAEQRTGNDEYLFDIGNQFNDNSLWDGLTTL  871

Query  400  NPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
             P  Q     E V+  G TIDAA+ GNVGRFINHSCSPNLYAQNVLYD+DD+++PHIM F
Sbjct  872  MPEAQPDAVVE-VQNSGFTIDAAQCGNVGRFINHSCSPNLYAQNVLYDHDDKRIPHIMFF  930

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            AVENI PL+ELTYHYNY +DQV DS+GNIK K C CGS ECTGR+Y
Sbjct  931  AVENIPPLQELTYHYNYMIDQVFDSNGNIKKKSCHCGSPECTGRMY  976



>ref|XP_010672907.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010672908.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Beta vulgaris subsp. vulgaris]
Length=1043

 Score =   340 bits (872),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/226 (69%), Positives = 187/226 (83%), Gaps = 8/226 (4%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             ++CACAV+NGG++P+N NGAIV+ KPLVYECGP CKCPPSC+NRVSQ GIK+ LE+FKT+
Sbjct  819   ERCACAVKNGGDIPFNYNGAIVQAKPLVYECGPLCKCPPSCHNRVSQLGIKLPLEVFKTD  878

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCS-------I  401
             SRGWGVR L++IPSG+FICEY GELL+DKEAE+R G+DEYLFDIG NY+D S       +
Sbjct  879   SRGWGVRCLSAIPSGSFICEYIGELLDDKEAEQRTGNDEYLFDIGQNYNDTSLWDGLSAL  938

Query  400   NPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
              P     T  + +E +G TIDA  YGN+GRFINHSCSPNLYAQNVLYD++D+++PHIM F
Sbjct  939   LPEMTSAT-DDVIENIGFTIDAVRYGNIGRFINHSCSPNLYAQNVLYDHEDKRIPHIMFF  997

Query  220   AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             A ENI PL+ELTYHYNYT+DQV DS GNIK K C CGS EC+GR+Y
Sbjct  998   AAENIPPLQELTYHYNYTIDQVFDSLGNIKKKSCHCGSMECSGRMY  1043



>gb|KHG00035.1| Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 
-like protein [Gossypium arboreum]
Length=1038

 Score =   340 bits (871),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 161/224 (72%), Positives = 184/224 (82%), Gaps = 7/224 (3%)
 Frame = -3

Query  736   KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
             KC+C ++N GE+PYN NGAIVE KPLVYECGP+C CPPSCYNRVSQ+GIKIQLEIFKTES
Sbjct  816   KCSCVMKNEGEIPYNHNGAIVEAKPLVYECGPNCNCPPSCYNRVSQHGIKIQLEIFKTES  875

Query  556   RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD------CSINP  395
             RGWGVRSL SI SGTFICEYAGELLED+EAE R G+DEYLFDIG+N          ++ P
Sbjct  876   RGWGVRSLNSISSGTFICEYAGELLEDREAEERKGNDEYLFDIGNNIDSSLWDGLSNLLP  935

Query  394   SGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
                  +S + V E G TIDAA  GN+GRFINHSCSPNLYAQNVLYD++D ++PHIM FA 
Sbjct  936   DAH-SSSCQVVHESGFTIDAARCGNIGRFINHSCSPNLYAQNVLYDHEDTRIPHIMFFAA  994

Query  214   ENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             ENI PL+ELTYHYNY +DQVRD +GNIK K C+CGS+ECTGRLY
Sbjct  995   ENIPPLQELTYHYNYMIDQVRDENGNIKKKICYCGSSECTGRLY  1038



>ref|XP_010919768.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Elaeis guineensis]
Length=832

 Score =   335 bits (860),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 187/225 (83%), Gaps = 9/225 (4%)
 Frame = -3

Query  736  KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
            KCACAV+NGGE+P+N NGAIVE KPLVYECGP CKCPPSC+NRVSQ+GIK  L+IFKTE+
Sbjct  610  KCACAVKNGGEIPFNHNGAIVEAKPLVYECGPSCKCPPSCHNRVSQHGIKFPLQIFKTEA  669

Query  556  RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSIN-------  398
            RGWGVRSL  IPSG+F+CEY GE+LED+EA++R  +DEYLF IG+NY D S+        
Sbjct  670  RGWGVRSLKKIPSGSFVCEYVGEILEDEEAQKR-RNDEYLFAIGNNYYDKSLWEGLSTSI  728

Query  397  PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
            P+ QK  S E  +EVG T+DA+ +GNVGRFINHSC+PNLYAQN+LYD+DD+++PHIM FA
Sbjct  729  PALQKGASCE-TDEVGFTVDASAFGNVGRFINHSCTPNLYAQNLLYDHDDKRMPHIMFFA  787

Query  217  VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             E+I PL+ELTY YNYT+DQV DS GNIK K CFCGS ECTGRLY
Sbjct  788  SEDIQPLQELTYDYNYTIDQVHDSDGNIKRKNCFCGSIECTGRLY  832



>ref|XP_008448779.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Cucumis melo]
 ref|XP_008448780.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Cucumis melo]
Length=993

 Score =   338 bits (868),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 159/226 (70%), Positives = 188/226 (83%), Gaps = 8/226 (4%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            ++C CAV NGGE+P+N NGAIVE K LVYECG  CKCPPSC+NRVSQ+GIK QLEIFKT+
Sbjct  769  ERCYCAVLNGGEIPFNHNGAIVEAKTLVYECGLSCKCPPSCHNRVSQHGIKFQLEIFKTK  828

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSIN------  398
            SRGWGVRSL SIPSG+FICEY GELLEDKEAE+R G+DEYLFDIG+NYSD S+       
Sbjct  829  SRGWGVRSLNSIPSGSFICEYIGELLEDKEAEQRTGNDEYLFDIGNNYSDNSLWDGLSTL  888

Query  397  -PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
             P  Q   + + +E+   TIDAA YGN+GRFINHSC+PNLYAQNVLYD++D+++PHIM F
Sbjct  889  LPDAQ-ANACDIMEDGSFTIDAASYGNIGRFINHSCTPNLYAQNVLYDHEDKRIPHIMFF  947

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            A ENI PL+EL+YHYNY +DQVRDS GNIK K+C+CGSAECTG +Y
Sbjct  948  AAENIPPLQELSYHYNYMMDQVRDSEGNIKKKRCYCGSAECTGWMY  993



>ref|XP_012070093.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Jatropha curcas]
 ref|XP_012070094.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Jatropha curcas]
 gb|KDP39948.1| hypothetical protein JCGZ_03479 [Jatropha curcas]
Length=1030

 Score =   339 bits (870),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 157/222 (71%), Positives = 185/222 (83%), Gaps = 5/222 (2%)
 Frame = -3

Query  733   CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
             C C  +NGGE+PYN NGAIVE KP+VYECGP CKCPPSCYNRVSQ+GIK QLEIFKTESR
Sbjct  809   CPCVAKNGGEIPYNHNGAIVEAKPMVYECGPSCKCPPSCYNRVSQHGIKFQLEIFKTESR  868

Query  553   GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHN-----YSDCSINPSG  389
             GWGVRSL SIPSG+FICEY GELLE+KEAE+R G+DEYLFDIG+N     +   S   S 
Sbjct  869   GWGVRSLNSIPSGSFICEYVGELLEEKEAEQRTGNDEYLFDIGNNNDNSLWDGLSNLISD  928

Query  388   QKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVEN  209
              + +S E V+E   TIDAA+YGN+GRFINHSCSPNLYAQN+LYD++D+++PHIMLFA EN
Sbjct  929   TQSSSCEVVKESCFTIDAAKYGNIGRFINHSCSPNLYAQNILYDHEDKRIPHIMLFAAEN  988

Query  208   ISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             I PL+ELTYHYNY + QV DS GN++ K C+CGS+ECTGR+Y
Sbjct  989   IPPLQELTYHYNYIIGQVLDSDGNVRKKSCYCGSSECTGRMY  1030



>gb|KJB25462.1| hypothetical protein B456_004G192900 [Gossypium raimondii]
Length=1064

 Score =   339 bits (870),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 161/224 (72%), Positives = 184/224 (82%), Gaps = 7/224 (3%)
 Frame = -3

Query  736   KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
             KC+C ++N GE+PYN NGAIVE KPLVYECGP+C CPPSCYNRVSQ+GIKIQLEIFKTES
Sbjct  842   KCSCVMKNEGEIPYNHNGAIVEAKPLVYECGPNCNCPPSCYNRVSQHGIKIQLEIFKTES  901

Query  556   RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD------CSINP  395
             RGWGVRSL SI SGTFICEYAGELLED+EAE R G+DEYLFDIG+N          ++ P
Sbjct  902   RGWGVRSLNSISSGTFICEYAGELLEDREAEERKGNDEYLFDIGNNIDSSLWDGLSNLLP  961

Query  394   SGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
                  +S + V E G TIDAA  GN+GRFINHSCSPNLYAQNVLYD++D ++PHIM FA 
Sbjct  962   DAH-SSSCQVVHESGFTIDAARCGNIGRFINHSCSPNLYAQNVLYDHEDTRIPHIMFFAA  1020

Query  214   ENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             ENI PL+ELTYHYNY +DQVRD +GNIK K C+CGS+ECTGRLY
Sbjct  1021  ENIPPLQELTYHYNYMIDQVRDENGNIKKKICYCGSSECTGRLY  1064



>ref|XP_004511737.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Cicer arietinum]
Length=1077

 Score =   339 bits (870),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 159/227 (70%), Positives = 187/227 (82%), Gaps = 8/227 (4%)
 Frame = -3

Query  742   FQKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKT  563
               KC+C ++NGGE+P+N NGAIVE KPLVYECGP CKCP +C+NRVSQ GIK+QLEIFKT
Sbjct  852   LDKCSCVLKNGGEIPFNHNGAIVEAKPLVYECGPKCKCPLTCHNRVSQLGIKMQLEIFKT  911

Query  562   ESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD-------CS  404
              SRGWGVRSL SI SG+FICEY GE+LEDKEAE+R G+DEYLFDIG+N S+        +
Sbjct  912   NSRGWGVRSLNSISSGSFICEYIGEVLEDKEAEQRTGNDEYLFDIGNNNSNNTLWDGLST  971

Query  403   INPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIML  224
             + P  Q   S E V++VG TIDAA++GNVGRF+NHSCSPNLYAQNVLYD+ D ++PHIML
Sbjct  972   LMPESQ-SHSCEIVKDVGFTIDAAKFGNVGRFVNHSCSPNLYAQNVLYDHHDSRIPHIML  1030

Query  223   FAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             FA ENI PL+ELTY YNY +DQVRDS+GNIK K C+CGS ECTGRLY
Sbjct  1031  FAAENIPPLQELTYDYNYMIDQVRDSNGNIKKKNCYCGSVECTGRLY  1077



>gb|EPS61767.1| hypothetical protein M569_13026 [Genlisea aurea]
Length=1004

 Score =   338 bits (866),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 150/219 (68%), Positives = 183/219 (84%), Gaps = 18/219 (8%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             +KC+CAVRNGGE+PYN NGA+VE KPLV+ECGP C+C PSCYNRVSQ GI+ + E+FKTE
Sbjct  804   KKCSCAVRNGGEIPYNHNGALVETKPLVFECGPGCRCLPSCYNRVSQRGIRFRFEVFKTE  863

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
             SRGWG+R+LTSIPSG+FICEYAGELLE++EAE+R+GSDEYLFDIGH+             
Sbjct  864   SRGWGLRALTSIPSGSFICEYAGELLEEREAEKRVGSDEYLFDIGHHG------------  911

Query  379   TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
                    E G TIDAAEYGN+GRFINHSC PNLYAQ+V+YD+DD ++PHIM FA+ENI+P
Sbjct  912   ------HEEGFTIDAAEYGNLGRFINHSCMPNLYAQDVVYDHDDTRMPHIMFFALENITP  965

Query  199   LRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             L+ELTY YNY++ Q+RD+ GN+KVK+CFCG+A CTGRLY
Sbjct  966   LKELTYDYNYSMGQIRDTDGNVKVKECFCGAASCTGRLY  1004



>ref|XP_010258733.1| PREDICTED: LOW QUALITY PROTEIN: histone-lysine N-methyltransferase, 
H3 lysine-9 specific SUVH5-like [Nelumbo nucifera]
Length=1134

 Score =   339 bits (870),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 190/226 (84%), Gaps = 9/226 (4%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             +KC+CA +NGGE+P+N NGAIVEVKPLVYECGP CKCP SC+NRVSQ+GIK QLEIFK+E
Sbjct  911   EKCSCAAKNGGEIPFNYNGAIVEVKPLVYECGPSCKCPSSCHNRVSQHGIKFQLEIFKSE  970

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD-------CSI  401
             SRGWGVRSLTSIPSG+FICEY G+LLEDKE ++R  +DEYLFDI HNY+D        ++
Sbjct  971   SRGWGVRSLTSIPSGSFICEYIGKLLEDKETKQRTNNDEYLFDIRHNYNDHTLWDQLSTL  1030

Query  400   NPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
              P  Q  + S+ VE+VG TIDAA+YGNVGRFIN SCSPNL+AQNVLYD+DD+++PHIMLF
Sbjct  1031  VPDLQ-TSPSKVVEDVGFTIDAAQYGNVGRFINRSCSPNLHAQNVLYDHDDKRMPHIMLF  1089

Query  220   AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             A ENI PL+ELTYHYNY +D++ DS+GNIK K C+CGS  CT R+Y
Sbjct  1090  AAENIPPLQELTYHYNYMIDKIHDSNGNIKKKNCYCGS-HCTWRIY  1134



>emb|CDP08342.1| unnamed protein product [Coffea canephora]
Length=1005

 Score =   337 bits (863),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/219 (72%), Positives = 177/219 (81%), Gaps = 22/219 (10%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             +KC CA RNGG +PYNRNGAIVE KPLV+ECGPHCKCPP+CYNRVSQ+GIKIQLEIFKT+
Sbjct  809   RKCYCAQRNGGGIPYNRNGAIVEAKPLVFECGPHCKCPPTCYNRVSQHGIKIQLEIFKTK  868

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
             SRGWGVRSL SIPSG+FICEYAGELLEDKEAE R GSDEY                    
Sbjct  869   SRGWGVRSLYSIPSGSFICEYAGELLEDKEAELRAGSDEYF-------------------  909

Query  379   TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
                E VEE G+TIDAA+YGN+GRFINHSCSPNLYAQ+VLYD+ D++VPH+MLFA +NI P
Sbjct  910   ---EAVEEGGYTIDAAKYGNIGRFINHSCSPNLYAQDVLYDHADKRVPHVMLFAADNIPP  966

Query  199   LRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             L+ELTYHYNY V QV DS GNIKVK C+CGS EC GR+Y
Sbjct  967   LQELTYHYNYGVGQVHDSKGNIKVKSCYCGSTECIGRMY  1005



>emb|CDX89510.1| BnaC04g35290D [Brassica napus]
Length=758

 Score =   329 bits (844),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 180/225 (80%), Gaps = 6/225 (3%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            + CAC  +NGGE+PYN +GAIV  K L+YECGP CKCP SCY RV+Q GIK  LEIFKTE
Sbjct  534  KDCACVAKNGGEIPYNYDGAIVSAKNLIYECGPLCKCPASCYLRVTQRGIKFPLEIFKTE  593

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD------CSIN  398
            SRGWGVRSL+SIPSG+FICEY GELLEDKEAERR G+DEYLFDIG+ Y +        + 
Sbjct  594  SRGWGVRSLSSIPSGSFICEYVGELLEDKEAERRTGNDEYLFDIGNRYDNSLAEGMSKLM  653

Query  397  PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
            P  Q     +  E  G TIDAA+ GN+GRFINHSCSPNLYAQNVLYD++D ++PH+M FA
Sbjct  654  PETQPAMGGDDDEMSGFTIDAAKKGNIGRFINHSCSPNLYAQNVLYDHEDTRIPHVMFFA  713

Query  217  VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            ++N+ PL+ELTYHYNY +DQVRDS+GNIK K C+CGS++CTGRLY
Sbjct  714  MDNVPPLQELTYHYNYMIDQVRDSNGNIKKKICYCGSSDCTGRLY  758



>ref|XP_006590581.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like isoform X1 [Glycine max]
 ref|XP_006590582.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like isoform X2 [Glycine max]
 ref|XP_006590583.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like isoform X3 [Glycine max]
 ref|XP_006590584.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like isoform X4 [Glycine max]
Length=1106

 Score =   336 bits (861),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 157/226 (69%), Positives = 182/226 (81%), Gaps = 6/226 (3%)
 Frame = -3

Query  742   FQKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKT  563
              +KC+C V+NGGE+P+N NGAIV+ KPLVYECGP CKCP +C+NRVSQ GIK QLEIFKT
Sbjct  881   LEKCSCVVKNGGEIPFNHNGAIVQAKPLVYECGPTCKCPSTCHNRVSQLGIKFQLEIFKT  940

Query  562   ESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYS------DCSI  401
             ++RGWGVRSL SIPSG+FICEY GELLEDKEAE+R G+DEYLFDIG+NYS      D S 
Sbjct  941   DTRGWGVRSLNSIPSGSFICEYIGELLEDKEAEQRTGNDEYLFDIGNNYSNSALWDDLST  1000

Query  400   NPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
                    TS E V++ G TIDAA++GNVGRFINHSCSPNL AQNVLYD  D ++PHIM F
Sbjct  1001  LMPDVHTTSCEVVKDGGFTIDAAQFGNVGRFINHSCSPNLIAQNVLYDNHDTRMPHIMFF  1060

Query  220   AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             A +NI PL+ELTY YNY +DQ+RDS GNIK K C CGS ECTGR+Y
Sbjct  1061  AADNIPPLQELTYDYNYEIDQIRDSGGNIKKKYCHCGSVECTGRMY  1106



>ref|XP_010055419.1| PREDICTED: uncharacterized protein LOC104443628 [Eucalyptus grandis]
 gb|KCW71897.1| hypothetical protein EUGRSUZ_E00362 [Eucalyptus grandis]
Length=1056

 Score =   335 bits (859),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 183/225 (81%), Gaps = 7/225 (3%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             ++C C V+NGGE+PYN NGAIVEVKPLVYECGP CKCP SC+NRV+Q G+K QLEIFKTE
Sbjct  833   ERCICTVKNGGEIPYNYNGAIVEVKPLVYECGPRCKCPSSCHNRVTQRGLKFQLEIFKTE  892

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
             SRGWGVRSL SIPSG+FICEY GELL D+EAE R  +DEYLFDIG NY+D ++       
Sbjct  893   SRGWGVRSLNSIPSGSFICEYIGELLSDEEAEERT-NDEYLFDIGTNYNDSNLWDELSTL  951

Query  379   T------SSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
                    S E VE+ G TIDAA+ GNVGRFINHSCSPNLYAQNVLYD++D++VPHIM FA
Sbjct  952   MPDVHMDSCEIVEDGGFTIDAAKCGNVGRFINHSCSPNLYAQNVLYDHEDKRVPHIMFFA  1011

Query  217   VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
              ENI PL+ELTYHYNYT+ QV DSSGNIK K C+CGS ECTGR+Y
Sbjct  1012  AENIPPLQELTYHYNYTIGQVHDSSGNIKKKDCYCGSVECTGRMY  1056



>gb|KHN34893.1| Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 
[Glycine soja]
Length=1092

 Score =   335 bits (860),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 157/226 (69%), Positives = 182/226 (81%), Gaps = 6/226 (3%)
 Frame = -3

Query  742   FQKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKT  563
              +KC+C V+NGGE+P+N NGAIV+ KPLVYECGP CKCP +C+NRVSQ GIK QLEIFKT
Sbjct  867   LEKCSCVVKNGGEIPFNHNGAIVQAKPLVYECGPTCKCPSTCHNRVSQLGIKFQLEIFKT  926

Query  562   ESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYS------DCSI  401
             ++RGWGVRSL SIPSG+FICEY GELLEDKEAE+R G+DEYLFDIG+NYS      D S 
Sbjct  927   DTRGWGVRSLNSIPSGSFICEYIGELLEDKEAEQRTGNDEYLFDIGNNYSNSALWDDLST  986

Query  400   NPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
                    TS E V++ G TIDAA++GNVGRFINHSCSPNL AQNVLYD  D ++PHIM F
Sbjct  987   LMPDVHTTSCEVVKDGGFTIDAAQFGNVGRFINHSCSPNLIAQNVLYDNHDTRMPHIMFF  1046

Query  220   AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             A +NI PL+ELTY YNY +DQ+RDS GNIK K C CGS ECTGR+Y
Sbjct  1047  AADNIPPLQELTYDYNYEIDQIRDSGGNIKKKYCHCGSVECTGRMY  1092



>ref|XP_009140380.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6 isoform X1 [Brassica rapa]
Length=776

 Score =   327 bits (838),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 179/225 (80%), Gaps = 6/225 (3%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            + CAC  +NGGE+PYN +GAIV  K L+YECGP CKCP SCY RV+Q GIK  LEIFKTE
Sbjct  552  KDCACVAKNGGEIPYNYDGAIVSAKNLIYECGPLCKCPASCYLRVTQRGIKFPLEIFKTE  611

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD------CSIN  398
            SRGWGVRSL+SIPSG+FICEY GELLEDKEAERR G+DEYLFDIG+ Y +        + 
Sbjct  612  SRGWGVRSLSSIPSGSFICEYVGELLEDKEAERRTGNDEYLFDIGNRYDNSLAEGMSKLM  671

Query  397  PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
            P  Q     +  E  G TIDAA+ GN+GRFINH CSPNLYAQNVLYD++D ++PH+M FA
Sbjct  672  PETQPAMGGDDDEMSGFTIDAAKKGNIGRFINHCCSPNLYAQNVLYDHEDTRIPHVMFFA  731

Query  217  VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            ++N+ PL+ELTYHYNY +DQVRDS+GNIK K C+CGS++CTGRLY
Sbjct  732  MDNVPPLQELTYHYNYIIDQVRDSNGNIKKKTCYCGSSDCTGRLY  776



>gb|KHG16641.1| Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 
-like protein [Gossypium arboreum]
Length=993

 Score =   331 bits (849),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/251 (62%), Positives = 190/251 (76%), Gaps = 6/251 (2%)
 Frame = -3

Query  736  KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
            KC+C +RNGG++PYN NGAIVE KPLVYECGP CKCP SCYNRVSQ+GIK Q EIFKT+S
Sbjct  696  KCSCVMRNGGQIPYNHNGAIVETKPLVYECGPTCKCPASCYNRVSQHGIKFQFEIFKTKS  755

Query  556  RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPS-----  392
             GWGVRSL SIPSG+FICEYAGELLED+EAE+R G DEYLFDIG+ YSD S+        
Sbjct  756  TGWGVRSLNSIPSGSFICEYAGELLEDREAEKRTGKDEYLFDIGNKYSDSSLWDDLSTLI  815

Query  391  -GQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
               + +  + V E G TIDAA +GN+GRFINHSCSPNLYAQNVLYD+DD+++PHIM FA 
Sbjct  816  HDSRSSFRQVVPECGFTIDAARFGNMGRFINHSCSPNLYAQNVLYDHDDKRIPHIMFFAA  875

Query  214  ENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY*LVFKGLSSRVGSGFS  35
            ENI PL+ELTYHYNY +DQV D +G+I+ K C CGS++CT      +F+G         +
Sbjct  876  ENIPPLQELTYHYNYMIDQVHDENGDIRKKVCCCGSSKCTELHSKRMFEGELLLSAYSTT  935

Query  34   SLPNVSSFFSL  2
            S+ + + F  +
Sbjct  936  SIQDAAQFLEV  946



>ref|XP_010677133.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010677134.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Beta vulgaris subsp. vulgaris]
Length=797

 Score =   327 bits (837),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/223 (66%), Positives = 184/223 (83%), Gaps = 6/223 (3%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            CAC+++NGG++PYN +GAIVE K L YECGP C CPP+C+NRVSQ+GIK+ LEIFKTES+
Sbjct  575  CACSLKNGGKIPYNYSGAIVEEKSLAYECGPSCNCPPTCHNRVSQHGIKLPLEIFKTESK  634

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPS------  392
            GWG+RSL+SIPSG+F+CEY GELL+DKEAE+R+G+DEYLFDIG NYSD ++         
Sbjct  635  GWGLRSLSSIPSGSFVCEYIGELLDDKEAEQRVGNDEYLFDIGQNYSDPTLREELSALMP  694

Query  391  GQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVE  212
             +  +  + VE VG T+DA  YGNVGRFINHSCSPNL+AQNVLYD+DD+++PHIM+FA E
Sbjct  695  DKPSSCRDVVENVGFTLDAGIYGNVGRFINHSCSPNLFAQNVLYDHDDKRIPHIMMFACE  754

Query  211  NISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            NI PL+ELTYHYNY +DQV D  G IK K C CGS+EC+GR+Y
Sbjct  755  NIPPLQELTYHYNYAIDQVFDFEGKIKKKSCHCGSSECSGRMY  797



>ref|XP_010672910.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010672911.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010672912.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010672913.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Beta vulgaris subsp. vulgaris]
Length=1035

 Score =   331 bits (848),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 183/225 (81%), Gaps = 6/225 (3%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             + CACAV+NGG++P+N +GAIV+ KPLVYECGP CKCPPSC+NRVSQ+GIK+ LE+FKT+
Sbjct  811   EHCACAVKNGGDIPFNYSGAIVQAKPLVYECGPLCKCPPSCHNRVSQHGIKLPLEVFKTD  870

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPS----  392
              RGWGVR L++IPSG+FICEY GELL+DKEAE+R G+DEYLFDIG NY+D S+       
Sbjct  871   CRGWGVRCLSAIPSGSFICEYIGELLDDKEAEQRTGNDEYLFDIGQNYNDVSLWDGLSAL  930

Query  391   --GQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
                    + + +E VG TID   YGN+GRFINHSCSPNLYAQNVLY++DD ++P+IM FA
Sbjct  931   LPEMTSATDDVIENVGFTIDGLRYGNIGRFINHSCSPNLYAQNVLYEHDDERIPNIMFFA  990

Query  217   VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
              ENI PL+ELTYHYNYT+D+V DS GNIK K C CGS ECTGRLY
Sbjct  991   AENIPPLQELTYHYNYTIDEVHDSLGNIKKKSCHCGSMECTGRLY  1035



>gb|KHN42656.1| Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 
[Glycine soja]
Length=1081

 Score =   331 bits (848),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 153/229 (67%), Positives = 184/229 (80%), Gaps = 9/229 (4%)
 Frame = -3

Query  742   FQKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKT  563
              +KC+C V+NGGE+P+N N AIV+ KPLVYECGP CKCP +C+NRVSQ GIK QLEIFKT
Sbjct  853   LEKCSCVVKNGGEIPFNHNEAIVQAKPLVYECGPTCKCPSTCHNRVSQLGIKFQLEIFKT  912

Query  562   ESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQK  383
             ++RGWGVRSL SIPSG+FICEY GELLEDKEAE+R G+DEYLFDIG+NYS+ ++      
Sbjct  913   DTRGWGVRSLNSIPSGSFICEYIGELLEDKEAEQRTGNDEYLFDIGNNYSNSTLWDDLST  972

Query  382   CT---------SSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHI  230
              T         S E V++ G TIDAA++GN+GRFINHSCSPNL AQNVLYD+ D ++PHI
Sbjct  973   LTTLMPDAHTASCEVVKDGGFTIDAAQFGNLGRFINHSCSPNLIAQNVLYDHHDTRMPHI  1032

Query  229   MLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             M FA +NI PL+ELTY YNY +DQVRDS GNIK K C+CGS +CTGR+Y
Sbjct  1033  MFFAADNIPPLQELTYDYNYEIDQVRDSDGNIKKKYCYCGSVDCTGRMY  1081



>ref|XP_003517399.2| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Glycine max]
Length=1081

 Score =   331 bits (848),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 153/229 (67%), Positives = 184/229 (80%), Gaps = 9/229 (4%)
 Frame = -3

Query  742   FQKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKT  563
              +KC+C V+NGGE+P+N N AIV+ KPLVYECGP CKCP +C+NRVSQ GIK QLEIFKT
Sbjct  853   LEKCSCVVKNGGEIPFNHNEAIVQAKPLVYECGPTCKCPSTCHNRVSQLGIKFQLEIFKT  912

Query  562   ESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQK  383
             ++RGWGVRSL SIPSG+FICEY GELLEDKEAE+R G+DEYLFDIG+NYS+ ++      
Sbjct  913   DTRGWGVRSLNSIPSGSFICEYIGELLEDKEAEQRTGNDEYLFDIGNNYSNSTLWDDLST  972

Query  382   CT---------SSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHI  230
              T         S E V++ G TIDAA++GN+GRFINHSCSPNL AQNVLYD+ D ++PHI
Sbjct  973   LTTLMPDAHSASCEVVKDGGFTIDAAQFGNLGRFINHSCSPNLIAQNVLYDHHDTRMPHI  1032

Query  229   MLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             M FA +NI PL+ELTY YNY +DQVRDS GNIK K C+CGS +CTGR+Y
Sbjct  1033  MFFAADNIPPLQELTYDYNYEIDQVRDSDGNIKKKYCYCGSVDCTGRMY  1081



>ref|XP_006293363.1| hypothetical protein CARUB_v10022678mg [Capsella rubella]
 gb|EOA26261.1| hypothetical protein CARUB_v10022678mg [Capsella rubella]
Length=777

 Score =   324 bits (830),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/224 (68%), Positives = 178/224 (79%), Gaps = 7/224 (3%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            CAC ++N GE+PYN +GAIV  KPL+YECGP C+C   CY RV+Q GIKIQLEIFKT+SR
Sbjct  554  CACVLKNNGEIPYNYDGAIVGAKPLIYECGPLCECRSDCYLRVTQLGIKIQLEIFKTKSR  613

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD------CSINPS  392
            GWGVRS+ SIP G+FICEY GELLED EAERRIG+DEYLFDIG+ Y D        + P 
Sbjct  614  GWGVRSVKSIPIGSFICEYVGELLEDSEAERRIGNDEYLFDIGNRYDDSLAQGMSELMPG  673

Query  391  GQKCTSSEQVEEV-GHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
             +K  + E+VEE  G TIDAA  GNVGRFINHSCSPNLYAQNVLYD++D ++PH+M FA+
Sbjct  674  KKKKPAMEEVEETSGFTIDAATKGNVGRFINHSCSPNLYAQNVLYDHEDTRMPHVMFFAM  733

Query  214  ENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            +NI PL+ELTYHYNY +DQVRDS GNIK K CFCGS  CT RLY
Sbjct  734  DNIPPLQELTYHYNYAIDQVRDSKGNIKKKACFCGSDGCTRRLY  777



>ref|XP_009367580.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like isoform X1 [Pyrus x bretschneideri]
Length=1070

 Score =   330 bits (845),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 168/226 (74%), Positives = 184/226 (81%), Gaps = 8/226 (4%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             +KC+CAV NGGE+PYN NGAIVE K LVYECG  CKCPPSCYNRVSQ GIK QLEIFKTE
Sbjct  846   EKCSCAVENGGEIPYNFNGAIVEAKSLVYECGLSCKCPPSCYNRVSQRGIKFQLEIFKTE  905

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCS-------I  401
             SRGWGVRSL SIPSG+FICEY GELLE+KEAE R G+DEYLFDIG+NYSD S       +
Sbjct  906   SRGWGVRSLNSIPSGSFICEYIGELLEEKEAEERTGNDEYLFDIGNNYSDNSLWDGLSTL  965

Query  400   NPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
              P     +S   V E G TIDA EYGNVGRFINHSCSPNLYAQNVLYD+DD ++PHIM F
Sbjct  966   MPDAH-SSSHGVVGEGGFTIDAVEYGNVGRFINHSCSPNLYAQNVLYDHDDTRIPHIMFF  1024

Query  220   AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             A ENI PL+ELTYHYNY +DQVRDS+G IK K C+CGS ECTGRLY
Sbjct  1025  AAENIPPLQELTYHYNYMIDQVRDSNGKIKKKSCYCGSPECTGRLY  1070



>ref|XP_009367581.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like isoform X2 [Pyrus x bretschneideri]
Length=1064

 Score =   329 bits (844),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 168/226 (74%), Positives = 184/226 (81%), Gaps = 8/226 (4%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             +KC+CAV NGGE+PYN NGAIVE K LVYECG  CKCPPSCYNRVSQ GIK QLEIFKTE
Sbjct  840   EKCSCAVENGGEIPYNFNGAIVEAKSLVYECGLSCKCPPSCYNRVSQRGIKFQLEIFKTE  899

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCS-------I  401
             SRGWGVRSL SIPSG+FICEY GELLE+KEAE R G+DEYLFDIG+NYSD S       +
Sbjct  900   SRGWGVRSLNSIPSGSFICEYIGELLEEKEAEERTGNDEYLFDIGNNYSDNSLWDGLSTL  959

Query  400   NPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
              P     +S   V E G TIDA EYGNVGRFINHSCSPNLYAQNVLYD+DD ++PHIM F
Sbjct  960   MPDAH-SSSHGVVGEGGFTIDAVEYGNVGRFINHSCSPNLYAQNVLYDHDDTRIPHIMFF  1018

Query  220   AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             A ENI PL+ELTYHYNY +DQVRDS+G IK K C+CGS ECTGRLY
Sbjct  1019  AAENIPPLQELTYHYNYMIDQVRDSNGKIKKKSCYCGSPECTGRLY  1064



>emb|CDY25627.1| BnaA04g13190D [Brassica napus]
Length=746

 Score =   322 bits (825),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 150/219 (68%), Positives = 178/219 (81%), Gaps = 13/219 (6%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            + CAC  +NGGE+PYN +GAIV  K L+YECGP CKCP SCY RV+Q GIK  LEIFKTE
Sbjct  541  KDCACVAKNGGEIPYNYDGAIVSAKNLIYECGPLCKCPASCYLRVTQRGIKFPLEIFKTE  600

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
            SRGWGVRSL+SIPSG+FICEY GELLEDKEAERR G+DEYLFDIG+ Y D S+       
Sbjct  601  SRGWGVRSLSSIPSGSFICEYVGELLEDKEAERRTGNDEYLFDIGNRY-DNSL-------  652

Query  379  TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
                  E +G TIDAA+ GN+GRFINH CSPNLYAQNVLYD++D ++PH+M FA++N+ P
Sbjct  653  -----AEGIGFTIDAAKKGNIGRFINHCCSPNLYAQNVLYDHEDTRIPHVMFFAMDNVPP  707

Query  199  LRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            L+ELTYHYNY +DQVRDS+GNIK K C+CGS++CTGRLY
Sbjct  708  LQELTYHYNYMIDQVRDSNGNIKKKTCYCGSSDCTGRLY  746



>ref|XP_010417031.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Camelina sativa]
Length=841

 Score =   323 bits (829),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/226 (67%), Positives = 178/226 (79%), Gaps = 7/226 (3%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            + C C  +NGGE+PYN +GAIV  KPL+YECGP CKCP SCY RV+Q+GI+  LEIFKT+
Sbjct  616  KNCNCVDKNGGEIPYNHDGAIVGAKPLIYECGPRCKCPASCYLRVTQHGIRFPLEIFKTK  675

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDC------SIN  398
            SRGWGVRSL SIPSG+FICEY GELLED EAERR G+DEYLFDIG+ Y +        I 
Sbjct  676  SRGWGVRSLKSIPSGSFICEYVGELLEDSEAERRTGNDEYLFDIGNRYENTLAEGMSEIM  735

Query  397  PSGQKCTSSEQVEEV-GHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
            P  Q   + E+ EE  G TIDAA  GN+GRFINHSCSPNLYAQNVLYD+ D+++PH+M F
Sbjct  736  PGAQAGPAEEEDEEASGFTIDAATKGNIGRFINHSCSPNLYAQNVLYDHADKRMPHVMFF  795

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            A++NI PL+ELTYHYNY +DQVRDS GNIK K C+CGSA CT RLY
Sbjct  796  AMDNIPPLQELTYHYNYAIDQVRDSMGNIKKKACYCGSAVCTRRLY  841



>ref|XP_010429207.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like isoform X2 [Camelina sativa]
Length=823

 Score =   322 bits (826),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/226 (67%), Positives = 178/226 (79%), Gaps = 7/226 (3%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            + C C  +NGGE+PYN +GAIV  KPL+YECGP CKCP SCY RV+Q+GI+  LEIFKT+
Sbjct  598  KNCNCVDKNGGEIPYNHDGAIVGAKPLIYECGPRCKCPASCYLRVTQHGIRFPLEIFKTK  657

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDC------SIN  398
            SRGWGVRS+ SIPSG+FICEY GELLED EAERR G+DEYLFDIG+ Y +        I 
Sbjct  658  SRGWGVRSIKSIPSGSFICEYVGELLEDSEAERRTGNDEYLFDIGNRYENTLAEGMSEIM  717

Query  397  PSGQKCTSSEQVEEV-GHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
            P  Q   + E+ EE  G TIDAA  GN+GRFINHSCSPNLYAQNVLYD+ D+++PH+M F
Sbjct  718  PGAQAGPAEEEDEEASGFTIDAATKGNIGRFINHSCSPNLYAQNVLYDHADKRMPHVMFF  777

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            A++NI PL+ELTYHYNY +DQVRDS GNIK K C+CGSA CT RLY
Sbjct  778  AMDNIPPLQELTYHYNYAIDQVRDSMGNIKKKACYCGSAVCTHRLY  823



>ref|XP_010429206.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like isoform X1 [Camelina sativa]
Length=830

 Score =   322 bits (826),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/226 (67%), Positives = 178/226 (79%), Gaps = 7/226 (3%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            + C C  +NGGE+PYN +GAIV  KPL+YECGP CKCP SCY RV+Q+GI+  LEIFKT+
Sbjct  605  KNCNCVDKNGGEIPYNHDGAIVGAKPLIYECGPRCKCPASCYLRVTQHGIRFPLEIFKTK  664

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDC------SIN  398
            SRGWGVRS+ SIPSG+FICEY GELLED EAERR G+DEYLFDIG+ Y +        I 
Sbjct  665  SRGWGVRSIKSIPSGSFICEYVGELLEDSEAERRTGNDEYLFDIGNRYENTLAEGMSEIM  724

Query  397  PSGQKCTSSEQVEEV-GHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
            P  Q   + E+ EE  G TIDAA  GN+GRFINHSCSPNLYAQNVLYD+ D+++PH+M F
Sbjct  725  PGAQAGPAEEEDEEASGFTIDAATKGNIGRFINHSCSPNLYAQNVLYDHADKRMPHVMFF  784

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            A++NI PL+ELTYHYNY +DQVRDS GNIK K C+CGSA CT RLY
Sbjct  785  AMDNIPPLQELTYHYNYAIDQVRDSMGNIKKKACYCGSAVCTHRLY  830



>ref|XP_010472268.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like isoform X2 [Camelina sativa]
Length=787

 Score =   321 bits (822),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 177/226 (78%), Gaps = 7/226 (3%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            + C C  +NGGE+PYN +GAIV  KPL+YECGP CKCP S Y RV+Q+GI+  LEIFKT+
Sbjct  562  KNCNCVDKNGGEIPYNHDGAIVGAKPLIYECGPRCKCPASSYLRVTQHGIRFPLEIFKTK  621

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDC------SIN  398
            SRGWGVRSL SIPSG+FICEY GELLED EAERR G+DEYLFDIG+ Y +        + 
Sbjct  622  SRGWGVRSLKSIPSGSFICEYVGELLEDSEAERRTGNDEYLFDIGNRYENTLAEGMSELM  681

Query  397  PSGQKCTSSEQVEEV-GHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
            P  Q   + E+ EE  G TIDAA  GN+GRFINHSCSPNLYAQNVLYD+ D+++PH+M F
Sbjct  682  PGAQAGPAEEEDEEASGFTIDAATKGNIGRFINHSCSPNLYAQNVLYDHADKRMPHVMFF  741

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            A++NI PL+ELTYHYNY +DQVRDS GNIK K C+CGSA CT RLY
Sbjct  742  AMDNIPPLQELTYHYNYAIDQVRDSMGNIKTKACYCGSAVCTHRLY  787



>ref|XP_010472269.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like isoform X3 [Camelina sativa]
Length=839

 Score =   322 bits (824),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 177/226 (78%), Gaps = 7/226 (3%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            + C C  +NGGE+PYN +GAIV  KPL+YECGP CKCP S Y RV+Q+GI+  LEIFKT+
Sbjct  614  KNCNCVDKNGGEIPYNHDGAIVGAKPLIYECGPRCKCPASSYLRVTQHGIRFPLEIFKTK  673

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDC------SIN  398
            SRGWGVRSL SIPSG+FICEY GELLED EAERR G+DEYLFDIG+ Y +        + 
Sbjct  674  SRGWGVRSLKSIPSGSFICEYVGELLEDSEAERRTGNDEYLFDIGNRYENTLAEGMSELM  733

Query  397  PSGQKCTSSEQVEEV-GHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
            P  Q   + E+ EE  G TIDAA  GN+GRFINHSCSPNLYAQNVLYD+ D+++PH+M F
Sbjct  734  PGAQAGPAEEEDEEASGFTIDAATKGNIGRFINHSCSPNLYAQNVLYDHADKRMPHVMFF  793

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            A++NI PL+ELTYHYNY +DQVRDS GNIK K C+CGSA CT RLY
Sbjct  794  AMDNIPPLQELTYHYNYAIDQVRDSMGNIKTKACYCGSAVCTHRLY  839



>ref|XP_006410675.1| hypothetical protein EUTSA_v10016339mg [Eutrema salsugineum]
 gb|ESQ52128.1| hypothetical protein EUTSA_v10016339mg [Eutrema salsugineum]
Length=688

 Score =   318 bits (814),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 148/219 (68%), Positives = 173/219 (79%), Gaps = 18/219 (8%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            +KCAC  RNGGELPYN +G IV  KPLVYECGP CKCPP CY RV+Q+GI+ QLEIFKTE
Sbjct  488  RKCACVSRNGGELPYNYDGGIVNAKPLVYECGPLCKCPPDCYLRVTQSGIRFQLEIFKTE  547

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
            SRGWGVRSL SIP G+FICEYAGELL++KEAER  G DEYLFDIG ++            
Sbjct  548  SRGWGVRSLDSIPIGSFICEYAGELLQEKEAERLSGKDEYLFDIGKDH------------  595

Query  379  TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
                  E  G TIDAA  GN+GRFINHSCSPNLYAQ+VLYD++D ++PH+MLFA++NI P
Sbjct  596  ------EMTGFTIDAARKGNIGRFINHSCSPNLYAQDVLYDHEDTRIPHVMLFAMDNIPP  649

Query  199  LRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            L EL+YHYNY +DQVRD +GNI+ K C+CGS+ECTGRLY
Sbjct  650  LEELSYHYNYKLDQVRDLNGNIRKKNCYCGSSECTGRLY  688



>ref|XP_002879534.1| hypothetical protein ARALYDRAFT_902613 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55793.1| hypothetical protein ARALYDRAFT_902613 [Arabidopsis lyrata subsp. 
lyrata]
Length=802

 Score =   320 bits (820),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/219 (68%), Positives = 175/219 (80%), Gaps = 20/219 (9%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            +KCAC V+NGGE+PYN +GAIV +KPLVYECGPHC+CPPSCY RVSQ+GIKI+LEIFKTE
Sbjct  604  KKCACVVKNGGEIPYNYDGAIVSIKPLVYECGPHCQCPPSCYMRVSQHGIKIKLEIFKTE  663

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
            SRGWGVRSL SIP G+FICEYAGELLEDK+AER  G DEYLF++G               
Sbjct  664  SRGWGVRSLESIPIGSFICEYAGELLEDKQAERLTGKDEYLFELGE--------------  709

Query  379  TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
                  EE   TIDAA  GN+GRFINHSCSPNLYAQ+VLYD++D ++PHIM FA+++I P
Sbjct  710  ------EEDQFTIDAARKGNIGRFINHSCSPNLYAQDVLYDHEDTRIPHIMFFALDHIPP  763

Query  199  LRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            L EL+Y YNY +DQV DS+GNIK K C+CGSAEC+GRLY
Sbjct  764  LEELSYDYNYKIDQVTDSNGNIKKKICYCGSAECSGRLY  802



>ref|XP_010472267.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like isoform X1 [Camelina sativa]
Length=839

 Score =   321 bits (822),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 177/226 (78%), Gaps = 7/226 (3%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            + C C  +NGGE+PYN +GAIV  KPL+YECGP CKCP S Y RV+Q+GI+  LEIFKT+
Sbjct  614  KNCNCVDKNGGEIPYNHDGAIVGAKPLIYECGPRCKCPASSYLRVTQHGIRFPLEIFKTK  673

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDC------SIN  398
            SRGWGVRSL SIPSG+FICEY GELLED EAERR G+DEYLFDIG+ Y +        + 
Sbjct  674  SRGWGVRSLKSIPSGSFICEYVGELLEDSEAERRTGNDEYLFDIGNRYENTLAEGMSELM  733

Query  397  PSGQKCTSSEQVEEV-GHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
            P  Q   + E+ EE  G TIDAA  GN+GRFINHSCSPNLYAQNVLYD+ D+++PH+M F
Sbjct  734  PGAQAGPAEEEDEEASGFTIDAATKGNIGRFINHSCSPNLYAQNVLYDHADKRMPHVMFF  793

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            A++NI PL+ELTYHYNY +DQVRDS GNIK K C+CGSA CT RLY
Sbjct  794  AMDNIPPLQELTYHYNYAIDQVRDSMGNIKKKACYCGSAVCTHRLY  839



>ref|XP_004300536.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6 [Fragaria vesca subsp. vesca]
Length=1082

 Score =   325 bits (833),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 164/225 (73%), Positives = 186/225 (83%), Gaps = 7/225 (3%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             +KC+CAV+N GE+PYN NGAIVE KPLVYECGP CKCPPSC+NRVSQ+GIK QLEIFKT+
Sbjct  859   EKCSCAVKNRGEIPYNFNGAIVEAKPLVYECGPTCKCPPSCHNRVSQHGIKFQLEIFKTK  918

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD------CSIN  398
             SRGWGVRSL SIPSG FICEY GELLE+KEAE R G+DEYLFDIG+NY+D       S+ 
Sbjct  919   SRGWGVRSLNSIPSGKFICEYIGELLEEKEAEARAGNDEYLFDIGNNYNDNLWDGLSSLM  978

Query  397   PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
             P     +S E VEE   TIDAA  GN+GRFINHSCSPNLYAQNVLYD++D ++PHIM FA
Sbjct  979   PDAH-SSSYEVVEEGCFTIDAASKGNLGRFINHSCSPNLYAQNVLYDHEDNRIPHIMFFA  1037

Query  217   VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
              ENI PL+ELTY YNY +DQVRDS+GNIK K C+CGS ECTGRLY
Sbjct  1038  AENIPPLQELTYDYNYMIDQVRDSNGNIKKKNCYCGSPECTGRLY  1082



>ref|XP_006404732.1| hypothetical protein EUTSA_v10000700mg [Eutrema salsugineum]
 gb|ESQ46185.1| hypothetical protein EUTSA_v10000700mg [Eutrema salsugineum]
Length=769

 Score =   318 bits (815),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 148/231 (64%), Positives = 180/231 (78%), Gaps = 12/231 (5%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            + CAC  +NGGE+PYN +GA+V  K LVYECGPHCKCPPSCY RV+Q GIK +LEIFKTE
Sbjct  539  RNCACVAKNGGEIPYNYDGALVSFKNLVYECGPHCKCPPSCYLRVTQRGIKFKLEIFKTE  598

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDC------SIN  398
            SRGWGVRSL+SIPSG+FICEY GELLEDKEAERRIG+DEYLFDIG  + +        + 
Sbjct  599  SRGWGVRSLSSIPSGSFICEYVGELLEDKEAERRIGNDEYLFDIGKKHDNTLAEGMSKLM  658

Query  397  PSGQKCT------SSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVP  236
            P  Q           +  +  G TIDAA+ GNVGRF+NHSCSPNL+AQ+V+YD++D +  
Sbjct  659  PETQAMKEDEDDDDDDDDKTSGFTIDAAKKGNVGRFLNHSCSPNLFAQDVMYDHEDTRFH  718

Query  235  HIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            H+M FA++NI PLRELTYHYNY +D+VRD +GNIK K C+CGS++CTGRLY
Sbjct  719  HVMFFAMDNIPPLRELTYHYNYKIDEVRDLNGNIKKKICYCGSSDCTGRLY  769



>ref|XP_008786195.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Phoenix dactylifera]
Length=771

 Score =   317 bits (813),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/230 (65%), Positives = 184/230 (80%), Gaps = 9/230 (4%)
 Frame = -3

Query  736  KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
            KCACAV+NGGE+P+N  GAIV+ KPLVYECGP CKCPPSC+NRVSQ+GIK QL+IFKTES
Sbjct  535  KCACAVKNGGEIPFNHRGAIVQAKPLVYECGPSCKCPPSCHNRVSQHGIKFQLQIFKTES  594

Query  556  RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSIN-------  398
            RGWGVRSL  I SG F+CEY GE+LED+EA++R  +DEYLF IG+NY D S+        
Sbjct  595  RGWGVRSLKKITSGGFVCEYVGEVLEDEEAQKR-RNDEYLFAIGNNYYDESLWEGLSTSI  653

Query  397  PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
            P+ Q+  S  + +EVG TIDA+ +GNVGRFINHSC+PNLYAQN+LYD+DD+ +PH+M FA
Sbjct  654  PALQRGASC-KTDEVGFTIDASAFGNVGRFINHSCTPNLYAQNLLYDHDDKSMPHVMFFA  712

Query  217  VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY*LVFK  68
             E+I PL+ELTY YNYT+D+V DS GN+K K C+C S ECTGR + L  K
Sbjct  713  SEDIQPLQELTYDYNYTIDEVHDSDGNVKRKNCYCSSIECTGRRWYLYEK  762



>gb|KEH28682.1| histone-lysine N-methyltransferase, suvh protein [Medicago truncatula]
Length=980

 Score =   321 bits (823),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 152/225 (68%), Positives = 179/225 (80%), Gaps = 6/225 (3%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            +KC+C V+NGGE+P+N NG IV+VKPLVYECGP CKCP +C+NRVSQ GI IQLEIFKT 
Sbjct  756  KKCSCVVKNGGEIPFNHNGDIVKVKPLVYECGPKCKCPSTCHNRVSQLGINIQLEIFKTN  815

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHN------YSDCSIN  398
            S GWGVRSL SIPSG+FICEY GE+LE+KEAE+R  +DEYLFDIG+N      +   S  
Sbjct  816  SMGWGVRSLNSIPSGSFICEYIGEVLEEKEAEQRTSNDEYLFDIGNNKNNNNLWDGLSNL  875

Query  397  PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
                  +SS+ V++   TID A++GNVGRF+NHSCSPNLYAQNVLYD+ D +VPHIMLFA
Sbjct  876  FPNSHSSSSDVVKDFDFTIDGAQFGNVGRFVNHSCSPNLYAQNVLYDHQDTRVPHIMLFA  935

Query  217  VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             ENI PL+ELTY YNYT+D V DS GN+K K CFCGS ECTGRLY
Sbjct  936  AENIPPLQELTYDYNYTIDTVLDSDGNMKKKYCFCGSVECTGRLY  980



>ref|XP_006293777.1| hypothetical protein CARUB_v10022753mg [Capsella rubella]
 gb|EOA26675.1| hypothetical protein CARUB_v10022753mg [Capsella rubella]
Length=704

 Score =   313 bits (803),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 172/219 (79%), Gaps = 20/219 (9%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            + C+C  +N G++PYN +GAI+EVKPLVYECGPHCKCPPSCY RVSQ+GIKIQLE+FKTE
Sbjct  506  KNCSCVAKNDGKIPYNYDGAILEVKPLVYECGPHCKCPPSCYMRVSQHGIKIQLELFKTE  565

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
            SRGWGVRSL S+P G+FICEYAGELLEDK+AE   G DEYLF++G               
Sbjct  566  SRGWGVRSLESVPVGSFICEYAGELLEDKQAEILTGKDEYLFNLGK--------------  611

Query  379  TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
                  EE   TIDAA  GN+GRFINHSCSPN+YAQ+VLYD+D+ ++PH+M FA ENI P
Sbjct  612  ------EEDPFTIDAAREGNIGRFINHSCSPNMYAQDVLYDHDETRIPHVMFFAQENIRP  665

Query  199  LRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            L ELTY YNY +DQVRDS+GNIK K C+CGSAEC+GRLY
Sbjct  666  LEELTYDYNYKIDQVRDSNGNIKKKFCYCGSAECSGRLY  704



>ref|XP_010509646.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH5-like [Camelina sativa]
Length=599

 Score =   311 bits (796),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 144/219 (66%), Positives = 171/219 (78%), Gaps = 20/219 (9%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            + C+C  RNGGE+PYN +GAI+EVKPLVYECGPHCKCPPSCY RV+Q+GIKI+LE+FKTE
Sbjct  401  KTCSCVARNGGEIPYNNDGAILEVKPLVYECGPHCKCPPSCYMRVTQHGIKIKLELFKTE  460

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
            SRGWGVRSL +IP G+F+CEYAGELLEDK+AE   G DEYLF++G               
Sbjct  461  SRGWGVRSLETIPVGSFVCEYAGELLEDKQAEILTGKDEYLFNLGE--------------  506

Query  379  TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
                  EE   TIDA   GN+GRFINHSCSPN+YAQ+VLY+YD+ ++PH+M FA E I P
Sbjct  507  ------EEDPFTIDAGRKGNIGRFINHSCSPNMYAQDVLYEYDETRIPHVMFFAQEVIRP  560

Query  199  LRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            L ELTY YNY +DQVRDS+GNIK K C+CGSAEC+GRLY
Sbjct  561  LEELTYDYNYKIDQVRDSNGNIKKKFCYCGSAECSGRLY  599



>gb|KDO52049.1| hypothetical protein CISIN_1g047072mg [Citrus sinensis]
Length=570

 Score =   310 bits (793),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 147/220 (67%), Positives = 174/220 (79%), Gaps = 6/220 (3%)
 Frame = -3

Query  742  FQKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKT  563
             +KCAC  +NGGE+PYN N AIV+ K LVYECGP CKCPPSCYNRVSQ GIK+QLEI+KT
Sbjct  357  LEKCACVAKNGGEIPYNHNRAIVQAKLLVYECGPSCKCPPSCYNRVSQQGIKVQLEIYKT  416

Query  562  ESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQK  383
            E+RGWGVRSL SI  G+FI E+ GELLE+KEAERR  +D+YLF+IG+NY+D S+      
Sbjct  417  EARGWGVRSLNSIAPGSFIYEFVGELLEEKEAERRTSNDKYLFNIGNNYNDGSL------  470

Query  382  CTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENIS  203
                  V     +     YGNVGRF+NHSCSPNLYAQNVLYD++D+++PH MLFA ENIS
Sbjct  471  WGGLSNVMPDAPSSSCGVYGNVGRFVNHSCSPNLYAQNVLYDHEDKRMPHKMLFAAENIS  530

Query  202  PLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            PL+ELTYHY+Y +DQV DSSGNIK K CFCGS+ECTG LY
Sbjct  531  PLQELTYHYSYMIDQVYDSSGNIKKKSCFCGSSECTGWLY  570



>ref|XP_009378414.1| PREDICTED: uncharacterized protein LOC103966914 [Pyrus x bretschneideri]
Length=1284

 Score =   322 bits (825),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 190/226 (84%), Gaps = 8/226 (4%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             +KC+CAV+NGGE+PYN +GAIVEVKPLVYECGP CKCPPSCYNRVSQ+GIK QL+IFKTE
Sbjct  1060  EKCSCAVQNGGEIPYNFDGAIVEVKPLVYECGPSCKCPPSCYNRVSQHGIKFQLQIFKTE  1119

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD-------CSI  401
             SRGWG+RSL  IPSG+FICEY GELLE+++AE RIG DEYLFDIG+NY+D        ++
Sbjct  1120  SRGWGLRSLNYIPSGSFICEYMGELLEEEKAEERIGYDEYLFDIGNNYNDNNLWDELSTL  1179

Query  400   NPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
              P+    +S E V +   TIDAA+YGNVGRFINHSCSPNLYAQ+VLYD++D ++PHIM F
Sbjct  1180  MPNAL-SSSFEVVYDGKFTIDAAKYGNVGRFINHSCSPNLYAQDVLYDHNDNRIPHIMFF  1238

Query  220   AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             A E+I P++ELTYHYNYT+D V DS+GNIK K C+CGS +CTGRLY
Sbjct  1239  AAEDIPPMKELTYHYNYTIDSVYDSNGNIKKKSCYCGSPDCTGRLY  1284



>ref|XP_010692065.1| PREDICTED: uncharacterized protein LOC104905282 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010692067.1| PREDICTED: uncharacterized protein LOC104905282 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010692068.1| PREDICTED: uncharacterized protein LOC104905282 [Beta vulgaris 
subsp. vulgaris]
Length=1352

 Score =   320 bits (819),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 181/224 (81%), Gaps = 6/224 (3%)
 Frame = -3

Query  736   KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
             +CAC+++NGGE+PYN  G IVE K LVYECGP CKCPP+C+NRVSQ+GIK+ L++FKTES
Sbjct  1129  RCACSLKNGGEIPYNYGGVIVEEKSLVYECGPSCKCPPTCHNRVSQHGIKLPLDVFKTES  1188

Query  556   RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINP------  395
             RGWGVR L+SI  G+F+CEY GELL+DKEAE RI +D YLFDIG NY+D ++        
Sbjct  1189  RGWGVRCLSSISCGSFVCEYIGELLDDKEAEERIDNDGYLFDIGQNYNDPTLRDGLSALI  1248

Query  394   SGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
                  + S+ VE +G T+DA  YGNVGRF+NHSCSPNL+AQNVLYD++D+++PHIM FA 
Sbjct  1249  PDMPSSCSDVVENIGFTLDARIYGNVGRFVNHSCSPNLFAQNVLYDHEDKRIPHIMFFAA  1308

Query  214   ENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             ENI PL+ELTYHYNYT+ QV DS GNIK K C+CGS+ECTGR+Y
Sbjct  1309  ENIPPLQELTYHYNYTIGQVLDSEGNIKKKSCYCGSSECTGRMY  1352



>ref|XP_010505017.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH5-like [Camelina sativa]
 ref|XP_010505018.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH5-like [Camelina sativa]
Length=600

 Score =   307 bits (786),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/219 (65%), Positives = 170/219 (78%), Gaps = 20/219 (9%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            + C+C  +NGGE+PYN +GAI+EVKPLVYECGPHCKCPPSCY RVSQ+GIKI+LE+FKTE
Sbjct  402  KTCSCVAKNGGEIPYNNDGAILEVKPLVYECGPHCKCPPSCYMRVSQHGIKIKLELFKTE  461

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
            SRGWGVRSL +IP G+ +CEYAGELLEDK+AE   G DEYLF++G               
Sbjct  462  SRGWGVRSLETIPVGSLVCEYAGELLEDKQAEILTGKDEYLFNLGE--------------  507

Query  379  TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
                  EE   TIDAA  GN+GR INHSCSPN+YAQ+VLY++D+ ++PH+M FA E I P
Sbjct  508  ------EEDPFTIDAARKGNIGRLINHSCSPNMYAQDVLYEHDETRIPHVMFFAQEVIRP  561

Query  199  LRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            L ELTY YNY +DQVRDS+GNIK K C+CGSAEC+GRLY
Sbjct  562  LEELTYDYNYKIDQVRDSNGNIKKKFCYCGSAECSGRLY  600



>emb|CBI38579.3| unnamed protein product [Vitis vinifera]
Length=556

 Score =   305 bits (782),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 169/218 (78%), Gaps = 20/218 (9%)
 Frame = -3

Query  736  KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
            KCAC ++NGGE+P+N +GAI+E KP +YECGP CKCPPSC NRVSQNGI+  LE+FKT+S
Sbjct  359  KCACVLKNGGEIPFNCSGAIIEAKPWIYECGPLCKCPPSCNNRVSQNGIRFPLEVFKTKS  418

Query  556  RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKCT  377
             GWGVRS   IPSG+FICEYAGEL++DKEAE+R+G+DEYLFD+  +Y             
Sbjct  419  TGWGVRSRNYIPSGSFICEYAGELIQDKEAEQRVGNDEYLFDLAKDYG------------  466

Query  376  SSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISPL  197
                       IDAA++ NVGRF NHSCSPNLYAQNVLYD+DD+++PHIMLFA +NI P+
Sbjct  467  --------AFAIDAAKFANVGRFFNHSCSPNLYAQNVLYDHDDKRMPHIMLFATKNIPPM  518

Query  196  RELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            RELTY YNY V QVRD +G IK K+C+CGS ECTGR+Y
Sbjct  519  RELTYDYNYMVGQVRDINGKIKKKRCYCGSRECTGRMY  556



>gb|EMT10007.1| Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 
[Aegilops tauschii]
Length=1010

 Score =   311 bits (798),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 181/225 (80%), Gaps = 8/225 (4%)
 Frame = -3

Query  736   KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
             +CACAV+NGGE+P+N NGAIV  KPL+YECGP C+CPP+C+NR SQ+GIKI LEIFKT  
Sbjct  787   RCACAVKNGGEIPFNFNGAIVHAKPLIYECGPSCRCPPTCHNRASQHGIKIPLEIFKTGE  846

Query  556   RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD-------CSIN  398
              GWGVRSL+SI SG+FICEYAGELL+D EAE+ I +DEYLFDIGHNY D        S+ 
Sbjct  847   TGWGVRSLSSISSGSFICEYAGELLQDTEAEK-IENDEYLFDIGHNYDDEELWKGLPSMI  905

Query  397   PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
             P  +  TS    E VG TIDAA+ GNVGRFINHSCSPNLYAQNVL+D+DD+++PHIM FA
Sbjct  906   PGLESSTSETMQEAVGFTIDAAKCGNVGRFINHSCSPNLYAQNVLWDHDDKRMPHIMFFA  965

Query  217   VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
              ENI PL+ELTYHYNYT+ QVRD +G  KVK+C CGSA+C  RLY
Sbjct  966   AENIPPLQELTYHYNYTIGQVRDKNGVEKVKECLCGSADCCHRLY  1010



>gb|EYU30751.1| hypothetical protein MIMGU_mgv1a006459mg [Erythranthe guttata]
Length=443

 Score =   297 bits (760),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 171/220 (78%), Gaps = 5/220 (2%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            + CAC ++NGGE+P+N NG I+  KP+V+ECGP CKCPPSC NRVSQNG + +LEIFKTE
Sbjct  228  EPCACVLKNGGEIPFNENGKIIRAKPIVHECGPLCKCPPSCMNRVSQNGPRYKLEIFKTE  287

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQ-K  383
            SRGWGVRS + I SG+FICEY G+LL DKEAE+R+G DEYLFDI     D S    GQ K
Sbjct  288  SRGWGVRSPSYISSGSFICEYIGKLLRDKEAEKRVGKDEYLFDI----CDDSHEEEGQGK  343

Query  382  CTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENIS  203
              S+E+    G  IDAA YGNVGRFINHSCSPNLYAQ VLYD+DDR++PH+M FA +NI 
Sbjct  344  VCSNEKSSVDGFAIDAALYGNVGRFINHSCSPNLYAQEVLYDHDDRRMPHVMFFASKNIR  403

Query  202  PLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            P++EL Y YNY +D++ D +GNIK K C CGS +CTGR+Y
Sbjct  404  PMKELFYDYNYKMDRICDVNGNIKTKDCHCGSRKCTGRMY  443



>ref|XP_010412879.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH5-like [Camelina sativa]
Length=226

 Score =   289 bits (739),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 161/204 (79%), Gaps = 20/204 (10%)
 Frame = -3

Query  694  NRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESRGWGVRSLTSIPSG  515
            N +GAI+EVKPLVYECGPHCKCPPSCY RVSQ+GIKI+LE+FKTESRGWGVRSL SIP G
Sbjct  43   NNDGAILEVKPLVYECGPHCKCPPSCYMRVSQHGIKIKLELFKTESRGWGVRSLESIPVG  102

Query  514  TFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKCTSSEQVEEVGHTIDA  335
            +F+CEYAGELLEDK+AE   G DEYLF++G+                    EE   TIDA
Sbjct  103  SFVCEYAGELLEDKQAEVLTGKDEYLFNLGN--------------------EEDPFTIDA  142

Query  334  AEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISPLRELTYHYNYTVDQV  155
            A  GN+GRFINHSCSPN+YAQ+VLY+YD+ ++PH+M FA E I PL ELTY YNY +DQV
Sbjct  143  ARKGNIGRFINHSCSPNMYAQDVLYEYDETRIPHVMFFAQEVIRPLEELTYDYNYKIDQV  202

Query  154  RDSSGNIKVKQCFCGSAECTGRLY  83
            RDS+GNIK K C+CGSAEC+GRLY
Sbjct  203  RDSNGNIKKKFCYCGSAECSGRLY  226



>ref|XP_010662241.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH5-like [Vitis vinifera]
 ref|XP_010662242.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH5-like [Vitis vinifera]
Length=895

 Score =   308 bits (788),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/225 (64%), Positives = 178/225 (79%), Gaps = 8/225 (4%)
 Frame = -3

Query  736  KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
            KCAC ++NGGE+P+N +GAI+E KP +YECGP CKCPPSC NRVSQNGI+  LE+FKT+S
Sbjct  672  KCACVLKNGGEIPFNCSGAIIEAKPWIYECGPLCKCPPSCNNRVSQNGIRFPLEVFKTKS  731

Query  556  RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDC------SINP  395
             GWGVRS   IPSG+FICEYAGEL++DKEAE+R+G+DEYLFD+G    +C      S   
Sbjct  732  TGWGVRSRNYIPSGSFICEYAGELIQDKEAEQRVGNDEYLFDLGGGM-NCLESQLNSFEA  790

Query  394  SGQKCTSSEQVEEVG-HTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
                 +SS + ++ G   IDAA++ NVGRF NHSCSPNLYAQNVLYD+DD+++PHIMLFA
Sbjct  791  MDDLQSSSYKAKDYGAFAIDAAKFANVGRFFNHSCSPNLYAQNVLYDHDDKRMPHIMLFA  850

Query  217  VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             +NI P+RELTY YNY V QVRD +G IK K+C+CGS ECTGR+Y
Sbjct  851  TKNIPPMRELTYDYNYMVGQVRDINGKIKKKRCYCGSRECTGRMY  895



>gb|AAL38815.1| putative mammalian MHC III region protein G9a [Arabidopsis thaliana]
Length=790

 Score =   305 bits (781),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 170/224 (76%), Gaps = 7/224 (3%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            CAC  +NGGE+PYN +GAIV  KP +YECGP CKCP SCY RV+Q+GIK+ LEIFKT+SR
Sbjct  567  CACVEKNGGEIPYNFDGAIVGAKPTIYECGPLCKCPSSCYLRVTQHGIKLPLEIFKTKSR  626

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC--  380
            GWGVR L SIP G+FICEY GELLED EAERRIG+DEYLFDIG+ Y +       +    
Sbjct  627  GWGVRCLKSIPIGSFICEYVGELLEDSEAERRIGNDEYLFDIGNRYDNSLAQGMSELMLG  686

Query  379  -----TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
                 + +E  E  G TIDAA  GNVGRFINHSCSPNLYAQNVLYD++D ++PH+M FA 
Sbjct  687  TQAGRSMAEGDESSGFTIDAASKGNVGRFINHSCSPNLYAQNVLYDHEDSRIPHVMFFAQ  746

Query  214  ENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            +NI PL+EL Y YNY +DQVRDS GNIK K CFCG+A C  RLY
Sbjct  747  DNIPPLQELCYDYNYALDQVRDSKGNIKQKPCFCGAAVCRRRLY  790



>ref|NP_850030.1| histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 
[Arabidopsis thaliana]
 ref|NP_973514.1| histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 
[Arabidopsis thaliana]
 sp|Q8VZ17.2|SUVH6_ARATH RecName: Full=Histone-lysine N-methyltransferase, H3 lysine-9 
specific SUVH6; AltName: Full=Histone H3-K9 methyltransferase 
6; Short=H3-K9-HMTase 6; AltName: Full=Protein SET DOMAIN 
GROUP 23; AltName: Full=Suppressor of variegation 3-9 homolog 
protein 6; Short=Su(var)3-9 homolog protein 6 [Arabidopsis 
thaliana]
 gb|AAK28971.1|AF344449_1 SUVH6 [Arabidopsis thaliana]
 gb|AAO22580.1| putative mammalian MHC III region protein G9a [Arabidopsis thaliana]
 gb|AEC07347.1| histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 
[Arabidopsis thaliana]
 gb|AEC07348.1| histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 
[Arabidopsis thaliana]
Length=790

 Score =   305 bits (781),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 170/224 (76%), Gaps = 7/224 (3%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            CAC  +NGGE+PYN +GAIV  KP +YECGP CKCP SCY RV+Q+GIK+ LEIFKT+SR
Sbjct  567  CACVEKNGGEIPYNFDGAIVGAKPTIYECGPLCKCPSSCYLRVTQHGIKLPLEIFKTKSR  626

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC--  380
            GWGVR L SIP G+FICEY GELLED EAERRIG+DEYLFDIG+ Y +       +    
Sbjct  627  GWGVRCLKSIPIGSFICEYVGELLEDSEAERRIGNDEYLFDIGNRYDNSLAQGMSELMLG  686

Query  379  -----TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
                 + +E  E  G TIDAA  GNVGRFINHSCSPNLYAQNVLYD++D ++PH+M FA 
Sbjct  687  TQAGRSMAEGDESSGFTIDAASKGNVGRFINHSCSPNLYAQNVLYDHEDSRIPHVMFFAQ  746

Query  214  ENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            +NI PL+EL Y YNY +DQVRDS GNIK K CFCG+A C  RLY
Sbjct  747  DNIPPLQELCYDYNYALDQVRDSKGNIKQKPCFCGAAVCRRRLY  790



>gb|AAD15582.1| similar to mammalian MHC III region protein G9a [Arabidopsis 
thaliana]
Length=788

 Score =   305 bits (781),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 170/224 (76%), Gaps = 7/224 (3%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            CAC  +NGGE+PYN +GAIV  KP +YECGP CKCP SCY RV+Q+GIK+ LEIFKT+SR
Sbjct  565  CACVEKNGGEIPYNFDGAIVGAKPTIYECGPLCKCPSSCYLRVTQHGIKLPLEIFKTKSR  624

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC--  380
            GWGVR L SIP G+FICEY GELLED EAERRIG+DEYLFDIG+ Y +       +    
Sbjct  625  GWGVRCLKSIPIGSFICEYVGELLEDSEAERRIGNDEYLFDIGNRYDNSLAQGMSELMLG  684

Query  379  -----TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
                 + +E  E  G TIDAA  GNVGRFINHSCSPNLYAQNVLYD++D ++PH+M FA 
Sbjct  685  TQAGRSMAEGDESSGFTIDAASKGNVGRFINHSCSPNLYAQNVLYDHEDSRIPHVMFFAQ  744

Query  214  ENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            +NI PL+EL Y YNY +DQVRDS GNIK K CFCG+A C  RLY
Sbjct  745  DNIPPLQELCYDYNYALDQVRDSKGNIKQKPCFCGAAVCRRRLY  788



>dbj|BAJ96303.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1163

 Score =   310 bits (795),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 155/225 (69%), Positives = 186/225 (83%), Gaps = 8/225 (4%)
 Frame = -3

Query  736   KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
             +CACAV+NGGE+P+N NGAIV  KPL+YECGP C+CPP+C+NRVSQ+G KI LEIFKT  
Sbjct  940   RCACAVKNGGEIPFNFNGAIVHAKPLIYECGPSCRCPPTCHNRVSQHGTKIPLEIFKTGE  999

Query  556   RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSI---NPS--  392
              GWGVRSL+SI SG+FICEYAGELL+D EAE+R  +DEYLFDIGHNY D  +    PS  
Sbjct  1000  TGWGVRSLSSISSGSFICEYAGELLQDTEAEKR-ENDEYLFDIGHNYDDEELWKGLPSMI  1058

Query  391   -GQKCTSSEQVEE-VGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
              G + ++SE +EE VG TIDAA+ GNVGRFINHSCSPNLYAQNVL+D+DD+++PHIM FA
Sbjct  1059  PGLESSTSETIEEAVGFTIDAAKCGNVGRFINHSCSPNLYAQNVLWDHDDKRMPHIMFFA  1118

Query  217   VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
              ENI PL+ELTYHYNYT+ QVRD +G  KVK+C CG+A+C  RLY
Sbjct  1119  AENIPPLQELTYHYNYTIGQVRDKNGVEKVKECLCGAADCCHRLY  1163



>ref|NP_181061.1| histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 
[Arabidopsis thaliana]
 sp|O82175.1|SUVH5_ARATH RecName: Full=Histone-lysine N-methyltransferase, H3 lysine-9 
specific SUVH5; AltName: Full=Histone H3-K9 methyltransferase 
5; Short=H3-K9-HMTase 5; AltName: Full=Protein SET DOMAIN 
GROUP 9; AltName: Full=Suppressor of variegation 3-9 homolog 
protein 5; Short=Su(var)3-9 homolog protein 5 [Arabidopsis 
thaliana]
 gb|AAK28970.1|AF344448_1 SUVH5 [Arabidopsis thaliana]
 gb|AAC61820.1| similar to mammalian MHC III region protein G9a [Arabidopsis 
thaliana]
 gb|AAL32813.1| putative SET-domain protein [Arabidopsis thaliana]
 gb|AAO30037.1| putative SET-domain protein [Arabidopsis thaliana]
 gb|AEC09075.1| histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 
[Arabidopsis thaliana]
Length=794

 Score =   304 bits (779),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 145/219 (66%), Positives = 174/219 (79%), Gaps = 21/219 (10%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            + CAC V+NGG++PY  +GAIVE+KPLVYECGPHCKCPPSC  RVSQ+GIKI+LEIFKTE
Sbjct  597  KNCACIVKNGGKIPY-YDGAIVEIKPLVYECGPHCKCPPSCNMRVSQHGIKIKLEIFKTE  655

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
            SRGWGVRSL SIP G+FICEYAGELLEDK+AE   G DEYLFD+G               
Sbjct  656  SRGWGVRSLESIPIGSFICEYAGELLEDKQAESLTGKDEYLFDLGD--------------  701

Query  379  TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
                  E+   TI+AA+ GN+GRFINHSCSPNLYAQ+VLYD+++ ++PHIM FA++NI P
Sbjct  702  ------EDDPFTINAAQKGNIGRFINHSCSPNLYAQDVLYDHEEIRIPHIMFFALDNIPP  755

Query  199  LRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            L+EL+Y YNY +DQV DS+GNIK K C+CGSAEC+GRLY
Sbjct  756  LQELSYDYNYKIDQVYDSNGNIKKKFCYCGSAECSGRLY  794



>ref|XP_010238096.1| PREDICTED: uncharacterized protein LOC100825032 [Brachypodium 
distachyon]
Length=1163

 Score =   310 bits (793),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 181/225 (80%), Gaps = 8/225 (4%)
 Frame = -3

Query  736   KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
             +CACAV+NGGE+P+N NGAIV  KPL+YECGP C+CPP+C+NRVSQ+G+KI LEIFKT  
Sbjct  940   RCACAVKNGGEIPFNFNGAIVHAKPLIYECGPSCRCPPTCHNRVSQHGVKIPLEIFKTGE  999

Query  556   RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD-------CSIN  398
              GWGVRSL+SI SG+FICEY GELL+D EAE+R  +DEYLFDIGHNY D        S+ 
Sbjct  1000  TGWGVRSLSSISSGSFICEYGGELLQDTEAEKR-ENDEYLFDIGHNYDDEELWKGLPSMI  1058

Query  397   PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
             P  +  T     ++VG TIDAA  GNVGRFINHSCSPNLYAQNVL+D+DD+++PHIM FA
Sbjct  1059  PGLESATPETMEDDVGFTIDAAISGNVGRFINHSCSPNLYAQNVLWDHDDKRMPHIMFFA  1118

Query  217   VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
              ENI PL+ELTYHYNYT+ QVRD +G  K K+CFCGS++C GRLY
Sbjct  1119  AENIPPLQELTYHYNYTIGQVRDKNGVEKEKKCFCGSSDCCGRLY  1163



>ref|XP_002880456.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56715.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=808

 Score =   303 bits (776),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/226 (63%), Positives = 174/226 (77%), Gaps = 7/226 (3%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            +KCAC V+N GE+PYN +GAIV  K  +YECGP CKCP SCY RV+Q+GIK+ LEIFKT+
Sbjct  583  RKCACVVKNDGEIPYNYDGAIVGAKLFIYECGPLCKCPSSCYLRVTQHGIKLPLEIFKTK  642

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD------CSIN  398
            SRGWGVRSL SIP G+FICEY GELL+D EAERRIG+DEYLFDIG+ Y +        + 
Sbjct  643  SRGWGVRSLKSIPIGSFICEYVGELLDDSEAERRIGNDEYLFDIGNRYDNSLAQGMSELM  702

Query  397  PSGQKCTSSEQVEEV-GHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
            P  Q   +  + +E  G TIDAA+ GN+GRFINHSCSPNLYAQNVLYD++D+++PH+M F
Sbjct  703  PGTQAGRAMAEGDEAGGFTIDAAKKGNIGRFINHSCSPNLYAQNVLYDHEDKRIPHVMFF  762

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            A +NI PL+EL Y YNY ++QVRDS GNIK K C CG+  C  RLY
Sbjct  763  AQDNIPPLQELCYDYNYALNQVRDSKGNIKKKPCLCGAPGCRHRLY  808



>emb|CDY31670.1| BnaA05g08770D [Brassica napus]
Length=717

 Score =   300 bits (769),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 144/219 (66%), Positives = 169/219 (77%), Gaps = 12/219 (5%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            + C C  +N GELPYN +GAIV  KP+VYECGP CKCPP CY RV+Q GIKIQLEIFKTE
Sbjct  511  KNCGCVAKNDGELPYNYDGAIVFRKPMVYECGPLCKCPPDCYLRVTQRGIKIQLEIFKTE  570

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
            SRGWGVRSL SIPSG+FICEYAGELL++ EA+R  G DEYLFDIG +             
Sbjct  571  SRGWGVRSLESIPSGSFICEYAGELLQENEADRLAGKDEYLFDIGTDNG-----------  619

Query  379  TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
             SS   E    TIDAA  GNVGRFINHSCSPNLYAQ+VLY ++D ++PH+MLFA +NI P
Sbjct  620  -SSSFYESSFFTIDAARKGNVGRFINHSCSPNLYAQDVLYHHEDMRIPHVMLFAKDNIPP  678

Query  199  LRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            L+ELTY+YNY + QV D+ GN+KVK C+CGSA+C+GRLY
Sbjct  679  LKELTYYYNYKIGQVLDADGNVKVKNCYCGSAKCSGRLY  717



>ref|XP_009143694.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH5 [Brassica rapa]
Length=717

 Score =   300 bits (769),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 144/219 (66%), Positives = 169/219 (77%), Gaps = 12/219 (5%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            + C C  +N GELPYN +GAIV  KP+VYECGP CKCPP CY RV+Q GIKIQLEIFKTE
Sbjct  511  KNCGCVAKNDGELPYNYDGAIVFRKPMVYECGPLCKCPPDCYLRVTQRGIKIQLEIFKTE  570

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
            SRGWGVRSL SIPSG+FICEYAGELL++ EA+R  G DEYLFDIG +             
Sbjct  571  SRGWGVRSLESIPSGSFICEYAGELLQENEADRLAGKDEYLFDIGTDNG-----------  619

Query  379  TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
             SS   E    TIDAA  GNVGRFINHSCSPNLYAQ+VLY ++D ++PH+MLFA +NI P
Sbjct  620  -SSSFYESSFFTIDAARKGNVGRFINHSCSPNLYAQDVLYHHEDMRIPHVMLFAKDNIPP  678

Query  199  LRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            L+ELTY+YNY + QV D+ GN+KVK C+CGSA+C+GRLY
Sbjct  679  LKELTYYYNYKIGQVLDADGNVKVKNCYCGSAKCSGRLY  717



>gb|EEC83539.1| hypothetical protein OsI_29152 [Oryza sativa Indica Group]
Length=573

 Score =   296 bits (758),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 176/229 (77%), Gaps = 15/229 (7%)
 Frame = -3

Query  736  KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
            KC CAV+NGG++P+N NGAIV  KPL++ECGP C+C  SC+NRVSQ G+KI LE+F+T +
Sbjct  349  KCFCAVKNGGKIPFNSNGAIVHDKPLIFECGPSCRCHSSCHNRVSQKGMKIHLEVFRTAN  408

Query  556  RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD-----------  410
            +GWGVRSL SI SG+FICEY G LL DKEA++R  +DEYLFDI HN  D           
Sbjct  409  KGWGVRSLRSISSGSFICEYVGILLTDKEADKRT-NDEYLFDISHNCDDEDCSKGRPSTI  467

Query  409  CSINPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHI  230
             S+N SG     S+ +E+V  TIDA+EYGN+GRFINHSCSPNLYAQNVL+D+DD++VPHI
Sbjct  468  SSLNSSG---GCSQTMEDVCFTIDASEYGNIGRFINHSCSPNLYAQNVLWDHDDQRVPHI  524

Query  229  MLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            M FA ENI PL+ELTY YNY + +VRD +G +KVK C CGS +C GRLY
Sbjct  525  MFFAAENIPPLQELTYDYNYKIGEVRDLNGRVKVKDCHCGSPQCCGRLY  573



>ref|XP_007156589.1| hypothetical protein PHAVU_002G001600g [Phaseolus vulgaris]
 gb|ESW28583.1| hypothetical protein PHAVU_002G001600g [Phaseolus vulgaris]
Length=1158

 Score =   307 bits (787),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 153/226 (68%), Positives = 184/226 (81%), Gaps = 8/226 (4%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             +KC+C V+NGGE+P+N N AIV+ KPLVYECGP CKCP +C+NRVSQ GIK QLEIFKT 
Sbjct  934   EKCSCVVKNGGEIPFNHNEAIVQAKPLVYECGPTCKCPSTCHNRVSQLGIKFQLEIFKTN  993

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD-------CSI  401
             +RGWGVRSL+SIPSG+FICEY GELLE+KEAE R G+DEYLFDIG+NYS+        ++
Sbjct  994   TRGWGVRSLSSIPSGSFICEYIGELLEEKEAELRAGNDEYLFDIGNNYSNSALWDGLSTL  1053

Query  400   NPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
              P  Q  +S + V++ G TIDAAE+GNVGRFINHSCSPN+ AQNVL D+ D ++PHIM F
Sbjct  1054  MPDAQ-TSSCDVVKDGGFTIDAAEFGNVGRFINHSCSPNIIAQNVLSDHHDTRMPHIMFF  1112

Query  220   AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             A +NI PL+ELTY YNY +DQV DS GNIK K C+CGSAECTGR+Y
Sbjct  1113  AADNIPPLQELTYDYNYEIDQVFDSDGNIKRKYCYCGSAECTGRMY  1158



>emb|CBI38560.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 164/217 (76%), Gaps = 22/217 (10%)
 Frame = -3

Query  736  KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
            KCAC ++NGGE+P+N +GAI+E KP VYECGP CKCPPSC NRVSQNGI+  LE+FKT+S
Sbjct  248  KCACVLKNGGEIPFNCHGAIIETKPWVYECGPLCKCPPSCNNRVSQNGIRFSLEVFKTKS  307

Query  556  RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKCT  377
             GWGVRS   I SG+FICEYAGEL++DKEA+RR  +DEYLFD+ +               
Sbjct  308  TGWGVRSRNYISSGSFICEYAGELIQDKEAKRRTANDEYLFDLDNG--------------  353

Query  376  SSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISPL  197
                       IDAA++GNVGR+INHSCSPNLYAQ VLYD+DD+++PHIMLFA +NI P+
Sbjct  354  --------AFAIDAAKFGNVGRYINHSCSPNLYAQKVLYDHDDKRLPHIMLFATKNIPPM  405

Query  196  RELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRL  86
            RELTYHYNY V QV D +G IK K+C+CGS EC GR+
Sbjct  406  RELTYHYNYMVGQVLDINGQIKTKRCYCGSQECKGRM  442



>emb|CDX84255.1| BnaC04g10170D [Brassica napus]
Length=721

 Score =   299 bits (765),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 144/219 (66%), Positives = 169/219 (77%), Gaps = 12/219 (5%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            + C C  +N GELPYN +GAIV  KP+VYECGP CKCPP CY RV+Q GIKIQLEIFKTE
Sbjct  515  KNCFCVAKNDGELPYNYDGAIVFRKPMVYECGPLCKCPPDCYLRVTQRGIKIQLEIFKTE  574

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
            SRGWGVRSL SIPSG+FICEYAGELL++ EA+R  G DEYLFDIG +             
Sbjct  575  SRGWGVRSLESIPSGSFICEYAGELLQENEADRLAGKDEYLFDIGTDNG-----------  623

Query  379  TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
             SS   E    TIDAA  GNVGRFINHSCSPNLYAQ+VLY ++D ++PH+MLFA +NI P
Sbjct  624  -SSSFYESSFFTIDAARKGNVGRFINHSCSPNLYAQDVLYHHEDMRIPHVMLFAKDNIPP  682

Query  199  LRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            L+ELTY+YNY + QV D+ GN+KVK C+CGSA+C+GRLY
Sbjct  683  LKELTYYYNYKIGQVLDADGNVKVKNCYCGSAKCSGRLY  721



>ref|XP_009593421.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Nicotiana tomentosiformis]
 ref|XP_009593425.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Nicotiana tomentosiformis]
 ref|XP_009593435.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Nicotiana tomentosiformis]
 ref|XP_009593443.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Nicotiana tomentosiformis]
 ref|XP_009593451.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Nicotiana tomentosiformis]
Length=681

 Score =   296 bits (759),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 138/222 (62%), Positives = 174/222 (78%), Gaps = 4/222 (2%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            ++C+CA RNGGE+P+N  G+I+  KPLVYECGP CKCPPSC NRVSQ+G +  LE+FKTE
Sbjct  461  EQCSCASRNGGEIPFNTRGSIIRAKPLVYECGPSCKCPPSCKNRVSQHGPRYHLEVFKTE  520

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQ--  386
            SRGWG+R    + SG+FICEY GELL++KEAERRI  DEYLFD+G NY + +   + +  
Sbjct  521  SRGWGLRLRDYVSSGSFICEYVGELLDEKEAERRIDHDEYLFDVG-NYDEETPKRNKKFA  579

Query  385  -KCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVEN  209
             +  S ++ +E G T+DAA YGNVGRFINHSCSPNLYAQNV+YD+ DR VPHIM FA ++
Sbjct  580  VESNSFQRKDEDGFTLDAARYGNVGRFINHSCSPNLYAQNVMYDHGDRTVPHIMFFASKS  639

Query  208  ISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            I+PL ELTY YNY +DQV D++GN+K K C CGS +C GR+Y
Sbjct  640  IAPLEELTYDYNYQIDQVYDANGNLKKKNCRCGSRKCLGRMY  681



>ref|XP_009787520.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH5-like [Nicotiana sylvestris]
 ref|XP_009787521.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH5-like [Nicotiana sylvestris]
 ref|XP_009787522.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH5-like [Nicotiana sylvestris]
Length=692

 Score =   295 bits (756),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/222 (61%), Positives = 176/222 (79%), Gaps = 4/222 (2%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            ++C+CA RNGGE+ +N  G+I+  KPLVYECGP CKCPPSC NRVSQ+G +  LE+FKTE
Sbjct  472  EQCSCASRNGGEIQFNTRGSIIRAKPLVYECGPSCKCPPSCKNRVSQHGPRYHLEVFKTE  531

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQ--  386
            SRGWG+RS   + SG+FICEY GELL++KEAE+RI  DEYLFD+G NY + +   + +  
Sbjct  532  SRGWGLRSRDYVSSGSFICEYVGELLDEKEAEKRIDHDEYLFDVG-NYDEETPKRNKKFE  590

Query  385  -KCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVEN  209
             +  S ++ +E G T+DAA YGNVGRFINHSCSPNLYAQNV+YD+ DR+VPHIM FA ++
Sbjct  591  VESNSFQRKDEDGFTLDAARYGNVGRFINHSCSPNLYAQNVMYDHGDRRVPHIMFFASKS  650

Query  208  ISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            I+P+ ELTY YNY +DQV D++GN+K K C CGS +C+GR+Y
Sbjct  651  IAPIEELTYDYNYQIDQVYDANGNLKKKNCKCGSRKCSGRMY  692



>ref|NP_001053458.1| Os04g0544100 [Oryza sativa Japonica Group]
 emb|CAE04343.2| OSJNBb0038F03.7 [Oryza sativa Japonica Group]
 dbj|BAF15372.1| Os04g0544100 [Oryza sativa Japonica Group]
Length=841

 Score =   298 bits (764),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/226 (61%), Positives = 178/226 (79%), Gaps = 10/226 (4%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            ++CACAV+NGGE+P+N  G I+E KPLVYECGP CKCPP+C+NRV Q+G++ +L++FKT+
Sbjct  619  KRCACAVKNGGEIPFNDKGRILEAKPLVYECGPSCKCPPTCHNRVGQHGLRFRLQVFKTK  678

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSIN------  398
              GWGVR+L  IPSG+F+CEY GE+LED+EA++R  +DEYLF IGHNY D ++       
Sbjct  679  LMGWGVRTLDFIPSGSFVCEYIGEVLEDEEAQKR-STDEYLFAIGHNYYDEALWEGLSRS  737

Query  397  -PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
             PS QK    ++ EE G  +DA++ GN  +FINHSC+PNLYAQNVLYD+DD+ VPHIM F
Sbjct  738  IPSLQK--GPDKDEEAGFAVDASKMGNFAKFINHSCTPNLYAQNVLYDHDDKSVPHIMFF  795

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            A E+I P +EL+YHYNYT+DQV D++GNIK K+C CGS EC G LY
Sbjct  796  ACEDIPPRQELSYHYNYTIDQVHDANGNIKKKKCLCGSIECDGWLY  841



>ref|XP_004956663.1| PREDICTED: uncharacterized protein LOC101783431 [Setaria italica]
Length=1240

 Score =   303 bits (777),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 151/224 (67%), Positives = 184/224 (82%), Gaps = 8/224 (4%)
 Frame = -3

Query  736   KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
             KCACAV+NGGE+P+N +GAI+E +PL+YECGP C+CPP+C+NRVSQ+G+KI LEIFKT S
Sbjct  1019  KCACAVKNGGEIPFNSDGAIIEARPLIYECGPSCRCPPTCHNRVSQHGVKIPLEIFKTGS  1078

Query  556   RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSI-----NPS  392
              GWGVRSL+SI SG+FICEY GELLEDKEA+ +  +DEYLFDIG NY D  +     +  
Sbjct  1079  TGWGVRSLSSISSGSFICEYVGELLEDKEAD-KTQNDEYLFDIGSNYHDEELWVGLKSVV  1137

Query  391   G-QKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
             G Q  TSS +  E G TIDAAEY NVGRFINHSCSPNLYAQ+VL+D+DD ++PH++LFAV
Sbjct  1138  GVQSSTSSSKTME-GFTIDAAEYANVGRFINHSCSPNLYAQHVLWDHDDMRMPHVVLFAV  1196

Query  214   ENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             ENI PL+ELTYHYNYTV QV D +G  KVK C+CG+++C GRLY
Sbjct  1197  ENIPPLQELTYHYNYTVGQVLDENGKEKVKHCYCGASDCCGRLY  1240



>ref|XP_006477569.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Citrus sinensis]
Length=193

 Score =   280 bits (715),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 155/187 (83%), Gaps = 8/187 (4%)
 Frame = -3

Query  622  SCYNRVSQNGIKIQLEIFKTESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDE  443
            SCYNRVSQ GIK+QLEI KTE++GWGVRSL SIPSG+FICEYAGELLE+KEAERR  +DE
Sbjct  8    SCYNRVSQQGIKVQLEIIKTEAQGWGVRSLNSIPSGSFICEYAGELLEEKEAERRTSNDE  67

Query  442  YLFDIGHNYSDCS-------INPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPN  284
            YLFDIG+NY+D S       + P     +S   VE+ G TIDA EYGNVGRF+NHSCSPN
Sbjct  68   YLFDIGNNYNDGSLWGGLSNVMPDA-PLSSCGVVEDGGFTIDAVEYGNVGRFVNHSCSPN  126

Query  283  LYAQNVLYDYDDRKVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSA  104
            LYAQNVLYD++D++ PHIMLFA ENI PL+ELTYHYNY +DQV DSSGNIK K CFCGS+
Sbjct  127  LYAQNVLYDHEDKRTPHIMLFAAENIPPLQELTYHYNYVIDQVYDSSGNIKKKSCFCGSS  186

Query  103  ECTGRLY  83
            ECTGRLY
Sbjct  187  ECTGRLY  193



>gb|EMT23957.1| Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 
[Aegilops tauschii]
Length=1307

 Score =   303 bits (776),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 141/223 (63%), Positives = 169/223 (76%), Gaps = 7/223 (3%)
 Frame = -3

Query  733   CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
             CAC ++NGGE P+N NGA+V  KPL+YECGP C+CPPSC++RVSQ+G+KI LE+F+T   
Sbjct  1086  CACVLKNGGEFPFNFNGAVVHAKPLIYECGPSCRCPPSCHSRVSQHGMKIPLEVFRTTKT  1145

Query  553   GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKCTS  374
             GWGVRSL SI +G+FICEY GELL   EA +R+ +DEYLFDIGHNY      PS     S
Sbjct  1146  GWGVRSLRSISAGSFICEYVGELLHSDEANQRM-NDEYLFDIGHNYDIWKGMPSVVPGLS  1204

Query  373   SEQVEEV------GHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVE  212
             S     V        TIDAAEYGN+GRFINHSCSPNLYAQN+L+D+DD++VPHIM FA E
Sbjct  1205  SSGPRSVTMDDDRAFTIDAAEYGNIGRFINHSCSPNLYAQNILWDHDDKRVPHIMFFAAE  1264

Query  211   NISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             NISPL+ELTY YNY +D VRD +G +KVK C CGS +C  RLY
Sbjct  1265  NISPLQELTYDYNYEIDHVRDMNGEVKVKYCHCGSPQCRDRLY  1307



>gb|EMS48020.1| Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 
[Triticum urartu]
Length=1234

 Score =   303 bits (775),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 142/223 (64%), Positives = 169/223 (76%), Gaps = 7/223 (3%)
 Frame = -3

Query  733   CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
             CACAV+NGGE P+N NGA+V  KPL+YECGP C+CPPSC++RVSQ+G+KI LE+F+T   
Sbjct  1013  CACAVKNGGEFPFNFNGAVVHAKPLIYECGPSCRCPPSCHSRVSQHGMKIPLEVFRTTKT  1072

Query  553   GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKCTS  374
             GWGVRSL SI +G+FICEY GELL   EA +R+ +DEYLFDIGHNY      PS     S
Sbjct  1073  GWGVRSLRSISAGSFICEYVGELLHSDEANQRM-NDEYLFDIGHNYDIWKGMPSVVPGLS  1131

Query  373   SEQVEEV------GHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVE  212
             S     V        TIDAAEYGN+GRFINHSCSPNLYAQN+L+D+ D++VPHIM FA E
Sbjct  1132  SSAPRSVIMDDDRAFTIDAAEYGNIGRFINHSCSPNLYAQNILWDHGDKRVPHIMFFAAE  1191

Query  211   NISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             NISPL+ELTY YNY +D VRD +G +KVK C CGS +C  RLY
Sbjct  1192  NISPLQELTYDYNYEIDHVRDMNGEVKVKYCHCGSPQCRDRLY  1234



>tpg|DAA36620.1| TPA: putative histone-lysine N-methyltransferase family protein 
isoform 1 [Zea mays]
 tpg|DAA36621.1| TPA: putative histone-lysine N-methyltransferase family protein 
isoform 2 [Zea mays]
Length=886

 Score =   298 bits (764),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 138/225 (61%), Positives = 173/225 (77%), Gaps = 8/225 (4%)
 Frame = -3

Query  736  KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
            KCACAV+NGGE+P+N  G IVE KPLVYECGP CKCPP+C+NRV Q+G+K +L+IFKT+S
Sbjct  663  KCACAVKNGGEIPFNDKGRIVEAKPLVYECGPSCKCPPTCHNRVGQHGLKFRLQIFKTKS  722

Query  556  RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSIN-------  398
             GWGVR+L  IPSG+F+CEY GE+LED+EA++R  +DEYLF IGHNY D S+        
Sbjct  723  MGWGVRTLEFIPSGSFVCEYIGEVLEDEEAQKRT-NDEYLFAIGHNYYDKSLWEGLSRSI  781

Query  397  PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
            PS QK    +   E G  +DA+E GN  +FINH+C+PN+YAQNVLYD++D  VPHIM FA
Sbjct  782  PSLQKGPGKDDENETGFAVDASEMGNFAKFINHNCTPNIYAQNVLYDHEDISVPHIMFFA  841

Query  217  VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             ++I P +EL YHYNY +DQV D++GNIK K+C CGS EC G LY
Sbjct  842  CDDIRPNQELAYHYNYKIDQVHDANGNIKKKKCLCGSVECDGWLY  886



>gb|EAZ31512.1| hypothetical protein OsJ_15653 [Oryza sativa Japonica Group]
Length=933

 Score =   298 bits (763),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/226 (61%), Positives = 178/226 (79%), Gaps = 10/226 (4%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            ++CACAV+NGGE+P+N  G I+E KPLVYECGP CKCPP+C+NRV Q+G++ +L++FKT+
Sbjct  711  KRCACAVKNGGEIPFNDKGRILEAKPLVYECGPSCKCPPTCHNRVGQHGLRFRLQVFKTK  770

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSIN------  398
              GWGVR+L  IPSG+F+CEY GE+LED+EA++R  +DEYLF IGHNY D ++       
Sbjct  771  LMGWGVRTLDFIPSGSFVCEYIGEVLEDEEAQKR-STDEYLFAIGHNYYDEALWEGLSRS  829

Query  397  -PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
             PS QK    ++ EE G  +DA++ GN  +FINHSC+PNLYAQNVLYD+DD+ VPHIM F
Sbjct  830  IPSLQK--GPDKDEEAGFAVDASKMGNFAKFINHSCTPNLYAQNVLYDHDDKSVPHIMFF  887

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            A E+I P +EL+YHYNYT+DQV D++GNIK K+C CGS EC G LY
Sbjct  888  ACEDIPPRQELSYHYNYTIDQVHDANGNIKKKKCLCGSIECDGWLY  933



>ref|XP_010236682.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Brachypodium distachyon]
Length=1116

 Score =   300 bits (768),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 140/222 (63%), Positives = 169/222 (76%), Gaps = 6/222 (3%)
 Frame = -3

Query  733   CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
             CAC V+NGGE+P+N NGA+V  KPL++ECGP C+CPPSC+NRVSQ G+KI LE+F+T   
Sbjct  896   CACVVKNGGEIPFNFNGAVVHAKPLIFECGPSCRCPPSCHNRVSQLGMKISLEVFRTSKT  955

Query  553   GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKCTS  374
             GWGVRSL SI SG+FICEY GELL  KEA +R  +DEY+FDIG NY       S   C +
Sbjct  956   GWGVRSLRSIASGSFICEYVGELLHSKEANQRT-NDEYMFDIGCNYDIWKGEASTIPCLN  1014

Query  373   SE-----QVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVEN  209
             S       +++   TIDAAEYGN+GRFINHSCSPNLY QNVL+D+DD++VPHIM FA EN
Sbjct  1015  SSGPRSLTMKDEDFTIDAAEYGNIGRFINHSCSPNLYTQNVLWDHDDKRVPHIMFFAAEN  1074

Query  208   ISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             ISPL+ELTY YNY +D V D +G +KVK C CGS +C GRLY
Sbjct  1075  ISPLQELTYDYNYKIDHVHDVNGKVKVKYCHCGSPQCRGRLY  1116



>ref|NP_001105193.1| SET domain-containing protein SET104 [Zea mays]
 gb|AAM89288.1| SET domain-containing protein SET104 [Zea mays]
Length=886

 Score =   296 bits (759),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 173/225 (77%), Gaps = 8/225 (4%)
 Frame = -3

Query  736  KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
            KCACAV+NGGE+P+N  G IVE KPLVYECGP CKCPP+C+NRV Q+G+K +L+IFKT+S
Sbjct  663  KCACAVKNGGEIPFNDKGRIVEAKPLVYECGPSCKCPPTCHNRVGQHGLKFRLQIFKTKS  722

Query  556  RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSIN-------  398
             GWGVR+L  IPSG+F+CEY GE+LED+EA++R  +DEYLF IGHNY D S+        
Sbjct  723  MGWGVRTLEFIPSGSFVCEYIGEVLEDEEAQKRT-NDEYLFAIGHNYYDKSLWEGLSRSI  781

Query  397  PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
            PS QK    +   E G  +DA+E GN  +FINH+C+PN+YAQNVLYD+++  VPHIM FA
Sbjct  782  PSLQKGPGKDDENETGFAVDASEMGNFAKFINHNCTPNIYAQNVLYDHEEISVPHIMFFA  841

Query  217  VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             ++I P +EL YHYNY +DQV D++GNIK K+C CGS EC G LY
Sbjct  842  CDDIRPNQELAYHYNYKIDQVHDANGNIKKKKCLCGSVECDGWLY  886



>emb|CDP04777.1| unnamed protein product [Coffea canephora]
Length=442

 Score =   285 bits (730),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 168/218 (77%), Gaps = 22/218 (10%)
 Frame = -3

Query  736  KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
            +C CAV+NGGELP+N  G++V  K +VYECGP+CKCPPSC NRVSQ+G ++ LEIF+T+S
Sbjct  247  RCPCAVKNGGELPFNEEGSVVRAKKMVYECGPNCKCPPSCQNRVSQHGPRLPLEIFRTKS  306

Query  556  RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKCT  377
             GWGVRS   IPSG+FICEYAGELL+DKEA+ R  +DEYLFD+                 
Sbjct  307  TGWGVRSQVEIPSGSFICEYAGELLQDKEADLR-DNDEYLFDLD----------------  349

Query  376  SSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISPL  197
                 +  G TIDAA+YGNVGRFINHSCSPNLYAQNVLYD+DD++VPH+MLFA + I  L
Sbjct  350  -----DGEGFTIDAAKYGNVGRFINHSCSPNLYAQNVLYDHDDKRVPHVMLFATKKIPAL  404

Query  196  RELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            +EL+Y YNY +++V D++GNIK+K+CFCGS +C GRLY
Sbjct  405  KELSYDYNYKLNRVLDANGNIKMKKCFCGSRKCIGRLY  442



>gb|EYU20164.1| hypothetical protein MIMGU_mgv1a020163mg [Erythranthe guttata]
Length=796

 Score =   295 bits (754),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 169/219 (77%), Gaps = 0/219 (0%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            + C+C ++NGGE+P+N NG I+  KP V+ECGP CKCPPSC NRVSQNG++ +LEIFKT+
Sbjct  578  EPCSCVLKNGGEIPFNENGDIIRAKPRVHECGPLCKCPPSCMNRVSQNGLRYKLEIFKTK  637

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
            SRGWGVRS + I SG+FICEY G+LL DKEAE R+G DEYLFDI  + +   +   G++ 
Sbjct  638  SRGWGVRSRSYISSGSFICEYVGKLLRDKEAETRVGRDEYLFDISKSENGVVVEERGERL  697

Query  379  TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
              + +    G+ IDAA +GNVGRFINHSCSPNLYAQ + YD DD+++PHIM FA +NI P
Sbjct  698  VRNRKPSVDGYAIDAAMHGNVGRFINHSCSPNLYAQEIFYDNDDKRMPHIMFFASKNIPP  757

Query  199  LRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            ++ELTY YNY +D++ D +GNIK K C+CG+  CTGR+Y
Sbjct  758  MQELTYDYNYKLDRICDVNGNIKTKACYCGARNCTGRMY  796



>ref|XP_009596759.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Nicotiana tomentosiformis]
Length=874

 Score =   296 bits (757),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 140/223 (63%), Positives = 171/223 (77%), Gaps = 6/223 (3%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            ++C+CA +NGGE+P+N  GAI+  KPLVYECGP CKCPPSC NRVSQ G +  LE+FKTE
Sbjct  654  EQCSCASKNGGEIPFNSRGAIIRAKPLVYECGPSCKCPPSCKNRVSQRGPRYHLEVFKTE  713

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQK-  383
            SRGWG+RS   + SG+FICEY GELL +KEAE+R   DEYLFD+  NY D  I     K 
Sbjct  714  SRGWGLRSRDYVSSGSFICEYVGELLHEKEAEKRTDHDEYLFDVS-NY-DEEIPERNNKF  771

Query  382  ---CTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVE  212
                  S++ +E G T+DAA YGNVGRFINHSCSPNLYAQNV+YD+ DR+VPHIM FA +
Sbjct  772  EVESNCSQRKDEDGFTLDAARYGNVGRFINHSCSPNLYAQNVMYDHGDRRVPHIMFFASK  831

Query  211  NISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            +I PL ELTYHYNY +DQV D++GN+K K C CGS +C+GR+Y
Sbjct  832  SIVPLEELTYHYNYQIDQVYDANGNLKKKNCRCGSRKCSGRMY  874



>ref|XP_004956427.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH5-like [Setaria italica]
Length=883

 Score =   296 bits (757),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 174/226 (77%), Gaps = 10/226 (4%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            +KCACAV+NGGE+P+N  G IVE KPLVYECGP CKCPP+C NRV Q+G+K +L++FKT+
Sbjct  661  KKCACAVKNGGEIPFNDKGRIVEAKPLVYECGPSCKCPPTCRNRVGQHGLKFRLQVFKTK  720

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSIN------  398
            S GWGVR+L  IPSG+F+CEY GE+LED+EA++R  +DEYLF IGHNY D S+       
Sbjct  721  SMGWGVRTLDFIPSGSFVCEYIGEVLEDEEAQKRT-TDEYLFAIGHNYYDESLWEGLSRS  779

Query  397  -PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
             PS QK    +  +E G  +DA+E GN  +FINHSC+PNLYAQNVLYD++D  VPH+M F
Sbjct  780  IPSLQKGPGKD--DEAGFAVDASEMGNFAKFINHSCTPNLYAQNVLYDHEDISVPHVMFF  837

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            A ++I P +EL YHYNY +DQV D++GNIK K+C CGS EC G LY
Sbjct  838  ACDDIRPRQELAYHYNYKIDQVHDANGNIKKKKCLCGSVECDGWLY  883



>gb|EEE68645.1| hypothetical protein OsJ_27218 [Oryza sativa Japonica Group]
Length=1072

 Score =   298 bits (764),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 176/229 (77%), Gaps = 15/229 (7%)
 Frame = -3

Query  736   KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
             KC CAV+NGG++P+N NGAIV  KPL++ECGP C+C  SC+NRVSQ G+KI LE+F+T +
Sbjct  848   KCFCAVKNGGKIPFNSNGAIVHDKPLIFECGPSCRCHSSCHNRVSQKGMKIHLEVFRTAN  907

Query  556   RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD-----------  410
             +GWGVRSL SI SG+FICEY G LL DKEA++R  +DEYLFDI HN  D           
Sbjct  908   KGWGVRSLRSISSGSFICEYVGILLTDKEADKRT-NDEYLFDISHNCDDEDCSKGRPSTI  966

Query  409   CSINPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHI  230
              S+N SG     S+ +E+V  TIDA+EYGN+GRFINHSCSPNLYAQNVL+D+DD++VPHI
Sbjct  967   SSLNSSG---GCSQTMEDVCFTIDASEYGNIGRFINHSCSPNLYAQNVLWDHDDQRVPHI  1023

Query  229   MLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             M FA ENI PL+ELTY YNY + +VRD +G +KVK C CGS +C GRLY
Sbjct  1024  MFFAAENIPPLQELTYDYNYKIGEVRDLNGRVKVKDCHCGSPQCCGRLY  1072



>ref|NP_001061753.1| Os08g0400200 [Oryza sativa Japonica Group]
 dbj|BAF23667.1| Os08g0400200 [Oryza sativa Japonica Group]
Length=1292

 Score =   300 bits (767),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 176/229 (77%), Gaps = 15/229 (7%)
 Frame = -3

Query  736   KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
             KC CAV+NGG++P+N NGAIV  KPL++ECGP C+C  SC+NRVSQ G+KI LE+F+T +
Sbjct  1068  KCFCAVKNGGKIPFNSNGAIVHDKPLIFECGPSCRCHSSCHNRVSQKGMKIHLEVFRTAN  1127

Query  556   RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD-----------  410
             +GWGVRSL SI SG+FICEY G LL DKEA++R  +DEYLFDI HN  D           
Sbjct  1128  KGWGVRSLRSISSGSFICEYVGILLTDKEADKRT-NDEYLFDISHNCDDEDCSKGRPSTI  1186

Query  409   CSINPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHI  230
              S+N SG     S+ +E+V  TIDA+EYGN+GRFINHSCSPNLYAQNVL+D+DD++VPHI
Sbjct  1187  SSLNSSG---GCSQTMEDVCFTIDASEYGNIGRFINHSCSPNLYAQNVLWDHDDQRVPHI  1243

Query  229   MLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             M FA ENI PL+ELTY YNY + +VRD +G +KVK C CGS +C GRLY
Sbjct  1244  MFFAAENIPPLQELTYDYNYKIGEVRDLNGRVKVKDCHCGSPQCCGRLY  1292



>ref|XP_010318184.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Solanum lycopersicum]
Length=740

 Score =   293 bits (749),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 139/226 (62%), Positives = 171/226 (76%), Gaps = 8/226 (4%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            ++C+CA RNGGE+P+N  G+IV  +PLVYECGP CKCPPSC NRVSQ+G +  LE+FKTE
Sbjct  516  EQCSCASRNGGEIPFNTRGSIVRAQPLVYECGPSCKCPPSCKNRVSQHGPRYHLEVFKTE  575

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD-------CSI  401
            SRGWG+RS   + SG+FICEY GELL++KEAE RI +DEYLFDIG NY +          
Sbjct  576  SRGWGLRSRDHVSSGSFICEYVGELLDEKEAENRIDNDEYLFDIG-NYDEEIPKRNVARN  634

Query  400  NPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
            N       SS + +E G T+DA  YGNVGRFINHSCSPNLYAQNV+Y + D+KVPHIM F
Sbjct  635  NNLKVDSNSSMRKDEDGFTLDAIRYGNVGRFINHSCSPNLYAQNVMYYHGDKKVPHIMFF  694

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            A E+I+PL+ELTYHYNY +D V D +G++K K C CGS +C GR+Y
Sbjct  695  ASESIAPLKELTYHYNYHIDHVYDKNGDVKRKNCRCGSRKCEGRMY  740



>dbj|BAC98666.1| putative histone-lysine N-methyltransferase [Oryza sativa Japonica 
Group]
 dbj|BAC99382.1| putative histone-lysine N-methyltransferase [Oryza sativa Japonica 
Group]
Length=1173

 Score =   299 bits (765),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 176/229 (77%), Gaps = 15/229 (7%)
 Frame = -3

Query  736   KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
             KC CAV+NGG++P+N NGAIV  KPL++ECGP C+C  SC+NRVSQ G+KI LE+F+T +
Sbjct  949   KCFCAVKNGGKIPFNSNGAIVHDKPLIFECGPSCRCHSSCHNRVSQKGMKIHLEVFRTAN  1008

Query  556   RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD-----------  410
             +GWGVRSL SI SG+FICEY G LL DKEA++R  +DEYLFDI HN  D           
Sbjct  1009  KGWGVRSLRSISSGSFICEYVGILLTDKEADKRT-NDEYLFDISHNCDDEDCSKGRPSTI  1067

Query  409   CSINPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHI  230
              S+N SG     S+ +E+V  TIDA+EYGN+GRFINHSCSPNLYAQNVL+D+DD++VPHI
Sbjct  1068  SSLNSSG---GCSQTMEDVCFTIDASEYGNIGRFINHSCSPNLYAQNVLWDHDDQRVPHI  1124

Query  229   MLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             M FA ENI PL+ELTY YNY + +VRD +G +KVK C CGS +C GRLY
Sbjct  1125  MFFAAENIPPLQELTYDYNYKIGEVRDLNGRVKVKDCHCGSPQCCGRLY  1173



>gb|EEC77735.1| hypothetical protein OsI_16848 [Oryza sativa Indica Group]
Length=1300

 Score =   299 bits (766),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/226 (60%), Positives = 177/226 (78%), Gaps = 10/226 (4%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             ++CACAV+NGGE+P+N  G I+E KPLVYECGP CKCPP+C+NRV Q+G++ +L++FKT+
Sbjct  1078  KRCACAVKNGGEIPFNDKGRILEAKPLVYECGPSCKCPPTCHNRVGQHGLRFRLQVFKTK  1137

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSIN------  398
               GWGVR+L  IPSG+F+CEY GE+LED+EA++R  +DEYLF IGHNY D ++       
Sbjct  1138  LMGWGVRTLDFIPSGSFVCEYIGEVLEDEEAQKRT-TDEYLFAIGHNYYDEALWEGLSRS  1196

Query  397   -PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
              PS QK    ++ EE    +DA++ GN  +FINHSC+PNLYAQNVLYD+DD+ VPHIM F
Sbjct  1197  IPSLQK--GPDKDEEASFAVDASKMGNFAKFINHSCTPNLYAQNVLYDHDDKSVPHIMFF  1254

Query  220   AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             A E+I P +EL+YHYNYT+DQV D++GNIK K+C CGS EC G LY
Sbjct  1255  ACEDIPPRQELSYHYNYTIDQVHDANGNIKKKKCLCGSIECDGWLY  1300



>ref|XP_003581482.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH5-like [Brachypodium distachyon]
Length=849

 Score =   295 bits (754),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 171/226 (76%), Gaps = 10/226 (4%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            +KCACAV+NGGE+P+N  G I+  KPLVYECGP CKCPP+C+NRV Q G+K +L++FKT+
Sbjct  627  KKCACAVKNGGEIPFNDKGRILAAKPLVYECGPSCKCPPTCHNRVGQKGMKFRLQVFKTK  686

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD-------CSI  401
            S GWGV++L  IP G+F+CEY GE+L+D+EA++R  +DEYLF IGHNY D          
Sbjct  687  SMGWGVKTLDFIPCGSFVCEYIGEVLDDEEAQKRT-TDEYLFAIGHNYYDEILWEGLSRS  745

Query  400  NPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
             PS QK    +  EE G  +DA++ GN  +F+NHSC+PNL+AQNVLYD+DD+ VPHIM F
Sbjct  746  IPSLQKGPGKD--EESGFAVDASKMGNFAKFVNHSCTPNLFAQNVLYDHDDKSVPHIMFF  803

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            A ENI P  EL YHYNYT+DQV D++GNIK K+C CGS EC G LY
Sbjct  804  ACENIQPCEELAYHYNYTIDQVHDANGNIKKKKCLCGSVECDGWLY  849



>ref|XP_006440177.1| hypothetical protein CICLE_v10022382mg [Citrus clementina]
 gb|ESR53417.1| hypothetical protein CICLE_v10022382mg [Citrus clementina]
Length=193

 Score =   275 bits (703),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 153/187 (82%), Gaps = 8/187 (4%)
 Frame = -3

Query  622  SCYNRVSQNGIKIQLEIFKTESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDE  443
            SC+NRVSQ GIK+QLEI KTE+RGWGVRSL SIPSG+FIC YAGELLE+KEAERR  +DE
Sbjct  8    SCHNRVSQQGIKVQLEIIKTEARGWGVRSLNSIPSGSFICAYAGELLEEKEAERRTSNDE  67

Query  442  YLFDIGHNYSDCS-------INPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPN  284
            YLFDIG+ YSD S       + P     +S   VE+ G TIDA EYGNVGRF+NHSCSPN
Sbjct  68   YLFDIGNKYSDGSLWGGLSNVMPDAPS-SSCGVVEDGGFTIDAVEYGNVGRFVNHSCSPN  126

Query  283  LYAQNVLYDYDDRKVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSA  104
            LYAQNVLYD++D+++PHIMLFA ENI PL+ELTYHYNY +DQV DSS NIK K CFCGS+
Sbjct  127  LYAQNVLYDHEDKRMPHIMLFAAENIPPLQELTYHYNYVIDQVYDSSSNIKKKSCFCGSS  186

Query  103  ECTGRLY  83
            ECTGRLY
Sbjct  187  ECTGRLY  193



>ref|XP_006653632.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH5-like, partial [Oryza brachyantha]
Length=820

 Score =   293 bits (749),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/226 (59%), Positives = 174/226 (77%), Gaps = 10/226 (4%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            ++CACAV+NGGE+P+N  G I+E KPLVYECGP CKCPP+C+NRV Q+G+K +L++FKT+
Sbjct  598  KRCACAVKNGGEIPFNDKGCIIEAKPLVYECGPSCKCPPTCHNRVGQHGLKFRLQVFKTK  657

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSIN------  398
              GWGVR+L  IPSG+F+CEY GE+LED+EA++R  +DEYLF IGHNY D ++       
Sbjct  658  LMGWGVRTLDFIPSGSFVCEYIGEVLEDEEAQKRT-TDEYLFAIGHNYYDEALWEGLSRS  716

Query  397  -PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
             PS QK    ++ EE G  +DA++ GN  +FINHSC+PNLYAQN LYD+DD+ +PHIM F
Sbjct  717  IPSLQK--GPDKDEEAGFAVDASKMGNFAKFINHSCTPNLYAQNALYDHDDKSIPHIMFF  774

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            A E+I   +EL+YHYNY++DQV D  GNIK K+C CGS EC G LY
Sbjct  775  ACEDIPRCQELSYHYNYSIDQVHDVDGNIKKKKCLCGSIECDGWLY  820



>dbj|BAK00408.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=961

 Score =   295 bits (755),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/222 (60%), Positives = 169/222 (76%), Gaps = 6/222 (3%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            CACAV+NGGE+P+N  G I+E KPLVYECGP CKCPP+C+NRV Q GIK +L++FKT+S 
Sbjct  741  CACAVKNGGEIPFNDMGRIIEAKPLVYECGPSCKCPPTCHNRVGQKGIKFRLQVFKTKSM  800

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKCTS  374
            GWGV++L  IPSG+F+CEY GE+L+D+EA++R+ +DEYLF IGHNY D ++     +   
Sbjct  801  GWGVKTLDYIPSGSFVCEYIGEVLDDEEAQKRM-TDEYLFAIGHNYYDETLWEGLSRSIP  859

Query  373  SEQ-----VEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVEN  209
            S Q      EE G  +DA++ GN  +FINHSC+PNLYAQN LYD+DD+  PHIM FA EN
Sbjct  860  SLQNGPGNDEEAGFAVDASKMGNFAKFINHSCTPNLYAQNALYDHDDKSAPHIMFFACEN  919

Query  208  ISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            I P +EL YHYNY +DQV D +GNIK K+C CGS EC G LY
Sbjct  920  IPPGQELVYHYNYAIDQVYDENGNIKKKKCLCGSTECDGWLY  961



>ref|XP_002277774.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH5 [Vitis vinifera]
Length=862

 Score =   293 bits (751),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 164/217 (76%), Gaps = 22/217 (10%)
 Frame = -3

Query  736  KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
            KCAC ++NGGE+P+N +GAI+E KP VYECGP CKCPPSC NRVSQNGI+  LE+FKT+S
Sbjct  667  KCACVLKNGGEIPFNCHGAIIETKPWVYECGPLCKCPPSCNNRVSQNGIRFSLEVFKTKS  726

Query  556  RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKCT  377
             GWGVRS   I SG+FICEYAGEL++DKEA+RR  +DEYLFD+ +               
Sbjct  727  TGWGVRSRNYISSGSFICEYAGELIQDKEAKRRTANDEYLFDLDNG--------------  772

Query  376  SSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISPL  197
                       IDAA++GNVGR+INHSCSPNLYAQ VLYD+DD+++PHIMLFA +NI P+
Sbjct  773  --------AFAIDAAKFGNVGRYINHSCSPNLYAQKVLYDHDDKRLPHIMLFATKNIPPM  824

Query  196  RELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRL  86
            RELTYHYNY V QV D +G IK K+C+CGS EC GR+
Sbjct  825  RELTYHYNYMVGQVLDINGQIKTKRCYCGSQECKGRM  861



>ref|XP_002448260.1| hypothetical protein SORBIDRAFT_06g024160 [Sorghum bicolor]
 gb|EES12588.1| hypothetical protein SORBIDRAFT_06g024160 [Sorghum bicolor]
Length=891

 Score =   294 bits (752),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/226 (61%), Positives = 175/226 (77%), Gaps = 10/226 (4%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            ++CACAV+NGGE+P+N  G I+E KPLVYECGP CKCPP+C+NRV Q+G+K +L+IFKT+
Sbjct  669  KRCACAVKNGGEIPFNDKGRILEAKPLVYECGPSCKCPPTCHNRVGQHGLKFRLQIFKTK  728

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSIN------  398
            S GWGVR+L  IPSG+F+CEY GE+LED+EA++R  +DEYLF IGHNY D S+       
Sbjct  729  SMGWGVRTLDFIPSGSFVCEYIGEVLEDEEAQKRT-NDEYLFAIGHNYYDESLWEGLSRS  787

Query  397  -PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
             PS QK    +  +E G  +DA+E GN  +FINHSC+PN+YAQNVLYD++D  VPHIM F
Sbjct  788  IPSLQKGPGKD--DETGFAVDASEMGNFAKFINHSCTPNIYAQNVLYDHEDISVPHIMFF  845

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            A ++I P +EL YHYNY +DQV D++GNIK K+C CGS EC G LY
Sbjct  846  ACDDIRPNQELFYHYNYKIDQVHDANGNIKKKKCLCGSVECDGWLY  891



>ref|XP_010318182.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Solanum lycopersicum]
 ref|XP_010318183.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Solanum lycopersicum]
Length=849

 Score =   291 bits (746),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 169/226 (75%), Gaps = 8/226 (4%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            ++C+CA RNGGE+P+N  G+IV  +PLVYECGP CKCPPSC NRVSQ+G +  LE+FKTE
Sbjct  625  EQCSCASRNGGEIPFNTRGSIVRAQPLVYECGPSCKCPPSCKNRVSQHGPRYHLEVFKTE  684

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD-------CSI  401
            SRGWG+RS   +  G FICEY GELL++KEAE RIG DEYLFDIG NY +          
Sbjct  685  SRGWGLRSRDYVTRGRFICEYVGELLDEKEAENRIGHDEYLFDIG-NYDEEIPKRNVARN  743

Query  400  NPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
            N    +  S  + +E G T+DA  YGNVGRFINHSCSPNLYAQNV+Y + D+KVPHIM F
Sbjct  744  NNLKVESNSLTRKDEDGFTLDALRYGNVGRFINHSCSPNLYAQNVMYYHGDKKVPHIMFF  803

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            A E+I+PL ELTYHYNY VDQV D +G++K K C CGS +C GR+Y
Sbjct  804  ASESIAPLEELTYHYNYDVDQVSDKNGDMKRKNCRCGSRKCEGRMY  849



>gb|EMT18003.1| Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 
[Aegilops tauschii]
Length=960

 Score =   293 bits (750),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 168/222 (76%), Gaps = 6/222 (3%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            CAC V+NGGE+P+N  G I+  KPLVYECGP CKCPP+C+NRV Q GIK +L++FKT+S 
Sbjct  740  CACVVKNGGEIPFNDKGCIIAAKPLVYECGPSCKCPPTCHNRVGQKGIKFRLQVFKTKSM  799

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKCTS  374
            GWGV++L  IPSG+F+CEY GE+L+D+EA++R+ +DEYLF IGHNY D S+     +   
Sbjct  800  GWGVKTLDYIPSGSFVCEYIGEVLDDEEAQKRM-TDEYLFAIGHNYYDESLWEGLSRSIP  858

Query  373  SEQ-----VEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVEN  209
            S Q      EE G  +DA++ GN  +FINHSC+PNLYAQNVLYD+DD+  PHIM FA E+
Sbjct  859  SLQNGPGKDEEAGFAVDASKMGNFAKFINHSCTPNLYAQNVLYDHDDKSAPHIMFFACED  918

Query  208  ISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            I P +EL YHYNY +DQV D +GNIK K+C CGS EC G LY
Sbjct  919  IPPGQELVYHYNYAIDQVYDENGNIKKKKCLCGSVECDGWLY  960



>gb|EMS56150.1| Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 
[Triticum urartu]
Length=985

 Score =   292 bits (748),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 132/222 (59%), Positives = 168/222 (76%), Gaps = 6/222 (3%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            CAC V+NGGE+P+N  G I+  KPLVYECGP CKCPP+C+NRV Q GI+ +L++FKT+S 
Sbjct  765  CACVVKNGGEIPFNDKGCIIAAKPLVYECGPSCKCPPTCHNRVGQKGIRFRLQVFKTKSM  824

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKCTS  374
            GWGV++L  IPSG+F+CEY GE+L+D+EA++R+ +DEYLF IGHNY D S+     +   
Sbjct  825  GWGVKTLDYIPSGSFVCEYIGEVLDDEEAQKRM-TDEYLFAIGHNYYDESLWEGLSRSIP  883

Query  373  SEQ-----VEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVEN  209
            S Q      EE G  +DA++ GN  +FINHSC+PNLYAQNVLYD+DD+  PHIM FA E+
Sbjct  884  SLQNGPGKDEEAGFAVDASKMGNFAKFINHSCTPNLYAQNVLYDHDDKSAPHIMFFACED  943

Query  208  ISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            I P +EL YHYNY +DQV D +GNIK K+C CGS EC G LY
Sbjct  944  IPPGQELVYHYNYAIDQVHDENGNIKKKKCLCGSVECDGWLY  985



>ref|XP_002460113.1| hypothetical protein SORBIDRAFT_02g022936 [Sorghum bicolor]
 gb|EER96634.1| hypothetical protein SORBIDRAFT_02g022936 [Sorghum bicolor]
Length=1246

 Score =   294 bits (752),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 150/224 (67%), Positives = 182/224 (81%), Gaps = 10/224 (4%)
 Frame = -3

Query  733   CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
             CACAV+NGGE+P+N NGAIVE +PL+YECGP C+CPP+C+NRVSQ+GIKI LEIFKT   
Sbjct  1026  CACAVKNGGEIPFNFNGAIVEARPLIYECGPSCRCPPTCHNRVSQHGIKIPLEIFKTGKT  1085

Query  553   GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSI-------NP  395
             GWGVRSL+SI SG+FICEY GELL+D+EAE+R  +DEYLFDIG+NY D  +         
Sbjct  1086  GWGVRSLSSISSGSFICEYTGELLKDEEAEKR-QNDEYLFDIGNNYHDEELWEGLKSVVG  1144

Query  394   SGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
              G   +SSE +E  G TIDAAE GNVGRFINHSCSPNLYAQNVL+D+DD ++PH+MLFAV
Sbjct  1145  VGSSTSSSETME--GFTIDAAECGNVGRFINHSCSPNLYAQNVLWDHDDMRMPHVMLFAV  1202

Query  214   ENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             ENI PL+ELTYHYNY+V +V D +   KVK C+CG+++C GRLY
Sbjct  1203  ENIPPLQELTYHYNYSVGEVYDKNHEEKVKHCYCGASDCCGRLY  1246



>ref|XP_004953299.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH5-like [Setaria italica]
Length=780

 Score =   288 bits (737),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/226 (60%), Positives = 168/226 (74%), Gaps = 10/226 (4%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            QKCAC V+NGGE PY+  G  +E KPL+YECGP CKCPP+C NRVSQ GIK + ++FKT 
Sbjct  558  QKCACTVKNGGEFPYDDIGENIEEKPLIYECGPSCKCPPTCRNRVSQRGIKFRFQVFKTN  617

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDC-------SI  401
            S GWGVR+L  IP+G+F+CEY GELLE++EA++R  SDEYLF IG+ Y D          
Sbjct  618  SMGWGVRTLDFIPNGSFVCEYIGELLEEEEAQKR-KSDEYLFAIGNKYHDVPRWKAQIKT  676

Query  400  NPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
             PS Q   S +  +E+G  IDA   GN  RFINHSC+PNLY QNVL+D+D+  +PH+MLF
Sbjct  677  IPSLQNVPSED--DEIGFAIDALNQGNFARFINHSCTPNLYTQNVLHDHDNISMPHVMLF  734

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            A E+I PL+EL+Y YNY +D+V DS GNIK+K CFCGS ECTGRLY
Sbjct  735  ASEDIPPLKELSYDYNYEIDKVYDSDGNIKMKPCFCGSVECTGRLY  780



>ref|XP_008670146.1| PREDICTED: uncharacterized protein LOC103647380 isoform X2 [Zea 
mays]
Length=1249

 Score =   293 bits (751),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 148/224 (66%), Positives = 180/224 (80%), Gaps = 11/224 (5%)
 Frame = -3

Query  733   CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
             CACAV+NGGE+ +N NGAIVE +PL+YECGP C+CPP+C+NRVSQ+G+KI LEIFKT   
Sbjct  1030  CACAVKNGGEIMFNFNGAIVEARPLIYECGPSCRCPPTCHNRVSQHGVKIPLEIFKTGKT  1089

Query  553   GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD-------CSINP  395
             GWGVRSL+SI SG+FICEY GELLED+EAE+R  +DEYLFDIGHNY D        S+  
Sbjct  1090  GWGVRSLSSISSGSFICEYTGELLEDEEAEKR-ENDEYLFDIGHNYHDKELWEGLKSVVG  1148

Query  394   SGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
              G   +SSE +E  G TIDA+E GNVGRFINHSCSPNLYAQNVL+D+DD ++PH+M FAV
Sbjct  1149  LGSATSSSETME--GFTIDASECGNVGRFINHSCSPNLYAQNVLWDHDDMRMPHVMFFAV  1206

Query  214   ENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             ENI PL+ELTYHYNY + +V   +G  KVK C+CG+++C GRLY
Sbjct  1207  ENIPPLQELTYHYNYKIGEVY-INGEEKVKHCYCGASDCCGRLY  1249



>ref|XP_008670145.1| PREDICTED: uncharacterized protein LOC103647380 isoform X1 [Zea 
mays]
Length=1301

 Score =   293 bits (751),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 148/224 (66%), Positives = 180/224 (80%), Gaps = 11/224 (5%)
 Frame = -3

Query  733   CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
             CACAV+NGGE+ +N NGAIVE +PL+YECGP C+CPP+C+NRVSQ+G+KI LEIFKT   
Sbjct  1082  CACAVKNGGEIMFNFNGAIVEARPLIYECGPSCRCPPTCHNRVSQHGVKIPLEIFKTGKT  1141

Query  553   GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD-------CSINP  395
             GWGVRSL+SI SG+FICEY GELLED+EAE+R  +DEYLFDIGHNY D        S+  
Sbjct  1142  GWGVRSLSSISSGSFICEYTGELLEDEEAEKR-ENDEYLFDIGHNYHDKELWEGLKSVVG  1200

Query  394   SGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
              G   +SSE +E  G TIDA+E GNVGRFINHSCSPNLYAQNVL+D+DD ++PH+M FAV
Sbjct  1201  LGSATSSSETME--GFTIDASECGNVGRFINHSCSPNLYAQNVLWDHDDMRMPHVMFFAV  1258

Query  214   ENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             ENI PL+ELTYHYNY + +V   +G  KVK C+CG+++C GRLY
Sbjct  1259  ENIPPLQELTYHYNYKIGEVY-INGEEKVKHCYCGASDCCGRLY  1301



>tpg|DAA39955.1| TPA: putative histone-lysine N-methyltransferase family protein 
[Zea mays]
Length=1308

 Score =   293 bits (751),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 148/224 (66%), Positives = 180/224 (80%), Gaps = 11/224 (5%)
 Frame = -3

Query  733   CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
             CACAV+NGGE+ +N NGAIVE +PL+YECGP C+CPP+C+NRVSQ+G+KI LEIFKT   
Sbjct  1089  CACAVKNGGEIMFNFNGAIVEARPLIYECGPSCRCPPTCHNRVSQHGVKIPLEIFKTGKT  1148

Query  553   GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD-------CSINP  395
             GWGVRSL+SI SG+FICEY GELLED+EAE+R  +DEYLFDIGHNY D        S+  
Sbjct  1149  GWGVRSLSSISSGSFICEYTGELLEDEEAEKR-ENDEYLFDIGHNYHDKELWEGLKSVVG  1207

Query  394   SGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
              G   +SSE +E  G TIDA+E GNVGRFINHSCSPNLYAQNVL+D+DD ++PH+M FAV
Sbjct  1208  LGSATSSSETME--GFTIDASECGNVGRFINHSCSPNLYAQNVLWDHDDMRMPHVMFFAV  1265

Query  214   ENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             ENI PL+ELTYHYNY + +V   +G  KVK C+CG+++C GRLY
Sbjct  1266  ENIPPLQELTYHYNYKIGEVY-INGEEKVKHCYCGASDCCGRLY  1308



>ref|XP_006660109.1| PREDICTED: uncharacterized protein LOC102710145 [Oryza brachyantha]
Length=1453

 Score =   293 bits (751),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 139/227 (61%), Positives = 173/227 (76%), Gaps = 11/227 (5%)
 Frame = -3

Query  736   KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
             KC+CAV+NGG++P+N NGAIV  KPL++ECGP CKC  SC+NRVSQ G+KI LE+F+T S
Sbjct  1229  KCSCAVKNGGKIPFNFNGAIVHDKPLIFECGPSCKCHSSCHNRVSQKGLKIPLEVFRTAS  1288

Query  556   RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKCT  377
              GWGVRSL SI SG+F+CEY G +L  KE ++R  + EYLFDI HNY D   +  G+  T
Sbjct  1289  TGWGVRSLRSISSGSFVCEYVGIVLTGKEGDKRT-NIEYLFDISHNYDD-EDHSKGRPST  1346

Query  376   SSEQ---------VEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIML  224
              S Q         +E+VG TIDA+EYGN+GRFINHSCSPNLYAQNVL+D+DD+++PHIM 
Sbjct  1347  ISGQNSFGACCQTMEDVGFTIDASEYGNIGRFINHSCSPNLYAQNVLWDHDDQRLPHIMF  1406

Query  223   FAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             FAVENI PL+ELTY YN+ +  V D +G +KVK C CGS +C GRLY
Sbjct  1407  FAVENIPPLQELTYDYNFKIGGVHDQNGRVKVKDCHCGSPQCRGRLY  1453



>ref|XP_009140381.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6 isoform X2 [Brassica rapa]
Length=754

 Score =   285 bits (730),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 156/200 (78%), Gaps = 6/200 (3%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            + CAC  +NGGE+PYN +GAIV  K L+YECGP CKCP SCY RV+Q GIK  LEIFKTE
Sbjct  552  KDCACVAKNGGEIPYNYDGAIVSAKNLIYECGPLCKCPASCYLRVTQRGIKFPLEIFKTE  611

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD------CSIN  398
            SRGWGVRSL+SIPSG+FICEY GELLEDKEAERR G+DEYLFDIG+ Y +        + 
Sbjct  612  SRGWGVRSLSSIPSGSFICEYVGELLEDKEAERRTGNDEYLFDIGNRYDNSLAEGMSKLM  671

Query  397  PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
            P  Q     +  E  G TIDAA+ GN+GRFINH CSPNLYAQNVLYD++D ++PH+M FA
Sbjct  672  PETQPAMGGDDDEMSGFTIDAAKKGNIGRFINHCCSPNLYAQNVLYDHEDTRIPHVMFFA  731

Query  217  VENISPLRELTYHYNYTVDQ  158
            ++N+ PL+ELTYHYNY +DQ
Sbjct  732  MDNVPPLQELTYHYNYIIDQ  751



>ref|XP_007038240.1| SU(VAR)3-9, putative [Theobroma cacao]
 gb|EOY22741.1| SU(VAR)3-9, putative [Theobroma cacao]
Length=771

 Score =   284 bits (727),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 165/219 (75%), Gaps = 10/219 (5%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            + C C ++NGGE+PYN    I+  KP++ ECGP CKC  SC NRVSQ GI+  LE+FKT+
Sbjct  563  EDCPCVIKNGGEIPYNYEECIMMEKPIIIECGPSCKCFTSCSNRVSQRGIRFPLEVFKTK  622

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
            ++GWGVRS + IP G+FICEY GE+L DKE E+RIG DEYLFDIGHNY   S +    +C
Sbjct  623  TKGWGVRSRSFIPCGSFICEYIGEILPDKEVEQRIGKDEYLFDIGHNYGVLSHSSEVNEC  682

Query  379  TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
                       TIDAA++GNVGRFINHSCSPNL+AQNVL+D++D  +PHIMLFA+E+I P
Sbjct  683  ----------FTIDAAQFGNVGRFINHSCSPNLFAQNVLFDHNDSSIPHIMLFAMEDIPP  732

Query  199  LRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            L+ELTY YNY +  V D +G+IK+K CFCGS ECTGR+Y
Sbjct  733  LKELTYDYNYRIGGVCDVNGDIKMKPCFCGSKECTGRMY  771



>ref|XP_003604410.1| Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 
[Medicago truncatula]
 gb|AES86607.1| histone-lysine N-methyltransferase, suvh protein [Medicago truncatula]
Length=464

 Score =   276 bits (706),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 168/224 (75%), Gaps = 20/224 (9%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKT-  563
            +KC+C V+NGGE+P+N NG IVEVKPLVYECGP CKCP +C+NRVSQ GI IQLEIFK  
Sbjct  256  KKCSCVVKNGGEIPFNHNGDIVEVKPLVYECGPKCKCPSTCHNRVSQLGINIQLEIFKNL  315

Query  562  ESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQK  383
             S GWGVRSL SIPSG+FICEY GE               YLFDIG+N ++ ++      
Sbjct  316  NSMGWGVRSLNSIPSGSFICEYIGE---------------YLFDIGNNKNNNNLWDGLSN  360

Query  382  C----TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
                 +SSE VE+   T DAA++GNVGRF+NHSCSPNLYAQNVLYD+ D +VPHIMLFA 
Sbjct  361  LFPDSSSSEVVEDSDFTTDAAQFGNVGRFVNHSCSPNLYAQNVLYDHQDSRVPHIMLFAA  420

Query  214  ENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            ENI PL+ELTY YNYT+D VRDS GNIK K CFCGS ECTGRLY
Sbjct  421  ENIPPLQELTYDYNYTIDTVRDSDGNIKKKYCFCGSVECTGRLY  464



>gb|EEE61358.1| hypothetical protein OsJ_15501 [Oryza sativa Japonica Group]
Length=335

 Score =   272 bits (695),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 175/234 (75%), Gaps = 19/234 (8%)
 Frame = -3

Query  736  KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
            +CACAV+NGGE+P+N NGAIVE KPLVYECGP C+CPP+C+NRVSQ+GIKI LEIFKT +
Sbjct  105  RCACAVKNGGEIPFNSNGAIVEAKPLVYECGPSCRCPPTCHNRVSQHGIKIPLEIFKTGN  164

Query  556  RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD-----------  410
            +GWGVRSL+SI SG+F+CEYAGE+L++   +  + +DEYLFDIGH+Y D           
Sbjct  165  KGWGVRSLSSISSGSFVCEYAGEVLQEN-GDEHVETDEYLFDIGHHYHDEVWEDPKFEGI  223

Query  409  ----CSINPSGQKCTSSEQVEEV-GHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDR  245
                 S + + +    S+  E+  G TIDA++  NVGRFINHSCSPNLYAQNVL+D+DD 
Sbjct  224  LGLESSTSKTTEDTEGSKTTEDTEGSTIDASKCSNVGRFINHSCSPNLYAQNVLWDHDDM  283

Query  244  KVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            K PHIM FA ENI PL+ELTY YNY   +V D +G  KVK CFCGS +C+ RLY
Sbjct  284  KKPHIMFFATENIPPLQELTYDYNY--GKVEDKNGKEKVKPCFCGSPDCSRRLY  335



>ref|XP_006660567.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Oryza brachyantha]
Length=1020

 Score =   286 bits (733),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 141/225 (63%), Positives = 179/225 (80%), Gaps = 8/225 (4%)
 Frame = -3

Query  736   KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
             +CACAV+NGGE+P+N +GAIVE +PL+YECGP C+CPP+C+NRVSQ+GIKI LEIFKT  
Sbjct  797   RCACAVKNGGEIPFNFSGAIVEARPLIYECGPSCRCPPTCHNRVSQHGIKITLEIFKTGE  856

Query  556   RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPS-----  392
             +GWGVRSL+SI SG+F+CEY GE+L+D E + ++ +DEYLFDIGHNY D     S     
Sbjct  857   KGWGVRSLSSISSGSFVCEYTGEILQDNEDD-QVENDEYLFDIGHNYHDEVWEGSKSGIY  915

Query  391   GQKCTSSEQVEEVGH--TIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
             G + ++SE  E+ G   TIDA++  NVGRFINHSCSPNL+AQ VL+D+DD K+PHIM FA
Sbjct  916   GLESSTSETTEDGGEGTTIDASKCSNVGRFINHSCSPNLFAQCVLWDHDDLKIPHIMFFA  975

Query  217   VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
              ENI PL+ELTY YNY V +++D +G  KVK CFCGS +C+GRLY
Sbjct  976   SENIPPLQELTYDYNYKVGKLKDKNGKEKVKPCFCGSPDCSGRLY  1020



>emb|CAN80078.1| hypothetical protein VITISV_029999 [Vitis vinifera]
Length=959

 Score =   285 bits (730),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 167/214 (78%), Gaps = 8/214 (4%)
 Frame = -3

Query  736  KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
            KCAC ++NGGE+P+N +GAI+E KP +YECGP CKCPPSC NRVSQNGI+  LE+FKT+S
Sbjct  672  KCACVLKNGGEIPFNCSGAIIEAKPWIYECGPLCKCPPSCNNRVSQNGIRFPLEVFKTKS  731

Query  556  RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDC------SINP  395
             GWGVRS   IPSG+FICEYAGEL++DKEAE+R+G+DEYLFD+G    +C      S   
Sbjct  732  TGWGVRSRNYIPSGSFICEYAGELIQDKEAEQRVGNDEYLFDLGGGM-NCLESQLNSFEA  790

Query  394  SGQKCTSSEQVEEVG-HTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
                 +SS + ++ G   IDAA++ NVGRF NHSCSPNLYAQNVLYD+DD+++PHIMLFA
Sbjct  791  MDDLQSSSYKAKDYGAFAIDAAKFANVGRFFNHSCSPNLYAQNVLYDHDDKRMPHIMLFA  850

Query  217  VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCF  116
             +NI P+RELTY YNY V QVRD +G IK K+ F
Sbjct  851  TKNIPPMRELTYDYNYMVGQVRDINGKIKKKRQF  884



>ref|XP_006827872.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6 [Amborella trichopoda]
 gb|ERM95288.1| hypothetical protein AMTR_s00008p00103090 [Amborella trichopoda]
Length=759

 Score =   280 bits (717),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 138/225 (61%), Positives = 168/225 (75%), Gaps = 9/225 (4%)
 Frame = -3

Query  736  KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
            KC C  +N G+ PY  +G +VE KPL+YECGP+CKCP SC NRVSQ+G+K +LE+FKTE 
Sbjct  537  KCECTQKNKGQFPYF-DGCVVESKPLIYECGPNCKCPQSCKNRVSQHGLKFELEVFKTEK  595

Query  556  RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSIN-------  398
            RGWGVR+LTSIPSG+F+CEY G++L ++ AE+ IG DEYLFDIG  Y D S+        
Sbjct  596  RGWGVRTLTSIPSGSFVCEYLGKILTNEMAEKLIGRDEYLFDIGCKYIDESVKDIVSSLI  655

Query  397  PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
            P+     + E+VEE G TIDA  YG+V RFINHSC PNLYAQNVL D+DD+ +PHIM FA
Sbjct  656  PNELPTEACEEVEE-GFTIDARVYGSVARFINHSCYPNLYAQNVLIDHDDKAMPHIMFFA  714

Query  217  VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             ENI PL+ELTYHY    DQV DS+GNIK K C CGS+ C+G LY
Sbjct  715  RENIPPLQELTYHYQMAHDQVYDSNGNIKKKACHCGSSMCSGWLY  759



>ref|XP_002445459.1| hypothetical protein SORBIDRAFT_07g019863 [Sorghum bicolor]
 gb|EES14954.1| hypothetical protein SORBIDRAFT_07g019863, partial [Sorghum bicolor]
Length=506

 Score =   273 bits (699),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 145/224 (65%), Positives = 172/224 (77%), Gaps = 8/224 (4%)
 Frame = -3

Query  736  KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
            +C+CA +NGGE+P+N + AIV+ K L+YECGP C+CPP+CYNRVSQ+G+KI LEIFKT  
Sbjct  285  RCSCAWKNGGEIPFNCDNAIVKAKRLIYECGPWCRCPPTCYNRVSQHGVKIPLEIFKTGK  344

Query  556  RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD----CSINP--  395
             GWGVRSL+SI SG+FICEY GELL+ +EAE R  +DEYLFDIG NY D      I P  
Sbjct  345  TGWGVRSLSSISSGSFICEYTGELLKGEEAENR-QNDEYLFDIGRNYYDEELWEGIPPVV  403

Query  394  SGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
              Q  TSS    + G TID AE  NVGRFINHSCSPNLYAQNVL+D+ + K+PHIMLFAV
Sbjct  404  DVQSSTSSSGTMK-GFTIDGAECSNVGRFINHSCSPNLYAQNVLWDHGNMKMPHIMLFAV  462

Query  214  ENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            ENI PL+ELTYHYNY V  V D +GN KVK C+CG++ C GRLY
Sbjct  463  ENIPPLQELTYHYNYKVGSVHDENGNEKVKHCYCGASACRGRLY  506



>emb|CDM87039.1| unnamed protein product [Triticum aestivum]
Length=640

 Score =   276 bits (706),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/224 (58%), Positives = 167/224 (75%), Gaps = 6/224 (3%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            QKCAC ++NGG++P+ + G ++E KPL+YECGP CKCPP+C NRV Q+GI  +L++FKT 
Sbjct  418  QKCACVMKNGGKIPFRKTGGLLEEKPLIYECGPSCKCPPTCRNRVGQHGISFRLQVFKTT  477

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
            S GWGVRSL  IP+G F+CEY GELL++++A+ R  +DEYLF IG+NY D S   + QK 
Sbjct  478  SMGWGVRSLDFIPTGHFVCEYIGELLDNEDAQER-DNDEYLFLIGNNYYDVSRWDNLQKT  536

Query  379  TSS-----EQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
              S      + EE    +DA + GN+ RFINHSC+PNL+ QNVLYD+D++ +PHIMLFA 
Sbjct  537  IPSLMNGPGEEEENFFAVDALKCGNLARFINHSCTPNLFTQNVLYDHDNKGMPHIMLFAC  596

Query  214  ENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            E+I PL  L+Y YNYT+D V DS GNIK K+C CGS ECTG LY
Sbjct  597  EDIQPLEPLSYDYNYTIDGVHDSEGNIKKKRCLCGSVECTGWLY  640



>emb|CDM87041.1| unnamed protein product [Triticum aestivum]
Length=628

 Score =   276 bits (705),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/224 (58%), Positives = 167/224 (75%), Gaps = 6/224 (3%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            QKCAC ++NGG++P+ + G ++E KPL+YECGP CKCPP+C NRV Q+GI  +L++FKT 
Sbjct  406  QKCACVMKNGGKIPFRKTGGLLEEKPLIYECGPSCKCPPTCRNRVGQHGISFRLQVFKTT  465

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
            S GWGVRSL  IP+G F+CEY GELL++++A+ R  +DEYLF IG+NY D S   + QK 
Sbjct  466  SMGWGVRSLDFIPTGHFVCEYIGELLDNEDAQER-DNDEYLFLIGNNYYDVSRWDNLQKT  524

Query  379  TSS-----EQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
              S      + EE    +DA + GN+ RFINHSC+PNL+ QNVLYD+D++ +PHIMLFA 
Sbjct  525  IPSLMNGPGEEEENFFAVDALKCGNLARFINHSCTPNLFTQNVLYDHDNKGMPHIMLFAC  584

Query  214  ENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            E+I PL  L+Y YNYT+D V DS GNIK K+C CGS ECTG LY
Sbjct  585  EDIQPLEPLSYDYNYTIDGVHDSEGNIKKKRCLCGSVECTGWLY  628



>ref|XP_002444303.1| hypothetical protein SORBIDRAFT_07g019860 [Sorghum bicolor]
 gb|EES13798.1| hypothetical protein SORBIDRAFT_07g019860 [Sorghum bicolor]
Length=1260

 Score =   284 bits (726),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/225 (61%), Positives = 169/225 (75%), Gaps = 9/225 (4%)
 Frame = -3

Query  733   CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
             CACAV+NGGE+P+N NGAIV  KPL++ECGP CKCPPSC N+VSQ+G+KI LE+FKT   
Sbjct  1037  CACAVKNGGEIPFNLNGAIVNEKPLIFECGPSCKCPPSCQNKVSQHGLKIPLEVFKTTKT  1096

Query  553   GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD--------CSIN  398
             GWGVRSL SI SG+FICEY GELL   EA+ R  S+ +LFDIG N+ D          ++
Sbjct  1097  GWGVRSLRSISSGSFICEYVGELLYGNEADERRNSN-FLFDIGLNHGDENFCNGLLSDVS  1155

Query  397   PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
                   +SS+ + +VG TID+AE GN+GRFINHSCSPNLYAQNVL+D+DD ++PHIM FA
Sbjct  1156  DMKSSSSSSQILGDVGFTIDSAECGNIGRFINHSCSPNLYAQNVLWDHDDLRIPHIMFFA  1215

Query  217   VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
              E I PL+ELTY YNY +D V D +G IK K C CGS+ C+GRLY
Sbjct  1216  AETIPPLQELTYDYNYEIDHVEDVNGRIKFKVCQCGSSGCSGRLY  1260



>ref|XP_011076448.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH5-like isoform X2 [Sesamum indicum]
Length=915

 Score =   280 bits (717),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 161/217 (74%), Gaps = 5/217 (2%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C+C ++N GE+P+N  G I+  +P+++ECGP CKCPPSC NRVSQ+G + QLEIFKT SR
Sbjct  704  CSCVLKNEGEIPFNEKGCIIRARPIIHECGPSCKCPPSCMNRVSQHGPRYQLEIFKTVSR  763

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKCTS  374
            GWGVRS   I SG+FICEY GELL DKEAE+RIG+DEYLFD+     +        +   
Sbjct  764  GWGVRSRNYISSGSFICEYVGELLRDKEAEQRIGNDEYLFDVSDGRDEGE-----SEVLL  818

Query  373  SEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISPLR  194
              +  + G  IDAA  GNVGRFINHSCSPNLYAQ VLYD+ D+++PHIM FA +NI PL+
Sbjct  819  DFRTSDDGFAIDAARLGNVGRFINHSCSPNLYAQEVLYDHQDKRLPHIMFFANKNIPPLQ  878

Query  193  ELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            ELTY YNY V +V D +GNIK K C+CGS +CTGR+Y
Sbjct  879  ELTYDYNYKVGRVCDGNGNIKTKDCYCGSRKCTGRMY  915



>ref|XP_011076447.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH5-like isoform X1 [Sesamum indicum]
Length=926

 Score =   280 bits (716),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 161/217 (74%), Gaps = 5/217 (2%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C+C ++N GE+P+N  G I+  +P+++ECGP CKCPPSC NRVSQ+G + QLEIFKT SR
Sbjct  715  CSCVLKNEGEIPFNEKGCIIRARPIIHECGPSCKCPPSCMNRVSQHGPRYQLEIFKTVSR  774

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKCTS  374
            GWGVRS   I SG+FICEY GELL DKEAE+RIG+DEYLFD+     +        +   
Sbjct  775  GWGVRSRNYISSGSFICEYVGELLRDKEAEQRIGNDEYLFDVSDGRDEGE-----SEVLL  829

Query  373  SEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISPLR  194
              +  + G  IDAA  GNVGRFINHSCSPNLYAQ VLYD+ D+++PHIM FA +NI PL+
Sbjct  830  DFRTSDDGFAIDAARLGNVGRFINHSCSPNLYAQEVLYDHQDKRLPHIMFFANKNIPPLQ  889

Query  193  ELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            ELTY YNY V +V D +GNIK K C+CGS +CTGR+Y
Sbjct  890  ELTYDYNYKVGRVCDGNGNIKTKDCYCGSRKCTGRMY  926



>gb|EEC84442.1| hypothetical protein OsI_31060 [Oryza sativa Indica Group]
Length=921

 Score =   278 bits (711),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 175/234 (75%), Gaps = 19/234 (8%)
 Frame = -3

Query  736  KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
            +CACAV+NGGE+P+N NGAIVE KPLVYECGP C+CPP+C+NRVSQ+GIKI LEIFKT +
Sbjct  691  RCACAVKNGGEIPFNSNGAIVEAKPLVYECGPSCRCPPTCHNRVSQHGIKIPLEIFKTGN  750

Query  556  RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD-----------  410
            +GWGVRSL+SI SG+F+CEYAGE+L++   +  + +DEYLFDIGH+Y D           
Sbjct  751  KGWGVRSLSSISSGSFVCEYAGEVLQE-NGDEHVETDEYLFDIGHHYHDEVWEDPKFEGI  809

Query  409  ----CSINPSGQKCTSSEQVEEV-GHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDR  245
                 S + + +    S+  E+  G TIDA++  NVGRFINHSCSPNLYAQNVL+D+DD 
Sbjct  810  LGLESSTSKTTEDTEGSKTTEDTEGSTIDASKCSNVGRFINHSCSPNLYAQNVLWDHDDM  869

Query  244  KVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            K PHIM FA ENI PL+ELTY YNY   +V D +G  KVK CFCGS +C+ RLY
Sbjct  870  KKPHIMFFATENIPPLQELTYDYNY--GKVEDKNGKEKVKPCFCGSPDCSRRLY  921



>ref|NP_001062989.1| Os09g0362900 [Oryza sativa Japonica Group]
 dbj|BAD23407.1| putative SET domain-containing protein SET104 [Oryza sativa Japonica 
Group]
 dbj|BAF24903.1| Os09g0362900 [Oryza sativa Japonica Group]
Length=921

 Score =   278 bits (711),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 175/234 (75%), Gaps = 19/234 (8%)
 Frame = -3

Query  736  KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
            +CACAV+NGGE+P+N NGAIVE KPLVYECGP C+CPP+C+NRVSQ+GIKI LEIFKT +
Sbjct  691  RCACAVKNGGEIPFNSNGAIVEAKPLVYECGPSCRCPPTCHNRVSQHGIKIPLEIFKTGN  750

Query  556  RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD-----------  410
            +GWGVRSL+SI SG+F+CEYAGE+L++   +  + +DEYLFDIGH+Y D           
Sbjct  751  KGWGVRSLSSISSGSFVCEYAGEVLQE-NGDEHVETDEYLFDIGHHYHDEVWEDPKFEGI  809

Query  409  ----CSINPSGQKCTSSEQVEEV-GHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDR  245
                 S + + +    S+  E+  G TIDA++  NVGRFINHSCSPNLYAQNVL+D+DD 
Sbjct  810  LGLESSTSKTTEDTEGSKTTEDTEGSTIDASKCSNVGRFINHSCSPNLYAQNVLWDHDDM  869

Query  244  KVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            K PHIM FA ENI PL+ELTY YNY   +V D +G  KVK CFCGS +C+ RLY
Sbjct  870  KKPHIMFFATENIPPLQELTYDYNY--GKVEDKNGKEKVKPCFCGSPDCSRRLY  921



>ref|XP_004974671.1| PREDICTED: uncharacterized protein LOC101771013 [Setaria italica]
Length=1244

 Score =   279 bits (714),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 171/225 (76%), Gaps = 9/225 (4%)
 Frame = -3

Query  733   CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
             CACAV+NGGE+P+N NGAIV  KPL++ECGP CKCP SC NRVSQ+G KI LE+F+T   
Sbjct  1021  CACAVKNGGEIPFNLNGAIVNEKPLIFECGPSCKCPRSCQNRVSQHGTKIPLEVFRTTKT  1080

Query  553   GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD--------CSIN  398
             GWGVRSL+SI SG+FICEY GELL  KEA+ R  SD YLFDIG    D         +++
Sbjct  1081  GWGVRSLSSISSGSFICEYVGELLYGKEADERRNSD-YLFDIGLKCGDENLCNGLISTVS  1139

Query  397   PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
                   + S+ +E+VG TIDAAEYGN+GRFINHSCSPNLY QNVL+D+DD+++ HIM FA
Sbjct  1140  GLNSSSSCSQTMEDVGFTIDAAEYGNIGRFINHSCSPNLYTQNVLWDHDDKRMTHIMFFA  1199

Query  217   VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
              E I PL+ELTY YNY +DQ++D++G IK K C CGS +C+GRLY
Sbjct  1200  AETIPPLQELTYDYNYEIDQIQDANGRIKFKVCQCGSPQCSGRLY  1244



>ref|XP_010104848.1| Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 
[Morus notabilis]
 gb|EXC02084.1| Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 
[Morus notabilis]
Length=369

 Score =   263 bits (672),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 152/216 (70%), Gaps = 27/216 (13%)
 Frame = -3

Query  730  ACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESRG  551
            A  V+NGGE+P+N NGAI+EVKPLVYECGP C+CPPSC NRVSQ+G              
Sbjct  181  ARVVKNGGEIPFNHNGAIIEVKPLVYECGPSCRCPPSCPNRVSQHG--------------  226

Query  550  WGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKCTSS  371
                        +FICEY GE L  KEAE R  + EYLF+IG+NY+D ++          
Sbjct  227  ------------SFICEYLGEFLSAKEAEARTANGEYLFNIGNNYNDNTLGKGLSTLMPR  274

Query  370  EQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISPLRE  191
               +  G TIDAAEYGNVGRFINHSC+PNLYAQNVLYD++D+++PHIMLFA ENI PL E
Sbjct  275  SVEDGEGFTIDAAEYGNVGRFINHSCTPNLYAQNVLYDHEDKRIPHIMLFAAENIRPLEE  334

Query  190  LTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            LT+HYNY  DQVRDS+GNIK K CFCGS ECTGRLY
Sbjct  335  LTFHYNYVADQVRDSNGNIK-KSCFCGSHECTGRLY  369



>ref|XP_003576441.1| PREDICTED: uncharacterized protein LOC100843697 [Brachypodium 
distachyon]
Length=968

 Score =   276 bits (707),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 174/219 (79%), Gaps = 7/219 (3%)
 Frame = -3

Query  736  KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
            +CACAV+NGGELP+N +  IV  +P++YECGP C+CPP+C+NRVSQ+G KI LEIFKT  
Sbjct  756  RCACAVKNGGELPFNFDSEIVYTEPVIYECGPSCRCPPTCHNRVSQHGPKIPLEIFKTGK  815

Query  556  RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKCT  377
             GWGVRS + I SG+FICEY GELL++ +AE +  +DEYLFDIG +  D      G + +
Sbjct  816  TGWGVRSPSFISSGSFICEYVGELLQENDAE-KTENDEYLFDIGRDSDD----EEGLQSS  870

Query  376  SSEQVEE-VGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
            +SE +++ VG+TIDAA+ GNVGRFINHSCSPNL+AQ+VL+D+DD+++PH+MLFA +NI P
Sbjct  871  TSETMDDNVGYTIDAAKCGNVGRFINHSCSPNLHAQDVLWDHDDKRMPHVMLFAEKNIPP  930

Query  199  LRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            L+ELTY YNY +  VR  +G  KVK+CFCGS++C  RLY
Sbjct  931  LQELTYDYNYNIGLVR-KNGTEKVKKCFCGSSKCRLRLY  968



>ref|XP_010318185.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Solanum lycopersicum]
Length=814

 Score =   273 bits (699),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 164/226 (73%), Gaps = 10/226 (4%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            ++C+CA RNGGE+P+N  G+I+  +PLVYECGP CKCPPSC NRVSQ+G +  LE+FKTE
Sbjct  592  EQCSCASRNGGEIPFNTRGSIIRAQPLVYECGPSCKCPPSCKNRVSQHGPRDHLEVFKTE  651

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD--CSINPSGQ  386
            SRGWG+RS   + SG+FICEY GELL++KEAE RI +DEYLFD+G NY +     NP   
Sbjct  652  SRGWGLRSRDRVSSGSFICEYVGELLDEKEAESRIDNDEYLFDVG-NYDEEIPKRNPMRN  710

Query  385  KCTSSE-----QVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
                 E     + +E G  +DA  YGNVGRFINHSCSPNLYAQNV+Y + DR+VPHIM F
Sbjct  711  NNLKVESDSLGRKDEDGFALDAVRYGNVGRFINHSCSPNLYAQNVMYYHGDRRVPHIMFF  770

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            A ++I+P  E TYHYNY    V D + N+K K C CGS +C GR+Y
Sbjct  771  ASKSIAPFEEFTYHYNYG--HVYDKNSNMKRKNCICGSQKCEGRMY  814



>ref|XP_006366727.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Solanum tuberosum]
Length=880

 Score =   275 bits (702),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 166/226 (73%), Gaps = 10/226 (4%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            ++C+CA RNGGE+P+N  G+IV  +PLVYECGP CKCPPSC NRVSQ+G +  LE+FKTE
Sbjct  658  EQCSCASRNGGEIPFNTRGSIVRAQPLVYECGPSCKCPPSCKNRVSQHGPRYHLEVFKTE  717

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD--CSINPSGQ  386
            SRGWG+RS   +  G FICEY GELL++KEAE RI +DEYLFD+G NY +     NP   
Sbjct  718  SRGWGLRSRDYVTCGRFICEYVGELLDEKEAESRIYNDEYLFDVG-NYDEEIPKRNPMRN  776

Query  385  -----KCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
                 +  S  + +E G T+DA  YGNVGRFINHSCSPNLYAQNV+Y + DR+VPHIM F
Sbjct  777  NNLKVESDSLRRKDEDGFTLDAVRYGNVGRFINHSCSPNLYAQNVMYYHGDRRVPHIMFF  836

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            A ++I+PL E TYHYNY  D V D + N+K K C CGS +C GR+Y
Sbjct  837  ASKSIAPLEEFTYHYNY--DHVYDKNRNLKRKNCRCGSRKCEGRMY  880



>gb|EMT10878.1| Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 
[Aegilops tauschii]
Length=956

 Score =   275 bits (702),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/224 (58%), Positives = 166/224 (74%), Gaps = 6/224 (3%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            QKCAC ++NGG+ P+ + G ++E KPL+YECGP CKCPP+C NRV Q+GI  +L++FKT 
Sbjct  734  QKCACVMKNGGKTPFRKTGGLLEEKPLIYECGPSCKCPPTCRNRVGQHGIAFRLQVFKTA  793

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
            S GWGVRSL  IP+G F+CEY GELL++++A+ R  +DEYLF IG+NY D S   + QK 
Sbjct  794  SMGWGVRSLDFIPTGRFVCEYIGELLDNEDAQER-DNDEYLFLIGNNYYDVSRWDNLQKT  852

Query  379  TSS-----EQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
              S      + EE    +DA + GN+ RFINHSC+PNL+ QNVLYD+D++ +PHIMLFA 
Sbjct  853  IPSLRNGPGEEEENFFAVDALKCGNLARFINHSCTPNLFTQNVLYDHDNKGMPHIMLFAC  912

Query  214  ENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            E+I PL  L+Y YNYT+D V DS GNIK K+C CGS ECTG LY
Sbjct  913  EDIQPLEPLSYDYNYTIDGVHDSEGNIKKKRCLCGSVECTGWLY  956



>ref|XP_006648891.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Oryza brachyantha]
Length=689

 Score =   270 bits (690),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/222 (59%), Positives = 172/222 (77%), Gaps = 4/222 (2%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            Q CAC V+NGGE+P++  G I++ KPL+YECGP C CPP+C+NRVSQ+GIK +L++FKT+
Sbjct  469  QNCACVVKNGGEIPFSHKGTIIDEKPLIYECGPSCGCPPTCHNRVSQHGIKFRLQVFKTK  528

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD---CSINPSG  389
            S GWGVRSL  IPSG+F+CEY GELLE++EA+ R  +DEYLF IG++Y +     I+ + 
Sbjct  529  STGWGVRSLDFIPSGSFLCEYIGELLEEEEAQER-KNDEYLFGIGNDYYNDRWQGISKTI  587

Query  388  QKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVEN  209
                +    +E G  IDA  +GN+ RFINHSC+PNL+AQNVLYD+D+  +PHIMLFA E+
Sbjct  588  PSLRNGPVEDEDGFAIDALNWGNLARFINHSCTPNLFAQNVLYDHDNISMPHIMLFAGED  647

Query  208  ISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            I PL+EL+Y YNY +D+V DS GNIK K+CFCGS ECTG LY
Sbjct  648  IPPLQELSYDYNYGIDEVYDSDGNIKKKKCFCGSIECTGWLY  689



>ref|XP_002452826.1| hypothetical protein SORBIDRAFT_04g033260 [Sorghum bicolor]
 gb|EES05802.1| hypothetical protein SORBIDRAFT_04g033260 [Sorghum bicolor]
Length=787

 Score =   271 bits (692),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 129/224 (58%), Positives = 162/224 (72%), Gaps = 6/224 (3%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            QKCACAV+NGG   +N  G + E KPL+YECGP CKCPP+C NRVSQ+GIK +L++FKT+
Sbjct  565  QKCACAVKNGGGFHFNDIGGLTEGKPLIYECGPSCKCPPTCRNRVSQHGIKFRLQVFKTK  624

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
            S GWGVR+L  IP G+F+CEY GELL D+EA+ R  +DEYLF IG++Y D     +  K 
Sbjct  625  SMGWGVRTLDFIPDGSFVCEYVGELLTDEEAQER-KNDEYLFAIGNSYYDAPHWEAEIKA  683

Query  379  TSSEQ-----VEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
              S Q      +E    +DA   GN  RFINH C+PNL+ QNVL+D+D+  +PHIM FA 
Sbjct  684  IPSLQNGPIEDDETVFAVDALNQGNFARFINHCCTPNLFPQNVLHDHDNISMPHIMFFAS  743

Query  214  ENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            E+I PL+EL+Y YNY +D+V DS GNIK+K CFCGS EC GRLY
Sbjct  744  EDIPPLKELSYDYNYQIDKVYDSDGNIKMKYCFCGSNECNGRLY  787



>ref|XP_006366728.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like isoform X1 [Solanum tuberosum]
 ref|XP_006366729.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like isoform X2 [Solanum tuberosum]
 ref|XP_006366730.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like isoform X3 [Solanum tuberosum]
 ref|XP_006366731.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like isoform X4 [Solanum tuberosum]
Length=614

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 167/222 (75%), Gaps = 3/222 (1%)
 Frame = -3

Query  742  FQKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKT  563
            F +C+CA +NGGE P+N   +I++ KPLV+ECGP+CKCPPSC NRVSQ+G+    E+FKT
Sbjct  393  FDQCSCASKNGGEFPFNPRSSILKAKPLVHECGPYCKCPPSCKNRVSQHGLGYHFEVFKT  452

Query  562  ESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYS---DCSINPS  392
            + +GWG+RS   I  G+FICEY GELL+ KEA+ R+  DEY FD+G+ Y       +  S
Sbjct  453  KLKGWGLRSSDYIAPGSFICEYIGELLDHKEAKIRMDYDEYFFDVGNYYEYIPQRKVVSS  512

Query  391  GQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVE  212
              +  S ++++E G TIDAA YGNVGRFINHSCSPNL AQNV+YD+ D++VPHIM FA +
Sbjct  513  KVESNSFKRMDEEGFTIDAAIYGNVGRFINHSCSPNLCAQNVMYDHGDKRVPHIMFFASK  572

Query  211  NISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRL  86
            +I PL ELTYHYN+ + +V D++GN+K ++  CGS +C+GR+
Sbjct  573  SIYPLEELTYHYNHRIVRVHDTNGNLKREKGKCGSHKCSGRM  614



>ref|XP_006366735.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Solanum tuberosum]
Length=768

 Score =   268 bits (685),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 165/226 (73%), Gaps = 10/226 (4%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            ++C+C  RNGGE+P+N  G+IV  +PLVYECGP CKCPP+C NR+SQ+G +  LE+FKTE
Sbjct  546  EQCSCTSRNGGEIPFNTRGSIVRAQPLVYECGPSCKCPPTCKNRISQHGPRDHLEVFKTE  605

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSD--CSINPSGQ  386
            SRGWG+RS   + SG+FICEY GELL++ EAE RI +DEYLFD+G NY +     NP   
Sbjct  606  SRGWGLRSRDHVSSGSFICEYVGELLDEMEAESRIDNDEYLFDVG-NYDEEIPKRNPMRN  664

Query  385  -----KCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
                 +  S  + +E G T+DA  YGNVGRFIN+SCSPNLYAQNV+Y + DR+VPHIM F
Sbjct  665  NNLKVESDSLRRKDEDGFTLDAVRYGNVGRFINYSCSPNLYAQNVMYYHGDRRVPHIMFF  724

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            A ++I+PL E TYHYNY  D V D + N+K K C CGS +C  R+Y
Sbjct  725  ASKSIAPLEEFTYHYNY--DHVCDKNRNLKRKNCRCGSRKCEARMY  768



>ref|XP_006827942.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH5 [Amborella trichopoda]
 gb|ERM95358.1| hypothetical protein AMTR_s00008p00186080 [Amborella trichopoda]
Length=694

 Score =   265 bits (676),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 160/221 (72%), Gaps = 8/221 (4%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C+CA++NG E PY+ NG +VE KPLVYECGP C C PSC NRVSQ GIK +L++FKT+ +
Sbjct  475  CSCAIKNGKEFPYS-NGCLVESKPLVYECGPSCTCHPSCGNRVSQGGIKFELQLFKTKLK  533

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSIN-------P  395
            GWGVR L SIPSG+FICEY GE+L  K  E+R+G +EY FDIG N++D S         P
Sbjct  534  GWGVRPLGSIPSGSFICEYLGEILTRKMVEKRVGPNEYFFDIGVNFTDKSFKDTLSFLVP  593

Query  394  SGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
              +   + + VE  G TIDA+  GNV RFIN SCSPNLYAQ+VLYD+ D+ VPHIMLFA 
Sbjct  594  ESEPTEACDTVEIKGFTIDASINGNVARFINQSCSPNLYAQSVLYDHGDKAVPHIMLFAG  653

Query  214  ENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTG  92
            ENI P  ELT +Y + ++ V D++ N K K+C CGS+ECTG
Sbjct  654  ENIRPFEELTIYYKFALNHVCDNNSNRKKKKCHCGSSECTG  694



>ref|XP_006827874.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH5 [Amborella trichopoda]
 gb|ERM95290.1| hypothetical protein AMTR_s00008p00104700 [Amborella trichopoda]
Length=696

 Score =   265 bits (676),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 159/221 (72%), Gaps = 8/221 (4%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C+CA++NG E PY+ NG +VE KPLVYECGP C C PSC NRVSQ GIK +L++FKT+ +
Sbjct  477  CSCAIKNGKEFPYS-NGCLVESKPLVYECGPSCTCRPSCGNRVSQGGIKFELQVFKTKLK  535

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSIN-------P  395
            GWGVR L SIPS +FICEY GE+L  K  E+R+G +EY FDIG N++D S         P
Sbjct  536  GWGVRPLGSIPSASFICEYLGEILTRKMVEKRVGPNEYFFDIGVNFTDKSFKDTLSFLVP  595

Query  394  SGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
              +   + + VE  G TIDA+  GNV RFINHSCSPNLYAQ+VLYD+ D+ VPHIMLFA 
Sbjct  596  ESEPTEACDTVEIKGFTIDASINGNVARFINHSCSPNLYAQSVLYDHGDKAVPHIMLFAR  655

Query  214  ENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTG  92
            ENI P  ELT +Y +  + V D++ N K K+C CGS+ECTG
Sbjct  656  ENIRPFEELTIYYKFASNHVCDNNSNGKKKECHCGSSECTG  696



>dbj|BAK05250.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=243

 Score =   248 bits (634),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 156/191 (82%), Gaps = 8/191 (4%)
 Frame = -3

Query  634  KCPPSCYNRVSQNGIKIQLEIFKTESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRI  455
            +CPP+C+NRVSQ+G KI LEIFKT   GWGVRSL+SI SG+FICEYAGELL+D EAE+R 
Sbjct  54   RCPPTCHNRVSQHGTKIPLEIFKTGETGWGVRSLSSISSGSFICEYAGELLQDTEAEKR-  112

Query  454  GSDEYLFDIGHNYSDCSIN---PS---GQKCTSSEQVEE-VGHTIDAAEYGNVGRFINHS  296
             +DEYLFDIGHNY D  +    PS   G + ++SE +EE VG TIDAA+ GNVGRFINHS
Sbjct  113  ENDEYLFDIGHNYDDEELWKGLPSMIPGLESSTSETIEEAVGFTIDAAKCGNVGRFINHS  172

Query  295  CSPNLYAQNVLYDYDDRKVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCF  116
            CSPNLYAQNVL+D+DD+++PHIM FA ENI PL+ELTYHYNYT+ QVRD +G  KVK+C 
Sbjct  173  CSPNLYAQNVLWDHDDKRMPHIMFFAAENIPPLQELTYHYNYTIGQVRDKNGVEKVKECL  232

Query  115  CGSAECTGRLY  83
            CG+A+C  RLY
Sbjct  233  CGAADCCHRLY  243



>ref|XP_002444302.1| hypothetical protein SORBIDRAFT_07g019850 [Sorghum bicolor]
 gb|EES13797.1| hypothetical protein SORBIDRAFT_07g019850 [Sorghum bicolor]
Length=1131

 Score =   263 bits (673),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 131/226 (58%), Positives = 166/226 (73%), Gaps = 10/226 (4%)
 Frame = -3

Query  733   CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
             CACAV+NGGE+P++ NG I+  K +++ECGP CKCPPSC+NRVSQ+ +KI LE+F+T   
Sbjct  907   CACAVKNGGEIPFDLNGKILNEKSVIFECGPSCKCPPSCHNRVSQHDMKIPLEVFRTTKT  966

Query  553   GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSI------NPS  392
             GWGVRSL SIPSG+FICEY GELL  KEA +R  ++ YLFD G NY D +I      N S
Sbjct  967   GWGVRSLRSIPSGSFICEYIGELLHQKEAYKRR-NNSYLFDTGLNYDDENISSGLPSNVS  1025

Query  391   G--QKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
             G     + S+  E+V  TIDA+EYGN+GRFINHSCSPNL AQNVL D+DD+++PHIM FA
Sbjct  1026  GLNSSSSCSQTKEDVHFTIDASEYGNIGRFINHSCSPNLQAQNVLQDHDDKRMPHIMFFA  1085

Query  217   VENISPLRELTYHYNYT-VDQVRDSSGNIKVKQCFCGSAECTGRLY  83
              E I PL+ELT  YN + +D+VR  +  +K K C CGS++C  R Y
Sbjct  1086  AETIPPLQELTCDYNNSEIDRVRGVNRRMKSKVCHCGSSQCHRRFY  1131



>emb|CAN74696.1| hypothetical protein VITISV_024649 [Vitis vinifera]
Length=992

 Score =   261 bits (668),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 145/193 (75%), Gaps = 22/193 (11%)
 Frame = -3

Query  736  KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
            KCAC ++NGGE+P+N +GAI+E KP VYECGP CKCPPSC NRVSQNGI+  LE+FKT+S
Sbjct  588  KCACVLKNGGEIPFNCHGAIIETKPWVYECGPLCKCPPSCNNRVSQNGIRFSLEVFKTKS  647

Query  556  RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKCT  377
             GWGVRS   I SG+FICEY GEL++DKEA+RR  +DEYLFD+ +               
Sbjct  648  TGWGVRSRNYISSGSFICEYXGELIQDKEAKRRTANDEYLFDLDNG--------------  693

Query  376  SSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISPL  197
                       IDAA++GNVGR+INHSCSPNLYAQ VLYD+DD+++PHIMLFA +NI P+
Sbjct  694  --------AFAIDAAKFGNVGRYINHSCSPNLYAQKVLYDHDDKRLPHIMLFATKNIPPM  745

Query  196  RELTYHYNYTVDQ  158
            RELTYHYNY V Q
Sbjct  746  RELTYHYNYMVGQ  758



>gb|KJB19630.1| hypothetical protein B456_003G111600 [Gossypium raimondii]
Length=731

 Score =   255 bits (651),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 124/226 (55%), Positives = 158/226 (70%), Gaps = 18/226 (8%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            + C C V+NGG   Y+    + E KPL+ ECGP CKC  SC NRVSQ GI++ LE+FKT+
Sbjct  517  EDCPCIVKNGGS-TYDYEERLFEAKPLIVECGPSCKCFTSCLNRVSQRGIRLPLEVFKTK  575

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPS----  392
            ++GWGVRS + I  G FICEY GE+L D E E+RIG+DEYLFDIG  Y D S+  +    
Sbjct  576  AKGWGVRSRSFIRRGCFICEYTGEILRDNEGEQRIGNDEYLFDIGVTYGDHSLRDANSLG  635

Query  391  ---GQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
               G +C           TIDAA  GNVGRFINHSCSPNL+ Q VL+D+D++++PHIMLF
Sbjct  636  SFEGNEC----------FTIDAARVGNVGRFINHSCSPNLFPQGVLFDHDNKRMPHIMLF  685

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            A+E+I PL ELTY YNY    V D++GNIK+K C+C S++C GR+Y
Sbjct  686  AMEDIPPLNELTYDYNYEKGGVCDANGNIKIKHCYCDSSDCLGRMY  731



>gb|KJB19628.1| hypothetical protein B456_003G111600 [Gossypium raimondii]
 gb|KJB19629.1| hypothetical protein B456_003G111600 [Gossypium raimondii]
 gb|KJB19632.1| hypothetical protein B456_003G111600 [Gossypium raimondii]
Length=828

 Score =   255 bits (652),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/226 (55%), Positives = 158/226 (70%), Gaps = 18/226 (8%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            + C C V+NGG   Y+    + E KPL+ ECGP CKC  SC NRVSQ GI++ LE+FKT+
Sbjct  614  EDCPCIVKNGGST-YDYEERLFEAKPLIVECGPSCKCFTSCLNRVSQRGIRLPLEVFKTK  672

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPS----  392
            ++GWGVRS + I  G FICEY GE+L D E E+RIG+DEYLFDIG  Y D S+  +    
Sbjct  673  AKGWGVRSRSFIRRGCFICEYTGEILRDNEGEQRIGNDEYLFDIGVTYGDHSLRDANSLG  732

Query  391  ---GQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
               G +C           TIDAA  GNVGRFINHSCSPNL+ Q VL+D+D++++PHIMLF
Sbjct  733  SFEGNEC----------FTIDAARVGNVGRFINHSCSPNLFPQGVLFDHDNKRMPHIMLF  782

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            A+E+I PL ELTY YNY    V D++GNIK+K C+C S++C GR+Y
Sbjct  783  AMEDIPPLNELTYDYNYEKGGVCDANGNIKIKHCYCDSSDCLGRMY  828



>gb|KJB19627.1| hypothetical protein B456_003G111600 [Gossypium raimondii]
 gb|KJB19631.1| hypothetical protein B456_003G111600 [Gossypium raimondii]
 gb|KJB19633.1| hypothetical protein B456_003G111600 [Gossypium raimondii]
Length=851

 Score =   255 bits (651),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 124/226 (55%), Positives = 158/226 (70%), Gaps = 18/226 (8%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            + C C V+NGG   Y+    + E KPL+ ECGP CKC  SC NRVSQ GI++ LE+FKT+
Sbjct  637  EDCPCIVKNGGST-YDYEERLFEAKPLIVECGPSCKCFTSCLNRVSQRGIRLPLEVFKTK  695

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPS----  392
            ++GWGVRS + I  G FICEY GE+L D E E+RIG+DEYLFDIG  Y D S+  +    
Sbjct  696  AKGWGVRSRSFIRRGCFICEYTGEILRDNEGEQRIGNDEYLFDIGVTYGDHSLRDANSLG  755

Query  391  ---GQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
               G +C           TIDAA  GNVGRFINHSCSPNL+ Q VL+D+D++++PHIMLF
Sbjct  756  SFEGNEC----------FTIDAARVGNVGRFINHSCSPNLFPQGVLFDHDNKRMPHIMLF  805

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            A+E+I PL ELTY YNY    V D++GNIK+K C+C S++C GR+Y
Sbjct  806  AMEDIPPLNELTYDYNYEKGGVCDANGNIKIKHCYCDSSDCLGRMY  851



>gb|EMS57938.1| Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 
[Triticum urartu]
Length=1433

 Score =   259 bits (661),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 157/208 (75%), Gaps = 6/208 (3%)
 Frame = -3

Query  736   KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
             +CACAV+NGGE+P+N N AIV  KPL+YECGP C+CPP+C+NRVSQ+G K+ LEIFKT  
Sbjct  875   ECACAVKNGGEIPFNLNSAIVYTKPLIYECGPSCRCPPTCHNRVSQHGPKVPLEIFKTGK  934

Query  556   RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSI-----NPS  392
              GWGVRSL+ IPSG+F+CEY GE+L++ EAE R  +DEYLFDIG +  D           
Sbjct  935   TGWGVRSLSFIPSGSFVCEYVGEVLQETEAE-RTENDEYLFDIGRDDDDDDDDDDDEEKD  993

Query  391   GQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVE  212
              Q   S    E +G+TIDAA+ GNVGRFINHSC+PN++AQ+VL+D+DD+++PH+MLFA +
Sbjct  994   SQSSKSEMTAEGLGYTIDAAKCGNVGRFINHSCTPNMHAQDVLWDHDDKRMPHVMLFAEK  1053

Query  211   NISPLRELTYHYNYTVDQVRDSSGNIKV  128
             NI PL+ELTY YNY +  VR +    +V
Sbjct  1054  NIRPLQELTYDYNYNIGNVRKNGKAARV  1081



>gb|EMT25277.1| Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 
[Aegilops tauschii]
Length=1706

 Score =   259 bits (661),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/204 (61%), Positives = 160/204 (78%), Gaps = 2/204 (1%)
 Frame = -3

Query  736   KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
             +CACAV+NGGE+P+N N AIV  KPL+YECGP C+CPP+C+NRVSQ+G K+ LEIFKT  
Sbjct  1170  ECACAVKNGGEIPFNLNSAIVYTKPLIYECGPSCRCPPTCHNRVSQHGPKVPLEIFKTGK  1229

Query  556   RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKCT  377
              GWGVRSL+ IPSG+F+CEY GE+L++ EAE R  +DEYLFDIG +  D      G + +
Sbjct  1230  TGWGVRSLSFIPSGSFVCEYVGEVLQETEAE-RTENDEYLFDIGRDDDDDEEEEEGSESS  1288

Query  376   SSEQ-VEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
              SE   E +G+TIDAA+ GNVGRFINHSCSPN++AQ+VL+D+DDR++PH+MLFA +NI P
Sbjct  1289  KSEMTAESLGYTIDAAKCGNVGRFINHSCSPNMHAQDVLWDHDDRRMPHVMLFAEKNIRP  1348

Query  199   LRELTYHYNYTVDQVRDSSGNIKV  128
             L+ELTY YNY +  VR +    +V
Sbjct  1349  LQELTYDYNYNIGNVRKNGKAARV  1372



>ref|XP_008671801.1| PREDICTED: wall-associated receptor kinase 2-like [Zea mays]
Length=396

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 150/190 (79%), Gaps = 11/190 (6%)
 Frame = -3

Query  631  CPPSCYNRVSQNGIKIQLEIFKTESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIG  452
            CPP+C+NRVSQ+G+KI LEIFKT   GWGVRSL+SI SG+FICEY GELLED+EAE+R  
Sbjct  211  CPPTCHNRVSQHGVKIPLEIFKTGKTGWGVRSLSSISSGSFICEYTGELLEDEEAEKR-E  269

Query  451  SDEYLFDIGHNYSDC-------SINPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSC  293
            +DEYLFDIGHNY D        S+   G   +SSE +E  G TIDA+E GNVGRFINHSC
Sbjct  270  NDEYLFDIGHNYHDKELWEGLKSVVGLGSATSSSETME--GFTIDASECGNVGRFINHSC  327

Query  292  SPNLYAQNVLYDYDDRKVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFC  113
            SPNLYAQNVL+D+DD ++PH+M FAVENI PL+ELTYHYNY + +V   +G  KVK C+C
Sbjct  328  SPNLYAQNVLWDHDDMRMPHVMFFAVENIPPLQELTYHYNYKIGEVY-INGEEKVKHCYC  386

Query  112  GSAECTGRLY  83
            G+++C GRLY
Sbjct  387  GASDCCGRLY  396



>ref|XP_008664717.1| PREDICTED: uncharacterized protein LOC103643335 isoform X1 [Zea 
mays]
 tpg|DAA49169.1| TPA: putative histone-lysine N-methyltransferase family protein 
[Zea mays]
Length=1161

 Score =   246 bits (629),  Expect = 4e-71, Method: Composition-based stats.
 Identities = 121/228 (53%), Positives = 163/228 (71%), Gaps = 10/228 (4%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             + CACAV+NGGE+P++ +GAI+  K +++ECG  CKCPPSC NRVSQ+ +KI LE+F+T 
Sbjct  935   ESCACAVKNGGEIPFDLSGAILNEKSVIFECGSSCKCPPSCRNRVSQHDMKIPLEVFRTT  994

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSI------N  398
               GWGVRSL SIP+G+FICEY GE+   K A++R  ++ YLFD+G NY D ++      N
Sbjct  995   KTGWGVRSLWSIPAGSFICEYIGEVQHQKAADKR-RNNNYLFDVGLNYDDENVSSVLLSN  1053

Query  397   PSG--QKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIML  224
              SG     + S+ +E+V  TIDA+ YGN+GRFINHSCSPNL AQNVL D+ D+++PHIM 
Sbjct  1054  VSGLNSSSSCSQAMEDVRFTIDASVYGNIGRFINHSCSPNLQAQNVLRDHGDKRMPHIMF  1113

Query  223   FAVENISPLRELTYHYNYT-VDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             FA E I PL+ELTY YN + +D+V+  +  +K K C   S+ C  R Y
Sbjct  1114  FAAETIPPLQELTYDYNNSEIDRVQGVNRRMKSKVCQYSSSLCRRRFY  1161



>gb|KDP22486.1| hypothetical protein JCGZ_26317 [Jatropha curcas]
Length=269

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 152/223 (68%), Gaps = 8/223 (4%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C C + NG E PY+ +  +++ KP VYECG  C C  SC NRVSQ GI+ QLE+FKT+S+
Sbjct  49   CKCKIENGQEFPYDNHRHLIKEKPYVYECGNSCNCSDSCINRVSQQGIQFQLEVFKTKSK  108

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGS-DEYLFDIGHNYSDCSIN----PSG  389
            G GV+S + IPSG+F+CEY GE L  KEAE+R+GS DEYLF IG N  D +      P  
Sbjct  109  GLGVKSRSYIPSGSFVCEYVGEFLSAKEAEQRVGSRDEYLFHIGDNCRDRNFKEEWIPLY  168

Query  388  QKCTSSEQVEEV-GHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVE  212
            +   S+   +++ G  IDAA+YGNV RFINHSCSPNLY + VL  YDD ++PHIML A +
Sbjct  169  ESRPSNFSEKDIGGSAIDAAQYGNVARFINHSCSPNLYVEKVL--YDDPEIPHIMLLAKK  226

Query  211  NISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            N+ P +ELTY Y Y + ++   +GN K K+CFC S +C G+ Y
Sbjct  227  NMPPSKELTYDYKYRLGELCHINGNFKAKECFCSSLKCVGKFY  269



>ref|XP_008664718.1| PREDICTED: uncharacterized protein LOC103643335 isoform X2 [Zea 
mays]
Length=1118

 Score =   243 bits (620),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 121/228 (53%), Positives = 163/228 (71%), Gaps = 10/228 (4%)
 Frame = -3

Query  739   QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             + CACAV+NGGE+P++ +GAI+  K +++ECG  CKCPPSC NRVSQ+ +KI LE+F+T 
Sbjct  892   ESCACAVKNGGEIPFDLSGAILNEKSVIFECGSSCKCPPSCRNRVSQHDMKIPLEVFRTT  951

Query  559   SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSI------N  398
               GWGVRSL SIP+G+FICEY GE+   K A++R  ++ YLFD+G NY D ++      N
Sbjct  952   KTGWGVRSLWSIPAGSFICEYIGEVQHQKAADKRR-NNNYLFDVGLNYDDENVSSVLLSN  1010

Query  397   PSG--QKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIML  224
              SG     + S+ +E+V  TIDA+ YGN+GRFINHSCSPNL AQNVL D+ D+++PHIM 
Sbjct  1011  VSGLNSSSSCSQAMEDVRFTIDASVYGNIGRFINHSCSPNLQAQNVLRDHGDKRMPHIMF  1070

Query  223   FAVENISPLRELTYHYNYT-VDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             FA E I PL+ELTY YN + +D+V+  +  +K K C   S+ C  R Y
Sbjct  1071  FAAETIPPLQELTYDYNNSEIDRVQGVNRRMKSKVCQYSSSLCRRRFY  1118



>ref|XP_012090520.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH5-like [Jatropha curcas]
Length=596

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/224 (54%), Positives = 156/224 (70%), Gaps = 14/224 (6%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C+C V+NG E PY+    +++ KP VYECG  CKC  SC NRVSQ GI+ QLE+FKT+S+
Sbjct  380  CSCKVKNGQEFPYDNRRHLIKEKPYVYECGNSCKCSDSCINRVSQLGIQFQLEVFKTKSK  439

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGS-DEYLFDIGHNYSDCSI----NPSG  389
            GWGVRS + IPSG+F+CEY GE+L  KEAE+R+GS D YLF +  N SD +      P G
Sbjct  440  GWGVRSRSYIPSGSFVCEYVGEILSSKEAEQRVGSRDGYLFHMEDNRSDRNFKEEWKPLG  499

Query  388  QKCTS--SEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
            +   S  SE+V     TIDAA+YGNV RFINHSCSPNL+ Q V+  YDD ++PH+MLFA 
Sbjct  500  KSHPSNFSEKV-----TIDAAQYGNVARFINHSCSPNLHVQKVI--YDDHEMPHLMLFAN  552

Query  214  ENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            ++I   +ELTY Y Y + ++   +GN K K+CFC S +C G+ Y
Sbjct  553  KDIPAWKELTYDYKYRLGELCHINGNFKAKECFCSSLKCVGKFY  596



>gb|KDP22485.1| hypothetical protein JCGZ_26316 [Jatropha curcas]
Length=602

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/224 (54%), Positives = 156/224 (70%), Gaps = 14/224 (6%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C+C V+NG E PY+    +++ KP VYECG  CKC  SC NRVSQ GI+ QLE+FKT+S+
Sbjct  386  CSCKVKNGQEFPYDNRRHLIKEKPYVYECGNSCKCSDSCINRVSQLGIQFQLEVFKTKSK  445

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGS-DEYLFDIGHNYSDCSI----NPSG  389
            GWGVRS + IPSG+F+CEY GE+L  KEAE+R+GS D YLF +  N SD +      P G
Sbjct  446  GWGVRSRSYIPSGSFVCEYVGEILSSKEAEQRVGSRDGYLFHMEDNRSDRNFKEEWKPLG  505

Query  388  QKCTS--SEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
            +   S  SE+V     TIDAA+YGNV RFINHSCSPNL+ Q V+  YDD ++PH+MLFA 
Sbjct  506  KSHPSNFSEKV-----TIDAAQYGNVARFINHSCSPNLHVQKVI--YDDHEMPHLMLFAN  558

Query  214  ENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            ++I   +ELTY Y Y + ++   +GN K K+CFC S +C G+ Y
Sbjct  559  KDIPAWKELTYDYKYRLGELCHINGNFKAKECFCSSLKCVGKFY  602



>ref|XP_002511028.1| histone-lysine n-methyltransferase, suvh, putative [Ricinus communis]
 gb|EEF51630.1| histone-lysine n-methyltransferase, suvh, putative [Ricinus communis]
Length=631

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/224 (51%), Positives = 152/224 (68%), Gaps = 5/224 (2%)
 Frame = -3

Query  742  FQKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKT  563
            F  C+C  +NG E+PYN    +V  +P +YECG  CKC  SC NRV Q GI++QLE+FKT
Sbjct  407  FDNCSCISKNGQEIPYNDCKRLVRKRPCIYECGHFCKCSDSCPNRVCQLGIQLQLEVFKT  466

Query  562  ESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSG-Q  386
            ES+GWGVRS + I +G+FICEY G++++ +EA RR G ++YLFDIG NY D  I  +   
Sbjct  467  ESKGWGVRSRSYIRAGSFICEYVGKIVQAEEACRRFGREDYLFDIGDNYDDRIIRANHVP  526

Query  385  KCTSSEQV----EEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
            +  + E +    ++ G  IDA + GNVGRFINHSCSPNLY QNVL+D+ DR +PH+MLFA
Sbjct  527  RLRNYEHLSLCKKDWGFMIDAGQRGNVGRFINHSCSPNLYVQNVLWDHHDRGIPHVMLFA  586

Query  217  VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRL  86
             ++I P  ELTY YN  +   R  +GN+K K C C S  C G+ 
Sbjct  587  KKDIPPWTELTYDYNCRLGDFRCMNGNVKAKNCMCKSPHCVGKF  630



>tpg|DAA49168.1| TPA: putative histone-lysine N-methyltransferase family protein 
[Zea mays]
Length=271

 Score =   226 bits (576),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 150/220 (68%), Gaps = 23/220 (10%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            + CACAV+NGGE+P++ +GAI+  K +++ECG  CKCPPSC NRVSQ+ +KI LE+F+T 
Sbjct  74   ESCACAVKNGGEIPFDLSGAILNEKSVIFECGSSCKCPPSCRNRVSQHDMKIPLEVFRTT  133

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
              GWGVRSL SIP+G+FICEY GE+   K A++R  ++ YLFD                 
Sbjct  134  KTGWGVRSLWSIPAGSFICEYIGEVQHQKAADKR-RNNNYLFD-----------------  175

Query  379  TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
                 +E+V  TIDA+ YGN+GRFINHSCSPNL AQNVL D+ D+++PHIM FA E I P
Sbjct  176  ----AMEDVRFTIDASVYGNIGRFINHSCSPNLQAQNVLRDHGDKRMPHIMFFAAETIPP  231

Query  199  LRELTYHYNYT-VDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            L+ELTY YN + +D+V+  +  +K K C   S+ C  R Y
Sbjct  232  LQELTYDYNNSEIDRVQGVNRRMKSKVCQYSSSLCRRRFY  271



>ref|XP_004516278.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH5-like [Cicer arietinum]
Length=596

 Score =   234 bits (598),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 153/218 (70%), Gaps = 9/218 (4%)
 Frame = -3

Query  736  KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
            KC CAVRNGG++PYN+N  IV    +++ECGP+CKC   C NRVSQ GIK  LEIF+TE 
Sbjct  388  KCLCAVRNGGKIPYNKNNVIVASGGVIHECGPYCKCSADCPNRVSQKGIKFNLEIFRTER  447

Query  556  RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKCT  377
            +GWGVRS  +IP+G+FICEY GE++ED E ++R   ++   D G       ++ SG +  
Sbjct  448  KGWGVRSRDTIPAGSFICEYIGEVIEDDEVDKRDEDEDEDEDGGDEEV--LVDESGNENN  505

Query  376  SSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISPL  197
                    G TIDAA YGNV RFINHSCSPNL+ QNVLYD+DD ++PHIMLF+ E I  +
Sbjct  506  G-------GFTIDAAYYGNVARFINHSCSPNLFGQNVLYDHDDGRIPHIMLFSAETIPKM  558

Query  196  RELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             ELTYHY+Y +  V D +GN+K K C+CG+ EC GRLY
Sbjct  559  TELTYHYHYKIGLVLDGNGNVKTKNCYCGAFECGGRLY  596



>ref|XP_012090774.1| PREDICTED: LOW QUALITY PROTEIN: histone-lysine N-methyltransferase, 
H3 lysine-9 specific SUVH5-like [Jatropha curcas]
Length=559

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 153/223 (69%), Gaps = 8/223 (4%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C C + NG E PY+ +  +++ KP VYECG  C C  SC NRVSQ GI+ QLE+FKT+S+
Sbjct  339  CKCKIENGQEFPYDNHRHLIKEKPYVYECGNSCNCSDSCINRVSQQGIQFQLEVFKTKSK  398

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGS-DEYLFDIGHNYSDCSIN----PSG  389
            G GV+S + IPSG+F+CEY GE L  KEAE+R+GS DEYLF IG N  D +      P  
Sbjct  399  GLGVKSRSYIPSGSFVCEYVGEFLSAKEAEQRVGSRDEYLFHIGDNCRDRNFKEEWIPLY  458

Query  388  QKCTSSEQVEEVGHT-IDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVE  212
            +   S+   +++G + IDAA+YGNV RFINHSCSPNLY + VL  YDD ++PHIML A +
Sbjct  459  ESRPSNFSEKDIGGSAIDAAQYGNVARFINHSCSPNLYVEKVL--YDDPEIPHIMLLAKK  516

Query  211  NISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            N+ P +ELTY Y Y + ++   +GN K K+CFC S +C G+ Y
Sbjct  517  NMPPSKELTYDYKYRLGELCHINGNFKAKECFCSSLKCVGKFY  559



>ref|XP_002979834.1| hypothetical protein SELMODRAFT_111454 [Selaginella moellendorffii]
 gb|EFJ19236.1| hypothetical protein SELMODRAFT_111454 [Selaginella moellendorffii]
Length=574

 Score =   229 bits (585),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/224 (51%), Positives = 150/224 (67%), Gaps = 8/224 (4%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C C  +N  ++PY  +GA+ E K ++YECGP C+C  SC  R+SQ G   +LE+FKTE+R
Sbjct  352  CLCIGKNSNKMPYT-DGALYEWKTILYECGPMCRCAASCPLRLSQQGQTRKLEVFKTENR  410

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDI----GHNYSDCSINPSGQ  386
            GWGVRS  +IP G+FICEY GELL ++EAERR+G DEY+FDI    G       I+   +
Sbjct  411  GWGVRSWEAIPFGSFICEYVGELLSNEEAERRVGQDEYIFDIDCIKGSRSRGVDISSFFE  470

Query  385  KCTSSE--QVEEVGH-TIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
            +    E  +V E GH +IDA   GNV RFINHSC PN++ Q V  D++D   PH+M+FA+
Sbjct  471  EKDGGEICEVVEDGHMSIDAGSCGNVSRFINHSCDPNMFVQCVFNDHNDMAYPHVMMFAM  530

Query  214  ENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            +NI P  EL+Y Y Y +D VRDS G IK K+C+CG+  C  RLY
Sbjct  531  KNIRPFEELSYDYGYEIDSVRDSDGKIKKKRCYCGARRCKKRLY  574



>ref|XP_008368926.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH6-like [Malus domestica]
Length=308

 Score =   222 bits (565),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 151/205 (74%), Gaps = 17/205 (8%)
 Frame = -3

Query  739  QKCACAVRN-GGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKT  563
            +K +CAV N GGE+PYN NGAIVE K LVYECGP CKCPP CYNRVSQ GIK QLEIFKT
Sbjct  105  EKXSCAVENNGGEIPYNFNGAIVEAKSLVYECGP-CKCPP-CYNRVSQPGIKFQLEIFKT  162

Query  562  ESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSI------  401
            ESRGWGVRSL SIPSG+F CE  GELLE+KEAE R G+D+YLFDIG+NY+D S+      
Sbjct  163  ESRGWGVRSLNSIPSGSFXCECIGELLEEKEAEERTGNDZYLFDIGNNYNDNSVWDGLST  222

Query  400  -NPSGQKCTSSEQVEEVGHTI---DAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPH  233
              P+ Q   S   V + G T+    AA + ++       CSPNLYAQNVLYD+DD ++PH
Sbjct  223  LMPNAQS-NSCGVVGDGGFTVMQYSAATWEDLSTIF---CSPNLYAQNVLYDHDDTEIPH  278

Query  232  IMLFAVENISPLRELTYHYNYTVDQ  158
             M FA ENI PL+ELTYHYNY +D+
Sbjct  279  HMFFAAENIHPLQELTYHYNYMIDR  303



>ref|XP_002976443.1| hypothetical protein SELMODRAFT_104841 [Selaginella moellendorffii]
 gb|EFJ22703.1| hypothetical protein SELMODRAFT_104841 [Selaginella moellendorffii]
Length=571

 Score =   229 bits (583),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 150/224 (67%), Gaps = 8/224 (4%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C C  +N  ++PY  +GA+ E K ++YECGP C+C  SC  R+SQ G   +LE+FKTE+R
Sbjct  349  CLCIGKNSNKMPYT-DGALYESKTILYECGPMCRCAASCPLRLSQQGQTRKLEVFKTENR  407

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDI----GHNYSDCSINPSGQ  386
            GWGVRS  +IP G+FICEY GEL+ ++EAERR+G DEY+FDI    G       I+   +
Sbjct  408  GWGVRSWEAIPFGSFICEYVGELISNEEAERRVGQDEYIFDIDCIKGSRSRGVDISSFFE  467

Query  385  KCTSSE--QVEEVGH-TIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
            +    E  +V E GH +IDA   GNV RFINHSC PN++ Q V  D++D   PH+M+FA+
Sbjct  468  EKDGGEICEVVEDGHMSIDAGSCGNVSRFINHSCDPNMFVQCVFNDHNDMAYPHVMMFAM  527

Query  214  ENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            +NI P  EL+Y Y Y +D VRDS G IK K+C+CG+  C  RLY
Sbjct  528  KNIRPFEELSYDYGYEIDSVRDSDGKIKKKRCYCGARRCKKRLY  571



>ref|XP_001753516.1| histone methyltransferase Su3-9 group [Physcomitrella patens]
 gb|EDQ81739.1| histone methyltransferase Su3-9 group [Physcomitrella patens]
Length=533

 Score =   209 bits (533),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 102/228 (45%), Positives = 145/228 (64%), Gaps = 10/228 (4%)
 Frame = -3

Query  739  QKCACAVRNGGE-LPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKT  563
             +C+C ++N G+ LPYN+ G ++   P VYECG  CKC   C+NRV Q G++ +LEIFKT
Sbjct  307  HRCSCVLKNSGKMLPYNQYGHLIRAVPAVYECGSRCKCSLECHNRVCQKGLRYRLEIFKT  366

Query  562  ESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGH---NYSDCSINPS  392
            E +GW VRS   IPSG F+CEY G +++ K A+  +  D+YLF++     N +   +  S
Sbjct  367  EKKGWAVRSWDFIPSGGFVCEYTGVIMDTKTADE-LDDDDYLFNLDFKQGNEARWGVQRS  425

Query  391  GQKCTSSE-----QVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIM  227
                +        ++    + IDA+++G V RF+NHSC+PNL+ Q VLYD+ D  +PH+M
Sbjct  426  DVFDSDDSDMPPLKLSSPKYVIDASKFGGVARFVNHSCTPNLFVQCVLYDHGDLDLPHVM  485

Query  226  LFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            LFA  +ISP +ELTY Y Y ++ V DS GN+K K C CG+  C  RLY
Sbjct  486  LFAGSDISPFQELTYDYGYALNSVYDSHGNLKKKDCHCGTRSCRKRLY  533



>ref|XP_010038409.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH5-like [Eucalyptus grandis]
Length=729

 Score =   210 bits (534),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 138/212 (65%), Gaps = 16/212 (8%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C+C ++NGG LPY ++G I + KPLVYECGP C C  SC NR SQ+GIK  LEIF+T+ +
Sbjct  528  CSCVIKNGGTLPYKQDGRISKFKPLVYECGPSCTCSHSCINRASQSGIKFDLEIFQTQGK  587

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKCTS  374
            GWGVRS + IP G+F+CEY G++L D+         +Y F+IG           G  C  
Sbjct  588  GWGVRSRSHIPLGSFVCEYIGKVLPDELVLPEFNKHKYFFNIG---------VGGATCKQ  638

Query  373  SEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISPLR  194
            S +      TIDA   GN+GRFINHSCSPNLYAQNVL D+ D+++PHIM FA ++I PLR
Sbjct  639  SGEC----FTIDAKAQGNIGRFINHSCSPNLYAQNVLSDHHDKRMPHIMFFASKDIPPLR  694

Query  193  ELTYHYNYTVDQVRDSSGNIKVKQCFCGSAEC  98
            ELT  ++Y V  VR  +  ++  +C+C +  C
Sbjct  695  ELT--FDYRVSHVR-CADVLRRMKCYCNAIAC  723



>gb|KHG01895.1| Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 
-like protein [Gossypium arboreum]
Length=200

 Score =   194 bits (494),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 122/160 (76%), Gaps = 3/160 (2%)
 Frame = -3

Query  565  TESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQ  386
            T+++GWGVRS + I  G FICEY GE+L DKE E+RIG+DEYLFDIG +Y D S+  +  
Sbjct  19   TKAKGWGVRSRSFIRRGCFICEYTGEILRDKEGEQRIGNDEYLFDIGVSYGDHSLRDANS  78

Query  385  KCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENI  206
                S +  E   TIDAA  GNVGRFINHSCSPNL+ Q+VL+D+D++++PHIMLFA+E+I
Sbjct  79   --LGSFEGNEC-FTIDAARVGNVGRFINHSCSPNLFPQSVLFDHDNKRMPHIMLFAMEDI  135

Query  205  SPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRL  86
             PL ELTY YNY    V D++GNIK+K C+C S++CTGR+
Sbjct  136  PPLNELTYDYNYEKGGVCDANGNIKIKHCYCDSSDCTGRM  175



>gb|EPS57959.1| hypothetical protein M569_16858, partial [Genlisea aurea]
Length=300

 Score =   196 bits (497),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 104/235 (44%), Positives = 138/235 (59%), Gaps = 24/235 (10%)
 Frame = -3

Query  733  CACAVRNGGELPY-NRN-GAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            CACA  NGG+ PY +RN G ++E K +V+ECGP C+C P C NR SQNGI  +LE+F+T+
Sbjct  72   CACAKLNGGDFPYVHRNVGRLIEPKAVVFECGPKCRCGPECINRTSQNGIIFRLEVFRTQ  131

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
             +GWG+RS   IP+G  ICEY G L+           + Y+FDI     DC     G   
Sbjct  132  KKGWGLRSWDHIPAGAPICEYIG-LVRKTSDLNSADDNSYVFDI-----DCLQTMQGLDG  185

Query  379  TSS----------------EQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDD  248
              S                ++ + V   IDAAE GN+ RFINHSC PNL+ Q +L ++ D
Sbjct  186  RESRLRDVELPWYLEEIVKDRSDSVPFCIDAAETGNIARFINHSCQPNLFVQCILSNHHD  245

Query  247  RKVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
              +  +MLFA +NI PL+ELTY Y YT+D V    GN++   C+CG+ EC  RLY
Sbjct  246  MNLARVMLFAADNIPPLQELTYDYCYTLDSVVGPDGNVRQMPCYCGAVECRKRLY  300



>gb|KEH22374.1| histone-lysine N-methyltransferase, suvh protein [Medicago truncatula]
Length=543

 Score =   201 bits (512),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 105/240 (44%), Positives = 149/240 (62%), Gaps = 50/240 (21%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
             KC+CA+++GG++P                              V +N IK +L+IFKT+
Sbjct  333  MKCSCALKSGGKIP-----------------------------SVKKNEIKFKLQIFKTK  363

Query  559  SRGWGVRSLTSIPSGTFI-CEYAGELLEDKEAERRIGSDEYLFDIGH-------NYSDCS  404
            ++GWGVRS  +IPSG FI CEY GE++ED+EA +++ +DEYLF+IG+       ++ + S
Sbjct  364  AKGWGVRSENAIPSGNFIICEYLGEIIEDEEALKKVDNDEYLFNIGNYIHKVYSSWEEDS  423

Query  403  INPSGQKCTSSEQVEEVG-------------HTIDAAEYGNVGRFINHSCSPNLYAQNVL  263
                 ++ +S + +E  G              TIDAA+YGNV RFINHSCSPNL+ +NVL
Sbjct  424  YVVDSKEMSSYQPLEASGGKEGVDDRCDSGRFTIDAAKYGNVARFINHSCSPNLFVRNVL  483

Query  262  YDYDDRKVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            YD D  ++PHIML+A ENI  ++ELT  YNY +DQ  DS+GN+K K C+CG++EC  RLY
Sbjct  484  YDDDVPRIPHIMLYAAENIPSMKELTLDYNYKIDQAIDSNGNLKTKACYCGASECIRRLY  543



>ref|XP_001785269.1| histone methyltransferase Su3-9 group [Physcomitrella patens]
 gb|EDQ49921.1| histone methyltransferase Su3-9 group [Physcomitrella patens]
Length=361

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/220 (48%), Positives = 136/220 (62%), Gaps = 4/220 (2%)
 Frame = -3

Query  733  CACAVRN-GGELPYNRNGAIVEVKPLVYECGPHCKCP-PSCYNRVSQNGIKIQLEIFKTE  560
            C C  +N GG L YN +G ++ V+ +VYECG  C C   +C NRVSQ G+K  LEIF+T 
Sbjct  143  CPCVKKNSGGVLAYNDDGHLIRVRNIVYECGSFCNCSHAACRNRVSQKGLKWHLEIFRTM  202

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG-HNYSDCSINPSGQK  383
            S+GWGVR+L  IPSG+F+CE  GELL    A  R  +DEYLF++  H  +     PS  K
Sbjct  203  SKGWGVRTLEFIPSGSFLCELTGELLTATAAADR-ENDEYLFNLDFHKNARGRGKPSKSK  261

Query  382  CTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENIS  203
              +  +     + ID    GNV RFINHSC+PNL+ Q VL+D+ D    HIMLFA E+I+
Sbjct  262  RQALVEELSAHYVIDCRLSGNVARFINHSCNPNLFVQGVLHDHGDLNRGHIMLFAGEDIA  321

Query  202  PLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
               EL Y Y Y ++ VRD  GN+  KQC CG + C  R+Y
Sbjct  322  AGTELAYDYGYELNSVRDIHGNVVAKQCLCGVSICRKRMY  361



>gb|ERN01547.1| hypothetical protein AMTR_s00002p00271340 [Amborella trichopoda]
Length=476

 Score =   198 bits (503),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 106/237 (45%), Positives = 140/237 (59%), Gaps = 19/237 (8%)
 Frame = -3

Query  742  FQKCACAVRNGGELPYNRNGA--IVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIF  569
            F+ CACA  NG E PY R     +V+ K +V+ECGP+C+C  SC NR SQ G++ +LE+F
Sbjct  242  FRICACAGLNGSEFPYVRRYGERLVQAKDVVFECGPNCRCGSSCVNRTSQRGLRYRLEVF  301

Query  568  KTESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG------------  425
            +T ++GW VRSL SIPSG  ICEY G L +  E +  +  + Y+F+I             
Sbjct  302  RTPNKGWAVRSLESIPSGAPICEYTGFLRQTDEIDNEL-ENNYIFEIDCLQTMKGIDGRQ  360

Query  424  HNYSDCSINPSGQKCTSSEQVEEVGHT---IDAAEYGNVGRFINHSCSPNLYAQNVLYDY  254
              + D SI+ S       E  +  GH    IDA   GNV RFINHSC PNL+ Q VL  +
Sbjct  361  RRFGDVSIH-SPANLHKIEDKKSEGHPEFCIDAGSTGNVARFINHSCEPNLFVQCVLSSH  419

Query  253  DDRKVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             D K+  +MLFA +NI PL+ELTY Y Y +  V D+ G IK   C+CG++ C  RLY
Sbjct  420  HDLKLARVMLFASDNIPPLQELTYDYGYALGSVMDADGKIKTMPCYCGASSCRKRLY  476



>ref|XP_010660678.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4 [Vitis vinifera]
 emb|CBI21273.3| unnamed protein product [Vitis vinifera]
Length=701

 Score =   201 bits (512),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 106/232 (46%), Positives = 138/232 (59%), Gaps = 18/232 (8%)
 Frame = -3

Query  739  QKCACAVRNGGELPY-NRNGA-IVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFK  566
            + C+CA+ NG + PY +R+G  ++E K +V+ECGP C C P C NR SQ G+K +LE+F+
Sbjct  473  RTCSCAMLNGSDFPYVHRDGGRLIEAKDVVFECGPKCGCGPGCLNRTSQRGLKYRLEVFR  532

Query  565  TESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG------------H  422
            T  +GW VRS   IPSG  ICEY G L+   E +  +  + Y+FDI              
Sbjct  533  TPKKGWAVRSWDYIPSGAPICEYKGILMRTDELDN-VSDNNYIFDIDCLQTMRGLDGRER  591

Query  421  NYSDCSINPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRK  242
             + D S+ P+      SE V E    IDA   GNV RFINHSC PNL+ Q VL  + D K
Sbjct  592  RFRDVSM-PTSTDDQKSESVPEF--CIDAGSTGNVARFINHSCEPNLFVQCVLSSHHDAK  648

Query  241  VPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRL  86
            +  +MLFA +NI PL+ELTY Y YT+D V    G IK   CFCG+A+C  RL
Sbjct  649  LARVMLFAADNIPPLQELTYDYGYTLDSVMGPDGKIKQMLCFCGAADCRKRL  700



>ref|XP_010453502.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4-like [Camelina sativa]
Length=256

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/234 (42%), Positives = 136/234 (58%), Gaps = 17/234 (7%)
 Frame = -3

Query  739  QKCACAVRNGGELPYN--RNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFK  566
            +KCACA  NGG  PY    +G ++E + +V+ECGPHC C P C NR SQ  ++  LE+F+
Sbjct  25   KKCACAKLNGGNFPYVALNDGRLIEPRDVVFECGPHCGCGPECVNRTSQKRLRFHLEVFR  84

Query  565  TESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG------------H  422
            +  +GW VRS   IP+G+ +CEY G L    + +  I  ++Y+F+I              
Sbjct  85   SAKKGWAVRSWDYIPAGSPVCEYIGVLRRTADVDT-ISDNDYIFEIDCQQTMQGLDGRQR  143

Query  421  NYSDCSINPSGQKCTSSEQVEEVGH-TIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDR  245
               D ++ P+  K + S + E V    IDA   GNV RFINHSC PNL+ Q VL  + D 
Sbjct  144  RLRDVAV-PTNDKVSQSSEDENVPEFCIDAGSKGNVARFINHSCEPNLFVQCVLSSHQDL  202

Query  244  KVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             +  ++LFA +NI PL+ELTY Y YT+D V    GN+K   C+CG+  C  RLY
Sbjct  203  SLARVVLFAADNIPPLQELTYDYGYTLDSVHGPDGNVKKLTCYCGALNCRKRLY  256



>ref|XP_002301759.2| hypothetical protein POPTR_0002s23900g [Populus trichocarpa]
 gb|EEE81032.2| hypothetical protein POPTR_0002s23900g [Populus trichocarpa]
Length=285

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/236 (43%), Positives = 136/236 (58%), Gaps = 20/236 (8%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNR--NGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFK  566
            + CACA  NG + PY +   G ++E + +V+ECGP C C P C NR SQ GIK +LE+F+
Sbjct  53   RTCACAKLNGSDFPYVQINGGRLIEARAVVFECGPSCGCGPGCVNRTSQRGIKHRLEVFR  112

Query  565  TESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG-------------  425
            T  +GW VRS   IPSG  +CEY G L+  ++ +  +  + Y+FDI              
Sbjct  113  TPKKGWAVRSWDFIPSGAPVCEYIGALVRTEDTDH-VCENNYIFDIDCLQTMRGLGGRER  171

Query  424  --HNYSDCSINPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYD  251
               + S  +IN        SE V E    IDA   GN+ RFINHSC PNL+ Q VL  + 
Sbjct  172  RLGDVSVSAINSFDGDDQKSESVPEF--CIDAGSTGNIARFINHSCEPNLFVQCVLSSHH  229

Query  250  DRKVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            D K+  +MLFA +NI P++ELTY Y Y +D V   SG IK   C+CG+A+C  RL+
Sbjct  230  DVKLARVMLFAADNIPPMQELTYDYGYALDSVSGPSGKIKQMPCYCGAADCRKRLF  285



>gb|EYU20735.1| hypothetical protein MIMGU_mgv1a005143mg [Erythranthe guttata]
Length=495

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/231 (45%), Positives = 134/231 (58%), Gaps = 16/231 (7%)
 Frame = -3

Query  733  CACAVRNGGELPY--NRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            CACA  NGG+ PY     G +V  K +V+ECGP+C C P C NR SQ+G + +LEIF+T 
Sbjct  267  CACAKLNGGDFPYVHREGGRLVAAKGVVFECGPNCGCGPKCVNRTSQSGPRFRLEIFRTP  326

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG------------HNY  416
             +GWGVRS   IPSG+ ICEY G LL   +       + Y+FDI                
Sbjct  327  KKGWGVRSWDYIPSGSPICEYIG-LLRKTDDLDPAADNSYVFDIDCLQTMKGMDGRERRL  385

Query  415  SDCSINPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVP  236
             D S+ PS  +    +  E V   IDA + GN  RFINHSC PNL+ Q +L ++ D  + 
Sbjct  386  RDVSL-PSYLQKVGEDATESVPFCIDAGKTGNFARFINHSCQPNLFVQCMLNEHHDISLA  444

Query  235  HIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             IML A +NI PL+ELTY Y Y +D V D+ GN+K   C+CG+ EC  RLY
Sbjct  445  RIMLIAADNIPPLKELTYDYGYALDSVMDAEGNVKQMACYCGAEECRKRLY  495



>ref|XP_007204245.1| hypothetical protein PRUPE_ppa002266mg [Prunus persica]
 gb|EMJ05444.1| hypothetical protein PRUPE_ppa002266mg [Prunus persica]
Length=693

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/225 (44%), Positives = 143/225 (64%), Gaps = 11/225 (5%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C+C  +NGG  PY  NG +V  K L++ECGP C C P+C NRVSQ G+K++LE+FKT+ R
Sbjct  466  CSCIQKNGGSFPYTGNGILVSRKQLLHECGPTCPCSPNCKNRVSQTGVKLRLEVFKTKDR  525

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIG---SDEYLFDIGHNYSDCSIN--PSG  389
            GWG+RS  SI +GTFICEYAGE++++ + + ++     DEY+FD G NY     N  P  
Sbjct  526  GWGLRSWDSIRAGTFICEYAGEVIDEVKLKHKVDEGEDDEYIFDTGRNYDSFKWNYEPGL  585

Query  388  QKCTSSEQVE-----EVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIML  224
             +  +S  +           I A   GNV RFINHSCSPN++ Q VLY+++ +   HI  
Sbjct  586  LEEETSNDINVDYNIPYRLIISAKNVGNVARFINHSCSPNVFWQPVLYEHNSQSCLHIAF  645

Query  223  FAVENISPLRELTYHY-NYTVDQVRDSSGNIKVKQCFCGSAECTG  92
            FA+ +I P+ ELTY Y N   ++  + +G+ + K+C CGS++C G
Sbjct  646  FAIRHIPPMTELTYDYGNSCSNEADNDNGSHRKKKCLCGSSKCRG  690



>ref|XP_011621748.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4 [Amborella trichopoda]
Length=492

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/237 (45%), Positives = 140/237 (59%), Gaps = 19/237 (8%)
 Frame = -3

Query  742  FQKCACAVRNGGELPYNRNGA--IVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIF  569
            F+ CACA  NG E PY R     +V+ K +V+ECGP+C+C  SC NR SQ G++ +LE+F
Sbjct  258  FRICACAGLNGSEFPYVRRYGERLVQAKDVVFECGPNCRCGSSCVNRTSQRGLRYRLEVF  317

Query  568  KTESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG------------  425
            +T ++GW VRSL SIPSG  ICEY G L +  E +  +  + Y+F+I             
Sbjct  318  RTPNKGWAVRSLESIPSGAPICEYTGFLRQTDEIDNEL-ENNYIFEIDCLQTMKGIDGRQ  376

Query  424  HNYSDCSINPSGQKCTSSEQVEEVGHT---IDAAEYGNVGRFINHSCSPNLYAQNVLYDY  254
              + D SI+ S       E  +  GH    IDA   GNV RFINHSC PNL+ Q VL  +
Sbjct  377  RRFGDVSIH-SPANLHKIEDKKSEGHPEFCIDAGSTGNVARFINHSCEPNLFVQCVLSSH  435

Query  253  DDRKVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             D K+  +MLFA +NI PL+ELTY Y Y +  V D+ G IK   C+CG++ C  RLY
Sbjct  436  HDLKLARVMLFASDNIPPLQELTYDYGYALGSVMDADGKIKTMPCYCGASSCRKRLY  492



>gb|ERN19324.1| hypothetical protein AMTR_s00069p00076340 [Amborella trichopoda]
Length=494

 Score =   195 bits (496),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 103/235 (44%), Positives = 142/235 (60%), Gaps = 17/235 (7%)
 Frame = -3

Query  739  QKCACAVRNGGELPY-NRNGA-IVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFK  566
            ++CACA  NG E PY ++NG  +V+ K ++YECGP+C C P C NR SQ G++ +LE+F+
Sbjct  261  RRCACARLNGSEFPYVSKNGGRLVQAKDVIYECGPNCGCGPDCVNRTSQRGLRYRLEVFR  320

Query  565  TESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG------------H  422
            T  +GW VRS  +IPSG  +CEY G L+   EA+     + ++FDI              
Sbjct  321  TPKKGWAVRSWDTIPSGAPVCEYTGLLMRTNEADNDT-ENNFIFDIDCLQTIKGIDGRQR  379

Query  421  NYSDCSI-NPSGQKCTSSEQVE-EVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDD  248
             + D SI NP+  +    +++E  V   IDA   G+V RFINHSC PNL+ Q VL  + D
Sbjct  380  RFGDVSIHNPANFEKIEDKKLEGSVEFCIDAGSCGSVARFINHSCEPNLFVQCVLSSHHD  439

Query  247  RKVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             K+  +MLFA +NI PL+EL+Y Y Y +D V    G IK   C+CGS+ C  RLY
Sbjct  440  MKLARVMLFASDNIPPLQELSYDYGYALDSVVGIDGKIKEMPCYCGSSGCRKRLY  494



>ref|XP_006385875.1| hypothetical protein POPTR_0003s16130g [Populus trichocarpa]
 ref|XP_006385876.1| hypothetical protein POPTR_0003s16130g [Populus trichocarpa]
 gb|ERP63672.1| hypothetical protein POPTR_0003s16130g [Populus trichocarpa]
 gb|ERP63673.1| hypothetical protein POPTR_0003s16130g [Populus trichocarpa]
Length=285

 Score =   189 bits (481),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 99/235 (42%), Positives = 137/235 (58%), Gaps = 17/235 (7%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNR--NGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFK  566
            + C+CA  NG + PY     G ++E K +V+ECGP C C PSC NRVSQ G+K QLEI++
Sbjct  52   RSCSCARLNGFDFPYVDIDGGRLIEAKDVVFECGPGCSCGPSCINRVSQRGLKYQLEIYR  111

Query  565  TESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG--HNYSDCSINPS  392
            T  +GW VRS   IPSG  +CEY G L  + E +  +  +E++FDI   H  ++      
Sbjct  112  TADKGWAVRSWDVIPSGAPVCEYFGILRRNDELDN-VSGNEFIFDIDCWHTMNEIGGRER  170

Query  391  GQKCTSSEQVEEVGHT------------IDAAEYGNVGRFINHSCSPNLYAQNVLYDYDD  248
             Q   S+  ++ +               IDA  YGNV RFINHSC PNL+ Q +L  + D
Sbjct  171  RQGDGSAPAIDPLKKVDVKMDESESEFCIDAGSYGNVTRFINHSCQPNLFVQCILSTHHD  230

Query  247  RKVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             ++  I+LFA ++I P++ELTY Y Y +D V    G +K   C+CG+ EC GRLY
Sbjct  231  IRLARIVLFAADDILPMQELTYDYGYALDSVVGPDGKLKQSPCYCGTDECRGRLY  285



>ref|XP_002511029.1| histone-lysine n-methyltransferase, suvh, putative [Ricinus communis]
 gb|EEF51631.1| histone-lysine n-methyltransferase, suvh, putative [Ricinus communis]
Length=614

 Score =   197 bits (501),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 101/219 (46%), Positives = 131/219 (60%), Gaps = 18/219 (8%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            + C+C ++NG    Y+ N  IV +K  +YECG  CKC  SC NRVSQ  I++ LE+F++E
Sbjct  413  EDCSCKIKNGKAFAYDYNEHIVGMKNFIYECGVSCKCFESCINRVSQRKIRLPLEVFRSE  472

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKC  380
               WGVRS   I SG+FICEY GE++  KE  ++    +YLFDIG N             
Sbjct  473  YGEWGVRSKVLISSGSFICEYVGEVINAKELIQKTSMSDYLFDIGCNE------------  520

Query  379  TSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISP  200
                  E   +TIDA   GNVGRFINHSCSPNLY ++V Y   +  +PHIMLFA  +I  
Sbjct  521  ------EGDAYTIDATRRGNVGRFINHSCSPNLYVRSVFYGEFNSNLPHIMLFAARDIPC  574

Query  199  LRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            L+ELTY Y Y + + R ++   KVK+C C S  CTG  Y
Sbjct  575  LQELTYDYKYKLGEFRLNNNAFKVKKCNCQSTNCTGEFY  613



>ref|XP_007157737.1| hypothetical protein PHAVU_002G094200g [Phaseolus vulgaris]
 gb|ESW29731.1| hypothetical protein PHAVU_002G094200g [Phaseolus vulgaris]
Length=713

 Score =   198 bits (504),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 109/243 (45%), Positives = 138/243 (57%), Gaps = 38/243 (16%)
 Frame = -3

Query  733  CACAVRNGGELPY-NRNGA-IVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            CACA+RNG + PY +RNG  +VE K +V+ECGP C C P C NR SQ G++ +LE+F+T 
Sbjct  483  CACALRNGSDFPYVSRNGGRLVEAKDVVFECGPKCGCGPGCVNRTSQKGLRYRLEVFRTA  542

Query  559  SRGWGVRSLTSIPSGTFICEYAGEL--LEDKEA----------------------ERRIG  452
             +GW VRS   IPSG  +CEY G L   ED ++                      ERR  
Sbjct  543  KKGWAVRSWDFIPSGAPVCEYTGILGRTEDMDSVLENNYIFEIDGLQTIKGLGGRERRSK  602

Query  451  SDEYLFDIGHNYSDCSINPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQ  272
              E   DI + Y D           SSE V E    IDA   GN+ RFINH C PNL+ Q
Sbjct  603  DGEIPEDILNKYDD----------QSSESVPEF--CIDAGSTGNIARFINHCCEPNLFVQ  650

Query  271  NVLYDYDDRKVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTG  92
             VL  +DD ++  +MLFA +NI PL+ELTY Y Y +D V DS G IK   C+CG+A+C  
Sbjct  651  CVLSTHDDLRLARVMLFAADNIPPLQELTYDYGYALDSVLDSDGKIKQMACYCGAADCRK  710

Query  91   RLY  83
            RL+
Sbjct  711  RLF  713



>gb|KHN46847.1| Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH4 
[Glycine soja]
Length=248

 Score =   188 bits (478),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 104/241 (43%), Positives = 137/241 (57%), Gaps = 34/241 (14%)
 Frame = -3

Query  733  CACAVRNGGELPY-NRNGA-IVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            CACA+RNG + PY +R+G  ++E K +V+ECGP C C P C NR SQ G++ +LE+F+T 
Sbjct  18   CACALRNGSDFPYVSRDGGRLIEAKDVVFECGPKCGCGPGCVNRTSQRGLRYRLEVFRTA  77

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSG---  389
             +GW VRS   IPSG  +CEY G +L   E    +  + Y+F+I     DC     G   
Sbjct  78   KKGWAVRSWDFIPSGAPVCEYTG-ILARAEDMDSVLENNYIFEI-----DCLQTIKGLGG  131

Query  388  -------------------QKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNV  266
                                +C  SE V E    IDA   GN+ RFINH C PNL+ Q V
Sbjct  132  RERRSQDGDIPANLLDKYHDQC--SESVPE--FCIDAGSTGNIARFINHCCEPNLFVQCV  187

Query  265  LYDYDDRKVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRL  86
            L  +DD ++  IMLFA +NI PL+ELTY Y Y +D V DS G IK   C+CG++ C  RL
Sbjct  188  LSTHDDLRLARIMLFAADNIPPLQELTYDYGYVLDSVLDSDGKIKQMPCYCGASVCRKRL  247

Query  85   Y  83
            +
Sbjct  248  F  248



>ref|XP_009355081.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH3-like [Pyrus x bretschneideri]
Length=689

 Score =   198 bits (503),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 101/224 (45%), Positives = 145/224 (65%), Gaps = 11/224 (5%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C+C  +NGG+ PY  NG +V  K L++ECGP C C P+C NRVSQ G+K++LE+FKT+ R
Sbjct  464  CSCIQKNGGDFPYTSNGILVSRKQLLHECGPTCPCTPNCKNRVSQTGVKLRLEVFKTKDR  523

Query  553  GWGVRSLTSIPSGTFICEYAGELLED---KEAERRIGSDEYLFDIGHNYSD--CSINPSG  389
            GWG+RS  SI +G FICEYAGE++++   K+ E    +DEY+FD G +Y     S  P G
Sbjct  524  GWGLRSWDSIRAGAFICEYAGEVIDEAKLKQKEEGGENDEYIFDTGRDYESFKWSYEP-G  582

Query  388  QKCTSSEQVEEVG----HTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
                S   VEE        I A   GNVGRFINHSCSPN++ Q V+Y+++++   HI  +
Sbjct  583  LIEESPNDVEEYNIPYRLIISAKNVGNVGRFINHSCSPNVFWQPVVYEHNNQSFVHIAFY  642

Query  220  AVENISPLRELTYHY-NYTVDQVRDSSGNIKVKQCFCGSAECTG  92
            A+ ++ P+ ELTY Y + + ++   +SG  +  +C CGS++C G
Sbjct  643  AIRHVPPMTELTYDYGSSSSNEAGSNSGPNRKNKCLCGSSKCRG  686



>ref|XP_008242105.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH3-like [Prunus mume]
Length=693

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/225 (44%), Positives = 143/225 (64%), Gaps = 11/225 (5%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C+C  +NGG  PY  NG +V  K L++ECGP C C P+C NRVSQ G+K++LE+FKT+ R
Sbjct  466  CSCIQKNGGSFPYTGNGILVSRKQLLHECGPTCPCSPNCKNRVSQTGVKLRLEVFKTKDR  525

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIG---SDEYLFDIGHNYSDCSIN--PSG  389
            GWG+RS  SI +GTFICEYAGE++++ + + +      DEY+FD G NY     N  P  
Sbjct  526  GWGLRSWDSIRAGTFICEYAGEVIDEVKLKHKGDEGEDDEYIFDTGRNYESFKWNYEPGL  585

Query  388  QKCTSSEQVE-----EVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIML  224
             +  +S  +           I A   GNV RFINHSCSPN++ Q VLY+++++   HI  
Sbjct  586  LEEETSNDINVDYNIPYRLIISAKNVGNVARFINHSCSPNVFWQPVLYEHNNQSCLHIAF  645

Query  223  FAVENISPLRELTYHY-NYTVDQVRDSSGNIKVKQCFCGSAECTG  92
            FA+ +I P+ ELTY Y N   ++  + +G+ + K+C CGS++C G
Sbjct  646  FAIRHIPPMTELTYDYGNSCSNEADNDNGSHQKKKCLCGSSKCRG  690



>ref|XP_008375400.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH1-like [Malus domestica]
Length=688

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/225 (43%), Positives = 141/225 (63%), Gaps = 13/225 (6%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C+C  +NGG+ PY  NG +V  K L++EC P C C P+C NRVSQ G+K++LE+FKT  R
Sbjct  463  CSCIQKNGGDFPYTSNGILVSRKQLLHECSPTCPCTPNCKNRVSQTGVKLRLEVFKTRDR  522

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIG---SDEYLFDIGHNYSDCSINPSGQK  383
            GWG+RS  SI +G FICEYAGE++++ + +++ G   +DEY+FD G +Y   S   S + 
Sbjct  523  GWGLRSWDSIRAGAFICEYAGEVIDEAKLKQKEGGGENDEYIFDTGRDYE--SFKWSYEP  580

Query  382  CTSSEQVEEVGH--------TIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIM  227
                E   +V           I A   GNVGRFINHSCSPN++ Q V+Y+++++   HI 
Sbjct  581  GLLEESPHDVNEDYNIPYRLIISAKNVGNVGRFINHSCSPNVFWQPVVYEHNNQSFVHIA  640

Query  226  LFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTG  92
             +A+ +I PL ELTY Y  +  +   +SG  +  +C CG ++C G
Sbjct  641  FYAIRHIPPLTELTYDYGTSSXEAGSNSGPNRKNKCLCGXSKCRG  685



>ref|XP_008245334.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH1-like [Prunus mume]
Length=704

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/225 (44%), Positives = 145/225 (64%), Gaps = 11/225 (5%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C+C  +NGG  PY  NG +V  K L++ECGP C C P+C NRVSQ G+K++LE+FKT+ R
Sbjct  477  CSCIQKNGGSFPYTGNGILVSRKQLLHECGPTCPCSPNCKNRVSQTGVKLRLEVFKTKDR  536

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGS---DEYLFDIGHNYSDCSIN--PSG  389
            GWG+RS  SI +G+FICEYAGE++++ + +++  +   DEY+FD G NY     N  P  
Sbjct  537  GWGLRSWDSIRAGSFICEYAGEVIDEVKLKQKGHAGEDDEYIFDTGRNYDSFKWNYEPGL  596

Query  388  QKCTSSEQVEEVGH-----TIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIML  224
             +  +S  + E  +      I A   GNV RFINHSCSPN++ Q VLY+++++   HI  
Sbjct  597  LEEETSNDINEDYNIPYRLIISAKNVGNVSRFINHSCSPNVFWQPVLYEHNNQSSLHIAF  656

Query  223  FAVENISPLRELTYHY-NYTVDQVRDSSGNIKVKQCFCGSAECTG  92
            FA+ +I P+ ELTY Y N +  +  + +G  +  +C CGS++C G
Sbjct  657  FAIRHIPPMTELTYDYGNSSSSEADNDNGPHRKNKCLCGSSKCRG  701



>ref|XP_008346233.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH1-like [Malus domestica]
 ref|XP_008346239.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH1-like [Malus domestica]
Length=689

 Score =   196 bits (498),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/224 (45%), Positives = 145/224 (65%), Gaps = 11/224 (5%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C+C  +NGG+ PY  NG +V  K L++ECGP C C P+C NRVSQ G+K++LE+FKT+ R
Sbjct  464  CSCIQKNGGDFPYTSNGILVSRKQLLHECGPTCPCTPNCKNRVSQTGVKLRLEVFKTKDR  523

Query  553  GWGVRSLTSIPSGTFICEYAGELLED---KEAERRIGSDEYLFDIGHNYSD--CSINPSG  389
            GWG+RS  SI +G FICEYAGE++++   K+ E    +DEY+FD G +Y     S  P G
Sbjct  524  GWGLRSWDSIRAGAFICEYAGEVIDEAKLKQKEDGGENDEYIFDTGRDYESFKWSYEP-G  582

Query  388  QKCTSSEQVEEVG----HTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
                S   VE+        I A   GNVGRFINHSCSPN++ Q V+Y+++++   HI  +
Sbjct  583  LIEESPNDVEDYNIPYRLIISAKNVGNVGRFINHSCSPNVFWQPVVYEHNNQSFVHIAFY  642

Query  220  AVENISPLRELTYHY-NYTVDQVRDSSGNIKVKQCFCGSAECTG  92
            A+ +I P+ ELTY Y + + ++   +SG  +  +C CGS++C G
Sbjct  643  AIGHIPPMTELTYDYGSSSSNEAGSNSGPNRKNKCLCGSSKCRG  686



>ref|XP_010249237.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4 isoform X2 [Nelumbo nucifera]
Length=708

 Score =   196 bits (498),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 104/235 (44%), Positives = 138/235 (59%), Gaps = 17/235 (7%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRN--GAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFK  566
            + CACA  NG + PY R   G ++E K +V+ECG  C C P C NR SQ G+K +LE+F+
Sbjct  475  KTCACARLNGSDFPYVRRDGGRLIEAKDVVFECGRKCGCGPGCVNRTSQRGLKYRLEVFR  534

Query  565  TESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG------------H  422
            T ++GW VRS  SIPSG  +CEY G L+   E E  +  + Y+F+I              
Sbjct  535  TPNKGWAVRSWDSIPSGAPVCEYTGILMRTDELEN-VSENNYIFEIDCLQTMKGLDGRER  593

Query  421  NYSDCSI-NPSGQKCTSSEQVEEVGHT-IDAAEYGNVGRFINHSCSPNLYAQNVLYDYDD  248
               D SI   +    T  +++E V    IDAA  GNV RFINHSC PNL+ Q VL  + D
Sbjct  594  RLRDVSIPTTTNLDRTDDKKLENVPEFCIDAASVGNVARFINHSCEPNLFVQCVLSSHHD  653

Query  247  RKVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             K+  +MLFA +NI PL+ELTY Y Y +D V  ++G IK   C+CG+ +C  RLY
Sbjct  654  IKLARVMLFAADNIPPLQELTYDYGYVLDSVMGANGEIKKMPCYCGAVDCRKRLY  708



>ref|XP_007220227.1| hypothetical protein PRUPE_ppa002185mg [Prunus persica]
 gb|EMJ21426.1| hypothetical protein PRUPE_ppa002185mg [Prunus persica]
Length=704

 Score =   196 bits (498),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 99/225 (44%), Positives = 144/225 (64%), Gaps = 11/225 (5%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C+C  +NGG  PY  NG +V  K L++ECGP C C P+C NRVSQ G+K++LE+FKT+ R
Sbjct  477  CSCIQKNGGSFPYTGNGILVSRKQLLHECGPTCPCSPNCKNRVSQTGVKLRLEVFKTKDR  536

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGS---DEYLFDIGHNYSDCSIN--PSG  389
            GWG+RS  SI +G+FICEYAGE++++ + +++  +   DEY+FD G NY     N  P  
Sbjct  537  GWGLRSWDSIRAGSFICEYAGEVIDEVKLKQKGHAGEDDEYIFDTGRNYDSFKWNYEPGL  596

Query  388  QKCTSSEQVEEVGH-----TIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIML  224
             +  +S  + E  +      I A   GNV RFINHSCSPN++ Q VLY+++++   HI  
Sbjct  597  LEEETSNDINEDYNIPYRLIISAKNVGNVSRFINHSCSPNVFWQPVLYEHNNQSSLHIAF  656

Query  223  FAVENISPLRELTYHY-NYTVDQVRDSSGNIKVKQCFCGSAECTG  92
            FA+ +I P+ ELTY Y N +  +  + +G     +C CGS++C G
Sbjct  657  FAIRHIPPMTELTYDYGNSSSSEADNDNGPHWKNKCLCGSSKCRG  701



>ref|XP_011628410.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4 [Amborella trichopoda]
Length=717

 Score =   195 bits (496),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 103/235 (44%), Positives = 142/235 (60%), Gaps = 17/235 (7%)
 Frame = -3

Query  739  QKCACAVRNGGELPY-NRNGA-IVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFK  566
            ++CACA  NG E PY ++NG  +V+ K ++YECGP+C C P C NR SQ G++ +LE+F+
Sbjct  484  RRCACARLNGSEFPYVSKNGGRLVQAKDVIYECGPNCGCGPDCVNRTSQRGLRYRLEVFR  543

Query  565  TESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG------------H  422
            T  +GW VRS  +IPSG  +CEY G L+   EA+     + ++FDI              
Sbjct  544  TPKKGWAVRSWDTIPSGAPVCEYTGLLMRTNEADNDT-ENNFIFDIDCLQTIKGIDGRQR  602

Query  421  NYSDCSI-NPSGQKCTSSEQVE-EVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDD  248
             + D SI NP+  +    +++E  V   IDA   G+V RFINHSC PNL+ Q VL  + D
Sbjct  603  RFGDVSIHNPANFEKIEDKKLEGSVEFCIDAGSCGSVARFINHSCEPNLFVQCVLSSHHD  662

Query  247  RKVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             K+  +MLFA +NI PL+EL+Y Y Y +D V    G IK   C+CGS+ C  RLY
Sbjct  663  MKLARVMLFASDNIPPLQELSYDYGYALDSVVGIDGKIKEMPCYCGSSGCRKRLY  717



>gb|KHN10157.1| Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1 
[Glycine soja]
Length=529

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/222 (45%), Positives = 140/222 (63%), Gaps = 9/222 (4%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C+C  RN G+ PY  NG +V  KPLV+ECGP CKC P+C NRVSQ G+K Q+E+FKT+ R
Sbjct  306  CSCIQRNEGDFPYTANGVLVSRKPLVHECGPLCKCSPNCKNRVSQTGLKHQMEVFKTKDR  365

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIG-SDEYLFDIGHNYSDCSIN--PS-GQ  386
            GWG+RSL  I +GTFICEYAGE+++  +  +  G  DEY+FD    Y     N  PS  +
Sbjct  366  GWGLRSLDPIRAGTFICEYAGEVIDVAKVNKNRGYDDEYVFDTSRIYDPFKWNYEPSLLE  425

Query  385  KCTSSEQVEEVG----HTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
            + +S+   E+        I + ++GNV R++NHSCSPN++ Q VLY  +++   HI  FA
Sbjct  426  EISSNVSCEDYDIPSPLIISSKKFGNVARYMNHSCSPNVFWQPVLYAENNQSFLHIAFFA  485

Query  217  VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTG  92
            + +I P+ ELTY Y  +      SS     K+C CGS++C G
Sbjct  486  LRHIPPMTELTYDYGCS-SHADHSSAPKGRKKCLCGSSKCRG  526



>ref|XP_008810792.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH1-like isoform X1 [Phoenix dactylifera]
 ref|XP_008810793.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH1-like isoform X1 [Phoenix dactylifera]
 ref|XP_008810795.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH1-like isoform X1 [Phoenix dactylifera]
Length=703

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/228 (43%), Positives = 139/228 (61%), Gaps = 16/228 (7%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C+C  +NG +LPY+  G +V  KPL+YECG  C+C  +C NRV+Q GI++  E+FKT  R
Sbjct  475  CSCLQQNGADLPYSSIGILVSRKPLIYECGASCQCSFNCRNRVTQKGIQLHFEVFKTRDR  534

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSIN--------  398
            GWG+RS   I +GTFICEY GE+++  +       DEY+F + H       N        
Sbjct  535  GWGLRSWDPIRAGTFICEYVGEVIDKCKVAETCEEDEYVFQVMHADQTFKWNYGPELLGE  594

Query  397  PSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
            PS     SSE  + +   I A   GNV RF+NHSCSPN++ Q VL+D+ D + PHIM FA
Sbjct  595  PS--HLDSSESSKTLPIIISAKNMGNVSRFMNHSCSPNVFWQPVLHDHGDDQYPHIMFFA  652

Query  217  VENISPLRELTYHY-----NYTVD-QVRDSSGNIKVKQCFCGSAECTG  92
             ++I P+ ELTY Y     +++ D ++R   G  + K+C CGS++CTG
Sbjct  653  SKHIPPMTELTYDYGLSGRDFSKDEEMRSGGGYRRTKKCLCGSSKCTG  700



>ref|XP_004970316.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH1-like [Setaria italica]
Length=737

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/221 (44%), Positives = 139/221 (63%), Gaps = 10/221 (5%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C+CA RNGG LPY  +G +V  KP+VYECG  C+C  +C N+V+Q G++I  E+FKT +R
Sbjct  517  CSCAQRNGGNLPYGSSGLLVCRKPMVYECGESCRCSFNCRNKVTQKGVRIHFEVFKTGNR  576

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDI---GHNYSDCSINPS--G  389
            GWG+RS   I +G+F+CEY GE ++D + +     D+Y+F     G      +  P   G
Sbjct  577  GWGLRSWDPIRAGSFLCEYVGEAIDDAKCDLNSHEDDYMFQTLCPGEKTLKWNYGPELIG  636

Query  388  QKCT--SSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
            ++ T  S++  E +   I A + GNV RF+NHSC+PN++ Q V +D++D   PHIM FA+
Sbjct  637  EQSTNISADTFEPLPLKISAKKMGNVSRFMNHSCAPNVFWQPVQFDHEDDHRPHIMFFAL  696

Query  214  ENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTG  92
            ++I P+ ELTY Y    D   DSSG  + K C CGS+ C G
Sbjct  697  KHIPPMTELTYDYG---DIGTDSSGVPRAKNCLCGSSNCRG  734



>gb|KHN09548.1| Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 
[Glycine soja]
Length=487

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/222 (45%), Positives = 137/222 (62%), Gaps = 32/222 (14%)
 Frame = -3

Query  736  KCACAVRNGGELPYN--RNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKT  563
            KC C ++NGG + Y+  +  A      L+YECGP CKC  SC NRVSQ+GI+ QLEIF T
Sbjct  283  KCVCIIKNGGIMAYDCKKRLASPMGSLLIYECGPSCKCSSSCINRVSQHGIQFQLEIFMT  342

Query  562  ESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIG-SDEYLFDIGHNYSDCSINPSGQ  386
            E +GWGVR+ + IPSG+F+CEY GE+ + +++   I   D+YLF  G             
Sbjct  343  ELKGWGVRTRSFIPSGSFVCEYIGEVRDSRQSGLSIDVDDDYLFHTG-------------  389

Query  385  KCTSSEQVEEVGHT-IDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVEN  209
                      VG   IDA + GN+GRFINHSCSPNL+ ++V+YD+DD+ +PH MLFA ++
Sbjct  390  ----------VGKGFIDATKCGNIGRFINHSCSPNLHVKDVMYDHDDKNLPHKMLFAAKD  439

Query  208  ISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            I   REL++ YN     + D S +     C+CGS EC G++Y
Sbjct  440  IPAGRELSFDYNSKGKFINDRSNS-----CYCGSQECNGQIY  476



>gb|KHN10323.1| Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1 
[Glycine soja]
Length=513

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/222 (46%), Positives = 137/222 (62%), Gaps = 9/222 (4%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C+C  RN G+ PY  NG +V  KPLV+ECGP CKC P+C NRVSQ G+K Q+E+FKT+ R
Sbjct  290  CSCIQRNEGDFPYTANGVLVSRKPLVHECGPLCKCFPNCKNRVSQTGLKHQMEVFKTKDR  349

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIG-SDEYLFDIGHNYSDCSIN--PSGQK  383
            GWG+RSL  I +GTFICEYAGE+++  +  +  G  DEY+FD    Y     N  PS  +
Sbjct  350  GWGLRSLDPIRAGTFICEYAGEVIDIAKVNKNRGYDDEYVFDTSRIYDTFKWNYEPSLLE  409

Query  382  CTSSEQVEE-----VGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
              SS    E         I + ++GNV R++NHSCSPN++ Q VLY  +++   HI  FA
Sbjct  410  EISSNVSSEDYDIPSPLIISSKKFGNVARYMNHSCSPNVFWQPVLYAENNQSFLHIAFFA  469

Query  217  VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTG  92
            + +I P+ ELTY Y  +      SS     K+C CGS++C G
Sbjct  470  LRHIPPMTELTYDYGCS-GHADGSSAPKGRKKCSCGSSKCRG  510



>ref|XP_010682641.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010682642.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4-like [Beta vulgaris subsp. vulgaris]
Length=877

 Score =   195 bits (495),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 137/233 (59%), Gaps = 17/233 (7%)
 Frame = -3

Query  733  CACAVRNGGELPYNRN--GAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            CACA  NG + PY R   G +VE K +V+ECGP+C C P C NRVSQ GIK +LE+++T 
Sbjct  646  CACAKLNGSDFPYVRRDGGRLVEAKDIVFECGPNCSCKPGCLNRVSQRGIKYRLEVYRTP  705

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDI----------GHNYSD  410
             +GW VRS   IPSG  +CEY G L    E +  I  +E++F+I          G     
Sbjct  706  DKGWAVRSWDFIPSGAPLCEYIGVLRRSDELDH-IAGNEFIFEIDCLHTINEIEGRERRF  764

Query  409  CSIN-PSGQKCTSSEQVEEVGHT---IDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRK  242
             ++N PS       ++    G     IDA   GNV RFINHSC PNL+ Q +L  + D +
Sbjct  765  GNVNVPSAIGLPKIDKKTLDGSPEFCIDAGSRGNVARFINHSCEPNLFVQCILSAHHDLR  824

Query  241  VPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            +  I+L A +NISP++ELTY Y Y +D V    GNIKV  CFCG+A+C  RLY
Sbjct  825  LARIVLIAADNISPMQELTYDYGYALDSVIGPDGNIKVLPCFCGTADCRKRLY  877



>ref|XP_003556861.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH5-like [Glycine max]
Length=552

 Score =   191 bits (486),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/222 (45%), Positives = 137/222 (62%), Gaps = 32/222 (14%)
 Frame = -3

Query  736  KCACAVRNGGELPYN--RNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKT  563
            KC C ++NGG + Y+  +  A      L+YECGP CKC  SC NRVSQ+GI+ QLEIF T
Sbjct  343  KCVCIIKNGGIMAYDCKKRLASPMGSLLIYECGPSCKCSSSCINRVSQHGIQFQLEIFMT  402

Query  562  ESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIG-SDEYLFDIGHNYSDCSINPSGQ  386
            E +GWGVR+ + IPSG+F+CEY GE+ + +++   I   D+YLF  G             
Sbjct  403  ELKGWGVRTRSFIPSGSFVCEYIGEVRDSRQSGLSIDVDDDYLFHTG-------------  449

Query  385  KCTSSEQVEEVGHT-IDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVEN  209
                      VG   IDA + GN+GRFINHSCSPNL+ ++V+YD+DD+ +PH MLFA ++
Sbjct  450  ----------VGKGFIDATKCGNIGRFINHSCSPNLHVKDVMYDHDDKNLPHKMLFAAKD  499

Query  208  ISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            I   REL++ YN     + D S +     C+CGS EC G++Y
Sbjct  500  IPAGRELSFDYNSKGKFINDRSNS-----CYCGSQECNGQIY  536



>ref|XP_007133570.1| hypothetical protein PHAVU_011G190200g [Phaseolus vulgaris]
 gb|ESW05564.1| hypothetical protein PHAVU_011G190200g [Phaseolus vulgaris]
Length=623

 Score =   192 bits (488),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 102/222 (46%), Positives = 142/222 (64%), Gaps = 9/222 (4%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C+C  RN G+ PY  NG +V  KPLV+ECGP CKC P+C NRVSQ G+K Q+E+FKTE+R
Sbjct  400  CSCIQRNEGDFPYIANGVLVSRKPLVHECGPMCKCFPNCKNRVSQAGLKHQMEVFKTENR  459

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIG-SDEYLFDIGHNYSDCSIN--PSGQK  383
            GWG+RS   I +GTFICEYAGE+++  +  ++ G +D+Y+FD    Y+    N  PS  +
Sbjct  460  GWGLRSFDPIRAGTFICEYAGEVIDRAKVYKKGGINDDYVFDTSRIYNPFKWNYEPSLLE  519

Query  382  CTSSEQVEE-----VGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
              SS    E        TI +  +GNV R++NHSCSPN++ Q VLY  +++   HI+ FA
Sbjct  520  EISSNVSTEDYTIPSPLTISSKNFGNVARYMNHSCSPNVFWQPVLYAENNQYFLHIVFFA  579

Query  217  VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTG  92
            + +I P+ ELTY Y  +      SS    +K+C CGS++C G
Sbjct  580  LGHIPPMTELTYDYGCS-GHGDGSSAPQGIKKCLCGSSKCRG  620



>ref|XP_004516550.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH1-like isoform X1 [Cicer arietinum]
Length=695

 Score =   193 bits (490),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 98/224 (44%), Positives = 135/224 (60%), Gaps = 10/224 (4%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C+C  RNGG+ PY  N  +V  KPL++ECGP C+C P+C NRVSQ GIK  +E+FKT++R
Sbjct  469  CSCIQRNGGDFPYAANSILVGRKPLIHECGPMCQCFPNCKNRVSQTGIKQHMEVFKTKNR  528

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRI--GSDEYLFDIGH-------NYSDCSI  401
            GWG+R+L  I +G+FICEYAGE+++  +  R      DEY+FD          NY    +
Sbjct  529  GWGLRTLDPIRAGSFICEYAGEVIDRAKLCRNTEGDRDEYVFDTSRIYEPFKWNYEPSLL  588

Query  400  NPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
                 K +S +        I A   GNV RF+NHSCSPN++ Q +LY  +++   HI+ F
Sbjct  589  EDISSKVSSEDYTIPSPLIISAKNVGNVARFMNHSCSPNVFWQPILYAENNQSFIHIVFF  648

Query  220  AVENISPLRELTYHYNYTVD-QVRDSSGNIKVKQCFCGSAECTG  92
            A+ +I P+ ELTY Y    D   + SS      +CFCGSA+C G
Sbjct  649  ALRHIPPMAELTYDYGIVPDGHAKGSSAPRGRNKCFCGSAKCRG  692



>ref|XP_002525581.1| histone-lysine n-methyltransferase, suvh, putative [Ricinus communis]
 gb|EEF36840.1| histone-lysine n-methyltransferase, suvh, putative [Ricinus communis]
Length=681

 Score =   192 bits (489),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 100/223 (45%), Positives = 136/223 (61%), Gaps = 9/223 (4%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C+C  +NGG+ PY  NG +V  +PLV+ECGP C C P+C NRVSQ G+K++LE+FKT+ R
Sbjct  456  CSCIRKNGGDFPYTANGVLVSRRPLVHECGPTCPCIPNCKNRVSQTGLKVRLEVFKTKDR  515

Query  553  GWGVRSLTSIPSGTFICEYAGELLED-KEAERRIGSDEYLFDIGHNYSDCSIN--PSGQK  383
            GWG+RS   I SGTFICEYAGE++E  K  +   G DEY+FD    Y     N  P   +
Sbjct  516  GWGLRSWDPIRSGTFICEYAGEVIEKVKGKQDGEGEDEYVFDTTRVYEPFKWNCEPGLVE  575

Query  382  CTSSEQVEEVG----HTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
               ++  EE        I A   GNV RF+NHSC+PN++ Q V Y+++     HI  FAV
Sbjct  576  EGDNDITEECNIPSPLIISARNVGNVARFMNHSCNPNVFWQPVAYEHNSESYVHIAFFAV  635

Query  214  ENISPLRELTYHYNYTVDQVRDSSGNIK--VKQCFCGSAECTG  92
             +I P+ ELTY Y  +     + + N++   K+C CGS +C G
Sbjct  636  RHIPPMTELTYDYGISRSDEAEGNNNVQHGRKKCLCGSQKCRG  678



>ref|XP_003546685.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH1-like isoform X1 [Glycine max]
 ref|XP_006598053.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH1-like isoform X2 [Glycine max]
 ref|XP_006598054.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH1-like isoform X3 [Glycine max]
Length=673

 Score =   192 bits (489),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 101/222 (45%), Positives = 140/222 (63%), Gaps = 9/222 (4%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C+C  RN G+ PY  NG +V  KPLV+ECGP CKC P+C NRVSQ G+K Q+E+FKT+ R
Sbjct  450  CSCIQRNEGDFPYTANGVLVSRKPLVHECGPLCKCSPNCKNRVSQTGLKHQMEVFKTKDR  509

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIG-SDEYLFDIGHNYSDCSIN--PS-GQ  386
            GWG+RSL  I +GTFICEYAGE+++  +  +  G  DEY+FD    Y     N  PS  +
Sbjct  510  GWGLRSLDPIRAGTFICEYAGEVIDVAKVNKNRGYDDEYVFDTSRIYDPFKWNYEPSLLE  569

Query  385  KCTSSEQVEEVG----HTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
            + +S+   E+        I + ++GNV R++NHSCSPN++ Q VLY  +++   HI  FA
Sbjct  570  EISSNVSCEDYDIPSPLIISSKKFGNVARYMNHSCSPNVFWQPVLYAENNQSFLHIAFFA  629

Query  217  VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTG  92
            + +I P+ ELTY Y  +      SS     K+C CGS++C G
Sbjct  630  LRHIPPMTELTYDYGCS-SHADHSSAPKGRKKCLCGSSKCRG  670



>ref|XP_006287619.1| hypothetical protein CARUB_v10000831mg [Capsella rubella]
 gb|EOA20517.1| hypothetical protein CARUB_v10000831mg [Capsella rubella]
Length=487

 Score =   189 bits (481),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 95/233 (41%), Positives = 134/233 (58%), Gaps = 17/233 (7%)
 Frame = -3

Query  739  QKCACAVRNGGELPYN--RNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFK  566
            +KCACA  NGG  PY    +G ++E + +V+ECGPHC C P+C NR SQ  ++  LE+F+
Sbjct  258  KKCACAKLNGGNFPYVDLNDGRLIESRDVVFECGPHCGCGPACVNRTSQKRLRFHLEVFR  317

Query  565  TESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG------------H  422
            +  +GW VRS   IP+G+ +CEY G L    + +  I  ++Y+F+I              
Sbjct  318  SAKKGWAVRSWDYIPAGSPVCEYIGVLRRTADVDT-ISDNDYIFEIDCQQTMQGLDGRQR  376

Query  421  NYSDCSINPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRK  242
               D ++     + +  E V E    IDA   GN  RFINHSC PNL+ Q VL  + D +
Sbjct  377  RLRDVALPTRVSQSSEDENVPEF--CIDAGSKGNFARFINHSCEPNLFVQCVLSSHQDLR  434

Query  241  VPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            +  ++LFA +NI PL+ELTY Y YT+D V    GN+K   C+CG+  C  RLY
Sbjct  435  LARVVLFAADNIPPLQELTYDYGYTLDSVHGPDGNVKKLTCYCGALNCRKRLY  487



>ref|XP_011098970.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4 [Sesamum indicum]
Length=640

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/233 (44%), Positives = 132/233 (57%), Gaps = 16/233 (7%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRN--GAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFK  566
            + CACA  NGG+ PY +   G +VE K +V+ECGP+C C P C NR SQ G + +LE+F+
Sbjct  410  RSCACAKLNGGDFPYVQRDGGRLVEPKAVVFECGPNCGCGPKCVNRTSQRGPRYRLEVFR  469

Query  565  TESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG------------H  422
            T  +GWGVRS   IPSG  +CEY G LL+  E       + Y+FDI              
Sbjct  470  TPKKGWGVRSWDYIPSGAPVCEYIG-LLKRTEDLDPAADNTYVFDIDCLQTMKGLDGRES  528

Query  421  NYSDCSINPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRK  242
               D S+ PS       E  E V   IDA   GN+ RFINHSC PNL+ Q +L  + D K
Sbjct  529  RLRDVSL-PSYLHKVDEEVSESVPFCIDAGHTGNIARFINHSCQPNLFVQCMLSSHHDIK  587

Query  241  VPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            +  ++L A +NI PL+ELTY Y Y +D V    G I+   CFCG+ EC  RLY
Sbjct  588  LARVILVAADNIPPLKELTYDYGYALDSVMGPDGKIRQMACFCGAQECRKRLY  640



>ref|XP_002273935.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH1 [Vitis vinifera]
 ref|XP_010659032.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH1 [Vitis vinifera]
Length=716

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/234 (45%), Positives = 144/234 (62%), Gaps = 26/234 (11%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C+C  +NGG+ PY  NG +V  +PLV+ECGP C C P+C NR+SQ G+K++LE+FKT +R
Sbjct  486  CSCIRKNGGDFPYTSNGILVARRPLVHECGPTCPCIPNCKNRMSQTGLKVRLEVFKTNNR  545

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEA--ERRIG-SDEYLFDIGHNYSDC--------  407
            GWG+RS   I +GTFICEYAGE+L+  +   ER  G S+EYLFD  H Y +         
Sbjct  546  GWGLRSWDPIRTGTFICEYAGEVLDKVKVYQERDEGESNEYLFDTTHVYDNAFKWNHEPG  605

Query  406  --SINPSGQKCTSSEQVEEVGHTIDAAEY-GNVGRFINHSCSPNLYAQNVLYDYDDRKVP  236
                 PS +    +E  +     I +A+Y GNV RF+NHSCSPN++ Q VLY++++    
Sbjct  606  LLDEEPSAE---PNEYYDIPSPLIISAKYVGNVARFMNHSCSPNVFWQPVLYEHNNESFL  662

Query  235  HIMLFAVENISPLRELTYHY------NYTVDQVRDSSGNIKVKQCFCGSAECTG  92
            HI  FA+++I P+ ELTY Y      NY V      +G    K+C CGS+ C G
Sbjct  663  HIAFFAIKHIPPMTELTYDYGMLQSENYEVQSNHTPNGK---KKCLCGSSNCRG  713



>gb|KEH22454.1| histone-lysine N-methyltransferase, suvh protein [Medicago truncatula]
Length=505

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/218 (44%), Positives = 135/218 (62%), Gaps = 34/218 (16%)
 Frame = -3

Query  736  KCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTES  557
            KC+CA+++GG++                              RV +N IK +L+IFKT++
Sbjct  322  KCSCALKSGGKI-----------------------------TRVKKNEIKFKLQIFKTKA  352

Query  556  RGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQKCT  377
            +GWGVRS  +IPSG FICEY GE++ED+EA + +  D+         S   +  SG K  
Sbjct  353  KGWGVRSENAIPSGNFICEYIGEIIEDEEALKIVDDDDKEMS-----SYQPVEASGSKEV  407

Query  376  SSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENISPL  197
              ++ +     IDAA+YGNVGRFINHSCSPNL+A+NVLYD D  ++P IML+A ENI  +
Sbjct  408  IDDRCDSGRFNIDAAKYGNVGRFINHSCSPNLFARNVLYDDDVPRIPQIMLYAAENIPSM  467

Query  196  RELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            +ELT  YNY ++QV DS+GN+K K C+C ++ C  RLY
Sbjct  468  KELTLDYNYKINQVTDSNGNLKTKVCYCEASACIHRLY  505



>ref|XP_003542785.2| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH1-like isoform X1 [Glycine max]
 ref|XP_006594345.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH1-like isoform X2 [Glycine max]
 ref|XP_006594346.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH1-like isoform X3 [Glycine max]
Length=673

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/222 (46%), Positives = 137/222 (62%), Gaps = 9/222 (4%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C+C  RN G+ PY  NG +V  KPLV+ECGP CKC P+C NRVSQ G+K Q+E+FKT+ R
Sbjct  450  CSCIQRNEGDFPYTANGVLVSRKPLVHECGPLCKCFPNCKNRVSQTGLKHQMEVFKTKDR  509

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIG-SDEYLFDIGHNYSDCSIN--PSGQK  383
            GWG+RSL  I +GTFICEYAGE+++  +  +  G  DEY+FD    Y     N  PS  +
Sbjct  510  GWGLRSLDPIRAGTFICEYAGEVIDIAKVNKNRGYDDEYVFDTSRIYDTFKWNYEPSLLE  569

Query  382  CTSSEQVEE-----VGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFA  218
              SS    E         I + ++GNV R++NHSCSPN++ Q VLY  +++   HI  FA
Sbjct  570  EISSNVSSEDYDIPSPLIISSKKFGNVARYMNHSCSPNVFWQPVLYAENNQSFLHIAFFA  629

Query  217  VENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTG  92
            + +I P+ ELTY Y  +      SS     K+C CGS++C G
Sbjct  630  LRHIPPMTELTYDYGCS-GHADGSSAPKGRKKCSCGSSKCRG  670



>ref|XP_006594267.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4-like [Glycine max]
 gb|KHN47143.1| Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH4 
[Glycine soja]
Length=676

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 104/239 (44%), Positives = 140/239 (59%), Gaps = 30/239 (13%)
 Frame = -3

Query  733  CACAVRNGGELPY-NRNGA-IVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            CACA+RNG + PY +R+G  +VE K +V+ECGP C C P C NR SQ G++ +LE+F+T 
Sbjct  446  CACALRNGSDFPYVSRDGGRLVEAKDVVFECGPKCGCDPGCVNRTSQKGLRYRLEVFRTA  505

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSI-------  401
            ++GW VRS   IPSG  +CEY G +L   +   R+  + Y+F+I     DC +       
Sbjct  506  NKGWAVRSWDFIPSGAPVCEYTG-ILSRTDDMDRVLENNYIFEI-----DCLLTMKGLGG  559

Query  400  ----NPSGQKCT---------SSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLY  260
                +P G+            SSE   E    IDA   GNV RFINH C PNL+ Q VL 
Sbjct  560  REKRSPKGEISANLLDKYDDQSSESAPEF--CIDAGSTGNVARFINHCCEPNLFVQCVLS  617

Query  259  DYDDRKVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             + D ++  +MLFA +NI PL+ELTY Y Y +D V DS G IK   C+CG++ C  RL+
Sbjct  618  THHDLRLARVMLFAADNIPPLQELTYDYGYELDSVLDSDGKIKQMPCYCGASYCRKRLF  676



>ref|XP_010067647.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH1-like [Eucalyptus grandis]
 ref|XP_010067648.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH1-like [Eucalyptus grandis]
 gb|KCW65826.1| hypothetical protein EUGRSUZ_G03176 [Eucalyptus grandis]
Length=680

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/222 (42%), Positives = 139/222 (63%), Gaps = 11/222 (5%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            CAC  +N G+LPY  +G +V  KPLVYECGP C C P+C  RVS++G+K++LE+FKT+ R
Sbjct  454  CACIRKNSGDLPYTTSGVLVSRKPLVYECGPSCPCGPNCKIRVSRSGLKVRLEVFKTKDR  513

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRI---GSDEYLFD-------IGHNYSDCS  404
            GWG+RS   I +G FICEYAGE+++    ++++    +DEY+FD          NY    
Sbjct  514  GWGLRSYDPIRAGAFICEYAGEVIDKDRLKKKLQEGDNDEYIFDSSRSYEPFKWNYEPGL  573

Query  403  INPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIML  224
            +   G    S +        + A ++GNV RF+NHSC+PN++ Q V+Y+ ++    HI  
Sbjct  574  LGEEGTNGASEDPDIPSPVIMTAKDFGNVARFMNHSCNPNVFWQPVIYEENNESFVHIAF  633

Query  223  FAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAEC  98
            FAV +I  + ELTY Y  T+ Q  D+  N++ K+C CG++EC
Sbjct  634  FAVRHIPLMTELTYDYG-TLPQEGDNGFNLRKKKCLCGTSEC  674



>ref|XP_009413964.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH1-like isoform X2 [Musa acuminata subsp. malaccensis]
Length=717

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 133/226 (59%), Gaps = 12/226 (5%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C CA +N G+LPYN  G +V  KPL+YEC   C+C  +C NRV+Q GI++  E+F+T+ R
Sbjct  489  CFCAQQNDGDLPYNSMGLLVRRKPLIYECSVSCQCSFNCRNRVTQKGIRLHFEVFRTKDR  548

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFD---IGHNYSDCSINP----  395
            GWG+RS   I +GTFICEYAGE++     E     DEY+F    +G   S  +  P    
Sbjct  549  GWGLRSWDPIRAGTFICEYAGEVISKTRVEDDGEEDEYIFQATYLGEKASRWNCGPELLE  608

Query  394  SGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
                  S+E       TI A   GN+ RF+NHSCSPN++ Q VLYD+ D   PHIM FA+
Sbjct  609  DPDINNSNEVFRPFPITISAKNSGNIARFMNHSCSPNVFWQPVLYDHGDEDYPHIMFFAI  668

Query  214  ENISPLRELTYHYNYTVD---QVRDSSGNI--KVKQCFCGSAECTG  92
            ++I P+ ELTY Y    D   Q +  +G I  + K+C CGS  C G
Sbjct  669  KHIPPMTELTYDYGLHGDEAGQQKIGTGFISQRAKKCLCGSPNCQG  714



>ref|XP_009413963.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH1-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=779

 Score =   191 bits (486),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 133/226 (59%), Gaps = 12/226 (5%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C CA +N G+LPYN  G +V  KPL+YEC   C+C  +C NRV+Q GI++  E+F+T+ R
Sbjct  551  CFCAQQNDGDLPYNSMGLLVRRKPLIYECSVSCQCSFNCRNRVTQKGIRLHFEVFRTKDR  610

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFD---IGHNYSDCSINP----  395
            GWG+RS   I +GTFICEYAGE++     E     DEY+F    +G   S  +  P    
Sbjct  611  GWGLRSWDPIRAGTFICEYAGEVISKTRVEDDGEEDEYIFQATYLGEKASRWNCGPELLE  670

Query  394  SGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAV  215
                  S+E       TI A   GN+ RF+NHSCSPN++ Q VLYD+ D   PHIM FA+
Sbjct  671  DPDINNSNEVFRPFPITISAKNSGNIARFMNHSCSPNVFWQPVLYDHGDEDYPHIMFFAI  730

Query  214  ENISPLRELTYHYNYTVD---QVRDSSGNI--KVKQCFCGSAECTG  92
            ++I P+ ELTY Y    D   Q +  +G I  + K+C CGS  C G
Sbjct  731  KHIPPMTELTYDYGLHGDEAGQQKIGTGFISQRAKKCLCGSPNCQG  776



>ref|XP_012068760.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH3-like [Jatropha curcas]
 ref|XP_012068761.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH3-like [Jatropha curcas]
 ref|XP_012068762.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH3-like [Jatropha curcas]
 gb|KDP40602.1| hypothetical protein JCGZ_24601 [Jatropha curcas]
Length=673

 Score =   191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/224 (45%), Positives = 134/224 (60%), Gaps = 11/224 (5%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C+C  +NGG+ PY  NG +V  +PL++ECGP C C P+C NRVSQ G+KI+LE+FKT+ +
Sbjct  448  CSCIRKNGGDFPYTANGVLVNRRPLIHECGPTCPCIPNCKNRVSQTGLKIRLEVFKTKDK  507

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRIG---SDEYLFDIGHNYSDCSIN--PSG  389
            GWG+RS   I SGTFICEYAGE++E K   R+ G    D+Y+FD    Y     N  P  
Sbjct  508  GWGLRSWDPIRSGTFICEYAGEVIE-KVKSRQDGEGEDDDYVFDTTRVYEPFKWNCEPGL  566

Query  388  QKCTSSEQVEEVG----HTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLF  221
             +   ++  EE        I A   GNV RF+NHSCSPN++ Q V Y+++     HI  F
Sbjct  567  IEEDGNDTTEEYNIPSPLIISAKNVGNVARFMNHSCSPNVFWQPVAYEHNSESYVHIAFF  626

Query  220  AVENISPLRELTYHYNYTVDQVRDSSGNIK-VKQCFCGSAECTG  92
            A+ +I P+ ELTY Y  +     D SG     K+C CGS  C G
Sbjct  627  ALRHIPPMTELTYDYGTSRSDEADGSGTPHGKKKCLCGSPRCRG  670



>emb|CBI29255.3| unnamed protein product [Vitis vinifera]
Length=485

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/234 (44%), Positives = 140/234 (60%), Gaps = 23/234 (10%)
 Frame = -3

Query  733  CACAVRNGGELPY---NRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKT  563
            C+CA RNG   PY   N N  + E K +V+ECGP+C C P+C NR SQ GIK  LE+F+T
Sbjct  258  CSCAERNGSSFPYVLENGNRLLFEPKDVVFECGPNCGCGPNCLNRTSQQGIKYHLEVFRT  317

Query  562  ESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDC--SINPSG  389
            + +GWGVR+L  IPSG+ +CEY GEL   K+      +D Y+F+I     DC  +++  G
Sbjct  318  KEKGWGVRTLDFIPSGSPVCEYIGELKRTKDINDVFDND-YIFEI-----DCWQTMHGIG  371

Query  388  QKCTSSEQVEEVGHT------------IDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDR  245
             +    + V+   H             IDA + G+V RF+NHSC PNL+ Q VL  + D 
Sbjct  372  GREKRLKDVQIPVHNNVDNIDDMPEYCIDARKTGSVSRFVNHSCEPNLFVQCVLSSHHDL  431

Query  244  KVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            ++  ++LFA ENI+P +ELTY Y Y +D V    GNIK   C CG+A C+ RLY
Sbjct  432  ELAQVVLFAAENITPSQELTYDYGYILDGVVGPDGNIKELACRCGAASCSKRLY  485



>ref|XP_011024754.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4-like [Populus euphratica]
Length=686

 Score =   191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 102/234 (44%), Positives = 134/234 (57%), Gaps = 20/234 (9%)
 Frame = -3

Query  733  CACAVRNGGELPYNR--NGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            CACA  NG + PY +   G ++E + +V+ECGP C C P C NR SQ GIK +LE+F+T 
Sbjct  456  CACAKLNGSDFPYVQINGGRLIEARAVVFECGPSCGCGPGCVNRTSQRGIKHRLEVFRTP  515

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG------------HNY  416
             +GW VRS   IPSG  +CEY G L+  ++ +  +  + Y+FDI                
Sbjct  516  KKGWAVRSWDFIPSGAPVCEYIGALVRTEDTDH-VCENNYIFDIDCLQTMRGLGGRERRL  574

Query  415  SDCS---INPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDR  245
             D S   IN        SE V E    IDA   GN+ RFINHSC PNL+ Q VL  + D 
Sbjct  575  GDVSVPGINNFDGDDQKSESVPEF--CIDAVSTGNIARFINHSCEPNLFVQCVLSSHHDV  632

Query  244  KVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            K+  +MLFA +NI P++ELTY Y Y +D V   SG IK   C+CG+A+C  RL+
Sbjct  633  KLARVMLFAADNIPPMQELTYDYGYALDSVSGPSGKIKQMPCYCGAADCRKRLF  686



>ref|XP_010492182.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4-like [Camelina sativa]
 ref|XP_010492183.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4-like [Camelina sativa]
 ref|XP_010492184.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4-like [Camelina sativa]
Length=629

 Score =   190 bits (483),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/234 (41%), Positives = 136/234 (58%), Gaps = 17/234 (7%)
 Frame = -3

Query  739  QKCACAVRNGGELPYN--RNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFK  566
            +KCACA  NGG  PY    +G ++E + +V+ECGPHC C P C NR SQ  ++  LE+F+
Sbjct  398  KKCACAKLNGGNFPYVALNDGRLIEPRDVVFECGPHCGCGPECVNRTSQKRLRFNLEVFR  457

Query  565  TESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG------------H  422
            +  +GW VRS   IP+G+ +CEY G L    + +  I  ++Y+F+I              
Sbjct  458  SAKKGWAVRSWDYIPAGSPVCEYIGVLRRTADVDT-ISDNDYIFEIDCQQTMQGLDGRQR  516

Query  421  NYSDCSINPSGQKCTSSEQVEEVGHT-IDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDR  245
               D ++ P+    + S + E V    IDA   GNV RFINHSC PNL+ Q VL  + D 
Sbjct  517  RLRDVAV-PTNDGVSQSSEDENVPEFCIDAGPKGNVARFINHSCEPNLFVQCVLSSHQDL  575

Query  244  KVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            ++  ++LFA +NI PL+ELTY Y YT+D V    GN+K   C+CG+  C  RLY
Sbjct  576  RLARVVLFAADNIPPLQELTYDYGYTLDSVHGPDGNVKKLTCYCGALNCRKRLY  629



>ref|XP_006598996.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4-like isoform X2 [Glycine max]
Length=716

 Score =   191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 138/232 (59%), Gaps = 20/232 (9%)
 Frame = -3

Query  733  CACAVRNGGELPY-NRNGA-IVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            CACA+RNG + PY +R+G  ++E K +V+ECGP C C P C NR SQ G++ +LE+F+T 
Sbjct  490  CACALRNGSDFPYVSRDGGRLIEAKDVVFECGPKCGCGPGCVNRTSQRGLRYRLEVFRTA  549

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDI----------GHNYSD  410
             +GW VRS   IPSG  +CEY G +L   E    +  + Y+F+I          G    +
Sbjct  550  KKGWAVRSWDFIPSGAPVCEYTG-ILARAEDMDSVLENNYIFEIDCLQTIKGLGGREDGE  608

Query  409  CSINPSGQ---KCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKV  239
               N   +   +C  SE V E    IDA   GN+ RFINH C PNL+ Q VL  +DD ++
Sbjct  609  IPANLLDKYHDQC--SESVPEF--CIDAGSTGNIARFINHCCEPNLFVQCVLSTHDDLRL  664

Query  238  PHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
              IMLFA +NI PL+ELTY Y Y +D V DS G IK   C+CG++ C  RL+
Sbjct  665  ARIMLFAADNIPPLQELTYDYGYVLDSVLDSDGKIKQMPCYCGASVCRKRLF  716



>ref|XP_004516520.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH1-like isoform X1 [Cicer arietinum]
Length=665

 Score =   191 bits (484),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/225 (44%), Positives = 138/225 (61%), Gaps = 11/225 (5%)
 Frame = -3

Query  733  CACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTESR  554
            C+C  RN G+ PY  NG +V  KPLV+ECGP C+C P+C NRVSQ G+K Q+E+FKT  R
Sbjct  438  CSCIRRNEGDYPYTSNGVLVNRKPLVHECGPTCQCFPNCRNRVSQTGLKHQMEVFKTNDR  497

Query  553  GWGVRSLTSIPSGTFICEYAGELLEDKEAERRI---GSDEYLFDIGHNYSDCSIN--PSG  389
            GWG+RS   I SG FICEYAGE+++     + +    +DEY+FD    Y     N  P  
Sbjct  498  GWGLRSWDPIRSGAFICEYAGEVIDKARLSQLVKEGDTDEYVFDTTRVYESFKWNYQPKL  557

Query  388  QKCTSSEQVEE---VGH--TIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIML  224
             +  S+ +  E   + H   I+A   GNV RF+NHSC PN++ Q VLY+ +++   H+  
Sbjct  558  LEEVSTNESSEDYALPHPLIINAKNVGNVARFMNHSCFPNVFWQPVLYEENNQSFLHVAF  617

Query  223  FAVENISPLRELTYHY-NYTVDQVRDSSGNIKVKQCFCGSAECTG  92
            FA+ +I P++ELTY Y +   D    SS +   K+C CGS++C G
Sbjct  618  FALRHIPPMQELTYDYGSERSDHTEGSSAHKGRKKCMCGSSQCRG  662



>ref|XP_006399899.1| hypothetical protein EUTSA_v10012985mg [Eutrema salsugineum]
 gb|ESQ41352.1| hypothetical protein EUTSA_v10012985mg [Eutrema salsugineum]
Length=616

 Score =   190 bits (482),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 98/233 (42%), Positives = 136/233 (58%), Gaps = 17/233 (7%)
 Frame = -3

Query  736  KCACAVRNGGELPYN--RNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKT  563
            KCACA  NGG  PY    NG ++E + +V+ECGP C C P C NR SQ  +K QLE+F++
Sbjct  386  KCACARLNGGNFPYVDLNNGRLIEPRDVVFECGPSCGCGPECVNRTSQKRLKFQLEVFRS  445

Query  562  ESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG------------HN  419
              +GW VRS   IP+G+ +CEY G L    + +  +  ++Y+F+I               
Sbjct  446  PKKGWAVRSWDFIPAGSPVCEYIGVLRRTDDVDT-LSDNDYIFEIDCQQTMQGLDGRQRR  504

Query  418  YSDCSINPSGQKCTSSEQVEEVGHT-IDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRK  242
              D ++ P+  K + S + E V    IDA   GNV RFINHSC PNL+ Q VL  + D +
Sbjct  505  LRDVAV-PTDIKVSQSNEDENVPEFCIDAGPTGNVARFINHSCEPNLFVQCVLSSHQDIR  563

Query  241  VPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            +  ++LFA +NI PL+ELTY Y YT+D V    G +K   C+CG+ +C  RLY
Sbjct  564  LARVVLFAADNIPPLQELTYDYGYTLDSVHGPDGKVKQLTCYCGAIKCRKRLY  616



>ref|XP_010249238.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4 isoform X3 [Nelumbo nucifera]
Length=681

 Score =   191 bits (484),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 104/238 (44%), Positives = 138/238 (58%), Gaps = 20/238 (8%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRN--GAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFK  566
            + CACA  NG + PY R   G ++E K +V+ECG  C C P C NR SQ G+K +LE+F+
Sbjct  445  KTCACARLNGSDFPYVRRDGGRLIEAKDVVFECGRKCGCGPGCVNRTSQRGLKYRLEVFR  504

Query  565  TESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG------------H  422
            T ++GW VRS  SIPSG  +CEY G L+   E E  +  + Y+F+I              
Sbjct  505  TPNKGWAVRSWDSIPSGAPVCEYTGILMRTDELE-NVSENNYIFEIDCLQTMKGLDGRER  563

Query  421  NYSDCSI-NPSGQKCTSSEQVEEVGHT-IDAAEYGNVGRFINHSCSPNLYAQNVLYDYDD  248
               D SI   +    T  +++E V    IDAA  GNV RFINHSC PNL+ Q VL  + D
Sbjct  564  RLRDVSIPTTTNLDRTDDKKLENVPEFCIDAASVGNVARFINHSCEPNLFVQCVLSSHHD  623

Query  247  RKVPHIMLFAVENISPL---RELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             K+  +MLFA +NI PL   +ELTY Y Y +D V  ++G IK   C+CG+ +C  RLY
Sbjct  624  IKLARVMLFAADNIPPLQVRQELTYDYGYVLDSVMGANGEIKKMPCYCGAVDCRKRLY  681



>ref|XP_010249235.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4 isoform X1 [Nelumbo nucifera]
 ref|XP_010249236.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4 isoform X1 [Nelumbo nucifera]
Length=711

 Score =   191 bits (484),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 104/238 (44%), Positives = 138/238 (58%), Gaps = 20/238 (8%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRN--GAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFK  566
            + CACA  NG + PY R   G ++E K +V+ECG  C C P C NR SQ G+K +LE+F+
Sbjct  475  KTCACARLNGSDFPYVRRDGGRLIEAKDVVFECGRKCGCGPGCVNRTSQRGLKYRLEVFR  534

Query  565  TESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG------------H  422
            T ++GW VRS  SIPSG  +CEY G L+   E E  +  + Y+F+I              
Sbjct  535  TPNKGWAVRSWDSIPSGAPVCEYTGILMRTDELE-NVSENNYIFEIDCLQTMKGLDGRER  593

Query  421  NYSDCSI-NPSGQKCTSSEQVEEVGHT-IDAAEYGNVGRFINHSCSPNLYAQNVLYDYDD  248
               D SI   +    T  +++E V    IDAA  GNV RFINHSC PNL+ Q VL  + D
Sbjct  594  RLRDVSIPTTTNLDRTDDKKLENVPEFCIDAASVGNVARFINHSCEPNLFVQCVLSSHHD  653

Query  247  RKVPHIMLFAVENISPL---RELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             K+  +MLFA +NI PL   +ELTY Y Y +D V  ++G IK   C+CG+ +C  RLY
Sbjct  654  IKLARVMLFAADNIPPLQVRQELTYDYGYVLDSVMGANGEIKKMPCYCGAVDCRKRLY  711



>ref|XP_006373665.1| hypothetical protein POPTR_0016s02600g [Populus trichocarpa]
 ref|XP_002323201.2| hypothetical protein POPTR_0016s02600g [Populus trichocarpa]
 gb|ERP51462.1| hypothetical protein POPTR_0016s02600g [Populus trichocarpa]
 gb|EEF04962.2| hypothetical protein POPTR_0016s02600g [Populus trichocarpa]
Length=626

 Score =   190 bits (482),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/221 (43%), Positives = 130/221 (59%), Gaps = 9/221 (4%)
 Frame = -3

Query  739  QKCACAVRNGGELPYNRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            + C C  +NGG LP+  NG IV  K ++YECGP C+CPP+C NRVSQ G++++LE+FKT+
Sbjct  413  ENCDCVQKNGGYLPHIVNGVIVSQKSVIYECGPPCRCPPTCRNRVSQGGLRVRLEVFKTK  472

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIG--SDEYLFDIGHNYSDCSINPSGQ  386
             RGWG+RS   I +G FIC YAGE ++D EA+   G   D+++FD    Y    + P   
Sbjct  473  DRGWGLRSWDPIRAGAFICVYAGEAVDDSEAQELAGENEDDHIFDGTRIYQPVEVLPGDL  532

Query  385  KCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVPHIMLFAVENI  206
                + Q   +   I+A   GNV RFINHSCSPNL+ Q VL         HI  +A+ ++
Sbjct  533  NNAPNLQFPLI---INARNAGNVARFINHSCSPNLFWQPVLRGNSKEFDLHIAFYAIRHV  589

Query  205  SPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             P+ ELTY Y     +  D       K+CFCGS +C G  Y
Sbjct  590  PPMTELTYSYGMVPPEKADRGK----KKCFCGSPKCRGFFY  626



>ref|XP_010420016.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4-like [Camelina sativa]
Length=637

 Score =   190 bits (482),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 98/234 (42%), Positives = 135/234 (58%), Gaps = 17/234 (7%)
 Frame = -3

Query  739  QKCACAVRNGGELPYN--RNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFK  566
            +KCACA  NGG  PY    +G ++E + +V+ECGPHC C P C NR SQ  ++  LE+F 
Sbjct  406  KKCACAKLNGGNFPYVALNDGRLIEPRDVVFECGPHCGCGPECVNRTSQKRLRFHLEVFC  465

Query  565  TESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG------------H  422
            +  +GW VRS   IP+G+ +CEY G L    + +  I  ++Y+F+I              
Sbjct  466  SAKKGWAVRSWDYIPAGSPVCEYIGVLRRTADVDT-ISDNDYIFEIDCQQTMQGLDGRQR  524

Query  421  NYSDCSINPSGQKCTSSEQVEEVGHT-IDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDR  245
               D ++ P+  K + S + E V    IDA   GNV RFINHSC PNL+ Q VL  + D 
Sbjct  525  RLRDVAV-PTNDKVSQSSEDENVPEFCIDAGSKGNVARFINHSCEPNLFVQCVLSSHQDL  583

Query  244  KVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             +  ++LFA +NI PL+ELTY Y YT+D V    GN+K   C+CG+  C  RLY
Sbjct  584  SLARVVLFAADNIPPLQELTYDYGYTLDSVHGPDGNVKKLTCYCGALNCRKRLY  637



>ref|XP_003548493.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4-like isoform X1 [Glycine max]
Length=720

 Score =   190 bits (483),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 102/237 (43%), Positives = 138/237 (58%), Gaps = 26/237 (11%)
 Frame = -3

Query  733  CACAVRNGGELPY-NRNGA-IVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            CACA+RNG + PY +R+G  ++E K +V+ECGP C C P C NR SQ G++ +LE+F+T 
Sbjct  490  CACALRNGSDFPYVSRDGGRLIEAKDVVFECGPKCGCGPGCVNRTSQRGLRYRLEVFRTA  549

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDC--SINPSGQ  386
             +GW VRS   IPSG  +CEY G +L   E    +  + Y+F+I     DC  +I   G 
Sbjct  550  KKGWAVRSWDFIPSGAPVCEYTG-ILARAEDMDSVLENNYIFEI-----DCLQTIKGLGG  603

Query  385  KCTSSEQVEEVGHT----------------IDAAEYGNVGRFINHSCSPNLYAQNVLYDY  254
            +   S+  E   +                 IDA   GN+ RFINH C PNL+ Q VL  +
Sbjct  604  RERRSQDGEIPANLLDKYHDQCSESVPEFCIDAGSTGNIARFINHCCEPNLFVQCVLSTH  663

Query  253  DDRKVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            DD ++  IMLFA +NI PL+ELTY Y Y +D V DS G IK   C+CG++ C  RL+
Sbjct  664  DDLRLARIMLFAADNIPPLQELTYDYGYVLDSVLDSDGKIKQMPCYCGASVCRKRLF  720



>ref|XP_010315899.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4 isoform X1 [Solanum lycopersicum]
Length=677

 Score =   189 bits (481),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 99/231 (43%), Positives = 136/231 (59%), Gaps = 15/231 (6%)
 Frame = -3

Query  733  CACAVRNGGELPY--NRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            C+CA  NG E PY     G ++E K +V+ECGP+C C P+C NR SQ G++ +LE+F+T 
Sbjct  448  CSCAKLNGSEFPYVHKDGGRLIEPKAVVFECGPNCGCGPACVNRTSQKGLRYRLEVFRTP  507

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDI----------GHNYSD  410
            ++GWGVRS   IPSG  ICEY G LL+  +       + Y+FDI          G     
Sbjct  508  NKGWGVRSWDYIPSGATICEYTG-LLKKTDQIDPAADNNYVFDIDCLQTMKGLDGRERRL  566

Query  409  CSINPSGQKCTSSEQVEEVG--HTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVP  236
              ++  G     SE++ + G  + IDA   GNV RFINHSC PNL+ Q VL  + D  + 
Sbjct  567  REVSLPGYWHNDSEKMSDGGPEYCIDAVSVGNVARFINHSCQPNLFVQCVLSTHHDIGLA  626

Query  235  HIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             ++L A +NI PL+ELTY Y Y +D V D  G +K   C+CG+A+C  RL+
Sbjct  627  RVVLMAADNIPPLQELTYDYGYVLDSVMDREGKVKQMACYCGAADCRKRLF  677



>ref|XP_012067355.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4 isoform X3 [Jatropha curcas]
 gb|KDP41858.1| hypothetical protein JCGZ_26876 [Jatropha curcas]
Length=689

 Score =   190 bits (482),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 103/240 (43%), Positives = 138/240 (58%), Gaps = 27/240 (11%)
 Frame = -3

Query  739  QKCACAVRNGGELPY-NRNGA-IVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFK  566
            + CACA  NG + PY +R+G  ++E K +VYECGP+C C P C NR SQ G+K + E+F+
Sbjct  456  RTCACAQLNGTDFPYVHRDGGRLIEAKAIVYECGPNCGCGPHCVNRTSQRGLKYRFEVFR  515

Query  565  TESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG------------H  422
            +  +GW VRS   IPSG  ICEY G L+  ++ +  +  + Y+F+I              
Sbjct  516  SPKKGWAVRSWDFIPSGAPICEYVGVLMRTEDLDSVL-DNNYIFEIDCLQTMSGLGGRER  574

Query  421  NYSDCSI-------NPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVL  263
               D S+        P  QK   SE V E    IDA   GN+ RFINHSC PNL+ Q VL
Sbjct  575  RLGDVSVPTINNSNRPEDQK---SESVPEF--CIDAGSTGNIARFINHSCEPNLFVQCVL  629

Query  262  YDYDDRKVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
              + D K+  +MLFA +NI PL+ELTY Y Y +D V    G IK   C+CG+A+C  RL+
Sbjct  630  SSHHDLKLARVMLFAADNIPPLQELTYDYGYALDSVTGPDGKIKQMACYCGAADCRKRLF  689



>ref|XP_012067353.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4 isoform X1 [Jatropha curcas]
Length=741

 Score =   190 bits (482),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 103/240 (43%), Positives = 138/240 (58%), Gaps = 27/240 (11%)
 Frame = -3

Query  739  QKCACAVRNGGELPY-NRNGA-IVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFK  566
            + CACA  NG + PY +R+G  ++E K +VYECGP+C C P C NR SQ G+K + E+F+
Sbjct  508  RTCACAQLNGTDFPYVHRDGGRLIEAKAIVYECGPNCGCGPHCVNRTSQRGLKYRFEVFR  567

Query  565  TESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG------------H  422
            +  +GW VRS   IPSG  ICEY G L+  ++ +  +  + Y+F+I              
Sbjct  568  SPKKGWAVRSWDFIPSGAPICEYVGVLMRTEDLDS-VLDNNYIFEIDCLQTMSGLGGRER  626

Query  421  NYSDCSI-------NPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVL  263
               D S+        P  QK   SE V E    IDA   GN+ RFINHSC PNL+ Q VL
Sbjct  627  RLGDVSVPTINNSNRPEDQK---SESVPEF--CIDAGSTGNIARFINHSCEPNLFVQCVL  681

Query  262  YDYDDRKVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
              + D K+  +MLFA +NI PL+ELTY Y Y +D V    G IK   C+CG+A+C  RL+
Sbjct  682  SSHHDLKLARVMLFAADNIPPLQELTYDYGYALDSVTGPDGKIKQMACYCGAADCRKRLF  741



>ref|XP_010657293.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4-like isoform X2 [Vitis vinifera]
Length=605

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/234 (44%), Positives = 140/234 (60%), Gaps = 23/234 (10%)
 Frame = -3

Query  733  CACAVRNGGELPY---NRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKT  563
            C+CA RNG   PY   N N  + E K +V+ECGP+C C P+C NR SQ GIK  LE+F+T
Sbjct  378  CSCAERNGSSFPYVLENGNRLLFEPKDVVFECGPNCGCGPNCLNRTSQQGIKYHLEVFRT  437

Query  562  ESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDC--SINPSG  389
            + +GWGVR+L  IPSG+ +CEY GEL   K+      +D Y+F+I     DC  +++  G
Sbjct  438  KEKGWGVRTLDFIPSGSPVCEYIGELKRTKDINDVFDND-YIFEI-----DCWQTMHGIG  491

Query  388  QKCTSSEQVEEVGHT------------IDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDR  245
             +    + V+   H             IDA + G+V RF+NHSC PNL+ Q VL  + D 
Sbjct  492  GREKRLKDVQIPVHNNVDNIDDMPEYCIDARKTGSVSRFVNHSCEPNLFVQCVLSSHHDL  551

Query  244  KVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            ++  ++LFA ENI+P +ELTY Y Y +D V    GNIK   C CG+A C+ RLY
Sbjct  552  ELAQVVLFAAENITPSQELTYDYGYILDGVVGPDGNIKELACRCGAASCSKRLY  605



>ref|XP_012067354.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4 isoform X2 [Jatropha curcas]
Length=740

 Score =   190 bits (482),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/240 (43%), Positives = 138/240 (58%), Gaps = 27/240 (11%)
 Frame = -3

Query  739  QKCACAVRNGGELPY-NRNGA-IVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFK  566
            + CACA  NG + PY +R+G  ++E K +VYECGP+C C P C NR SQ G+K + E+F+
Sbjct  507  RTCACAQLNGTDFPYVHRDGGRLIEAKAIVYECGPNCGCGPHCVNRTSQRGLKYRFEVFR  566

Query  565  TESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG------------H  422
            +  +GW VRS   IPSG  ICEY G L+  ++ +  +  + Y+F+I              
Sbjct  567  SPKKGWAVRSWDFIPSGAPICEYVGVLMRTEDLDS-VLDNNYIFEIDCLQTMSGLGGRER  625

Query  421  NYSDCSI-------NPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVL  263
               D S+        P  QK   SE V E    IDA   GN+ RFINHSC PNL+ Q VL
Sbjct  626  RLGDVSVPTINNSNRPEDQK---SESVPEF--CIDAGSTGNIARFINHSCEPNLFVQCVL  680

Query  262  YDYDDRKVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
              + D K+  +MLFA +NI PL+ELTY Y Y +D V    G IK   C+CG+A+C  RL+
Sbjct  681  SSHHDLKLARVMLFAADNIPPLQELTYDYGYALDSVTGPDGKIKQMACYCGAADCRKRLF  740



>ref|XP_010657284.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4-like isoform X1 [Vitis vinifera]
Length=612

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/234 (44%), Positives = 140/234 (60%), Gaps = 23/234 (10%)
 Frame = -3

Query  733  CACAVRNGGELPY---NRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKT  563
            C+CA RNG   PY   N N  + E K +V+ECGP+C C P+C NR SQ GIK  LE+F+T
Sbjct  385  CSCAERNGSSFPYVLENGNRLLFEPKDVVFECGPNCGCGPNCLNRTSQQGIKYHLEVFRT  444

Query  562  ESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDC--SINPSG  389
            + +GWGVR+L  IPSG+ +CEY GEL   K+      +D Y+F+I     DC  +++  G
Sbjct  445  KEKGWGVRTLDFIPSGSPVCEYIGELKRTKDINDVFDND-YIFEI-----DCWQTMHGIG  498

Query  388  QKCTSSEQVEEVGHT------------IDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDR  245
             +    + V+   H             IDA + G+V RF+NHSC PNL+ Q VL  + D 
Sbjct  499  GREKRLKDVQIPVHNNVDNIDDMPEYCIDARKTGSVSRFVNHSCEPNLFVQCVLSSHHDL  558

Query  244  KVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            ++  ++LFA ENI+P +ELTY Y Y +D V    GNIK   C CG+A C+ RLY
Sbjct  559  ELAQVVLFAAENITPSQELTYDYGYILDGVVGPDGNIKELACRCGAASCSKRLY  612



>ref|XP_002963315.1| hypothetical protein SELMODRAFT_79965, partial [Selaginella moellendorffii]
 gb|EFJ35186.1| hypothetical protein SELMODRAFT_79965, partial [Selaginella moellendorffii]
Length=491

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/234 (41%), Positives = 137/234 (59%), Gaps = 17/234 (7%)
 Frame = -3

Query  739  QKCACAVRNGGELPY--NRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFK  566
            + C+CA RNG   PY  +  G +      VYECGP+C C P+C NRV+Q G++ +LE++K
Sbjct  260  KTCSCAKRNGHTFPYVDSHGGRLAVPLDAVYECGPNCGCGPACINRVTQRGLRYRLEVYK  319

Query  565  TESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDI----------GHNY  416
            T+ +GW VRS  SIP+G  +CEY G++++    +  + SD YLFD+          G  +
Sbjct  320  TQHKGWAVRSWDSIPAGAPVCEYFGKVIKSDSLD--VKSDVYLFDLDCIQTMRGVDGRQF  377

Query  415  SDCSINPSGQKCTSSEQVEEVGHT---IDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDR  245
             D        +   +E  E  G     +D  E G V RFINHSC PNL+ Q VL  + D 
Sbjct  378  LDYQNGKVSCESRDAEDAEHHGQAEFCLDGGECGAVARFINHSCEPNLFIQCVLSTHHDM  437

Query  244  KVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            ++P I+LFA +NI+PL+EL+Y Y Y ++ V DS G +K   C+CG+  C  RLY
Sbjct  438  RIPRIVLFAADNIAPLQELSYDYGYALNSVVDSDGLVKKLPCYCGALSCRKRLY  491



>gb|KJB31593.1| hypothetical protein B456_005G196900 [Gossypium raimondii]
Length=991

 Score =   191 bits (485),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 141/237 (59%), Gaps = 19/237 (8%)
 Frame = -3

Query  739  QKCACAVRNGGELPY-NRNGA-IVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFK  566
            + C+CA  NGG+ PY +R+G  + E K +V+ECGP+C C P C NR SQ G+K QLE+++
Sbjct  756  RSCSCAQLNGGDFPYVSRDGGRLFEAKDVVFECGPNCGCGPECVNRTSQQGLKYQLEVYR  815

Query  565  TESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG--HNYSDCSINPS  392
            T+ +GW VRSL  IPSG  +CEY G L ++ E E  I  ++Y+F+I   H          
Sbjct  816  TKEKGWAVRSLDFIPSGAPVCEYVGILRKNDELED-ISENDYIFEIDCWHTMKGIGGRER  874

Query  391  GQKCTS---SEQVEEVGHT-----------IDAAEYGNVGRFINHSCSPNLYAQNVLYDY  254
             Q   S   S  V+EV              IDA+ +GNV RFINHSC PNL+ Q +L  +
Sbjct  875  RQGDVSLPMSNLVDEVDERTLESEPEPEFCIDASSFGNVARFINHSCDPNLFVQCILSSH  934

Query  253  DDRKVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             D ++  I+LFA ++I  ++ELTY YNY +D V    G  K   CFCG++EC  RLY
Sbjct  935  HDVRLARIVLFAADDIPRMQELTYDYNYAIDSVIGPDGKTKQLPCFCGTSECRKRLY  991



>gb|KJB31592.1| hypothetical protein B456_005G196900 [Gossypium raimondii]
Length=964

 Score =   191 bits (484),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 141/237 (59%), Gaps = 19/237 (8%)
 Frame = -3

Query  739  QKCACAVRNGGELPY-NRNGA-IVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFK  566
            + C+CA  NGG+ PY +R+G  + E K +V+ECGP+C C P C NR SQ G+K QLE+++
Sbjct  729  RSCSCAQLNGGDFPYVSRDGGRLFEAKDVVFECGPNCGCGPECVNRTSQQGLKYQLEVYR  788

Query  565  TESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG--HNYSDCSINPS  392
            T+ +GW VRSL  IPSG  +CEY G L ++ E E  I  ++Y+F+I   H          
Sbjct  789  TKEKGWAVRSLDFIPSGAPVCEYVGILRKNDELED-ISENDYIFEIDCWHTMKGIGGRER  847

Query  391  GQKCTS---SEQVEEVGHT-----------IDAAEYGNVGRFINHSCSPNLYAQNVLYDY  254
             Q   S   S  V+EV              IDA+ +GNV RFINHSC PNL+ Q +L  +
Sbjct  848  RQGDVSLPMSNLVDEVDERTLESEPEPEFCIDASSFGNVARFINHSCDPNLFVQCILSSH  907

Query  253  DDRKVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             D ++  I+LFA ++I  ++ELTY YNY +D V    G  K   CFCG++EC  RLY
Sbjct  908  HDVRLARIVLFAADDIPRMQELTYDYNYAIDSVIGPDGKTKQLPCFCGTSECRKRLY  964



>ref|XP_010908513.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4-like [Elaeis guineensis]
 ref|XP_010908514.1| PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific 
SUVH4-like [Elaeis guineensis]
Length=682

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/234 (44%), Positives = 134/234 (57%), Gaps = 21/234 (9%)
 Frame = -3

Query  739  QKCACAVRNGGELPY--NRNGAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFK  566
            + CACA  NG + PY     G +VE K +V+ECGP+C C   C NR SQ G+K +LE+F+
Sbjct  455  RTCACARLNGSDFPYVHKDGGRLVEAKAVVFECGPNCGCGVDCVNRTSQQGLKYRLEVFR  514

Query  565  TESRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIGHNYSDCSINPSGQ  386
            T ++GW VRS  +IPSG  ICEY G L +  + E  +  + Y+FDI     DC     G 
Sbjct  515  TPNKGWAVRSWDTIPSGAPICEYTGILRKTDDVEN-VSENNYIFDI-----DCLQTMQGL  568

Query  385  KCTS-------------SEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDR  245
               +              ++ E   + IDA   GNV RFINHSC PNL+ Q +L  + D 
Sbjct  569  DGRARRPGDISFLTNFDDKKSEVPEYCIDAGSIGNVARFINHSCQPNLFVQCILSLHHDI  628

Query  244  KVPHIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
            K+  IMLFA + ISPL+ELTY Y Y +D V  S G I    C+CG+A+C  RLY
Sbjct  629  KMAKIMLFAADTISPLQELTYDYGYALDSVVGSDGKIIKMPCYCGAADCRKRLY  682



>ref|XP_002512666.1| histone-lysine n-methyltransferase, suvh, putative [Ricinus communis]
 gb|EEF50118.1| histone-lysine n-methyltransferase, suvh, putative [Ricinus communis]
Length=326

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/231 (41%), Positives = 132/231 (57%), Gaps = 15/231 (6%)
 Frame = -3

Query  733  CACAVRNGGELPYNRN--GAIVEVKPLVYECGPHCKCPPSCYNRVSQNGIKIQLEIFKTE  560
            C+CA  NG + PY R   G ++E K +V+ECGP C C P+C NR+SQ GIK +LE+++T 
Sbjct  97   CSCARLNGSDFPYVRKDGGRLIEPKDVVFECGPGCGCGPNCINRISQQGIKYRLEVYRTR  156

Query  559  SRGWGVRSLTSIPSGTFICEYAGELLEDKEAERRIGSDEYLFDIG------------HNY  416
            ++GW VRS   IPSG F+CEY G L +  + +  +  ++++F+I                
Sbjct  157  NKGWAVRSWDFIPSGAFVCEYIGVLRQCADLDN-VSENDFIFEIDCWHTMHGIGGRERRQ  215

Query  415  SDCSINPSGQKCTSSEQVEEVGHTIDAAEYGNVGRFINHSCSPNLYAQNVLYDYDDRKVP  236
             D S +         E   E    ID A   NV RFINHSC PNL+ Q VL  + D +  
Sbjct  216  GDVSKHARYLVEKMDEAQSETEFCIDGASCSNVTRFINHSCDPNLFVQCVLSSHHDIRFA  275

Query  235  HIMLFAVENISPLRELTYHYNYTVDQVRDSSGNIKVKQCFCGSAECTGRLY  83
             I+LFA ++I P++EL Y Y Y +D V    G IK   C+CG++EC GRLY
Sbjct  276  RIVLFAADDIPPMQELAYDYGYALDSVIGPDGKIKKSPCYCGTSECRGRLY  326



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1566421839775