BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13996

Length=842
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009606841.1|  PREDICTED: 5-epiaristolochene 1,3-dihydroxyl...    241   5e-73   Nicotiana tomentosiformis
ref|XP_009801864.1|  PREDICTED: LOW QUALITY PROTEIN: 5-epiaristol...    238   6e-71   Nicotiana sylvestris
emb|CDP20313.1|  unnamed protein product                                230   7e-71   Coffea canephora [robusta coffee]
sp|P93530.1|C71D6_SOLCH  RecName: Full=Cytochrome P450 71D6             238   7e-71   Solanum chacoense
ref|XP_009625417.1|  PREDICTED: 5-epiaristolochene 1,3-dihydroxylase    238   1e-70   Nicotiana tomentosiformis
ref|XP_004250027.1|  PREDICTED: cytochrome P450 71D7                    238   1e-70   Solanum lycopersicum
gb|ABC69421.1|  CYP71D20v2                                              238   1e-70   Nicotiana tabacum [American tobacco]
emb|CAC24711.1|  cytochrome P450                                        238   1e-70   Solanum tuberosum [potatoes]
ref|XP_006350394.1|  PREDICTED: cytochrome P450 71D6-like               237   2e-70   Solanum tuberosum [potatoes]
ref|XP_006350396.1|  PREDICTED: premnaspirodiene oxygenase-like         236   4e-70   
ref|XP_004237369.1|  PREDICTED: premnaspirodiene oxygenase              236   4e-70   Solanum lycopersicum
gb|AIZ01224.2|  epi-aristolochene dihydroxylase                         235   5e-70   Nicotiana benthamiana
gb|AAK62343.2|  elicitor-inducible cytochrome P450                      234   8e-70   Nicotiana tabacum [American tobacco]
sp|Q94FM7.2|C71DK_TOBAC  RecName: Full=5-epiaristolochene 1,3-dih...    235   8e-70   Nicotiana tabacum [American tobacco]
ref|XP_006350417.1|  PREDICTED: cytochrome P450 71D7-like               235   8e-70   
ref|XP_009771988.1|  PREDICTED: 5-epiaristolochene 1,3-dihydroxyl...    235   1e-69   Nicotiana sylvestris
gb|KHN42024.1|  Cytochrome P450 71D8                                    234   1e-69   Glycine soja [wild soybean]
sp|A6YIH8.1|C7D55_HYOMU  RecName: Full=Premnaspirodiene oxygenase...    234   3e-69   Hyoscyamus muticus
sp|P93531.1|C71D7_SOLCH  RecName: Full=Cytochrome P450 71D7             234   3e-69   Solanum chacoense
emb|CDP20312.1|  unnamed protein product                                233   5e-69   Coffea canephora [robusta coffee]
ref|XP_006350393.1|  PREDICTED: cytochrome P450 71D7-like               233   8e-69   Solanum tuberosum [potatoes]
dbj|BAN58140.1|  putative premaspirodiene oxygenase                     232   1e-68   Hyoscyamus albus [white henbane]
ref|XP_006350395.1|  PREDICTED: premnaspirodiene oxygenase-like         231   5e-68   Solanum tuberosum [potatoes]
emb|CDP07877.1|  unnamed protein product                                220   2e-67   Coffea canephora [robusta coffee]
ref|XP_003516584.1|  PREDICTED: cytochrome P450 71D8-like               227   2e-66   Glycine max [soybeans]
ref|XP_011081932.1|  PREDICTED: cytochrome P450 71D95-like              226   2e-66   Sesamum indicum [beniseed]
ref|XP_009609586.1|  PREDICTED: premnaspirodiene oxygenase-like         217   3e-66   Nicotiana tomentosiformis
ref|XP_011081934.1|  PREDICTED: cytochrome P450 71D95-like              226   3e-66   Sesamum indicum [beniseed]
ref|XP_009617020.1|  PREDICTED: premnaspirodiene oxygenase-like         218   4e-66   Nicotiana tomentosiformis
ref|XP_004228509.1|  PREDICTED: premnaspirodiene oxygenase-like         225   7e-66   Solanum lycopersicum
ref|XP_007156881.1|  hypothetical protein PHAVU_002G025000g             225   9e-66   Phaseolus vulgaris [French bean]
emb|CDP07872.1|  unnamed protein product                                224   1e-65   Coffea canephora [robusta coffee]
ref|XP_009759476.1|  PREDICTED: premnaspirodiene oxygenase-like         215   1e-65   Nicotiana sylvestris
ref|XP_011082374.1|  PREDICTED: premnaspirodiene oxygenase-like         224   2e-65   Sesamum indicum [beniseed]
ref|XP_009612725.1|  PREDICTED: premnaspirodiene oxygenase-like         224   3e-65   Nicotiana tomentosiformis
ref|XP_004241764.1|  PREDICTED: premnaspirodiene oxygenase-like         224   3e-65   
ref|XP_011082249.1|  PREDICTED: premnaspirodiene oxygenase-like         224   3e-65   
gb|AJD25162.1|  cytochrome P450 CYP71D374                               223   4e-65   Salvia miltiorrhiza [Chinese salvia]
ref|XP_004249520.2|  PREDICTED: premnaspirodiene oxygenase-like         224   4e-65   Solanum lycopersicum
ref|XP_009587552.1|  PREDICTED: premnaspirodiene oxygenase-like         223   4e-65   Nicotiana tomentosiformis
emb|CDP07879.1|  unnamed protein product                                223   5e-65   Coffea canephora [robusta coffee]
gb|AGN04217.1|  cytochrome P450                                         223   5e-65   Salvia miltiorrhiza [Chinese salvia]
ref|XP_009609752.1|  PREDICTED: premnaspirodiene oxygenase-like         214   7e-65   Nicotiana tomentosiformis
gb|KDO62260.1|  hypothetical protein CISIN_1g020837mg                   217   9e-65   Citrus sinensis [apfelsine]
ref|XP_011081935.1|  PREDICTED: cytochrome P450 71D95-like              222   1e-64   Sesamum indicum [beniseed]
emb|CDP07886.1|  unnamed protein product                                221   1e-64   Coffea canephora [robusta coffee]
ref|XP_003611886.1|  Cytochrome P450                                    222   1e-64   Medicago truncatula
ref|XP_006339044.1|  PREDICTED: premnaspirodiene oxygenase-like         222   1e-64   Solanum tuberosum [potatoes]
ref|XP_011073878.1|  PREDICTED: premnaspirodiene oxygenase-like         222   1e-64   Sesamum indicum [beniseed]
gb|KDO62263.1|  hypothetical protein CISIN_1g0110962mg                  215   1e-64   Citrus sinensis [apfelsine]
gb|KDO62262.1|  hypothetical protein CISIN_1g0110962mg                  215   2e-64   Citrus sinensis [apfelsine]
gb|ABC69397.1|  CYP71D48v1                                              221   2e-64   Nicotiana tabacum [American tobacco]
gb|ADA70806.1|  cytochrome P450 CYP71D177                               221   2e-64   Scoparia dulcis [escobilla]
ref|XP_007020552.1|  Cytochrome P450 71D10, putative                    221   2e-64   
gb|ABC69396.1|  CYP71D48v2                                              221   2e-64   Nicotiana tabacum [American tobacco]
ref|XP_012071254.1|  PREDICTED: cytochrome P450 71D10-like              224   2e-64   
ref|XP_009611155.1|  PREDICTED: premnaspirodiene oxygenase-like         221   2e-64   Nicotiana tomentosiformis
ref|XP_010644548.1|  PREDICTED: premnaspirodiene oxygenase-like         221   2e-64   Vitis vinifera
ref|XP_009776868.1|  PREDICTED: premnaspirodiene oxygenase-like         221   3e-64   Nicotiana sylvestris
ref|XP_009606204.1|  PREDICTED: premnaspirodiene oxygenase-like         221   4e-64   
ref|XP_009770332.1|  PREDICTED: premnaspirodiene oxygenase-like         221   6e-64   Nicotiana sylvestris
ref|XP_003517259.1|  PREDICTED: cytochrome P450 71D8-like               220   8e-64   Glycine max [soybeans]
gb|AAD47832.1|  cytochrome P450                                         219   1e-63   Nicotiana tabacum [American tobacco]
ref|XP_009769208.1|  PREDICTED: premnaspirodiene oxygenase-like         219   1e-63   Nicotiana sylvestris
ref|XP_003537455.1|  PREDICTED: cytochrome P450 71D8-like               219   1e-63   
ref|XP_007020554.1|  Cytochrome P450 71D10, putative                    220   1e-63   
ref|XP_004233564.1|  PREDICTED: premnaspirodiene oxygenase-like         219   2e-63   Solanum lycopersicum
ref|XP_004511998.1|  PREDICTED: cytochrome P450 71D8-like               219   2e-63   Cicer arietinum [garbanzo]
gb|KHN36164.1|  Cytochrome P450 71D8                                    219   2e-63   Glycine soja [wild soybean]
ref|XP_009765039.1|  PREDICTED: premnaspirodiene oxygenase-like         218   2e-63   Nicotiana sylvestris
ref|XP_006361940.1|  PREDICTED: premnaspirodiene oxygenase-like         218   3e-63   Solanum tuberosum [potatoes]
ref|XP_009794456.1|  PREDICTED: premnaspirodiene oxygenase-like         218   3e-63   Nicotiana sylvestris
ref|XP_012070984.1|  PREDICTED: cytochrome P450 71D10-like              218   3e-63   Jatropha curcas
emb|CDP07878.1|  unnamed protein product                                214   3e-63   Coffea canephora [robusta coffee]
ref|XP_009780029.1|  PREDICTED: premnaspirodiene oxygenase-like         218   3e-63   Nicotiana sylvestris
emb|CDP07874.1|  unnamed protein product                                216   3e-63   Coffea canephora [robusta coffee]
ref|XP_009793271.1|  PREDICTED: premnaspirodiene oxygenase-like         218   4e-63   Nicotiana sylvestris
ref|XP_011082254.1|  PREDICTED: premnaspirodiene oxygenase              218   5e-63   
ref|XP_006355983.1|  PREDICTED: premnaspirodiene oxygenase-like         218   5e-63   Solanum tuberosum [potatoes]
ref|XP_006339046.1|  PREDICTED: premnaspirodiene oxygenase-like         218   6e-63   Solanum tuberosum [potatoes]
ref|XP_009765480.1|  PREDICTED: premnaspirodiene oxygenase-like         217   8e-63   Nicotiana sylvestris
gb|EYU21953.1|  hypothetical protein MIMGU_mgv1a025918mg                217   9e-63   Erythranthe guttata [common monkey flower]
gb|KDP39256.1|  hypothetical protein JCGZ_01013                         216   1e-62   Jatropha curcas
ref|XP_009803037.1|  PREDICTED: premnaspirodiene oxygenase-like         217   1e-62   Nicotiana sylvestris
gb|EYU32748.1|  hypothetical protein MIMGU_mgv1a004746mg                217   1e-62   Erythranthe guttata [common monkey flower]
ref|XP_006452554.1|  hypothetical protein CICLE_v10008073mg             217   1e-62   Citrus clementina [clementine]
ref|XP_006367966.1|  PREDICTED: premnaspirodiene oxygenase-like         217   1e-62   Solanum tuberosum [potatoes]
gb|EYU21988.1|  hypothetical protein MIMGU_mgv1a004711mg                216   2e-62   Erythranthe guttata [common monkey flower]
sp|O81974.1|C71D8_SOYBN  RecName: Full=Cytochrome P450 71D8; AltN...    216   2e-62   Glycine max [soybeans]
dbj|BAC53923.1|  cytochrome P450                                        216   2e-62   Petunia x hybrida [garden petunia]
ref|XP_009612417.1|  PREDICTED: premnaspirodiene oxygenase-like         216   2e-62   Nicotiana tomentosiformis
ref|XP_009619325.1|  PREDICTED: premnaspirodiene oxygenase-like         216   2e-62   Nicotiana tomentosiformis
ref|XP_006474921.1|  PREDICTED: cytochrome P450 71D11-like isofor...    216   2e-62   Citrus sinensis [apfelsine]
ref|XP_006452556.1|  hypothetical protein CICLE_v10008047mg             216   2e-62   Citrus clementina [clementine]
ref|XP_002514827.1|  cytochrome P450, putative                          216   2e-62   Ricinus communis
emb|CDP18847.1|  unnamed protein product                                216   2e-62   Coffea canephora [robusta coffee]
gb|AEX07771.1|  cytochrome P450                                         216   3e-62   Catharanthus roseus [chatas]
ref|XP_004228511.1|  PREDICTED: premnaspirodiene oxygenase-like         216   3e-62   Solanum lycopersicum
ref|XP_009598320.1|  PREDICTED: premnaspirodiene oxygenase-like         216   3e-62   Nicotiana tomentosiformis
gb|EYU39554.1|  hypothetical protein MIMGU_mgv1a004505mg                216   3e-62   Erythranthe guttata [common monkey flower]
gb|KEH34014.1|  cytochrome P450 family 71 protein                       216   3e-62   Medicago truncatula
gb|KEH25843.1|  cytochrome P450 family 71 protein                       215   3e-62   Medicago truncatula
ref|XP_003537457.1|  PREDICTED: cytochrome P450 71D8-like               215   3e-62   Glycine max [soybeans]
ref|XP_006359503.1|  PREDICTED: premnaspirodiene oxygenase-like         215   4e-62   Solanum tuberosum [potatoes]
gb|KCW68415.1|  hypothetical protein EUGRSUZ_F02064                     214   4e-62   Eucalyptus grandis [rose gum]
ref|XP_011081964.1|  PREDICTED: premnaspirodiene oxygenase-like         215   4e-62   Sesamum indicum [beniseed]
emb|CDP08464.1|  unnamed protein product                                213   4e-62   Coffea canephora [robusta coffee]
ref|XP_004512032.1|  PREDICTED: cytochrome P450 71D8-like               215   5e-62   Cicer arietinum [garbanzo]
gb|KJB11068.1|  hypothetical protein B456_001G239400                    211   5e-62   Gossypium raimondii
ref|XP_006365979.1|  PREDICTED: premnaspirodiene oxygenase-like         215   5e-62   Solanum tuberosum [potatoes]
sp|Q6WKZ1.1|C71DI_MENGR  RecName: Full=Cytochrome P450 71D18; Alt...    215   5e-62   Mentha x gracilis [ginger mint]
ref|XP_007156882.1|  hypothetical protein PHAVU_002G025100g             215   6e-62   Phaseolus vulgaris [French bean]
gb|KHN36162.1|  Cytochrome P450 71D8                                    213   6e-62   Glycine soja [wild soybean]
ref|XP_006363816.1|  PREDICTED: premnaspirodiene oxygenase-like i...    214   7e-62   Solanum tuberosum [potatoes]
ref|XP_007020553.1|  Cytochrome P450 71D10, putative                    215   7e-62   
ref|XP_004245943.1|  PREDICTED: premnaspirodiene oxygenase-like         214   7e-62   Solanum lycopersicum
ref|XP_003611884.1|  Cytochrome P450                                    214   7e-62   Medicago truncatula
gb|AGH68502.1|  cytochrome p450                                         206   8e-62   Ipomoea batatas [batate]
ref|XP_010061471.1|  PREDICTED: cytochrome P450 71D11-like              214   8e-62   Eucalyptus grandis [rose gum]
ref|XP_003611883.1|  Cytochrome P450                                    214   8e-62   Medicago truncatula
ref|XP_010064672.1|  PREDICTED: cytochrome P450 71D11-like              214   9e-62   Eucalyptus grandis [rose gum]
ref|XP_003615865.1|  Cytochrome P450                                    214   1e-61   Medicago truncatula
gb|KCW76838.1|  hypothetical protein EUGRSUZ_D01192                     214   1e-61   Eucalyptus grandis [rose gum]
gb|KDP39250.1|  hypothetical protein JCGZ_01007                         213   1e-61   Jatropha curcas
ref|XP_011047803.1|  PREDICTED: cytochrome P450 71D8-like               211   1e-61   Populus euphratica
emb|CDP20311.1|  unnamed protein product                                216   1e-61   Coffea canephora [robusta coffee]
ref|XP_011077043.1|  PREDICTED: premnaspirodiene oxygenase-like         214   2e-61   Sesamum indicum [beniseed]
ref|XP_010910607.1|  PREDICTED: premnaspirodiene oxygenase-like         214   2e-61   Elaeis guineensis
ref|XP_006374280.1|  hypothetical protein POPTR_0015s05640g             214   2e-61   
gb|AAF27282.1|AF122821_1  cytochrome P450                               214   2e-61   Capsicum annuum
gb|KHN37234.1|  Cytochrome P450 71D11                                   214   2e-61   Glycine soja [wild soybean]
ref|XP_008779150.1|  PREDICTED: premnaspirodiene oxygenase-like         214   2e-61   Phoenix dactylifera
ref|XP_007148448.1|  hypothetical protein PHAVU_006G209700g             214   2e-61   Phaseolus vulgaris [French bean]
gb|AHH25653.1|  cytochrome P450 CYP71D                                  213   2e-61   Nicotiana tabacum [American tobacco]
ref|XP_009608635.1|  PREDICTED: premnaspirodiene oxygenase-like         214   2e-61   Nicotiana tomentosiformis
gb|ABC68406.1|  cytochrome P450 monooxygenase CYP71D54                  207   2e-61   Glycine max [soybeans]
ref|XP_010054541.1|  PREDICTED: premnaspirodiene oxygenase-like         213   2e-61   
ref|XP_006596106.1|  PREDICTED: cytochrome P450 71D11-like              214   2e-61   Glycine max [soybeans]
ref|XP_010027347.1|  PREDICTED: premnaspirodiene oxygenase-like         214   2e-61   Eucalyptus grandis [rose gum]
gb|KJB61458.1|  hypothetical protein B456_009G359100                    213   2e-61   Gossypium raimondii
gb|KCW62217.1|  hypothetical protein EUGRSUZ_H04878                     214   2e-61   Eucalyptus grandis [rose gum]
ref|XP_010027345.1|  PREDICTED: cytochrome P450 71D95-like              205   2e-61   
gb|KDO62258.1|  hypothetical protein CISIN_1g0123662mg                  210   3e-61   Citrus sinensis [apfelsine]
gb|ABC69394.1|  CYP71D47v1                                              213   3e-61   Nicotiana tabacum [American tobacco]
ref|XP_009766832.1|  PREDICTED: premnaspirodiene oxygenase-like         213   3e-61   Nicotiana sylvestris
gb|ABC69395.1|  CYP71D47v2                                              213   3e-61   Nicotiana tabacum [American tobacco]
ref|XP_006367128.1|  PREDICTED: premnaspirodiene oxygenase-like i...    211   3e-61   
ref|XP_003557037.1|  PREDICTED: cytochrome P450 71D8-like               204   4e-61   
ref|XP_007033124.1|  Cytochrome P450 71D10, putative                    213   4e-61   
gb|AET00662.2|  cytochrome P450 family 71 protein                       213   4e-61   Medicago truncatula
gb|EYU21978.1|  hypothetical protein MIMGU_mgv1a004623mg                213   4e-61   Erythranthe guttata [common monkey flower]
ref|XP_003615871.1|  Cytochrome P450                                    213   4e-61   Medicago truncatula
ref|XP_003516583.1|  PREDICTED: cytochrome P450 71D8-like               213   4e-61   Glycine max [soybeans]
gb|KHN01537.1|  Cytochrome P450 71D11                                   213   5e-61   Glycine soja [wild soybean]
ref|XP_003549267.1|  PREDICTED: cytochrome P450 71D11-like              213   5e-61   Glycine max [soybeans]
gb|KHN39921.1|  Cytochrome P450 71D8                                    212   5e-61   Glycine soja [wild soybean]
ref|XP_012070986.1|  PREDICTED: cytochrome P450 71D10-like              212   6e-61   Jatropha curcas
ref|XP_007033123.1|  Cytochrome P450 71D10, putative                    212   6e-61   
gb|KCW68417.1|  hypothetical protein EUGRSUZ_F02067                     212   6e-61   Eucalyptus grandis [rose gum]
ref|XP_006365962.1|  PREDICTED: cytochrome P450 71D7-like               212   6e-61   Solanum tuberosum [potatoes]
ref|XP_009595835.1|  PREDICTED: premnaspirodiene oxygenase-like i...    212   6e-61   Nicotiana tomentosiformis
ref|XP_009595834.1|  PREDICTED: premnaspirodiene oxygenase-like i...    212   6e-61   Nicotiana tomentosiformis
gb|ABC69405.1|  CYP71D51v3                                              212   8e-61   Nicotiana tabacum [American tobacco]
gb|ABC69403.1|  CYP71D51v1                                              212   8e-61   Nicotiana tabacum [American tobacco]
ref|XP_009758268.1|  PREDICTED: premnaspirodiene oxygenase              212   8e-61   Nicotiana sylvestris
ref|XP_008778500.1|  PREDICTED: premnaspirodiene oxygenase-like         212   9e-61   Phoenix dactylifera
ref|XP_006365938.1|  PREDICTED: premnaspirodiene oxygenase-like         212   1e-60   Solanum tuberosum [potatoes]
ref|XP_006357930.1|  PREDICTED: cytochrome P450 71D7-like               211   1e-60   Solanum tuberosum [potatoes]
gb|EYU31465.1|  hypothetical protein MIMGU_mgv1a004885mg                211   1e-60   Erythranthe guttata [common monkey flower]
gb|KEH34013.1|  cytochrome P450 family 71 protein                       211   2e-60   Medicago truncatula
ref|XP_003520239.1|  PREDICTED: cytochrome P450 71D8-like               211   2e-60   Glycine max [soybeans]
ref|XP_004511999.1|  PREDICTED: cytochrome P450 71D8-like               211   2e-60   
ref|XP_009794007.1|  PREDICTED: premnaspirodiene oxygenase-like         211   2e-60   Nicotiana sylvestris
gb|KEH28447.1|  cytochrome P450 family 71 protein                       209   2e-60   Medicago truncatula
gb|KHN48844.1|  Cytochrome P450 71D8                                    211   2e-60   Glycine soja [wild soybean]
ref|XP_003600322.1|  Cytochrome P450                                    211   2e-60   Medicago truncatula
ref|XP_007213422.1|  hypothetical protein PRUPE_ppa025696mg             210   2e-60   
ref|XP_007213458.1|  hypothetical protein PRUPE_ppa024556mg             211   2e-60   
ref|XP_006367127.1|  PREDICTED: premnaspirodiene oxygenase-like i...    211   2e-60   Solanum tuberosum [potatoes]
ref|XP_006361719.1|  PREDICTED: 5-epiaristolochene 1,3-dihydroxyl...    209   2e-60   Solanum tuberosum [potatoes]
ref|XP_009616520.1|  PREDICTED: premnaspirodiene oxygenase-like         211   3e-60   Nicotiana tomentosiformis
ref|XP_003537216.1|  PREDICTED: cytochrome P450 71D8-like               211   3e-60   Glycine max [soybeans]
ref|XP_006589940.1|  PREDICTED: cytochrome P450 71D8-like               206   3e-60   
ref|XP_004246079.1|  PREDICTED: cytochrome P450 71D7-like               210   3e-60   Solanum lycopersicum
gb|KJB11069.1|  hypothetical protein B456_001G239600                    210   3e-60   Gossypium raimondii
ref|XP_006452553.1|  hypothetical protein CICLE_v10008076mg             210   3e-60   Citrus clementina [clementine]
ref|XP_007222260.1|  hypothetical protein PRUPE_ppa005870mg             208   4e-60   
ref|XP_004231934.1|  PREDICTED: premnaspirodiene oxygenase-like         210   4e-60   Solanum lycopersicum
ref|XP_012066837.1|  PREDICTED: premnaspirodiene oxygenase-like         210   4e-60   Jatropha curcas
ref|XP_009622900.1|  PREDICTED: cytochrome P450 71D7-like               210   5e-60   Nicotiana tomentosiformis
gb|ABC69400.1|  CYP71D49v3                                              210   5e-60   Nicotiana tabacum [American tobacco]
ref|XP_012071258.1|  PREDICTED: cytochrome P450 71D9-like               210   5e-60   Jatropha curcas
emb|CDP07882.1|  unnamed protein product                                211   5e-60   Coffea canephora [robusta coffee]
gb|EEC66624.1|  hypothetical protein OsI_32869                          209   6e-60   Oryza sativa Indica Group [Indian rice]
gb|KDP32263.1|  hypothetical protein JCGZ_14784                         204   8e-60   Jatropha curcas
ref|XP_003610580.1|  Cytochrome P450                                    209   8e-60   Medicago truncatula
ref|XP_010644547.1|  PREDICTED: premnaspirodiene oxygenase-like         209   8e-60   Vitis vinifera
gb|ABC69399.1|  CYP71D49v1                                              209   8e-60   Nicotiana tabacum [American tobacco]
ref|XP_010067810.1|  PREDICTED: premnaspirodiene oxygenase-like         207   8e-60   
gb|KCW66024.1|  hypothetical protein EUGRSUZ_G03315                     207   8e-60   Eucalyptus grandis [rose gum]
emb|CDP11813.1|  unnamed protein product                                203   8e-60   Coffea canephora [robusta coffee]
ref|XP_003615863.1|  Cytochrome P450                                    209   9e-60   
ref|XP_009794009.1|  PREDICTED: premnaspirodiene oxygenase-like         209   9e-60   Nicotiana sylvestris
ref|XP_009615716.1|  PREDICTED: premnaspirodiene oxygenase-like         209   1e-59   Nicotiana tomentosiformis
ref|XP_003600339.1|  Cytochrome P450                                    209   1e-59   Medicago truncatula
ref|XP_012071026.1|  PREDICTED: cytochrome P450 71D9-like               209   1e-59   
dbj|BAO45903.1|  cytochrome P450 71D10                                  209   1e-59   Acacia mangium
gb|ABC69402.1|  CYP71D5v2                                               209   1e-59   Nicotiana tabacum [American tobacco]
gb|KDO50397.1|  hypothetical protein CISIN_1g020458mg                   204   1e-59   Citrus sinensis [apfelsine]
ref|XP_009764618.1|  PREDICTED: cytochrome P450 71D7-like isoform X1    209   1e-59   Nicotiana sylvestris
ref|XP_009793838.1|  PREDICTED: premnaspirodiene oxygenase-like         200   1e-59   Nicotiana sylvestris
gb|ABC69398.1|  CYP71D5v3                                               208   1e-59   Nicotiana tabacum [American tobacco]
gb|KEH25835.1|  cytochrome P450 family 71 protein                       208   1e-59   Medicago truncatula
gb|KHN08403.1|  Cytochrome P450 71D8                                    207   2e-59   Glycine soja [wild soybean]
ref|XP_003617703.1|  Cytochrome P450                                    213   2e-59   
gb|KJB13844.1|  hypothetical protein B456_002G097100                    208   2e-59   Gossypium raimondii
ref|XP_003593442.1|  Cytochrome P450                                    206   2e-59   
gb|KHN36161.1|  Cytochrome P450 71D8                                    207   2e-59   Glycine soja [wild soybean]
ref|XP_006365912.1|  PREDICTED: premnaspirodiene oxygenase-like         208   2e-59   Solanum tuberosum [potatoes]
ref|XP_004511997.1|  PREDICTED: cytochrome P450 71D8-like               208   2e-59   Cicer arietinum [garbanzo]
ref|XP_004491658.1|  PREDICTED: uncharacterized protein LOC101503808    214   2e-59   
ref|XP_004228510.1|  PREDICTED: premnaspirodiene oxygenase-like         208   2e-59   Solanum lycopersicum
gb|EMS48703.1|  Premnaspirodiene oxygenase                              208   2e-59   Triticum urartu
ref|XP_007022417.1|  Cytochrome P450 71D10, putative                    208   2e-59   
gb|KCW62218.1|  hypothetical protein EUGRSUZ_H04879                     207   2e-59   Eucalyptus grandis [rose gum]
gb|AGO03790.1|  costunolide                                             207   3e-59   Tanacetum cinerariifolium [pyrethrum]
ref|XP_004242036.1|  PREDICTED: premnaspirodiene oxygenase-like         207   3e-59   Solanum lycopersicum
emb|CDP18841.1|  unnamed protein product                                208   3e-59   Coffea canephora [robusta coffee]
dbj|BAJ90648.1|  predicted protein                                      208   3e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB61438.1|  hypothetical protein B456_009G358400                    207   3e-59   Gossypium raimondii
ref|XP_006355212.1|  PREDICTED: premnaspirodiene oxygenase-like         207   3e-59   Solanum tuberosum [potatoes]
gb|EMT16961.1|  Cytochrome P450 71D7                                    206   3e-59   
ref|XP_003617704.1|  Cytochrome P450                                    207   3e-59   Medicago truncatula
gb|KDO62257.1|  hypothetical protein CISIN_1g038414mg                   207   4e-59   Citrus sinensis [apfelsine]
ref|XP_004242219.2|  PREDICTED: cytochrome P450 71D7-like               207   4e-59   Solanum lycopersicum
ref|XP_004516743.1|  PREDICTED: cytochrome P450 71D10-like              207   5e-59   
ref|XP_011097779.1|  PREDICTED: cytochrome P450 71D11-like              207   5e-59   Sesamum indicum [beniseed]
gb|AJD25166.1|  cytochrome P450 CYP71D413                               207   5e-59   Salvia miltiorrhiza [Chinese salvia]
gb|KHG11859.1|  Cytochrome P450                                         207   5e-59   Gossypium arboreum [tree cotton]
ref|XP_012077832.1|  PREDICTED: cytochrome P450 71D10-like              202   5e-59   Jatropha curcas
ref|XP_003617701.1|  Cytochrome P450                                    207   6e-59   
gb|AIS36973.1|  (-)-limonene 3 hydroxylase PM17 isoform-like cyto...    199   6e-59   Mentha aquatica [water mint]
ref|XP_003589691.1|  Cytochrome P450                                    207   6e-59   Medicago truncatula
emb|CBI39704.3|  unnamed protein product                                201   6e-59   Vitis vinifera
ref|XP_009345818.1|  PREDICTED: cytochrome P450 71D9-like               207   6e-59   Pyrus x bretschneideri [bai li]
ref|XP_010104090.1|  Cytochrome P450 71D10                              207   6e-59   Morus notabilis
ref|XP_006421138.1|  hypothetical protein CICLE_v10004785mg             207   7e-59   
ref|XP_003517257.1|  PREDICTED: cytochrome P450 71D8-like               207   7e-59   Glycine max [soybeans]
ref|XP_010027348.1|  PREDICTED: cytochrome P450 CYP71D312-like          207   7e-59   Eucalyptus grandis [rose gum]
ref|XP_007146291.1|  hypothetical protein PHAVU_006G028100g             207   7e-59   Phaseolus vulgaris [French bean]
gb|KHG24310.1|  Cytochrome P450                                         205   8e-59   Gossypium arboreum [tree cotton]
gb|AHN62856.1|  costunolide synthase                                    206   8e-59   Tanacetum parthenium [feverfew]
ref|XP_010067806.1|  PREDICTED: premnaspirodiene oxygenase-like         206   8e-59   Eucalyptus grandis [rose gum]
ref|XP_003600327.1|  Cytochrome P450                                    206   8e-59   Medicago truncatula
gb|KDP39027.1|  hypothetical protein JCGZ_00784                         202   9e-59   Jatropha curcas
ref|XP_006447873.1|  hypothetical protein CICLE_v10017726mg             206   9e-59   
gb|KHN08718.1|  Cytochrome P450 71D8                                    206   1e-58   Glycine soja [wild soybean]
gb|KCW66019.1|  hypothetical protein EUGRSUZ_G03311                     206   1e-58   Eucalyptus grandis [rose gum]
gb|KJB61457.1|  hypothetical protein B456_009G359000                    206   1e-58   Gossypium raimondii
ref|XP_003535171.1|  PREDICTED: cytochrome P450 71D8-like               206   1e-58   Glycine max [soybeans]
ref|XP_010687580.1|  PREDICTED: cytochrome P450 71D11-like              206   1e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003537212.1|  PREDICTED: cytochrome P450 71D8-like               206   1e-58   
ref|XP_003535173.1|  PREDICTED: cytochrome P450 71D8-like               206   1e-58   
ref|XP_003535170.1|  PREDICTED: cytochrome P450 71D8-like               206   1e-58   
ref|NP_001047187.1|  Os02g0570500                                       206   1e-58   
gb|KCW55753.1|  hypothetical protein EUGRSUZ_I01583                     206   1e-58   Eucalyptus grandis [rose gum]
emb|CDP21848.1|  unnamed protein product                                204   1e-58   Coffea canephora [robusta coffee]
gb|KJB61456.1|  hypothetical protein B456_009G359000                    206   1e-58   Gossypium raimondii
ref|XP_008219722.1|  PREDICTED: premnaspirodiene oxygenase-like         206   1e-58   
gb|EAY86362.1|  hypothetical protein OsI_07741                          206   1e-58   Oryza sativa Indica Group [Indian rice]
sp|A3A871.1|C71Z6_ORYSJ  RecName: Full=Ent-isokaurene C2-hydroxyl...    206   1e-58   Oryza sativa Japonica Group [Japonica rice]
gb|KDP39016.1|  hypothetical protein JCGZ_00773                         205   1e-58   Jatropha curcas
gb|KEH25844.1|  cytochrome P450 family 71 protein                       206   1e-58   Medicago truncatula
gb|KEH29697.1|  cytochrome P450 family 71 protein                       206   1e-58   Medicago truncatula
ref|XP_004516744.1|  PREDICTED: cytochrome P450 71D10-like              206   2e-58   Cicer arietinum [garbanzo]
ref|NP_001047188.1|  Os02g0570700                                       206   2e-58   
ref|XP_004516745.1|  PREDICTED: cytochrome P450 71D10-like              206   2e-58   Cicer arietinum [garbanzo]
gb|EMT16962.1|  Cytochrome P450 71D7                                    205   2e-58   
ref|XP_006452552.1|  hypothetical protein CICLE_v10010406mg             205   2e-58   
ref|XP_010030713.1|  PREDICTED: premnaspirodiene oxygenase-like         205   2e-58   
gb|KDP39286.1|  hypothetical protein JCGZ_01043                         204   2e-58   
ref|XP_009402814.1|  PREDICTED: premnaspirodiene oxygenase-like         206   2e-58   
gb|KCW62216.1|  hypothetical protein EUGRSUZ_H04877                     205   2e-58   
ref|XP_010910161.1|  PREDICTED: premnaspirodiene oxygenase-like         205   2e-58   
ref|XP_007148447.1|  hypothetical protein PHAVU_006G209600g             205   3e-58   
ref|XP_010061472.1|  PREDICTED: cytochrome P450 71D11-like              205   3e-58   
dbj|BAK05439.1|  predicted protein                                      205   3e-58   
ref|XP_006351653.1|  PREDICTED: premnaspirodiene oxygenase-like         205   3e-58   
ref|XP_007161221.1|  hypothetical protein PHAVU_001G052100g             205   3e-58   
ref|XP_003535169.1|  PREDICTED: cytochrome P450 71D8-like               205   3e-58   
ref|XP_007148446.1|  hypothetical protein PHAVU_006G209500g             205   3e-58   
ref|XP_010687582.1|  PREDICTED: cytochrome P450 71D10-like              205   3e-58   
gb|KCW68416.1|  hypothetical protein EUGRSUZ_F02065                     206   3e-58   
gb|AAO32823.1|  cytochrome P450 71D2                                    203   3e-58   
ref|XP_009772938.1|  PREDICTED: premnaspirodiene oxygenase-like         205   4e-58   
ref|XP_004247352.1|  PREDICTED: premnaspirodiene oxygenase-like         205   4e-58   
gb|ABC59080.1|  cytochrome P450 monooxygenase CYP71D64                  205   4e-58   
ref|XP_011086258.1|  PREDICTED: premnaspirodiene oxygenase-like         201   4e-58   
ref|XP_003617706.1|  Cytochrome P450 71D10                              204   4e-58   
ref|XP_004295869.1|  PREDICTED: cytochrome P450 71D11-like              205   5e-58   
ref|XP_012087348.1|  PREDICTED: cytochrome P450 71D8-like               204   5e-58   
ref|XP_008779112.1|  PREDICTED: premnaspirodiene oxygenase-like         204   5e-58   
ref|XP_009624011.1|  PREDICTED: premnaspirodiene oxygenase-like i...    203   5e-58   
ref|XP_007212707.1|  hypothetical protein PRUPE_ppa018666mg             204   5e-58   
ref|XP_012071202.1|  PREDICTED: premnaspirodiene oxygenase-like         204   6e-58   
ref|XP_008779115.1|  PREDICTED: cytochrome P450 71A1-like               198   6e-58   
ref|XP_004243471.1|  PREDICTED: premnaspirodiene oxygenase-like         204   6e-58   
ref|XP_006590052.1|  PREDICTED: cytochrome P450 71D8-like               204   7e-58   
ref|XP_003617715.1|  Cytochrome P450                                    204   7e-58   
sp|Q6WKZ0.1|C7D94_MENGR  RecName: Full=Cytochrome P450 71D94            204   8e-58   
gb|KHN29895.1|  Cytochrome P450 71D11                                   200   8e-58   
ref|XP_006493509.1|  PREDICTED: cytochrome P450 71D11-like              204   9e-58   
emb|CDP13734.1|  unnamed protein product                                208   9e-58   
ref|XP_003520242.1|  PREDICTED: cytochrome P450 71D8-like               204   9e-58   
gb|ABO32531.1|  cytochrome P450-dependent monooxygenase-like protein    204   1e-57   
gb|KHN42275.1|  Cytochrome P450 71D8                                    204   1e-57   
gb|KDO41344.1|  hypothetical protein CISIN_1g016245mg                   201   1e-57   
ref|XP_008807778.1|  PREDICTED: premnaspirodiene oxygenase-like         203   1e-57   
gb|KHN43881.1|  Cytochrome P450 71D10                                   202   1e-57   
ref|XP_009419632.1|  PREDICTED: premnaspirodiene oxygenase-like         203   1e-57   
gb|ADD84654.1|  CYP71D175                                               204   1e-57   
ref|XP_003529672.2|  PREDICTED: cytochrome P450 71D8-like               204   1e-57   
gb|EAY90852.1|  hypothetical protein OsI_12459                          203   2e-57   
ref|XP_003600328.1|  Cytochrome P450                                    203   2e-57   
gb|AIA09039.1|  costunolide synthase                                    203   2e-57   
gb|AIA09038.1|  costunolide synthase                                    203   2e-57   
ref|XP_011097781.1|  PREDICTED: premnaspirodiene oxygenase-like         203   2e-57   
ref|XP_009612418.1|  PREDICTED: premnaspirodiene oxygenase-like         203   2e-57   
gb|AIS36970.1|  (-)-limonene 6-hydroxylase-like cytochrome p450-d...    203   2e-57   
ref|XP_006349702.1|  PREDICTED: premnaspirodiene oxygenase-like         194   2e-57   
ref|XP_007020557.1|  Cytochrome P450, putative                          203   2e-57   
gb|EEE66810.1|  hypothetical protein OsJ_23564                          201   2e-57   
gb|EMS50166.1|  Premnaspirodiene oxygenase                              202   2e-57   
ref|XP_009624010.1|  PREDICTED: premnaspirodiene oxygenase-like i...    203   2e-57   
gb|EAY86363.1|  hypothetical protein OsI_07742                          203   2e-57   
ref|XP_012071259.1|  PREDICTED: cytochrome P450 71D9-like               203   2e-57   
gb|AIS36972.1|  (-)-limonene 3-hydroxylase PM2 isoform-like cytoc...    196   2e-57   
gb|KHG07193.1|  Cytochrome P450                                         201   2e-57   
ref|XP_012078956.1|  PREDICTED: premnaspirodiene oxygenase-like         203   2e-57   
ref|XP_006339045.1|  PREDICTED: premnaspirodiene oxygenase-like         203   2e-57   
ref|XP_004977177.1|  PREDICTED: ent-cassadiene C2-hydroxylase-like      202   3e-57   
gb|AGO03787.1|  cytochrome P450                                         202   3e-57   
ref|XP_002514826.1|  cytochrome P450, putative                          202   3e-57   
ref|NP_001050589.2|  Os03g0593600                                       202   3e-57   
ref|XP_010688182.1|  PREDICTED: cytochrome P450 71AV8-like              202   3e-57   
gb|EMS51621.1|  Cytochrome P450 71D7                                    202   3e-57   
ref|XP_009619866.1|  PREDICTED: premnaspirodiene oxygenase-like         202   3e-57   
ref|XP_009775980.1|  PREDICTED: premnaspirodiene oxygenase-like         202   3e-57   
sp|E3W9C4.1|C71A1_ZINZE  RecName: Full=Alpha-humulene 10-hydroxylase    202   3e-57   
ref|XP_003617705.1|  Cytochrome P450                                    202   3e-57   
ref|XP_006856442.1|  PREDICTED: cytochrome P450 71A1                    202   4e-57   
ref|XP_006427937.1|  hypothetical protein CICLE_v10025671mg             200   4e-57   
ref|XP_002443233.1|  hypothetical protein SORBIDRAFT_08g016110          202   4e-57   
gb|ABF97419.1|  Cytochrome P450 family protein, expressed               203   4e-57   
gb|AAO32822.1|  cytochrome P450 71D1                                    202   4e-57   
gb|AHK60843.1|  CYP71D2                                                 202   4e-57   
gb|KHG19246.1|  Cytochrome P450                                         201   4e-57   
gb|KHN33492.1|  Cytochrome P450 71D10-like protein                      202   5e-57   
gb|ACD42776.1|  cytochrome P450 71D1                                    202   5e-57   
ref|NP_001236165.1|  cytochrome P450 71D10                              202   5e-57   
ref|XP_004295868.2|  PREDICTED: cytochrome P450 71D11-like              203   5e-57   
ref|XP_008777955.1|  PREDICTED: premnaspirodiene oxygenase-like         202   5e-57   
gb|EMT29843.1|  Cytochrome P450 71D8                                    196   5e-57   
emb|CBI39705.3|  unnamed protein product                                209   6e-57   
sp|G3GBK0.1|C7BL3_CICIN  RecName: Full=Costunolide synthase; Shor...    201   6e-57   
ref|XP_007033576.1|  Cytochrome P450, putative                          197   6e-57   
ref|XP_008370832.1|  PREDICTED: premnaspirodiene oxygenase-like         201   7e-57   
ref|XP_010100302.1|  Cytochrome P450 71A1                               199   7e-57   
ref|XP_002513345.1|  cytochrome P450, putative                          201   7e-57   
sp|Q6IV13.1|C7D95_MENSP  RecName: Full=Cytochrome P450 71D95; Alt...    201   7e-57   
ref|XP_007153130.1|  hypothetical protein PHAVU_003G009200g             201   7e-57   
gb|EMT26276.1|  putative Cytochrome P450 71D11                          202   8e-57   
ref|XP_006339043.1|  PREDICTED: premnaspirodiene oxygenase-like         201   8e-57   
ref|XP_012071207.1|  PREDICTED: premnaspirodiene oxygenase-like         202   8e-57   
ref|XP_003545101.1|  PREDICTED: cytochrome P450 71D10-like              201   8e-57   
ref|XP_006575708.1|  PREDICTED: cytochrome P450 71D10-like              201   8e-57   
gb|ABR15423.1|  (-)P450 limonene-3-hydroxylase                          201   9e-57   
sp|Q6WKY9.1|C7D95_MENGR  RecName: Full=Cytochrome P450 71D95; Alt...    201   9e-57   
ref|XP_007226700.1|  hypothetical protein PRUPE_ppa020463mg             201   9e-57   
ref|NP_001059196.1|  Os07g0218700                                       201   1e-56   
sp|Q9XHE7.1|C71DD_MENPI  RecName: Full=Cytochrome P450 71D13; Alt...    201   1e-56   
gb|KHN25725.1|  Cytochrome P450 71D10                                   200   1e-56   
ref|XP_012085920.1|  PREDICTED: premnaspirodiene oxygenase-like         201   1e-56   
ref|XP_009796910.1|  PREDICTED: premnaspirodiene oxygenase-like         201   1e-56   
ref|XP_004973458.1|  PREDICTED: premnaspirodiene oxygenase-like         201   1e-56   
gb|AIM47558.1|  CYP726A4                                                201   1e-56   
gb|AIS36971.1|  (-)-limonene 3-hydroxylase-like cytochrome p450-d...    201   1e-56   
ref|XP_007214004.1|  hypothetical protein PRUPE_ppa014661mg             192   2e-56   
gb|EEE60760.1|  hypothetical protein OsJ_14321                          199   2e-56   
gb|EYU27425.1|  hypothetical protein MIMGU_mgv1a024069mg                201   2e-56   
gb|KJB82210.1|  hypothetical protein B456_013G181700                    200   2e-56   
ref|XP_006388368.1|  hypothetical protein POPTR_0206s00200g             192   2e-56   
gb|KJB27712.1|  hypothetical protein B456_005G005900                    200   2e-56   
gb|KHG00691.1|  Cytochrome P450                                         199   2e-56   
ref|XP_003617772.1|  Cytochrome P450                                    200   2e-56   
gb|KHN27239.1|  Cytochrome P450 71D11                                   199   2e-56   
dbj|BAJ98067.1|  predicted protein                                      200   2e-56   
gb|AJD25164.1|  cytochrome P450 CYP71D411                               200   2e-56   
ref|XP_011030953.1|  PREDICTED: tabersonine 16-hydroxylase-like         197   3e-56   
gb|AGN04218.1|  cytochrome P450                                         200   3e-56   
ref|NP_001052496.1|  Os04g0339000                                       200   3e-56   
ref|XP_002442197.1|  hypothetical protein SORBIDRAFT_08g016200          198   3e-56   
gb|ACR57218.1|  cytochrome P450                                         200   3e-56   
ref|XP_004965768.1|  PREDICTED: premnaspirodiene oxygenase-like         200   3e-56   
ref|XP_003566286.1|  PREDICTED: premnaspirodiene oxygenase-like         199   4e-56   
ref|XP_008345750.1|  PREDICTED: cytochrome P450 71D8-like               200   4e-56   
ref|XP_009385126.1|  PREDICTED: premnaspirodiene oxygenase-like         199   4e-56   
dbj|BAC20114.1|  putative cytochrome P450                               199   5e-56   
gb|EAY86118.1|  hypothetical protein OsI_07490                          199   5e-56   
ref|XP_007022425.1|  Cytochrome P450                                    199   6e-56   
gb|AFK45297.1|  unknown                                                 199   6e-56   
emb|CDP11811.1|  unnamed protein product                                199   6e-56   
ref|XP_010067809.1|  PREDICTED: cytochrome P450 71D10-like              191   7e-56   
ref|XP_007154033.1|  hypothetical protein PHAVU_003G085400g             199   7e-56   
gb|KCW66023.1|  hypothetical protein EUGRSUZ_G033141                    190   8e-56   
gb|KDP39288.1|  hypothetical protein JCGZ_01045                         197   8e-56   
sp|D5JBX1.1|GAO_BARSP  RecName: Full=Germacrene A oxidase; Short=...    198   9e-56   
gb|KEH16965.1|  cytochrome P450 family 71 protein                       198   9e-56   
ref|XP_009626802.1|  PREDICTED: cytochrome P450 71D7-like               198   9e-56   
ref|XP_012071211.1|  PREDICTED: cytochrome P450 71D9-like               199   9e-56   
ref|XP_003529194.2|  PREDICTED: cytochrome P450 71D11-like              199   1e-55   
ref|XP_010052635.1|  PREDICTED: premnaspirodiene oxygenase-like         196   1e-55   
dbj|BAJ89686.1|  predicted protein                                      198   1e-55   
gb|EEE56458.1|  hypothetical protein OsJ_05659                          196   1e-55   
ref|XP_002466860.1|  hypothetical protein SORBIDRAFT_01g015360          198   1e-55   
gb|KDP39284.1|  hypothetical protein JCGZ_01041                         197   1e-55   
ref|XP_002459492.1|  hypothetical protein SORBIDRAFT_02g005510          198   1e-55   
ref|XP_010256342.1|  PREDICTED: cytochrome P450 71A1-like               198   1e-55   
gb|KEH34023.1|  cytochrome P450 family 71 protein                       196   1e-55   
ref|XP_004305999.2|  PREDICTED: uncharacterized protein LOC101299609    204   1e-55   
ref|XP_010052769.1|  PREDICTED: premnaspirodiene oxygenase-like         198   1e-55   
emb|CDM81270.1|  unnamed protein product                                198   1e-55   
ref|XP_004506687.1|  PREDICTED: cytochrome P450 71D11-like              198   1e-55   
gb|EYU21985.1|  hypothetical protein MIMGU_mgv1a025303mg                191   1e-55   
ref|XP_003551494.1|  PREDICTED: cytochrome P450 71D10-like              198   1e-55   
gb|EMS53205.1|  Premnaspirodiene oxygenase                              197   1e-55   
emb|CDP11812.1|  unnamed protein product                                197   2e-55   
ref|XP_008810543.1|  PREDICTED: premnaspirodiene oxygenase-like         196   2e-55   
ref|XP_002310634.2|  hypothetical protein POPTR_0007s07300g             198   2e-55   
ref|NP_001046114.1|  Os02g0185300                                       198   2e-55   
ref|XP_004982488.1|  PREDICTED: ent-isokaurene C2-hydroxylase-lik...    198   2e-55   
gb|EEC72634.1|  hypothetical protein OsI_06139                          198   2e-55   
gb|EEE56459.1|  hypothetical protein OsJ_05660                          198   2e-55   
dbj|BAK03820.1|  predicted protein                                      198   2e-55   
ref|XP_003581127.1|  PREDICTED: premnaspirodiene oxygenase-like         197   2e-55   
ref|XP_006841384.1|  PREDICTED: cytochrome P450 71A1                    197   2e-55   
ref|XP_010102940.1|  Cytochrome P450 71A1                               198   2e-55   
ref|XP_009385309.1|  PREDICTED: premnaspirodiene oxygenase-like         197   2e-55   
ref|XP_002459491.1|  hypothetical protein SORBIDRAFT_02g005500          197   2e-55   
ref|XP_004247351.1|  PREDICTED: premnaspirodiene oxygenase-like         197   2e-55   
ref|XP_010911323.1|  PREDICTED: cytochrome P450 71A1-like               197   2e-55   
ref|XP_012074194.1|  PREDICTED: cytochrome P450 71D10-like              197   2e-55   
gb|KEH19671.1|  cytochrome P450 family 71 protein                       197   2e-55   
ref|XP_006585455.1|  PREDICTED: cytochrome P450 71D10-like              197   2e-55   
dbj|BAK04183.1|  predicted protein                                      197   2e-55   
sp|Q9XHE6.1|C71DF_MENPI  RecName: Full=Cytochrome P450 71D15; Alt...    197   3e-55   
ref|XP_003532742.2|  PREDICTED: cytochrome P450 71D10                   197   3e-55   
gb|EAZ23294.1|  hypothetical protein OsJ_06991                          197   3e-55   
gb|ABB46898.1|  Cytochrome P450 family protein, expressed               196   3e-55   
gb|AIM47557.1|  CYP726A3                                                197   3e-55   
ref|XP_011014080.1|  PREDICTED: cytochrome P450 71D11-like              197   3e-55   
gb|EMT12360.1|  Cytochrome P450 71D7                                    197   3e-55   
ref|XP_007142403.1|  hypothetical protein PHAVU_008G277500g             197   3e-55   
ref|NP_001046113.1|  Os02g0185200                                       197   3e-55   
ref|XP_003600334.1|  Cytochrome P450                                    199   3e-55   
ref|XP_004958622.1|  PREDICTED: premnaspirodiene oxygenase-like         197   3e-55   
gb|ADC94830.1|  (-)-limonene-7-hydroxylase                              196   4e-55   
sp|P24465.2|C71A1_PERAE  RecName: Full=Cytochrome P450 71A1; AltN...    197   4e-55   
emb|CDP07881.1|  unnamed protein product                                201   4e-55   
gb|EMS65006.1|  Premnaspirodiene oxygenase                              195   4e-55   
ref|XP_012071260.1|  PREDICTED: cytochrome P450 71D9-like               197   4e-55   
ref|XP_012071257.1|  PREDICTED: premnaspirodiene oxygenase-like         197   4e-55   
ref|XP_006646990.1|  PREDICTED: ent-cassadiene C2-hydroxylase-like      197   4e-55   
ref|NP_001047016.1|  Os02g0529800                                       197   4e-55   
gb|AES70585.2|  cytochrome P450 family 71 protein                       198   4e-55   
gb|EAY93604.1|  hypothetical protein OsI_15391                          197   4e-55   
ref|XP_006345633.1|  PREDICTED: premnaspirodiene oxygenase-like         196   4e-55   
ref|XP_004978934.1|  PREDICTED: ent-cassadiene C2-hydroxylase-like      197   4e-55   
ref|XP_006648385.1|  PREDICTED: ent-isokaurene C2-hydroxylase-like      196   5e-55   
ref|XP_011012702.1|  PREDICTED: cytochrome P450 71D11-like              197   5e-55   
gb|KHN26716.1|  Cytochrome P450 71D10                                   187   5e-55   
gb|KDP39022.1|  hypothetical protein JCGZ_00779                         195   6e-55   
emb|CDP07805.1|  unnamed protein product                                195   6e-55   
gb|KJB61440.1|  hypothetical protein B456_009G358600                    194   6e-55   
ref|XP_008227138.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    196   6e-55   
ref|XP_003617769.1|  Cytochrome P450                                    196   6e-55   
ref|XP_007146604.1|  hypothetical protein PHAVU_006G054100g             196   6e-55   
gb|AAK38084.1|  putative cytochrome P450                                196   6e-55   
emb|CDP07875.1|  unnamed protein product                                194   7e-55   
ref|XP_003570845.1|  PREDICTED: premnaspirodiene oxygenase-like         196   7e-55   
sp|E1B2Z9.1|C7AV8_CICIN  RecName: Full=Cytochrome P450 71AV8; Alt...    196   7e-55   
ref|XP_004249519.1|  PREDICTED: premnaspirodiene oxygenase-like         196   7e-55   
sp|F8S1I0.1|C7BL2_LACSA  RecName: Full=Costunolide synthase; Shor...    196   8e-55   
gb|EAZ44015.1|  hypothetical protein OsJ_28639                          196   8e-55   
emb|CDP07873.1|  unnamed protein product                                194   8e-55   
ref|NP_001064688.2|  Os10g0439800                                       196   8e-55   
ref|XP_010545272.1|  PREDICTED: cytochrome P450 71D11-like              196   8e-55   
ref|XP_008231957.1|  PREDICTED: cytochrome P450 CYP71D312-like          198   9e-55   
gb|AAK38083.1|  putative cytochrome P450                                196   9e-55   
ref|XP_002310636.2|  hypothetical protein POPTR_0007s07310g             196   9e-55   



>ref|XP_009606841.1| PREDICTED: 5-epiaristolochene 1,3-dihydroxylase-like, partial 
[Nicotiana tomentosiformis]
Length=399

 Score =   241 bits (614),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 148/197 (75%), Gaps = 4/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRV--EESNVDKLAYLNLVI  587
            DMF    +TS+T TV AM EM+KNP V  KAQAEVRE F+ +V  +E++V++L YL LVI
Sbjct  193  DMFAAGTETSSTTTVWAMAEMMKNPSVFTKAQAEVREAFRDKVSFDENDVEELKYLKLVI  252

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE  +D+ + GYTIP +T+V++N WA+ RDP+YW+D ESFKPERF
Sbjct  253  KETLRLHPPSPLLVPRECREDTDINGYTIPAKTKVMVNVWALGRDPKYWDDAESFKPERF  312

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   MDF   + F+++PFG G+R+CPG+SFGLA++Y PLA LLYHFDW+LP GI P  L 
Sbjct  313  EQCSMDFF-GNNFEFLPFGGGRRICPGMSFGLANLYLPLAQLLYHFDWKLPTGIKPRDLD  371

Query  229  LTELPRMAMGVKNDIFF  179
            LTEL  + +  K D++ 
Sbjct  372  LTELSGITIARKGDLYL  388



>ref|XP_009801864.1| PREDICTED: LOW QUALITY PROTEIN: 5-epiaristolochene 1,3-dihydroxylase-like 
[Nicotiana sylvestris]
Length=504

 Score =   238 bits (608),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 148/197 (75%), Gaps = 4/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRV--EESNVDKLAYLNLVI  587
            DMF    +TS+T TV AM EM+KNP V  KAQAEVRE F+ +V  +E++V++L YL LVI
Sbjct  299  DMFAAGTETSSTTTVWAMAEMMKNPSVFTKAQAEVREAFRDKVSFDENDVEELKYLKLVI  358

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE  +D+ + GYTIP +T+V++N WA+ RDP+YW+D ESFKPERF
Sbjct  359  KETLRLHPPSPLLVPRECREDTDINGYTIPAKTKVMVNVWALGRDPKYWDDAESFKPERF  418

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +DF   + F+++PFG G+R+CPG+SFGLA++Y PLA LLYHFDW+LP GI P  L 
Sbjct  419  EQCSVDFF-GNNFEFLPFGGGRRICPGMSFGLANLYLPLAQLLYHFDWKLPTGIKPRDLD  477

Query  229  LTELPRMAMGVKNDIFF  179
            LTEL  + +  K D++ 
Sbjct  478  LTELSGITIARKGDLYL  494



>emb|CDP20313.1| unnamed protein product [Coffea canephora]
Length=247

 Score =   230 bits (587),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 144/183 (79%), Gaps = 4/183 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    +TS+T    AM EMV+NP V+AKAQ+E+R  FKG+  +EE+++ +L YL LVI
Sbjct  39   DVFSAGTETSSTTVEWAMSEMVRNPNVMAKAQSEIRTAFKGKKKIEETDIQELKYLRLVI  98

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPPGP++  RE  ++  + GYTIP +TRVLINAWAI RDP YW DPESFKPERF
Sbjct  99   KETLRLHPPGPLLVPRECREECEIEGYTIPVKTRVLINAWAIGRDPDYWNDPESFKPERF  158

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            + +P+DFT  + F+Y+PFG+G+RMCPGISFGLA+V+ PLA LLYHFDW+LP G+ P  L 
Sbjct  159  KSNPVDFT-GTHFEYLPFGAGRRMCPGISFGLANVHLPLALLLYHFDWKLPDGLDPCDLD  217

Query  229  LTE  221
            ++E
Sbjct  218  MSE  220



>sp|P93530.1|C71D6_SOLCH RecName: Full=Cytochrome P450 71D6 [Solanum chacoense]
 gb|AAB61964.1| putative cytochrome P450 [Solanum chacoense]
Length=501

 Score =   238 bits (608),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 148/198 (75%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRV--EESNVDKLAYLNLVI  587
            DMF    +TS+T TV AMVEM+KNPRVLAKAQAEVRE F+ +V  +E++V+ L YL LVI
Sbjct  299  DMFAAGTETSSTTTVWAMVEMLKNPRVLAKAQAEVREAFRNKVTFDENDVEDLKYLKLVI  358

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KETMRLH P P++  RE  K++ + GYTIP +T+V++N WA+ RDP+YW+D E FKPERF
Sbjct  359  KETMRLHAPIPLLVPRECRKETEINGYTIPVKTKVMVNVWALGRDPKYWDDVECFKPERF  418

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +DF   + F+Y+PFG G+R+CPG SFGLA+ Y PLA LL HFDW+LP G+ P  L 
Sbjct  419  EQCSIDFI-GNNFEYLPFGGGRRICPGTSFGLANDYLPLAQLLCHFDWKLPTGMEPKDLD  477

Query  229  LTELPRMAMGVKNDIFFI  176
            LTEL  M+   K+D++ I
Sbjct  478  LTELAGMSAASKDDLYLI  495



>ref|XP_009625417.1| PREDICTED: 5-epiaristolochene 1,3-dihydroxylase [Nicotiana tomentosiformis]
Length=504

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 147/197 (75%), Gaps = 4/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRV--EESNVDKLAYLNLVI  587
            DMF    +TS+T TV AM EM+KNP V  KAQAEVRE FK +V  +E++ ++L YL LVI
Sbjct  299  DMFAAGTETSSTTTVWAMAEMMKNPSVFTKAQAEVREAFKNKVTFDENDAEELKYLKLVI  358

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE  +D+ + GYTIP +T+V++N WA+ RDP+YW+D ESFKPERF
Sbjct  359  KETLRLHPPSPLLVPRECREDTDINGYTIPAKTKVMVNVWALGRDPKYWDDAESFKPERF  418

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +DF   + F+++PFG G+R+CPG+SFGLA++Y PLA LLYHFDW+LP G+ P  L 
Sbjct  419  EQCSVDFF-GNNFEFLPFGGGRRICPGMSFGLANLYLPLAQLLYHFDWKLPTGMKPRDLD  477

Query  229  LTELPRMAMGVKNDIFF  179
            LTEL  + +  K DI+ 
Sbjct  478  LTELAGITIARKGDIYL  494



>ref|XP_004250027.1| PREDICTED: cytochrome P450 71D7 [Solanum lycopersicum]
Length=508

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 153/198 (77%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRV--EESNVDKLAYLNLVI  587
            D+F G  DT++ I V AM EM++NP +LAKAQAEVRE FKG+V  ++ +V++L YL LV+
Sbjct  306  DIFAGGTDTTSIIIVWAMAEMMRNPSILAKAQAEVREAFKGKVKFDKYDVEELKYLKLVV  365

Query  586  KETMRLHPPGPV-IYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHP  P+ + RE  +++ + GYTIP +T++LIN WA+ RDP+YW+DPESFKPERF
Sbjct  366  KETLRLHPSVPLSVPRECREETDINGYTIPLKTKILINVWALGRDPEYWDDPESFKPERF  425

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +DF   + F+++PFGSG+R+CPGISFGLA++Y+ LA  LYHFDW+LP+G+ P  L 
Sbjct  426  EQCSVDFI-GNNFEFLPFGSGRRVCPGISFGLANIYSSLAQSLYHFDWKLPNGMDPTDLD  484

Query  229  LTELPRMAMGVKNDIFFI  176
            LTE    + G+KND++ I
Sbjct  485  LTESDGGSTGMKNDLYLI  502



>gb|ABC69421.1| CYP71D20v2 [Nicotiana tabacum]
Length=504

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 148/197 (75%), Gaps = 4/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRV--EESNVDKLAYLNLVI  587
            DMF    +TS+T TV AM EM+KNP V AKAQAEVRE F+ +V  +E++V++L YL LVI
Sbjct  299  DMFAAGTETSSTTTVWAMAEMMKNPSVFAKAQAEVREAFRDKVSFDENDVEELKYLKLVI  358

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE  +D+ + GYTIP +T+V++N WA+ RDP+YW+D ESFKPERF
Sbjct  359  KETLRLHPPSPLLVPRECREDTDINGYTIPAKTKVMVNVWALGRDPKYWDDAESFKPERF  418

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +D    + F+++PFG G+R+CPG+SFGLA++Y PLA LLYHFDW+LP GI P  L 
Sbjct  419  EQCSVDIF-GNNFEFLPFGGGRRICPGMSFGLANLYLPLAQLLYHFDWKLPTGIKPRDLD  477

Query  229  LTELPRMAMGVKNDIFF  179
            LTEL  + +  K D++ 
Sbjct  478  LTELSGITIARKGDLYL  494



>emb|CAC24711.1| cytochrome P450 [Solanum tuberosum]
Length=502

 Score =   238 bits (606),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 150/198 (76%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS++  V AMV+M+KNP V+AKAQAEVRE FK +   +E++V++L YL LVI
Sbjct  297  DMFAAGTETSSSTLVWAMVQMMKNPSVIAKAQAEVREAFKDKETFDENDVEELKYLKLVI  356

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE  +++ + GYTIP +T+V++N WA+ RDP+YW+D ESFKPERF
Sbjct  357  KETLRLHPPVPLLVPRECREETDINGYTIPVKTKVMVNVWALGRDPKYWDDAESFKPERF  416

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +DF   + F+Y+PFG G+R+CPGISFGLA+VY PLAHLLYHFDW+LP G+ P  L 
Sbjct  417  EQRSVDFV-GNNFEYLPFGGGRRICPGISFGLANVYLPLAHLLYHFDWKLPIGMEPKDLN  475

Query  229  LTELPRMAMGVKNDIFFI  176
            LTEL  +    K+D+  +
Sbjct  476  LTELVGVTAARKDDLILV  493



>ref|XP_006350394.1| PREDICTED: cytochrome P450 71D6-like [Solanum tuberosum]
Length=501

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 149/198 (75%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRV--EESNVDKLAYLNLVI  587
            DMF    +TS+T TV AM EM+KNP VLAKAQAEVRE F+ +V  +E++V++L YL LVI
Sbjct  299  DMFAAGTETSSTTTVWAMAEMLKNPSVLAKAQAEVREAFRNKVTLDENDVEELKYLKLVI  358

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KETMRLH P P++  RE  +++ + GYTIP +T+V++N WA+ RDP+YW+D ESFKPERF
Sbjct  359  KETMRLHAPIPLLVPRECREETEINGYTIPVKTKVMVNVWALGRDPKYWDDVESFKPERF  418

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +DF   + F+Y+PFG G+R+CPGISFGLA+VY PLA LL  FDW+LP G+ P  L 
Sbjct  419  EQCSIDFI-GNNFEYLPFGGGRRICPGISFGLANVYLPLAQLLCRFDWKLPAGMEPKDLD  477

Query  229  LTELPRMAMGVKNDIFFI  176
            LTEL  M++  K D++ I
Sbjct  478  LTELAGMSVARKGDLYLI  495



>ref|XP_006350396.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=502

 Score =   236 bits (603),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 149/198 (75%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS++  V AMV+M+KNP V AKAQAEVRE FK +   +E++V++L YL LVI
Sbjct  297  DMFAAGTETSSSTLVWAMVQMMKNPSVFAKAQAEVREAFKDKETFDENDVEELKYLKLVI  356

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE  +++ +  YTIP +T+V++N WA+ RDP+YW+D ESFKPERF
Sbjct  357  KETLRLHPPVPLLVPRECREETDINSYTIPVKTKVMVNVWALGRDPKYWDDAESFKPERF  416

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +DF   + F+Y+PFGSG+R+CPGISFGLA+VY PLAHLLYHFDW+LP G+ P  L 
Sbjct  417  EQRSVDFV-GNNFEYLPFGSGRRICPGISFGLANVYLPLAHLLYHFDWKLPIGMEPKDLN  475

Query  229  LTELPRMAMGVKNDIFFI  176
            LTEL  +    K+D+  +
Sbjct  476  LTELVGVTAARKDDLILV  493



>ref|XP_004237369.1| PREDICTED: premnaspirodiene oxygenase [Solanum lycopersicum]
Length=501

 Score =   236 bits (602),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 149/198 (75%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS++  V AMV+++KNP V AKAQAEVRE FK R   +E++V++L YL LVI
Sbjct  299  DMFAAGTETSSSTLVWAMVQLMKNPSVFAKAQAEVREAFKDRETFDENDVEELKYLKLVI  358

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE  +++ + GYT+P +T+V++N WA+ RDP+YW+D ESFKPERF
Sbjct  359  KETLRLHPPVPLLVPRECREETDINGYTVPVKTKVMVNVWALGRDPKYWDDAESFKPERF  418

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +DF   + F+Y+PFG G+R+CPGISFGLA+VY PLA LLYHFDW+LP+G+ P  L 
Sbjct  419  EQSSVDFI-GNNFEYLPFGGGRRICPGISFGLANVYLPLAQLLYHFDWKLPNGMEPKDLN  477

Query  229  LTELPRMAMGVKNDIFFI  176
            LTEL  +    K+D+  +
Sbjct  478  LTELVGVTAARKDDLILV  495



>gb|AIZ01224.2| epi-aristolochene dihydroxylase [Nicotiana benthamiana]
Length=482

 Score =   235 bits (600),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 143/184 (78%), Gaps = 4/184 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRV--EESNVDKLAYLNLVI  587
            DMF    +TS+T TV AM EM+KNPRV  KAQAEVRE F+ +V  +E++V++L YL LVI
Sbjct  299  DMFAAGTETSSTTTVWAMAEMMKNPRVFTKAQAEVREAFRDKVSFDENDVEELKYLKLVI  358

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE  +D+ + GYTIP +T+V++N WA+ RDP+YW+D ESFKPERF
Sbjct  359  KETLRLHPPSPLLVPRECREDTDINGYTIPAKTKVMVNVWALGRDPKYWDDAESFKPERF  418

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +DF   + F+++PFG G+R+CPG+SFGLA++Y PLA LLYHFDW+LP G+ P  L 
Sbjct  419  EQCSLDFY-GNNFEFLPFGGGRRICPGMSFGLANLYLPLAQLLYHFDWKLPTGMKPRDLD  477

Query  229  LTEL  218
            LTEL
Sbjct  478  LTEL  481



>gb|AAK62343.2| elicitor-inducible cytochrome P450 [Nicotiana tabacum]
Length=473

 Score =   234 bits (598),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 147/198 (74%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRV--EESNVDKLAYLNLVI  587
            DMF    +TS+T TV AM EM+KNP V  KAQAEVRE FK +V  +E + ++L YL LVI
Sbjct  268  DMFAAGTETSSTTTVWAMAEMMKNPNVFNKAQAEVRETFKDKVTFDEIDAEELEYLKLVI  327

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE  +D+ + GYTIP +T+V++N WA+ RDP+YW+D ESFKPERF
Sbjct  328  KETLRLHPPSPLLVPRECREDTDINGYTIPAKTKVMVNVWALGRDPKYWDDAESFKPERF  387

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +DF   + F+++PFG G+R+CPG+SFGLA++Y PLA LLYHFDW+LP G+ P  L 
Sbjct  388  EQCSVDFF-GNNFEFLPFGGGRRICPGMSFGLANLYLPLAQLLYHFDWKLPSGMMPGDLD  446

Query  229  LTELPRMAMGVKNDIFFI  176
            LTEL  + +  K D++ +
Sbjct  447  LTELAGITIARKGDLYLM  464



>sp|Q94FM7.2|C71DK_TOBAC RecName: Full=5-epiaristolochene 1,3-dihydroxylase; Short=NtEAH; 
AltName: Full=Cytochrome P450 71D20 [Nicotiana tabacum]
 gb|AAK62342.2| elicitor-inducible cytochrome P450 [Nicotiana tabacum]
Length=504

 Score =   235 bits (600),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 147/197 (75%), Gaps = 4/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRV--EESNVDKLAYLNLVI  587
            DMF    +TS+T TV AM EM+KNP V  KAQAEVRE F+ +V  +E++V++L YL LVI
Sbjct  299  DMFAAGTETSSTTTVWAMAEMMKNPSVFTKAQAEVREAFRDKVSFDENDVEELKYLKLVI  358

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE  +D+ + GYTIP +T+V++N WA+ RDP+YW+D ESFKPERF
Sbjct  359  KETLRLHPPSPLLVPRECREDTDINGYTIPAKTKVMVNVWALGRDPKYWDDAESFKPERF  418

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +DF   + F+++PFG G+R+CPG+SFGLA++Y PLA LLYHFDW+LP GI P  L 
Sbjct  419  EQCSVDFF-GNNFEFLPFGGGRRICPGMSFGLANLYLPLAQLLYHFDWKLPTGIMPRDLD  477

Query  229  LTELPRMAMGVKNDIFF  179
            LTEL  + +  K  ++ 
Sbjct  478  LTELSGITIARKGGLYL  494



>ref|XP_006350417.1| PREDICTED: cytochrome P450 71D7-like [Solanum tuberosum]
Length=500

 Score =   235 bits (600),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 148/198 (75%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRVE--ESNVDKLAYLNLVI  587
            D+F    +TS+T TV AM EM KNP +L+KAQAEVRE F+ +V+  E++V+ L YL LVI
Sbjct  298  DLFAAGTETSSTTTVWAMAEMFKNPTLLSKAQAEVREAFRNKVKFGENDVEDLKYLKLVI  357

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+R+H P P++  RE  +++ + GYTIP +T+V++N WA+ RDP+YW++ ESFKPERF
Sbjct  358  KETLRIHAPIPLLVPRECREETKINGYTIPMKTKVMVNVWALGRDPKYWDNAESFKPERF  417

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E+  MDF   + F+++PFG G+R+CPGISFGLA++Y PLA LLYHFDW+LP GI P  L 
Sbjct  418  EECSMDFV-GNNFEFLPFGGGRRICPGISFGLANIYLPLAQLLYHFDWKLPTGIEPRDLD  476

Query  229  LTELPRMAMGVKNDIFFI  176
            L EL R+    K D++ I
Sbjct  477  LIELSRITASRKGDLYLI  494



>ref|XP_009771988.1| PREDICTED: 5-epiaristolochene 1,3-dihydroxylase-like [Nicotiana 
sylvestris]
Length=504

 Score =   235 bits (599),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 147/198 (74%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRV--EESNVDKLAYLNLVI  587
            DMF    +TS+T TV AM EM+KNP V  KAQAEVRE FK +V  +E + ++L YL LVI
Sbjct  299  DMFAAGTETSSTTTVWAMAEMMKNPNVFNKAQAEVRETFKDKVTFDEIDAEELEYLKLVI  358

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE  +D+ + GYTIP +T+V++N WA+ RDP+YW+D ESFKPERF
Sbjct  359  KETLRLHPPSPLLVPRECREDTDINGYTIPAKTKVMVNVWALGRDPKYWDDAESFKPERF  418

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +DF   + F+++PFG G+R+CPG+SFGLA++Y PLA LLYHFDW+LP G+ P  L 
Sbjct  419  EQCSVDFF-GNNFEFLPFGGGRRICPGMSFGLANLYLPLAQLLYHFDWKLPSGMMPGDLD  477

Query  229  LTELPRMAMGVKNDIFFI  176
            LTEL  + +  K D++ +
Sbjct  478  LTELAGITIARKGDLYLM  495



>gb|KHN42024.1| Cytochrome P450 71D8 [Glycine soja]
Length=459

 Score =   234 bits (596),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 150/198 (76%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F G +DTS +    AM EM+KNPRV  KAQAE+R+ F+ +  + ES++++L YL LVI
Sbjct  257  DVFAGGIDTSASTLEWAMTEMMKNPRVREKAQAELRQAFREKKIIHESDIEQLTYLKLVI  316

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE ++++++ GY IP +T+V+IN WAI RDP+YW D E F PERF
Sbjct  317  KETLRLHPPTPLLIPRECSEETIIAGYEIPVKTKVMINVWAICRDPKYWTDAERFVPERF  376

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            ED  +DF + + F+Y+PFG+G+R+CPGISFGLAS+  PLA LL +F+WELP+G+ P ++ 
Sbjct  377  EDSSIDF-KGNNFEYLPFGAGRRICPGISFGLASIMLPLAQLLLYFNWELPNGMKPESID  435

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   +A+G KND+  I
Sbjct  436  MTERFGLAIGRKNDLCLI  453



>sp|A6YIH8.1|C7D55_HYOMU RecName: Full=Premnaspirodiene oxygenase; Short=HPO; AltName: 
Full=Cytochrome P450 71D55 [Hyoscyamus muticus]
 gb|ABS00393.1| cytochrome P450 hydroxylase [Hyoscyamus muticus]
Length=502

 Score =   234 bits (597),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 150/198 (76%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS++  V AMV+M++NP +LAKAQAEVRE FKG+   +E++V++L YL LVI
Sbjct  297  DMFAAGTETSSSTLVWAMVQMMRNPTILAKAQAEVREAFKGKETFDENDVEELKYLKLVI  356

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE  +++ + GYTIP +T+V++N WA+ RDP+YW+D ++FKPERF
Sbjct  357  KETLRLHPPVPLLVPRECREETEINGYTIPVKTKVMVNVWALGRDPKYWDDADNFKPERF  416

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +DF   + F+Y+PFG G+R+CPGISFGLA+VY PLA LLYHFDW+LP G+ P  L 
Sbjct  417  EQCSVDFI-GNNFEYLPFGGGRRICPGISFGLANVYLPLAQLLYHFDWKLPTGMEPKDLD  475

Query  229  LTELPRMAMGVKNDIFFI  176
            LTEL  +    K+D+  +
Sbjct  476  LTELVGVTAARKSDLMLV  493



>sp|P93531.1|C71D7_SOLCH RecName: Full=Cytochrome P450 71D7 [Solanum chacoense]
 gb|AAB61965.1| putative cytochrome P450 [Solanum chacoense]
Length=500

 Score =   234 bits (596),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 147/198 (74%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRV--EESNVDKLAYLNLVI  587
            D+F    +TS+T TV AM EM+KNP V AKAQA+VRE F+ +V  +E++V++L YL LVI
Sbjct  298  DLFAAGTETSSTTTVWAMAEMLKNPSVFAKAQAKVREAFRDKVTFDENDVEELKYLKLVI  357

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KETMRLH P P++  RE  +++ + GYTIP +T+V++N WA+ RDP+YW+D ESFKPERF
Sbjct  358  KETMRLHAPVPLLVPRECREETEINGYTIPVKTKVMVNVWALGRDPKYWDDAESFKPERF  417

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +DF   + F+Y+PFG G+R+CPGISFGLA+VY PLA LLYHFDW+LP G+ P  L 
Sbjct  418  EQCSIDFI-GNNFEYLPFGGGRRICPGISFGLANVYLPLAQLLYHFDWKLPTGMEPKDLD  476

Query  229  LTELPRMAMGVKNDIFFI  176
            LTE   +    K D++ I
Sbjct  477  LTESAGITAARKGDLYLI  494



>emb|CDP20312.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   233 bits (593),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 144/183 (79%), Gaps = 4/183 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    +TS+T    AM EMV+NP V+AKAQ+E+R  FKG+  +EE+++ +L YL LVI
Sbjct  261  DVFSAGTETSSTTVEWAMSEMVRNPNVMAKAQSEIRTAFKGKKKIEETDIQELKYLRLVI  320

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPPGP++  RE  ++  + GYTIP +TRVLINAWAI RDP YW DPESFKPERF
Sbjct  321  KETLRLHPPGPLLVPRECREECEIEGYTIPVKTRVLINAWAIGRDPDYWNDPESFKPERF  380

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            + +P+DFT  + F+Y+PFG+G+RMCPGISFGLA+V+ PLA LLYHFDW+LP G+ P  L 
Sbjct  381  KSNPVDFT-GTHFEYLPFGAGRRMCPGISFGLANVHLPLALLLYHFDWKLPDGLDPCDLD  439

Query  229  LTE  221
            ++E
Sbjct  440  MSE  442



>ref|XP_006350393.1| PREDICTED: cytochrome P450 71D7-like [Solanum tuberosum]
Length=500

 Score =   233 bits (593),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 147/198 (74%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRV--EESNVDKLAYLNLVI  587
            D+F    +TS+T TV AM EM+KNP V AKAQAEVRE F+ +V  + ++V++L YL LVI
Sbjct  298  DLFAAGTETSSTTTVWAMAEMLKNPSVFAKAQAEVREAFRDKVTFDGNDVEELKYLKLVI  357

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KETMRLH P P++  RE  +++ + GYTIP +T+V++N WA+ RDP+YW+D ESFKPERF
Sbjct  358  KETMRLHAPVPLLVPRECREETEINGYTIPVKTKVMVNVWALGRDPKYWDDAESFKPERF  417

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +DF   + F+Y+PFG G+R+CPGISFGLA+VY PLA LLYHFDW+LP G+ P  L 
Sbjct  418  EQCSIDFI-GNNFEYLPFGGGRRICPGISFGLANVYFPLAQLLYHFDWKLPTGMEPKDLD  476

Query  229  LTELPRMAMGVKNDIFFI  176
            LTE   + +  K D++ I
Sbjct  477  LTESAGITVARKGDLYLI  494



>dbj|BAN58140.1| putative premaspirodiene oxygenase [Hyoscyamus albus]
Length=502

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 148/198 (75%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS++  V AMV+M++NP +LAKAQ EVRE FKG+   +E++V++L YL LVI
Sbjct  297  DMFAAGTETSSSTLVWAMVQMMRNPTILAKAQEEVREAFKGKETFDENDVEELKYLKLVI  356

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE  +++ + GYTIP +T+V++N WA+ RDP+YWED + FKPERF
Sbjct  357  KETLRLHPPVPLLVPRECREETEIDGYTIPVKTKVMVNVWALGRDPKYWEDADDFKPERF  416

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +DF   + F+Y+PFG G+R+CPGISFGLA+VY PLA LLYHFDW+LP G+ P  L 
Sbjct  417  EQCSVDFI-GNNFEYLPFGGGRRICPGISFGLANVYLPLAQLLYHFDWKLPTGMEPKDLD  475

Query  229  LTELPRMAMGVKNDIFFI  176
            LTEL  +    K+D+  +
Sbjct  476  LTELVGVTAARKSDLMLV  493



>ref|XP_006350395.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=502

 Score =   231 bits (588),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 148/198 (75%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS++    AMV+M+KNP V+AKAQAEVRE FK +   +E++V++L YL LVI
Sbjct  297  DMFAAETETSSSTLDWAMVQMMKNPSVIAKAQAEVREAFKDKETFDENDVEELKYLKLVI  356

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE  +++ + GYTIP +T+V++N WA+ RDP+YW+D ESFKPERF
Sbjct  357  KETLRLHPPVPLLVPRECREETDINGYTIPVKTKVMVNVWALGRDPKYWDDAESFKPERF  416

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +DF   + F+Y+PFG G+R+CPGISFGLA+VY PLA LLYHFDW+LP G+ P  L 
Sbjct  417  EQCSVDFI-GNNFEYLPFGGGRRICPGISFGLANVYLPLAQLLYHFDWKLPIGMEPKDLN  475

Query  229  LTELPRMAMGVKNDIFFI  176
            LTEL  +    K+D+  +
Sbjct  476  LTELVGVTAARKDDLILV  493



>emb|CDP07877.1| unnamed protein product [Coffea canephora]
Length=207

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 141/185 (76%), Gaps = 4/185 (2%)
 Frame = -2

Query  766  M*DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNL  593
            M D+F G  +TS+T    AM E+++NPR + KAQ+EVR  F G+  +EE+++ +L YL  
Sbjct  1    MQDIFSGGTETSSTTVEWAMSELMRNPRAMVKAQSEVRNAFVGKKTIEETDIQELKYLKS  60

Query  592  VIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPE  416
            VIKET+RLHPP P++  R+  + + + GY IP +TRV++NAWAI RDP+YW+DPESFKPE
Sbjct  61   VIKETLRLHPPVPLLVPRKCRQVTEIDGYIIPIKTRVIVNAWAIGRDPEYWDDPESFKPE  120

Query  415  RFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHT  236
            RFE+  +DF+    F+Y+PFG+G+R+CPGISFGLA+V  PLA LLYHFDW+LP+G+ P  
Sbjct  121  RFENSSVDFS-GCHFQYVPFGAGRRICPGISFGLANVELPLALLLYHFDWKLPNGLKPSD  179

Query  235  LKLTE  221
            L +TE
Sbjct  180  LDMTE  184



>ref|XP_003516584.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 gb|KHN36163.1| Cytochrome P450 71D8 [Glycine soja]
Length=505

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 147/198 (74%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+F   +DTS +    AM EM+KN RV  KAQAE+R+VF  K  + ES++++L YL LVI
Sbjct  303  DVFAAGIDTSASTLEWAMTEMMKNSRVREKAQAELRKVFGEKKIIHESDIEQLTYLKLVI  362

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE ++++++ GY IP +T+V+IN WAI RDP+YW D E F PERF
Sbjct  363  KETLRLHPPTPLLIPRECSEETIIGGYEIPVKTKVMINVWAICRDPKYWTDAERFVPERF  422

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            ED  +DF + + F+Y+PFG+G+R+CPGI+FGLAS+  PLA LL HF+WELP G+ P ++ 
Sbjct  423  EDSSIDF-KGNNFEYLPFGAGRRICPGITFGLASIMLPLAQLLLHFNWELPDGMKPESID  481

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   +A+G K+D+  I
Sbjct  482  MTERFGLAIGRKHDLCLI  499



>ref|XP_011081932.1| PREDICTED: cytochrome P450 71D95-like [Sesamum indicum]
Length=505

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 144/197 (73%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS+T    AM E+++NPRV+AK QAEVRE FKG+  VEES+V  L YL LVI
Sbjct  300  DMFSAGTETSSTTIDWAMAELMRNPRVMAKVQAEVREAFKGKTTVEESDVQALKYLKLVI  359

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET RLHPP P++ R    +  V GY+IP +++VLIN WA+ RDP+YW  PE+F+PERF+
Sbjct  360  KETFRLHPPIPLLPRACRDECEVNGYSIPLKSKVLINIWAMGRDPEYWHQPETFQPERFD  419

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            +  +DF   +  +Y+PFG+G+R+CPG++FGLA+V  PLA LLYHFDW++P G+TP  + +
Sbjct  420  NSCIDFL-GNNLEYIPFGAGRRICPGMNFGLANVELPLAQLLYHFDWKMPKGMTPDDVDM  478

Query  226  TELPRMAMGVKNDIFFI  176
            TE   +A+  KN +F +
Sbjct  479  TEAEGIAIARKNGLFLV  495



>ref|XP_009609586.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=210

 Score =   217 bits (553),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 148/199 (74%), Gaps = 5/199 (3%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRV---EESNVDKLAYLNLV  590
            DMF    DTS++  + A+ EM+KNP+V+AKAQAEVRE FKG+    E+++++KL YLNLV
Sbjct  4    DMFVAGSDTSSSTVIWALTEMMKNPKVMAKAQAEVREAFKGKKACDEDTDLEKLHYLNLV  63

Query  589  IKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPER  413
            IKET+RLHPP P++  RE  +++ + G+TIP +++VL+N WAI RDP+ W++PE F PER
Sbjct  64   IKETLRLHPPTPLLVPRECREETEIEGFTIPLKSKVLVNVWAIGRDPENWKNPECFIPER  123

Query  412  FEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTL  233
            FE+  ++FT  + F+ +PFG+G+R+CPG+ FGLA V  PLAHLL++FDW+LP GI    L
Sbjct  124  FENSSIEFT-GNHFQLLPFGAGRRICPGMQFGLALVTLPLAHLLHNFDWKLPEGINARDL  182

Query  232  KLTELPRMAMGVKNDIFFI  176
             +TE   ++   + D++ I
Sbjct  183  DMTEANGISARREKDLYLI  201



>ref|XP_011081934.1| PREDICTED: cytochrome P450 71D95-like [Sesamum indicum]
Length=501

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 145/197 (74%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS+T    AM E+++NPRV+AK QAEVRE FKG+  VEES+V  L YL LVI
Sbjct  298  DMFSAGTETSSTTIDWAMAELMRNPRVMAKVQAEVREAFKGKTTVEESDVQALKYLKLVI  357

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET RLHPP P++ R    +  V GYTIP +++V+IN WA+ RDP YW+ P++F+PERF+
Sbjct  358  KETFRLHPPIPLLPRACRDECKVNGYTIPLKSKVMINIWAMGRDPAYWDQPDTFQPERFD  417

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            ++ +DF   + F+Y+PFG+G+R+CPG++FGLA+V  PLA LLYHFDW++P G+TP  + +
Sbjct  418  NNSIDFL-GNNFEYIPFGAGRRICPGMNFGLANVELPLAQLLYHFDWKMPKGMTPDDIDM  476

Query  226  TELPRMAMGVKNDIFFI  176
            TE   +A+  +N +  +
Sbjct  477  TEAEGIAVSRRNALLLV  493



>ref|XP_009617020.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=227

 Score =   218 bits (554),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 148/199 (74%), Gaps = 5/199 (3%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRV---EESNVDKLAYLNLV  590
            DMF    DTS++  + A+ EM+KNP+V+AKAQAEVRE FKG+    E+++++KL YLNLV
Sbjct  21   DMFVAGSDTSSSTVIWALTEMMKNPKVMAKAQAEVREAFKGKKACDEDTDLEKLHYLNLV  80

Query  589  IKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPER  413
            IKET+RLHPP P++  RE  +++ + G+TIP +++VL+N WAI RDP+ W++PE F PER
Sbjct  81   IKETLRLHPPTPLLVPRECREETEIEGFTIPLKSKVLVNVWAIGRDPENWKNPECFIPER  140

Query  412  FEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTL  233
            FE+  ++FT  + F+ +PFG+G+R+CPG+ FGLA V  PLAHLL++FDW+LP GI    L
Sbjct  141  FENSSIEFT-GNHFQLLPFGAGRRICPGMQFGLALVTLPLAHLLHNFDWKLPEGINARDL  199

Query  232  KLTELPRMAMGVKNDIFFI  176
             +TE   ++   + D++ I
Sbjct  200  DMTEANGISARREKDLYLI  218



>ref|XP_004228509.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=495

 Score =   225 bits (573),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 144/198 (73%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF G  DTS+T+   AMVEM+KNP VL KAQ E+R  F G+    E++V++L YL LV+
Sbjct  290  DMFAGGTDTSSTLIDWAMVEMMKNPSVLLKAQDEIRNAFTGKETFNENDVEELKYLKLVV  349

Query  586  KETMRLHPPGPV-IYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET RLHPP P+ + RE  ++  + GY IP +T+VL+NA+AI RDP+YW D E FKPERF
Sbjct  350  KETFRLHPPAPLLVARECREEVDIDGYNIPLKTKVLVNAYAIGRDPKYWIDAECFKPERF  409

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +DF   + F+++PFGSG+R+CPGISFGLA+++ PLA LLYHFDW+LP GI P  L 
Sbjct  410  EQISVDFI-GNNFEFLPFGSGRRICPGISFGLANIFFPLAKLLYHFDWKLPIGINPSDLD  468

Query  229  LTELPRMAMGVKNDIFFI  176
            LTE   +A   K++++ I
Sbjct  469  LTESAGIACARKSNLYLI  486



>ref|XP_007156881.1| hypothetical protein PHAVU_002G025000g [Phaseolus vulgaris]
 gb|ESW28875.1| hypothetical protein PHAVU_002G025000g [Phaseolus vulgaris]
Length=504

 Score =   225 bits (573),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 146/198 (74%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F G +DTS +    AM EM+++PRV+ KAQAE+RE  + +  + E ++++L YL LV+
Sbjct  304  DIFAGGIDTSGSTIEWAMTEMMRSPRVMKKAQAELREALREKEIIHEKDLEQLPYLKLVV  363

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE ++ +++ GY IP +T+V+IN WAI RDP+YW D E F PERF
Sbjct  364  KETLRLHPPTPLLIPRECSERTIIDGYEIPVKTKVMINVWAICRDPKYWSDAEKFVPERF  423

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +DF + + F+Y+PFG+G+R+CPGISFGLAS+  PLA LLYHF+WELP+ +TP ++ 
Sbjct  424  EGSSIDF-KGNNFEYLPFGAGRRICPGISFGLASIMLPLARLLYHFNWELPNSMTPESID  482

Query  229  LTELPRMAMGVKNDIFFI  176
              E   MA+G KND+  I
Sbjct  483  TIERFGMAIGRKNDLCLI  500



>emb|CDP07872.1| unnamed protein product [Coffea canephora]
Length=504

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 144/195 (74%), Gaps = 4/195 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F G  +TS+T    AM EM++NP V+AKAQ+E+R  F+G+  +EE+++ +L YL  VI
Sbjct  302  DVFAGGTETSSTTVEWAMSEMIRNPGVMAKAQSEIRNAFRGKNTIEETDIQRLQYLRSVI  361

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE  ++  + GY IP +TRVL+NAWAI RDP+YW+D ESFKPERF
Sbjct  362  KETLRLHPPIPLLIPRECREECEIDGYIIPVKTRVLVNAWAIGRDPEYWDDAESFKPERF  421

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E+  +DF   S F+Y+PFG+G+R+CPGI+FGLA+V  PLA LLYHFDW LP+G+  + L 
Sbjct  422  ENSSIDFN-GSHFEYLPFGAGRRICPGIAFGLANVELPLALLLYHFDWRLPNGLDSNDLD  480

Query  229  LTELPRMAMGVKNDI  185
            +TE   +     N++
Sbjct  481  MTETVVITASRANNL  495



>ref|XP_009759476.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=208

 Score =   215 bits (548),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 147/200 (74%), Gaps = 4/200 (2%)
 Frame = -2

Query  766  M*DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNL  593
            M D+F    +TS+T    AMVEM+KNP V +KAQAEVR++ +G+    E +V++  YL +
Sbjct  1    MKDLFAAGTETSSTTINWAMVEMMKNPSVFSKAQAEVRKILRGKETFGEIDVEEFKYLKM  60

Query  592  VIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPE  416
            VIKET RLHP  P++  RE  +++ + GYTIP +T+V+INAWA+ RDP+YW+D ESFKPE
Sbjct  61   VIKETFRLHPALPLLLPRECREETDLNGYTIPLKTKVVINAWAMGRDPKYWDDVESFKPE  120

Query  415  RFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHT  236
            RFE + MD+   + ++Y+PFGSG+R+CPG+SFGLA+VY PLA LLYHFDW+LP GI P  
Sbjct  121  RFEHNSMDYI-GNNYEYLPFGSGRRICPGMSFGLANVYFPLAQLLYHFDWKLPTGINPSE  179

Query  235  LKLTELPRMAMGVKNDIFFI  176
            L LTE P  A   KND+  I
Sbjct  180  LDLTEAPGAACTTKNDLHLI  199



>ref|XP_011082374.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=517

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 143/197 (73%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS+T     M E+V+NPRV+AKAQAEVRE F G   ++E++V KL YL LVI
Sbjct  314  DMFSAGTETSSTAIDWTMAELVRNPRVMAKAQAEVREFFNGSEIIQENDVQKLKYLKLVI  373

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            +E++RLHPP P++ R + ++  + GYTIP + +VL+N WA+ RDP+YW +PE+F+PERFE
Sbjct  374  RESLRLHPPVPILPRASREEREISGYTIPAKVKVLVNNWAMQRDPKYWTNPETFEPERFE  433

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            +  +DF   + F+Y+PFG+G+RMCPG++FGLASV  PLA LLY F+W+LP G+    L +
Sbjct  434  NQSLDFL-GADFQYLPFGTGRRMCPGMTFGLASVELPLAQLLYSFNWKLPDGVKAEDLDM  492

Query  226  TELPRMAMGVKNDIFFI  176
             E P +    K+++F +
Sbjct  493  IENPGITASRKDNLFVV  509



>ref|XP_009612725.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=503

 Score =   224 bits (570),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 145/199 (73%), Gaps = 5/199 (3%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR---VEESNVDKLAYLNLV  590
            DMF    +TS+T  + A+ EM+K P VLAKAQAEVR+  KG+    +E ++DKL YL LV
Sbjct  300  DMFSAGSETSSTTIIWALAEMMKKPSVLAKAQAEVRQALKGKKISFQEIDIDKLKYLKLV  359

Query  589  IKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPER  413
            IKET+R+HPP P++  RE  +D+ + GY IP +TRV++NAWAI RDPQ W+DPESF PER
Sbjct  360  IKETLRMHPPIPLLVPRECMEDTKIDGYNIPFKTRVIVNAWAIGRDPQSWDDPESFTPER  419

Query  412  FEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTL  233
            FE++ +DF   +  +++PFG+G+R+CPG+ FGLA+V  PLA LLYHFDW+LP+G T    
Sbjct  420  FENNSIDFL-GNHHQFIPFGAGRRICPGMLFGLANVGQPLAQLLYHFDWKLPNGQTHQNF  478

Query  232  KLTELPRMAMGVKNDIFFI  176
             +TE P ++   K+D+  I
Sbjct  479  DMTESPGISATRKDDLILI  497



>ref|XP_004241764.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=513

 Score =   224 bits (570),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 139/197 (71%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRVE--ESNVDKLAYLNLVI  587
            DMF    +TS    + A+ EM++ P+++AKAQ EVR+VFKG++   E ++DKL YL LVI
Sbjct  308  DMFAAGTETSAATIIWALSEMMRKPKIMAKAQNEVRQVFKGKITFYEDDLDKLTYLKLVI  367

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RLHPP  ++ RE  K + + GYTIPP+TRVLIN WA+ RD + W+DPESF PERFE
Sbjct  368  KETLRLHPPSTLLPRECRKQTYINGYTIPPKTRVLINTWALGRDSESWDDPESFIPERFE  427

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            + P+D+   + +K++PFGSG+R+CPG+ FGL +V  PLA LLYHFDW LP+G  P  L +
Sbjct  428  NSPVDYM-GNYYKFIPFGSGRRICPGMQFGLTNVKHPLAQLLYHFDWVLPYGANPEDLDM  486

Query  226  TELPRMAMGVKNDIFFI  176
             E   ++     D+  I
Sbjct  487  IEKNGLSAAKHRDLCLI  503



>ref|XP_011082249.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=530

 Score =   224 bits (571),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 145/197 (74%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS+T    AM E+++NP VLAKAQAEVRE FKG+  +EE +V  L YL LVI
Sbjct  327  DMFSAGTETSSTTVDWAMAELMRNPHVLAKAQAEVRETFKGKETIEECDVHALKYLKLVI  386

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+R+HPP P++ R   ++  V GYTIP + +V++N WA+ RDP YW  PE+FKPERFE
Sbjct  387  KETLRMHPPIPLLPRACREECEVEGYTIPLKAKVMVNTWAMGRDPNYWPQPENFKPERFE  446

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            ++ +D+   + ++Y+PFGSG+R+CPG++FGLA+V  PLA LLYHFDW+LP+G+ P  + +
Sbjct  447  ENSIDYL-GAHYQYLPFGSGRRICPGMTFGLANVELPLAQLLYHFDWKLPNGMKPSDMDM  505

Query  226  TELPRMAMGVKNDIFFI  176
             +   +A+G K+++  I
Sbjct  506  ADAEGIAVGRKHNLLVI  522



>gb|AJD25162.1| cytochrome P450 CYP71D374 [Salvia miltiorrhiza]
Length=502

 Score =   223 bits (568),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 144/197 (73%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS+T TV AM EM++NPRV+ KAQAEVR   KG+  VEES+V +L YL LVI
Sbjct  299  DMFVAGTETSSTTTVWAMSEMMRNPRVMEKAQAEVRAALKGKAAVEESDVQELKYLKLVI  358

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET RLHPP P++ R+  ++  V GY+IP +T+V++N W++ RDPQYWE PE F+PERFE
Sbjct  359  KETFRLHPPIPLLPRQTREECKVDGYSIPIKTKVMLNIWSMGRDPQYWEQPEKFQPERFE  418

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            + P DF   + F+Y+PFG+G+R+CPG++FGLA++  PLA +LYHFDW+LP G++   L +
Sbjct  419  NSPKDFI-GNDFEYIPFGAGRRICPGLNFGLANIELPLAKILYHFDWKLPKGMSYERLDM  477

Query  226  TELPRMAMGVKNDIFFI  176
            +E   + +  K  +  I
Sbjct  478  SEGEGLTVSRKKPLIII  494



>ref|XP_004249520.2| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=536

 Score =   224 bits (570),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 144/200 (72%), Gaps = 4/200 (2%)
 Frame = -2

Query  766  M*DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNL  593
            M D+F    +TS+T    AM EM++NPRVL KAQAEVRE FKG+   +E  +++L YL  
Sbjct  330  MVDLFSAGTETSSTTATWAMTEMMRNPRVLKKAQAEVREAFKGKETFDEDVIEELKYLRQ  389

Query  592  VIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPE  416
            V+KET+RLHPP P++  RE  +++ + GYTIP +TRV++N W++ RDP+YWED ESF PE
Sbjct  390  VVKETLRLHPPVPLLAPRECREETNINGYTIPLKTRVMVNVWSMGRDPKYWEDAESFIPE  449

Query  415  RFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHT  236
            RF    +DF   + F+Y+PFG+G+RMCPGI+FGL +VY PLA LLYHFDW+LP G  P  
Sbjct  450  RFARSSVDFL-GNNFEYLPFGAGRRMCPGITFGLFNVYLPLAKLLYHFDWKLPDGQKPED  508

Query  235  LKLTELPRMAMGVKNDIFFI  176
            + +TEL  +    K++++ I
Sbjct  509  VDMTELSAITAARKSELYLI  528



>ref|XP_009587552.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=512

 Score =   223 bits (569),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 145/197 (74%), Gaps = 4/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS+T  V A+ E++KNP V+AKAQ+EVR+ FKG+   +E ++D L YL LV+
Sbjct  307  DMFTAGTETSSTAIVWALSELMKNPNVMAKAQSEVRQAFKGKSSFDEEDLDNLPYLMLVV  366

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RLH PG +++R+  + + + GYTIP R  VL+N WAI RDP+ W DPESF PERFE
Sbjct  367  KETLRLHAPG-ILHRQCREQTCIDGYTIPSRATVLVNTWAIGRDPEVWHDPESFIPERFE  425

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            +  +D+   + F+++PFGSGKR+CPG+ FGLA+   PLA LLYHF+WELP+G +P  L +
Sbjct  426  NSSIDYM-GNHFEFIPFGSGKRICPGMQFGLANFRYPLARLLYHFNWELPYGTSPKDLDM  484

Query  226  TELPRMAMGVKNDIFFI  176
            +++P M++  + D++ I
Sbjct  485  SQIPGMSVAKEKDLYLI  501



>emb|CDP07879.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   223 bits (568),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 147/198 (74%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+FG   +TS++I   AM EM++NP V+AKAQ+E+R  F+G+  +EE+++ +L YL  VI
Sbjct  302  DVFGAGTETSSSIVDWAMSEMIRNPGVMAKAQSEIRNAFRGKNTIEETDIQQLQYLRSVI  361

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE  ++  + GY IP +T++L+NAWAI RDP+YW+DPE FKPERF
Sbjct  362  KETLRLHPPIPLLIPRECREECEIDGYIIPVKTKILVNAWAIGRDPEYWDDPECFKPERF  421

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E+ P+DFT  S+F+++PFG+G+R+CPGISFGLA+V   LA LLYHFDW+LP+G+    L 
Sbjct  422  EESPIDFT-GSRFEFLPFGAGRRICPGISFGLANVEVALALLLYHFDWKLPNGLDTKDLD  480

Query  229  LTELPRMAMGVKNDIFFI  176
            + E   +     N++  +
Sbjct  481  MKETVGITASRTNNLRLL  498



>gb|AGN04217.1| cytochrome P450 [Salvia miltiorrhiza]
Length=502

 Score =   223 bits (567),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 144/197 (73%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS+T TV AM EM++NPRV+ KAQAEVR   KG+  VEES+V +L YL LVI
Sbjct  299  DMFVAGTETSSTTTVWAMSEMMRNPRVMEKAQAEVRAALKGKAAVEESDVQELKYLKLVI  358

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET RLHPP P++ R+  ++  V GY+IP +T+V++N W++ RDPQYWE PE F+PERFE
Sbjct  359  KETFRLHPPIPLLPRQTREECKVDGYSIPIKTKVMLNIWSMGRDPQYWEQPEMFQPERFE  418

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            + P DF   + F+Y+PFG+G+R+CPG++FGLA++  PLA +LYHFDW+LP G++   L +
Sbjct  419  NSPKDFI-GNDFEYIPFGAGRRICPGLNFGLANIELPLAKMLYHFDWKLPKGMSCERLDM  477

Query  226  TELPRMAMGVKNDIFFI  176
            +E   + +  K  +  I
Sbjct  478  SEGEGLTVSRKKPLIII  494



>ref|XP_009609752.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=208

 Score =   214 bits (544),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 147/200 (74%), Gaps = 4/200 (2%)
 Frame = -2

Query  766  M*DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNL  593
            M DMF    +TS++  V AMVEMVKNP V AKAQAEVRE F+ +   +E++V++L YL L
Sbjct  1    MQDMFAAGTETSSSTIVWAMVEMVKNPTVFAKAQAEVREAFREKETFDENDVEELNYLKL  60

Query  592  VIKETMRLHPPGPVIYR-ENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPE  416
            VIKET+RLHPP P++   E  +++ + GYTIP +T+V++N WA+ RDP+YW+D E+FKPE
Sbjct  61   VIKETLRLHPPVPLLLPRECREETNINGYTIPVKTKVMVNVWALGRDPKYWDDAETFKPE  120

Query  415  RFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHT  236
            RFE    DF   + F+Y+PFG G+R+CPGISFGLA+ Y PLA LLYHFDWELP GI P  
Sbjct  121  RFEQCSKDFV-GNNFEYLPFGGGRRICPGISFGLANAYLPLAQLLYHFDWELPTGIKPSD  179

Query  235  LKLTELPRMAMGVKNDIFFI  176
            L LTEL  +    K+D++ +
Sbjct  180  LDLTELVGVTAARKSDLYLV  199



>gb|KDO62260.1| hypothetical protein CISIN_1g020837mg [Citrus sinensis]
Length=320

 Score =   217 bits (553),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 139/197 (71%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+FG   +TS T    AM EM+KNPRV+ KAQAEVREVF  KG+V+E+ ++++ YL LV+
Sbjct  120  DIFGAGSETSATTVDWAMYEMMKNPRVMKKAQAEVREVFNRKGKVDETGINEMKYLKLVV  179

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RLHP  P+I RE      + G+ IP + RV++N+WA  RDP YW +PESF PERF 
Sbjct  180  KETLRLHPSAPLILRECGDSCEINGFNIPAKARVIVNSWATGRDPMYWTEPESFIPERFI  239

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            D  +D+ + + F+Y+PFG+G+R+CPG+SFGLASV   LA LLYHF+W+LP+G+    L +
Sbjct  240  DHSVDY-KGTNFEYIPFGAGRRICPGMSFGLASVELTLAMLLYHFEWKLPNGMKHEDLDM  298

Query  226  TELPRMAMGVKNDIFFI  176
            TE     +  K D+  I
Sbjct  299  TEAFGATVRRKQDLCMI  315



>ref|XP_011081935.1| PREDICTED: cytochrome P450 71D95-like [Sesamum indicum]
Length=506

 Score =   222 bits (566),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 143/197 (73%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS+T    AM E+++NPRV+AK QAE +E FKG+  VEES+V  L YL LVI
Sbjct  303  DMFSAGTETSSTTIDWAMAELMRNPRVMAKVQAEQKEAFKGKTTVEESDVQALKYLKLVI  362

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET RLHPP P++ R    +  V GYTIP +++V+IN W + RDP+YW  PE+F+PERF+
Sbjct  363  KETFRLHPPIPLLPRACRDECKVNGYTIPLKSKVMINIWGMGRDPEYWHQPETFQPERFD  422

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            ++ +DF   + F+Y+PFG+G+R+CPG++FGLA+V  PLA LLYHFDW++P G+TP  + +
Sbjct  423  NNSIDFL-GNNFEYIPFGAGRRICPGMNFGLANVELPLAKLLYHFDWKMPKGMTPDDIDM  481

Query  226  TELPRMAMGVKNDIFFI  176
            TE   +A+  +N +  +
Sbjct  482  TEAEGIAVSRRNGLVLV  498



>emb|CDP07886.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 143/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF G  +TS+T    AM E++KNP V+ K Q EVR+ F G+  +EE+ + +L YL LVI
Sbjct  283  DMFLGGTETSSTTLEWAMSELIKNPNVMTKVQNEVRKAFTGKKTIEENEIQQLQYLKLVI  342

Query  586  KETMRLHPPGPV-IYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P+ + ++  +   + GY+IP +TR+ +N WAI+RDP+YW+DPESFKPERF
Sbjct  343  KETLRLHPPAPLSVPKQCREQCEIDGYSIPVKTRLFVNTWAIARDPEYWDDPESFKPERF  402

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E+  +DFT  + F+ +PFGSG+R+CPGISFG+A+V  PL  LLYHFDW LP+G++P  L 
Sbjct  403  ENSSIDFT-GNHFELLPFGSGRRICPGISFGIANVELPLTLLLYHFDWRLPNGLSPDDLD  461

Query  229  LTELPRMAMGVKNDIFFI  176
            + E   +A   KND+  +
Sbjct  462  MIESVGIATTRKNDLCLL  479



>ref|XP_003611886.1| Cytochrome P450 [Medicago truncatula]
 gb|AES94844.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=505

 Score =   222 bits (566),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 145/198 (73%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    DT++T    AM EM+KNP V  KAQAE+RE FKG+  + ES++++L Y  LVI
Sbjct  303  DVFVAGTDTTSTTIEWAMSEMMKNPSVREKAQAELREAFKGKKIISESDLNELTYFKLVI  362

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KETMRLHPP P++  RE  + +++ GY IP  T+V+INAWA++RDPQYW D E F PERF
Sbjct  363  KETMRLHPPSPLLVPRECTELTIIDGYEIPKNTKVMINAWAVARDPQYWTDAEMFIPERF  422

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            +   +DF + + F+Y+PFG+G+RMCPG+SFG+ASV  PLA LLYHF+WELP+ + P  L 
Sbjct  423  DGSLIDF-KGNNFEYIPFGAGRRMCPGMSFGIASVMLPLALLLYHFNWELPNQMKPEDLD  481

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   +A+G +N++  I
Sbjct  482  MTENVGLAVGRENELCLI  499



>ref|XP_006339044.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=510

 Score =   222 bits (566),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 143/201 (71%), Gaps = 4/201 (2%)
 Frame = -2

Query  769  CM*DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLN  596
             M D+FG   +TS T  + AM EM++NP VLAKAQAEVRE FKG+    E  +++L YL 
Sbjct  302  IMIDLFGAGTETSGTTIIWAMSEMMRNPSVLAKAQAEVREAFKGKETFNEDVIEELKYLK  361

Query  595  LVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKP  419
             V+KET RLHPP P++  RE  +++ + GYTIP +TRV++N +A+ RDP+YWED ESF P
Sbjct  362  QVVKETFRLHPPAPLLIPRECREETSINGYTIPLKTRVIVNVYAMGRDPKYWEDAESFIP  421

Query  418  ERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPH  239
            ERFE   +DF   + FKY+PFG+G+RMCPGI FGL +VY PLA+LLYHFDW+LP G+   
Sbjct  422  ERFEQISVDFM-GNNFKYLPFGAGRRMCPGILFGLINVYLPLANLLYHFDWKLPDGVKLE  480

Query  238  TLKLTELPRMAMGVKNDIFFI  176
             + +TE   +    K++++ I
Sbjct  481  DVDMTEFFGITAARKSELYLI  501



>ref|XP_011073878.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=519

 Score =   222 bits (566),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 146/197 (74%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK-GR-VEESNVDKLAYLNLVI  587
            DMF GA +TS++    AMVE+V+NPRV AKAQAEVR+ FK GR ++E+ V KL YL LV+
Sbjct  316  DMFSGATETSSSTLDWAMVELVRNPRVRAKAQAEVRQAFKDGRSIDENEVGKLKYLKLVV  375

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KE +RLHP  P++ R + +DS + GY IP +T+VL+N W + R+P Y+ + ESF+PERFE
Sbjct  376  KEVLRLHPATPLVPRASREDSEINGYYIPAKTKVLVNNWGMGRNPNYFPNAESFEPERFE  435

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
             + +DF   + F+Y+PFG+GKRMCPG++FGLASV  PLAHLLY+F+WELP GI P  L +
Sbjct  436  SNGIDFN-GANFEYLPFGAGKRMCPGMTFGLASVELPLAHLLYNFNWELPKGIKPSDLDM  494

Query  226  TELPRMAMGVKNDIFFI  176
            TE P ++   K+ +  +
Sbjct  495  TENPGISAPRKHHLHIV  511



>gb|KDO62263.1| hypothetical protein CISIN_1g0110962mg, partial [Citrus sinensis]
Length=271

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 141/195 (72%), Gaps = 4/195 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK--GRVEESNVDKLAYLNLVI  587
            D+F    +TS T    AM EM+KNPRV+ KAQAEVREVF   G+V E+++D++ +L LV+
Sbjct  65   DIFAAGSETSATTVDWAMCEMMKNPRVMKKAQAEVREVFHRTGKVNETSIDEMKFLKLVV  124

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHP  P++  RE  +   + G+ IP + RV++NAWAI RDP+YW +PESF PERF
Sbjct  125  KETLRLHPAAPLLIPRECGQRCQINGFDIPVKARVIVNAWAIGRDPEYWTEPESFIPERF  184

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D  +D+ + + F+Y+PFG+G+R+CPG+SFGLASV  PLA LLYHFDW+LP+GI    L 
Sbjct  185  LDHSVDY-KGTNFEYIPFGAGRRICPGMSFGLASVELPLAMLLYHFDWKLPNGIKHEDLD  243

Query  229  LTELPRMAMGVKNDI  185
            +TE   + +  K D+
Sbjct  244  MTEAFGVTVRRKQDL  258



>gb|KDO62262.1| hypothetical protein CISIN_1g0110962mg, partial [Citrus sinensis]
Length=268

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 141/195 (72%), Gaps = 4/195 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK--GRVEESNVDKLAYLNLVI  587
            D+F    +TS T    AM EM+KNPRV+ KAQAEVREVF   G+V E+++D++ +L LV+
Sbjct  62   DIFAAGSETSATTVDWAMCEMMKNPRVMKKAQAEVREVFHRTGKVNETSIDEMKFLKLVV  121

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHP  P++  RE  +   + G+ IP + RV++NAWAI RDP+YW +PESF PERF
Sbjct  122  KETLRLHPAAPLLIPRECGQRCQINGFDIPVKARVIVNAWAIGRDPEYWTEPESFIPERF  181

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D  +D+ + + F+Y+PFG+G+R+CPG+SFGLASV  PLA LLYHFDW+LP+GI    L 
Sbjct  182  LDHSVDY-KGTNFEYIPFGAGRRICPGMSFGLASVELPLAMLLYHFDWKLPNGIKHEDLD  240

Query  229  LTELPRMAMGVKNDI  185
            +TE   + +  K D+
Sbjct  241  MTEAFGVTVRRKQDL  255



>gb|ABC69397.1| CYP71D48v1 [Nicotiana tabacum]
Length=504

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 145/199 (73%), Gaps = 5/199 (3%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR---VEESNVDKLAYLNLV  590
            DMF    +TS+T  + A+ EM+K P VLAKAQAEVR+  KG+    +E ++DKL YL LV
Sbjct  300  DMFSAGSETSSTTIIWALAEMMKKPSVLAKAQAEVRQALKGKKISFQEIDIDKLKYLKLV  359

Query  589  IKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPER  413
            IKET+R+HPP P++  RE  +D+ + GY IP +TRV++NAWAI RDPQ W+DPESF PER
Sbjct  360  IKETLRMHPPIPLLVPRECMEDTKIDGYNIPFKTRVIVNAWAIGRDPQSWDDPESFTPER  419

Query  412  FEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTL  233
            FE++ +DF   +  +++PFG+G+R+CPG+ FGLA+V  PLA LLYHFDW+LP+G +    
Sbjct  420  FENNSIDFL-GNHHQFIPFGAGRRICPGMLFGLANVGQPLAQLLYHFDWKLPNGQSHENF  478

Query  232  KLTELPRMAMGVKNDIFFI  176
             +TE P ++   K+D+  I
Sbjct  479  DMTESPGISATRKDDLVLI  497



>gb|ADA70806.1| cytochrome P450 CYP71D177 [Scoparia dulcis]
Length=504

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 141/197 (72%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    +TS+T    AM E+++NPRV+AK QAE+R+ FKG+  ++ES++  L YL LVI
Sbjct  292  DVFSAGSETSSTTVDWAMAELMQNPRVMAKVQAELRDAFKGKKTIDESDIQSLTYLKLVI  351

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RLHPP P++ R   ++S + GYTIP + ++++N WA+ RDP YW +PESF+PERFE
Sbjct  352  KETLRLHPPFPMLLRGTREESQLNGYTIPYKAKIIVNNWAMGRDPAYWHEPESFQPERFE  411

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
                DF   + F+++PFG+GKR+CPG+ FGLA+V  PLA LLYHF+W  P G+T   + L
Sbjct  412  SISTDFL-GNNFEFLPFGAGKRICPGLHFGLANVELPLAQLLYHFNWNFPQGMTAKDIDL  470

Query  226  TELPRMAMGVKNDIFFI  176
            TE   +++  KN +F I
Sbjct  471  TETEGLSLSRKNGLFLI  487



>ref|XP_007020552.1| Cytochrome P450 71D10, putative [Theobroma cacao]
 gb|EOY12077.1| Cytochrome P450 71D10, putative [Theobroma cacao]
Length=513

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 141/197 (72%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+F    +TS+T    AM EM+KNPRV+ KAQ E R VF  +GRV+ES + +L YL+LV+
Sbjct  302  DIFAAGSETSSTTVEWAMSEMIKNPRVMKKAQDEARRVFNERGRVDESGIHELEYLSLVV  361

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RLHP  P++ RE ++D V+ GY +P RT V++NAWAI RDP++W++ E F PERF 
Sbjct  362  KETLRLHPSVPLLQRECSEDCVIDGYEVPARTNVIVNAWAIGRDPRHWKEAEKFHPERFL  421

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            D  +DF R   F+ +PFG+G+R+CPGISF L ++  PLA LLYHFDWELP+G+    L +
Sbjct  422  DTSIDF-RGLDFELIPFGAGRRICPGISFALPNILLPLAQLLYHFDWELPNGMKHQDLDM  480

Query  226  TELPRMAMGVKNDIFFI  176
            TE   + +  +ND+F I
Sbjct  481  TEEFGITVTRRNDLFLI  497



>gb|ABC69396.1| CYP71D48v2 [Nicotiana tabacum]
Length=503

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 144/199 (72%), Gaps = 5/199 (3%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR---VEESNVDKLAYLNLV  590
            DMF    +TS+T  + A+ EM+K P VLAKAQAEV +  KG+    +E ++DKL YL LV
Sbjct  300  DMFSAGSETSSTTIIWALAEMMKKPSVLAKAQAEVSQALKGKKISFQEIDIDKLKYLKLV  359

Query  589  IKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPER  413
            IKET+R+HPP P++  RE  +D+ + GY IP +TRV++NAWAI RDPQ W+DPESF PER
Sbjct  360  IKETLRMHPPIPLLVPRECMEDTKIDGYNIPFKTRVIVNAWAIGRDPQSWDDPESFTPER  419

Query  412  FEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTL  233
            FE++ +DF   +  +++PFG+G+R+CPG+ FGLA+V  PLA LLYHFDW+LP+G T    
Sbjct  420  FENNSIDFL-GNHHQFIPFGAGRRICPGMLFGLANVGQPLAQLLYHFDWKLPNGQTHQNF  478

Query  232  KLTELPRMAMGVKNDIFFI  176
             +TE P ++   K+D+  I
Sbjct  479  DMTESPGISATRKDDLILI  497



>ref|XP_012071254.1| PREDICTED: cytochrome P450 71D10-like [Jatropha curcas]
Length=655

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 146/198 (74%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            DMF    DTS+T    AM EM+KNP V+ KAQAEVR VF  KG V+E+++++L YL LVI
Sbjct  449  DMFIAGSDTSSTPIEWAMSEMMKNPEVMEKAQAEVRLVFEAKGDVDEASLNELNYLKLVI  508

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE  +  +V GY IP +TRV++NAWAI R+P+YW +PE F PERF
Sbjct  509  KETLRLHPPVPLLVPRECREHCIVNGYDIPEKTRVIVNAWAIGRNPEYWREPEKFNPERF  568

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D+ +D+ + + F+++PFG+G+RMCPGISFG+A+V  PLAHLLYHFDW+LP G+ P  L 
Sbjct  569  LDNSIDY-KGAHFEFIPFGAGRRMCPGISFGMANVELPLAHLLYHFDWKLPSGVNPENLD  627

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   + +   N ++ I
Sbjct  628  MTESLSVTVKRSNALYVI  645


 Score =   196 bits (498),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 128/167 (77%), Gaps = 4/167 (2%)
 Frame = -2

Query  709  MVEMVKNPRVLAKAQAEVREVFK--GRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RE  539
            M E++KN  V+ KAQAE+R+VFK  G V+E  V +L YL L++KET+RLHPP P++  RE
Sbjct  1    MSELLKNTSVMKKAQAELRQVFKNKGYVDEEGVCELNYLKLIVKETLRLHPPVPLLVPRE  60

Query  538  NNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMP  359
            N++   + GY IP ++RVLIN WAI RDP YW++PE F PERF D+ +D+ + S F+++P
Sbjct  61   NSELCEINGYFIPVKSRVLINVWAIGRDPNYWKEPERFNPERFLDNSIDY-KGSNFEFIP  119

Query  358  FGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKLTEL  218
            FG+G+R+CPGI FG+A+V  PLA+LLYHFDW+LP  I P  L++TE+
Sbjct  120  FGAGRRICPGILFGIANVELPLANLLYHFDWKLPGEINPENLEMTEV  166



>ref|XP_009611155.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=499

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 146/198 (74%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS+T    AMVEM+K P V AKAQAEVR++ +G+   +E +V++  YL +VI
Sbjct  294  DMFAAGTETSSTTINWAMVEMMKKPSVFAKAQAEVRKILRGKETFDEIDVEEFKYLKMVI  353

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET RLHPP P++  RE  +++ + GYTIP +T+V++N WA+ RDP+YW+D ESFKPERF
Sbjct  354  KETFRLHPPLPLLLPRECREETDLNGYTIPLKTKVVVNVWAMGRDPKYWDDVESFKPERF  413

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E++PMD+   + F+Y+PFG G+R+CPGISFGLA+VY PLA +LYHFDW+LP GI P  L 
Sbjct  414  ENNPMDYI-GNNFEYLPFGGGRRICPGISFGLANVYFPLAQMLYHFDWKLPTGINPSELD  472

Query  229  LTELPRMAMGVKNDIFFI  176
            LTE    A   KND+  I
Sbjct  473  LTEAAGAACARKNDLHLI  490



>ref|XP_010644548.1| PREDICTED: premnaspirodiene oxygenase-like [Vitis vinifera]
Length=508

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 143/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+F    +TS+T    AM EM+KNPRV+AKAQAEVR++F  KG  +E+ V +L +L LVI
Sbjct  302  DLFVAGTETSSTAVEWAMAEMLKNPRVMAKAQAEVRDIFSRKGNADETVVRELKFLKLVI  361

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE+ +   + GY IP +TRV+INAWAI+RDP+YW D ESF PERF
Sbjct  362  KETLRLHPPVPLLIPRESRERCAINGYEIPVKTRVIINAWAIARDPKYWTDAESFNPERF  421

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D  +D+ + + F+Y+PFG+G+RMCPGI FG+A+V   LA LLYHFDW+LP+G     L 
Sbjct  422  LDSSIDY-QGTNFEYIPFGAGRRMCPGILFGMANVELALAQLLYHFDWKLPNGARHEELD  480

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE  R +   K D++ I
Sbjct  481  MTEGFRTSTKRKQDLYLI  498



>ref|XP_009776868.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   221 bits (562),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 144/198 (73%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS T    AMVEM+KNP V AK QAEVR++ +G+    E +VD+  YL +VI
Sbjct  294  DMFAAGTETSATTINWAMVEMMKNPSVFAKTQAEVRKILRGKETFGEIDVDEFKYLKMVI  353

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET RLHPP P++  RE  +++ + GYTIP +T+V++N WA+ RDP+YW+D ESFKPERF
Sbjct  354  KETFRLHPPLPLLLPRECREETDLNGYTIPLKTKVVVNVWAMGRDPKYWDDVESFKPERF  413

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E++ MD+T  + F+Y+PFGSG+R+CPGISFGLA+VY PLA LLYHFDW+LP  I P  L 
Sbjct  414  ENNSMDYT-GNNFEYLPFGSGRRICPGISFGLANVYFPLAQLLYHFDWKLPTEINPSELD  472

Query  229  LTELPRMAMGVKNDIFFI  176
            LTE    A   KND+  I
Sbjct  473  LTEAAGAACARKNDLHLI  490



>ref|XP_009606204.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=527

 Score =   221 bits (563),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 148/197 (75%), Gaps = 4/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMFG   +TS+T    AMVEM+KNP V AKAQAEVRE F+ +   +E++V++L YL LVI
Sbjct  322  DMFGAGTETSSTTIDWAMVEMIKNPSVFAKAQAEVREAFREKETFDENDVEELKYLKLVI  381

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET RLHPP P++  RE+ +++ + GYTIP +T++++N WAI RDP+YW+D ESFKPERF
Sbjct  382  KETFRLHPPFPLLLPRESREETDINGYTIPFKTKLMVNVWAIGRDPKYWDDVESFKPERF  441

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E + MDF   + F+Y+PFGSG+RMCPGISFGLA+VY PLA LLYHFDW+LP GI    L 
Sbjct  442  EHNSMDFI-GNNFEYLPFGSGRRMCPGISFGLANVYLPLAQLLYHFDWKLPTGINSSDLD  500

Query  229  LTELPRMAMGVKNDIFF  179
            +TE   +    K+D++ 
Sbjct  501  MTESSGVTCARKSDLYL  517



>ref|XP_009770332.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=523

 Score =   221 bits (562),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 143/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS T  + AM EM++NP V+AKAQ EVREV KG+   E+ ++++L YLNLVI
Sbjct  320  DMFLAGAETSATTIIWAMAEMIRNPSVMAKAQLEVREVLKGKRTFEDIDLEELKYLNLVI  379

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE  +++ +  Y IP +TRVL+N WAI R+   W +PESF PERF
Sbjct  380  KETLRLHPPVPLLIPRECREETKIDKYIIPIKTRVLVNVWAIGRESTNWHNPESFIPERF  439

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E++ +DF R + F+++PFG+G+RMCPG+ FGL +V  PLA LLYHFDW+ PHGI P  L 
Sbjct  440  ENNSIDF-RGNHFEFIPFGAGRRMCPGLLFGLVNVGHPLAQLLYHFDWKTPHGIAPDNLN  498

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   +A G K+D+  I
Sbjct  499  MTETIGVAGGRKDDLCLI  516



>ref|XP_003517259.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=503

 Score =   220 bits (560),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 141/197 (72%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            ++F    DT  +    AM EM+KNPRV  KAQAE+R+ FKG+  + E+++++L+YL  VI
Sbjct  301  NIFASGTDTPASTLEWAMSEMMKNPRVREKAQAELRQTFKGKEIIRETDLEELSYLKSVI  360

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RLHPP  +I RE  K + + GY IP +T+V+IN WAI RDPQYW D E F PERF+
Sbjct  361  KETLRLHPPSQLIPRECIKSTNIDGYDIPIKTKVMINTWAIGRDPQYWSDAERFIPERFD  420

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            D  +DF + + F+Y+PFG+G+RMCPGI+FGLAS+  PLA LLYHF+WELP+ + P  L +
Sbjct  421  DSSIDF-KGNSFEYIPFGAGRRMCPGITFGLASITLPLALLLYHFNWELPNKMKPADLDM  479

Query  226  TELPRMAMGVKNDIFFI  176
             EL  + +  KN +F I
Sbjct  480  DELFGLTVVRKNKLFLI  496



>gb|AAD47832.1| cytochrome P450 [Nicotiana tabacum]
Length=499

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 145/198 (73%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+FGG  +TS+T    AMVEM+KNP V +KAQAEVRE+ +G+    E +V++  YL +VI
Sbjct  294  DIFGGGTETSSTTINWAMVEMMKNPSVFSKAQAEVREILRGKETFGEIDVEEFKYLKMVI  353

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET RLHPP P++  RE  ++  + GYTIP +T+V++NAWA+ RDP+YW+D ESFKPERF
Sbjct  354  KETFRLHPPLPLLLPRECREEIDLNGYTIPLKTKVVVNAWAMGRDPKYWDDVESFKPERF  413

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E + MD+   + ++Y+PFGSG+R+CPGISFGLA+VY PLA LL HFDW+LP GI P    
Sbjct  414  EHNSMDYI-GNNYEYLPFGSGRRICPGISFGLANVYFPLAQLLNHFDWKLPTGINPRNCD  472

Query  229  LTELPRMAMGVKNDIFFI  176
            LTE    A   KND+  I
Sbjct  473  LTEAAGAACARKNDLHLI  490



>ref|XP_009769208.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 144/198 (73%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS T    AMVEM+KNP V AK QAEVR++ +G+    E +V++  YL +VI
Sbjct  294  DMFAAGTETSATTINWAMVEMMKNPSVFAKTQAEVRKILRGKETFGEIDVEEFKYLKMVI  353

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET RLHPP P++  RE  +++ + GYTIP +T+V++N WA+ RDP+YW+D ESFKPERF
Sbjct  354  KETFRLHPPLPLLLPRECREETDLNGYTIPLKTKVVVNVWAMGRDPKYWDDVESFKPERF  413

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E++ MD+T  + F+Y+PFGSG+R+CPGISFGLA+VY PLA LLYHFDW+LP  I P  L 
Sbjct  414  ENNSMDYT-GNNFEYLPFGSGRRICPGISFGLANVYFPLAQLLYHFDWKLPTEINPSELD  472

Query  229  LTELPRMAMGVKNDIFFI  176
            LTE    A   KND+  I
Sbjct  473  LTEAAGAACARKNDLHLI  490



>ref|XP_003537455.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 gb|KHN42025.1| Cytochrome P450 71D8 [Glycine soja]
Length=504

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 141/197 (72%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            ++F    DTS +    AM EM+KNP+V  KAQAE+R++FKG+  + E+++++L+YL  VI
Sbjct  302  NIFAAGTDTSASTLEWAMSEMMKNPKVKEKAQAELRQIFKGKEIIRETDLEELSYLKSVI  361

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RLHPP  +I RE  K + + GY IP +T+V+IN WAI RDPQYW D + F PERF 
Sbjct  362  KETLRLHPPSQLIPRECIKSTNIDGYEIPIKTKVMINTWAIGRDPQYWSDADRFIPERFN  421

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            D  +DF + + F+Y+PFG+G+RMCPG++FGLAS+  PLA LLYHF+WELP+ + P  L +
Sbjct  422  DSSIDF-KGNSFEYIPFGAGRRMCPGMTFGLASITLPLALLLYHFNWELPNKMKPEDLDM  480

Query  226  TELPRMAMGVKNDIFFI  176
             E   M +  KN +F I
Sbjct  481  DEHFGMTVARKNKLFLI  497



>ref|XP_007020554.1| Cytochrome P450 71D10, putative [Theobroma cacao]
 gb|EOY12079.1| Cytochrome P450 71D10, putative [Theobroma cacao]
Length=541

 Score =   220 bits (560),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 146/198 (74%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+FG   + S+     AM EMV+NP+++ +AQAEVR VF  KG+V+E  +++L +L L++
Sbjct  305  DIFGAGSEASSNTVEWAMSEMVRNPKLMKEAQAEVRRVFHGKGKVDEVGLEELKFLKLIV  364

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RL+P GP++  RE ++D V+ GY IP +T+V++NAWAI RDP YW++ E F+PERF
Sbjct  365  KETLRLYPAGPLLIPRECSEDCVIGGYEIPAKTKVIVNAWAIGRDPSYWKEAEKFQPERF  424

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D P+DF R + F+Y+PFG+G+RMCPGISF L ++  PLA+LLYHFDW+LP+ +    L 
Sbjct  425  IDKPIDF-RGTNFEYIPFGAGRRMCPGISFALPNIELPLANLLYHFDWKLPNKMKCEDLD  483

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   + +  KND+F I
Sbjct  484  MTESFGLTIRRKNDLFLI  501



>ref|XP_004233564.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=503

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 146/198 (74%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS+T  + A+ EM+K P VLAKAQAEVR+V K +   ++ ++D+L YL LVI
Sbjct  301  DMFSAGSETSSTTIIWALAEMMKKPSVLAKAQAEVRQVLKEKKGFQQIDLDELKYLKLVI  360

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+R+HPP P++  RE  +D+ + GY IP +TRV++NAWAI RDP+ W+DPESF PERF
Sbjct  361  KETLRMHPPIPLLVPRECMEDTKIDGYNIPFKTRVIVNAWAIGRDPESWDDPESFSPERF  420

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E+  +DF   S  +++PFG+G+R+CPG+ FGLA+V  PLA LLYHFDW+LP+G +  +L 
Sbjct  421  ENSSVDFL-GSHHQFIPFGAGRRICPGMLFGLANVGQPLAQLLYHFDWKLPNGQSHESLD  479

Query  229  LTELPRMAMGVKNDIFFI  176
            LTE P ++   K+D+  I
Sbjct  480  LTESPGISATRKDDLVLI  497



>ref|XP_004511998.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=505

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 144/198 (73%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRVEESNVD--KLAYLNLVI  587
            D+F    DT+ TI    M E++KNP V  KAQAE+R+V +G+ + S +D  +L YLNLVI
Sbjct  303  DVFVAGTDTTATIIEWTMSELMKNPSVREKAQAELRKVLRGKEKISEIDLHELTYLNLVI  362

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KETMRLHPP P++  RE ++ +++ GY IP  T+V+INAWA++RDP+YW D E F PERF
Sbjct  363  KETMRLHPPSPLLVPRECSESTIIGGYEIPKNTKVMINAWALARDPEYWSDAERFIPERF  422

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            +   +DF + + F+Y+PFG+G+RMCPG+SFGLAS+  PLA LLYHF+WELP+ + PH   
Sbjct  423  DGSFIDF-KGNNFEYIPFGAGRRMCPGMSFGLASIMLPLALLLYHFNWELPNHMKPHDFD  481

Query  229  LTELPRMAMGVKNDIFFI  176
            + E   +A+G KN++  I
Sbjct  482  MIEHFGLAVGRKNELSLI  499



>gb|KHN36164.1| Cytochrome P450 71D8 [Glycine soja]
Length=503

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 141/197 (72%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            ++F    DT  +    AM EM+KNPRV  KAQAE+R+ FKG+  + E+++++L+YL  VI
Sbjct  301  NIFASGTDTPASTLEWAMSEMMKNPRVREKAQAELRQTFKGKEIIRETDLEELSYLKSVI  360

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RLHPP  +I RE  K + + GY IP +T+V+IN WAI RDPQYW D E F PERF+
Sbjct  361  KETLRLHPPSQLIPRECIKSTNIDGYDIPIKTKVMINTWAIGRDPQYWSDAERFIPERFD  420

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            D  +DF + + F+Y+PFG+G+RMCPGI+FGLAS+  PLA +LYHF+WELP+ + P  L +
Sbjct  421  DSSIDF-KGNSFEYIPFGAGRRMCPGITFGLASITLPLALILYHFNWELPNKMKPADLDM  479

Query  226  TELPRMAMGVKNDIFFI  176
             EL  + +  KN +F I
Sbjct  480  DELFGLTVVRKNKLFLI  496



>ref|XP_009765039.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=501

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 147/197 (75%), Gaps = 4/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMFG   +TS+T    AMVEM+KNP V AKAQAEVR+ F+G+   +E++V++L YL LVI
Sbjct  296  DMFGAGTETSSTTIDWAMVEMMKNPTVFAKAQAEVRKAFRGKETFDENDVEELKYLKLVI  355

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET RLHPP P++  RE+ +++ + GYTI  +T++++N WAI RDP+YW+D ESFKPERF
Sbjct  356  KETFRLHPPFPLLLPRESREETDINGYTISLKTKLMVNVWAIGRDPKYWDDVESFKPERF  415

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E + MDF   + F+Y+PFGSG+RMCPGISFGLA+VY PLA LLYHFDW+LP GI P  L 
Sbjct  416  EHNSMDFI-GNNFEYLPFGSGRRMCPGISFGLANVYLPLAQLLYHFDWKLPTGINPCDLD  474

Query  229  LTELPRMAMGVKNDIFF  179
            + E        K+D++ 
Sbjct  475  MIESSGATCSRKSDLYL  491



>ref|XP_006361940.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=503

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 145/198 (73%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS+T  + A+ EM+K P VLAKAQAEVR+V K +   ++ ++D+L YL LVI
Sbjct  301  DMFSAGSETSSTTIIWALAEMMKKPSVLAKAQAEVRQVLKEKKGFQQIDLDELKYLKLVI  360

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+R+HPP P++  RE  +D+ + GY IP +TRV++NAWAI RDP+ W+DPESF PERF
Sbjct  361  KETLRMHPPIPLLVPRECMEDTKIDGYNIPFKTRVIVNAWAIGRDPESWDDPESFSPERF  420

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E+  +DF   S  +++PFG+G+R+CPG+ FGLA+V  PLA LLYHFDW+LP+G +   L 
Sbjct  421  ENSSIDFL-GSHHQFIPFGAGRRICPGMLFGLANVGQPLAQLLYHFDWKLPNGQSHENLD  479

Query  229  LTELPRMAMGVKNDIFFI  176
            LTE P ++   K+D+  I
Sbjct  480  LTESPGISATRKDDLVLI  497



>ref|XP_009794456.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 147/199 (74%), Gaps = 5/199 (3%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRV---EESNVDKLAYLNLV  590
            DMF    DTS++  + A+ EM+KNP V+AKAQAEVRE FKG+    E+++++KL+YLNLV
Sbjct  295  DMFVAGSDTSSSTVIWALAEMIKNPSVMAKAQAEVREAFKGKKTCDEDTDLEKLSYLNLV  354

Query  589  IKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPER  413
            IKET+RLHPP P++  RE  +++ + G+TIP +++VL+N WAI RDP+ W +PE F PER
Sbjct  355  IKETLRLHPPTPLLVPRECREETEIDGFTIPLKSKVLVNVWAIGRDPENWGNPECFIPER  414

Query  412  FEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTL  233
            FE+  ++FT  + F+ +PFG+G+R+CPGI FG+A V  PLAHLL++FDW+LP GI    L
Sbjct  415  FENSSIEFT-GNHFQLLPFGAGRRICPGIQFGMALVTLPLAHLLHNFDWKLPEGINARDL  473

Query  232  KLTELPRMAMGVKNDIFFI  176
             +TE   ++   + D++ I
Sbjct  474  DMTEANGISARREKDLYLI  492



>ref|XP_012070984.1| PREDICTED: cytochrome P450 71D10-like [Jatropha curcas]
 gb|KDP39255.1| hypothetical protein JCGZ_01012 [Jatropha curcas]
Length=504

 Score =   218 bits (555),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 138/183 (75%), Gaps = 4/183 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            DMF    DTS+T    AM EM+KNP V+ KAQAEVR VF  KG V+E+++++L YL LVI
Sbjct  298  DMFIAGSDTSSTPIEWAMSEMMKNPEVMEKAQAEVRRVFEAKGNVDEASLNELNYLKLVI  357

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE  +  V+ GY +P +TR+++NAW+I R+P+YW +PE F PERF
Sbjct  358  KETLRLHPPVPLLVPRECKEHCVINGYDVPEKTRIIVNAWSIGRNPEYWTEPEKFFPERF  417

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D  +D+ + + F+++PFG+G+RMCPGISFG+A+V  PLAHLLYHFDW+L  GI P  L 
Sbjct  418  LDSSIDY-KGANFEFIPFGAGRRMCPGISFGMANVELPLAHLLYHFDWKLQSGINPENLD  476

Query  229  LTE  221
            +TE
Sbjct  477  MTE  479



>emb|CDP07878.1| unnamed protein product [Coffea canephora]
Length=369

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 142/191 (74%), Gaps = 8/191 (4%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+F G ++TSTT    AM E+++NPRV+ KAQ+E+R+ F  K  +EE+++ +L YL  VI
Sbjct  163  DVFSGGIETSTTTVEWAMSELIRNPRVMVKAQSEIRKAFIAKRTIEETDIQELKYLKSVI  222

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++   E  +++ + GY IP +TRV+INAWAI RD +YW+DPE F+PERF
Sbjct  223  KETLRLHPPIPMLIPGECRRETEIDGYIIPIKTRVIINAWAIGRDLEYWDDPECFRPERF  282

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E+  +DF   + F+Y+PFG+G+R+C GISFGLA+V  PLA LLYHFDW+LP+G+ P  L 
Sbjct  283  ENSSIDFN-GTHFEYIPFGAGRRICSGISFGLANVELPLALLLYHFDWKLPNGLKPCDLD  341

Query  229  LTELPRMAMGV  197
            +TE     MGV
Sbjct  342  VTE----TMGV  348



>ref|XP_009780029.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   218 bits (555),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 146/198 (74%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+FGG  +TS+T    AM EM+KNP V +KAQAEVR++ +G+    E +V++  YL +VI
Sbjct  294  DIFGGGTETSSTTINWAMAEMMKNPCVFSKAQAEVRKILRGKETFGEIDVEEFKYLKMVI  353

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET RLHPP P++  RE  ++  + GYTIP +T+V++NAWA+ RDP+YW+D ESFKPERF
Sbjct  354  KETFRLHPPLPLLLPRECREEIDLNGYTIPLKTKVVVNAWAMGRDPKYWDDVESFKPERF  413

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E + MD+   + ++Y+PFGSG+R+CPGISFGLA+VY PLA LL HFDW+LP GI P  L 
Sbjct  414  EHNSMDYI-GNNYEYLPFGSGRRICPGISFGLANVYFPLAQLLNHFDWKLPTGINPSELD  472

Query  229  LTELPRMAMGVKNDIFFI  176
            LTE   +A   KND+  I
Sbjct  473  LTEAAGVACATKNDLHLI  490



>emb|CDP07874.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 144/196 (73%), Gaps = 5/196 (3%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDK-LAYLNLV  590
            D+F G  +TS+     AM EM++NP V+ KAQ+E+R+VF+G+  ++E +V + L YL LV
Sbjct  234  DVFTGGTETSSATVEWAMSEMIRNPGVMTKAQSEIRKVFRGKNTIDEIDVQQQLQYLKLV  293

Query  589  IKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPER  413
            IKET+RLHPP P++  RE  ++  + GY IP +TRVL+NAWAI RDP+YW+D ESFKPER
Sbjct  294  IKETLRLHPPVPLLVPRECREECEIDGYIIPFKTRVLVNAWAIGRDPEYWDDAESFKPER  353

Query  412  FEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTL  233
            FE+  +DF   S F+Y+PFG+G+R+CPGI+FGLA+V  PLA LLYHFDW LP+G+  + L
Sbjct  354  FENSSIDFN-GSHFEYLPFGAGRRICPGIAFGLANVELPLALLLYHFDWRLPNGLDSNDL  412

Query  232  KLTELPRMAMGVKNDI  185
             +TE   +     N++
Sbjct  413  DMTETVVITASRANNL  428



>ref|XP_009793271.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   218 bits (554),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 146/198 (74%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+FGG  +TS+T    AM EM+KNP V +KAQAEVR++ +G+    E +V++  YL +VI
Sbjct  294  DIFGGGTETSSTTINWAMAEMMKNPCVFSKAQAEVRKILRGKETFGEIDVEEFKYLKMVI  353

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET RLHPP P++  RE  ++  + GYTIP +T+V++NAWA+ RDP+YW+D ESFKPERF
Sbjct  354  KETFRLHPPLPLLLPRECREEIDLNGYTIPLKTKVVVNAWAMGRDPKYWDDVESFKPERF  413

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E + MD+   + ++Y+PFGSG+R+CPGISFGLA+VY PLA LL HFDW+LP GI P  L 
Sbjct  414  EHNSMDYI-GNNYEYLPFGSGRRICPGISFGLANVYFPLAQLLNHFDWKLPTGINPSELD  472

Query  229  LTELPRMAMGVKNDIFFI  176
            LTE   +A   KND+  I
Sbjct  473  LTEAAGVACATKNDLHLI  490



>ref|XP_011082254.1| PREDICTED: premnaspirodiene oxygenase [Sesamum indicum]
Length=524

 Score =   218 bits (555),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/199 (50%), Positives = 138/199 (69%), Gaps = 5/199 (3%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR----VEESNVDKLAYLNL  593
            D+F  A +TS T     M E+++NP V+AKAQAEVR+VF G     + E NV KL YL L
Sbjct  295  DVFSAATETSATAIDWIMTELMRNPGVMAKAQAEVRQVFNGSRTTSINEDNVRKLNYLKL  354

Query  592  VIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPER  413
            VI+ET+RLHP  P + R + ++  + GYTIP   +VL+N+W + RDP+YW +PESF+PER
Sbjct  355  VIRETLRLHPSVPFLPRASREECTINGYTIPANVKVLVNSWGMQRDPKYWTNPESFEPER  414

Query  412  FEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTL  233
            FE++ MDF     F+Y+PFGSG+RMCPGI+F LAS+  PLA LLY+F+W+LP G+ P  L
Sbjct  415  FENNSMDFV-GGDFEYLPFGSGRRMCPGITFALASIELPLAQLLYNFNWKLPEGVKPENL  473

Query  232  KLTELPRMAMGVKNDIFFI  176
             + E P +    K+ ++ +
Sbjct  474  DMIENPGLTASRKSKLYVV  492



>ref|XP_006355983.1| PREDICTED: premnaspirodiene oxygenase-like, partial [Solanum 
tuberosum]
Length=514

 Score =   218 bits (555),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 143/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    + S+   + A+ EM++NP V+AKAQ EVR+VFKG+   +E +++KL YL LVI
Sbjct  308  DIFIAGTEASSLTIIWALSEMMRNPNVMAKAQHEVRQVFKGKKNYDEKDIEKLTYLKLVI  367

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLH PGP++  RE  +++ + GY IP +TRVL+N WA++RDP+YW++P SF PERF
Sbjct  368  KETLRLHTPGPLMGPRECRENTNIDGYIIPQKTRVLVNVWALARDPKYWQNPTSFIPERF  427

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E+  +DF   + F+++PFGSG+RMCPGI F LA+V   LA LLYHF+WELP+G+ P  L 
Sbjct  428  ENSSIDFM-GNDFEFIPFGSGRRMCPGIQFALANVGFSLAQLLYHFEWELPNGVNPKDLD  486

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   +    K D++ I
Sbjct  487  MTETHGLTASKKKDLYLI  504



>ref|XP_006339046.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=510

 Score =   218 bits (554),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 143/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    +TS T T+ AM EM++ P VLAKAQAEVRE FKG+   +E  +++L YL  V+
Sbjct  305  DLFSAGSETSGTTTIWAMSEMMRKPSVLAKAQAEVRETFKGKETFDEDVIEELKYLKQVV  364

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  R+  +++ + GYTIP +TRV++N +A+ RDP+YWED E F PERF
Sbjct  365  KETLRLHPPVPLLIPRKCREETNINGYTIPLKTRVMVNVYAMGRDPKYWEDAEIFIPERF  424

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +DF   + F+Y+PFG+G+RMCPGI+FGL +VY PLA LLYHFDW+LP G+ P  + 
Sbjct  425  EQSSVDFM-GNNFEYLPFGAGRRMCPGITFGLINVYLPLAKLLYHFDWKLPDGLKPKYVD  483

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   +    K++++ I
Sbjct  484  MTEFSGITAARKSELYLI  501



>ref|XP_009765480.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=511

 Score =   217 bits (553),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 149/201 (74%), Gaps = 4/201 (2%)
 Frame = -2

Query  769  CM*DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLN  596
             M D+F    +TS+T T+ AM EM++NP+V AKAQAEVREVFKG+  ++E N+++L YL 
Sbjct  303  VMIDLFSAGTETSSTTTIWAMTEMMRNPKVYAKAQAEVREVFKGKETIDEDNIEELKYLK  362

Query  595  LVIKETMRLHPPGPVIYR-ENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKP  419
             V+KET+RLHPP P++   E  +++ + GYTIP +TRV++NAWAI RDP+YWED E FKP
Sbjct  363  QVVKETLRLHPPLPLLLPRECREETNINGYTIPLKTRVMVNAWAIGRDPKYWEDAEQFKP  422

Query  418  ERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPH  239
            ERFE   +DF   + F+Y+PFGSG+RMCPGISFGL +V+ PLA LLYH DW+LP G+ P 
Sbjct  423  ERFEHGSVDFM-GNNFEYLPFGSGRRMCPGISFGLINVHLPLAKLLYHCDWKLPDGVKPE  481

Query  238  TLKLTELPRMAMGVKNDIFFI  176
             L +TE   +    K++++ I
Sbjct  482  DLDMTEFTAITAARKSELYLI  502



>gb|EYU21953.1| hypothetical protein MIMGU_mgv1a025918mg [Erythranthe guttata]
Length=498

 Score =   217 bits (552),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 143/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS+T    AM E+++NPRV+AK QAE+RE  KG+  VEES++  L YL LV+
Sbjct  294  DMFSAGTETSSTTMDWAMAELMRNPRVMAKVQAEIREALKGKNTVEESDLQGLKYLKLVV  353

Query  586  KETMRLHPPGPVIYRENNKDSV-VCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET RLHPP P++ R   ++ V V GY+IP  ++V++N W++ RDPQYW+ PESF+PERF
Sbjct  354  KETFRLHPPIPLLPRACREEGVKVNGYSIPINSKVMVNIWSMGRDPQYWDKPESFEPERF  413

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E+  +DF  +S F+Y+PFG+G+R+CPG++FGLA+   PLA +LYHFDW +P G+T   + 
Sbjct  414  ENSAVDFQGNS-FEYLPFGAGRRICPGMNFGLANTELPLAQILYHFDWSMPEGMTRGGID  472

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   +A+  KN +  +
Sbjct  473  MTEQEGIAVSRKNGLVLV  490



>gb|KDP39256.1| hypothetical protein JCGZ_01013 [Jatropha curcas]
Length=488

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 144/198 (73%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK--GRVEESNVDKLAYLNLVI  587
            D+F    +TS+T    AM E++KN  V+ KAQAE+R+VFK  G V+E  V +L YL L++
Sbjct  282  DLFIAGSETSSTTVEWAMSELLKNTSVMKKAQAELRQVFKNKGYVDEEGVCELNYLKLIV  341

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  REN++   + GY IP ++RVLIN WAI RDP YW++PE F PERF
Sbjct  342  KETLRLHPPVPLLVPRENSELCEINGYFIPVKSRVLINVWAIGRDPNYWKEPERFNPERF  401

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D+ +D+ + S F+++PFG+G+R+CPGI FG+A+V  PLA+LLYHFDW+LP  I P  L+
Sbjct  402  LDNSIDY-KGSNFEFIPFGAGRRICPGILFGIANVELPLANLLYHFDWKLPGEINPENLE  460

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   +A+  KND+  I
Sbjct  461  MTEASGIAVRRKNDLNLI  478



>ref|XP_009803037.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=512

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 142/197 (72%), Gaps = 4/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS+T  + AM E++KNP V+AKAQ+EVR+ FKG+   +E ++D L YL LV+
Sbjct  307  DMFTAGTETSSTAIIWAMSELMKNPNVMAKAQSEVRQAFKGKSSFDEEDLDNLPYLMLVV  366

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RLH P  +++RE  + + + GYTIP +  VL+N WAI RDP+ W +PESF PERFE
Sbjct  367  KETLRLHAPS-ILHRECREQTCIDGYTIPSKATVLVNTWAIGRDPEVWNNPESFIPERFE  425

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            +  +D+   + F+++PFGSGKR+CPG+ FGLA+   PLA LLYHF+WELP+G +P  L +
Sbjct  426  NSFIDYL-GNHFEFIPFGSGKRICPGMQFGLANFRYPLARLLYHFNWELPYGTSPKDLDM  484

Query  226  TELPRMAMGVKNDIFFI  176
            +E P M+   + D++ I
Sbjct  485  SEKPGMSAAKEKDLYVI  501



>gb|EYU32748.1| hypothetical protein MIMGU_mgv1a004746mg [Erythranthe guttata]
Length=512

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 140/187 (75%), Gaps = 3/187 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKG--RVEESNVDKLAYLNLVI  587
            DMF  A +TS++    AMVE+++NPRV AKAQAEVR VFK   +++E+   KL YL LV+
Sbjct  307  DMFSAATETSSSTIDWAMVELMRNPRVRAKAQAEVRNVFKDGQKIDEAEASKLKYLKLVV  366

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KE +RLHP  P++ R + +DS + GY IP +T+VL+N W + R+ +Y+ + E+F+PERFE
Sbjct  367  KEALRLHPATPLLSRASREDSEINGYFIPAKTKVLVNNWGMGRNSKYFPNAENFEPERFE  426

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            ++ +DF   + F+Y+PFG+GKRMCPG++FGLASV  PLAHLLYHFDW+LP G+ P  L++
Sbjct  427  NNGIDFN-GANFEYLPFGAGKRMCPGMTFGLASVELPLAHLLYHFDWKLPEGMKPSDLEM  485

Query  226  TELPRMA  206
             E P ++
Sbjct  486  LENPGIS  492



>ref|XP_006452554.1| hypothetical protein CICLE_v10008073mg [Citrus clementina]
 ref|XP_006474924.1| PREDICTED: cytochrome P450 71D11-like [Citrus sinensis]
 gb|ESR65794.1| hypothetical protein CICLE_v10008073mg [Citrus clementina]
Length=504

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 139/197 (71%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+FG   +TS T    AM EM+KNPRV+ KAQAEVREVF  KG+V+E+ ++++ YL LV+
Sbjct  304  DIFGAGSETSATTVDWAMYEMMKNPRVMKKAQAEVREVFNRKGKVDETGINEMKYLKLVV  363

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RLHP  P+I RE      + G+ IP + RV++N+WA  RDP YW +PESF PERF 
Sbjct  364  KETLRLHPSAPLILRECGDSCEINGFNIPAKARVIVNSWATGRDPMYWTEPESFIPERFI  423

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            D  +D+ + + F+Y+PFG+G+R+CPG+SFGLASV   LA LLYHF+W+LP+G+    L +
Sbjct  424  DHSVDY-KGTNFEYIPFGAGRRICPGMSFGLASVELTLAMLLYHFEWKLPNGMKHEDLDM  482

Query  226  TELPRMAMGVKNDIFFI  176
            TE     +  K D+  I
Sbjct  483  TEAFGATVRRKQDLCMI  499



>ref|XP_006367966.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=518

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 143/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +T++T  + A +E++KNPRV+ KAQ EVRE   G+    ++++++L YL  VI
Sbjct  314  DMFLAGTETASTTLIWAFLELIKNPRVMVKAQLEVRERLNGKKTFNDTDLEELNYLQFVI  373

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE  +++ + GYTIP +T+VL+NAW+I RDP+YW + ESF PERF
Sbjct  374  KETLRLHPPAPLLIPRECREETKIDGYTIPVKTKVLVNAWSIGRDPKYWHNSESFIPERF  433

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E+  +DF R + F+++PFG+G+RMCPG+ FGL ++  PL+ LLYHFDW++PHG+ P+ L 
Sbjct  434  ENSSIDF-RGNHFEFIPFGAGRRMCPGMLFGLVNIAHPLSQLLYHFDWKVPHGVNPNDLD  492

Query  229  LTELPRMAMGVKNDIFFI  176
              E   +    KND++ I
Sbjct  493  TIETEGLTARRKNDLYLI  510



>gb|EYU21988.1| hypothetical protein MIMGU_mgv1a004711mg [Erythranthe guttata]
Length=513

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 139/198 (70%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    DTS+T     M E+++NPRV+AKAQAEVRE FK    ++E N   L YL +VI
Sbjct  313  DMFSAGTDTSSTAIEWTMTELMRNPRVMAKAQAEVREAFKETEPIDEGNTQHLKYLKMVI  372

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KE++RLHPP P++ R + +++VV GYTIP   +VL+N WAI RDP++WE+P+SF+PERFE
Sbjct  373  KESLRLHPPVPLLPRASREETVVNGYTIPANVKVLVNNWAIQRDPKHWENPDSFEPERFE  432

Query  406  D-DPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
              +  DF     F+Y+PFGSGKRMCPGI+F LASV   LA LLY F+W+LP G+ P  + 
Sbjct  433  KKNSRDFL-GGDFEYLPFGSGKRMCPGITFSLASVELFLAQLLYSFNWKLPDGVNPGNMD  491

Query  229  LTELPRMAMGVKNDIFFI  176
            LTE P +    K +++ +
Sbjct  492  LTENPGITAQRKENLYVV  509



>sp|O81974.1|C71D8_SOYBN RecName: Full=Cytochrome P450 71D8; AltName: Full=Cytochrome 
P450 CP7 [Glycine max]
 emb|CAA71517.1| putative cytochrome P450 [Glycine max]
Length=504

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 140/197 (71%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            ++F    DTS +    AM EM+KNP+V  KAQAE+R++FKG+  + E+++++L+YL  VI
Sbjct  302  NIFAAGTDTSASTLEWAMSEMMKNPKVKEKAQAELRQIFKGKEIIRETDLEELSYLKSVI  361

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RLHPP  +I RE    + + GY IP +T+V+IN WAI RDPQYW D + F PERF 
Sbjct  362  KETLRLHPPSQLIPRECIISTNIDGYEIPIKTKVMINTWAIGRDPQYWSDADRFIPERFN  421

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            D  +DF + + F+Y+PFG+G+RMCPG++FGLAS+  PLA LLYHF+WELP+ + P  L +
Sbjct  422  DSSIDF-KGNSFEYIPFGAGRRMCPGMTFGLASITLPLALLLYHFNWELPNKMKPEDLDM  480

Query  226  TELPRMAMGVKNDIFFI  176
             E   M +  KN +F I
Sbjct  481  DEHFGMTVARKNKLFLI  497



>dbj|BAC53923.1| cytochrome P450 [Petunia x hybrida]
Length=502

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 146/198 (74%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS+T  + A+ EM+K P VLAKAQAEVR+  KG+   +  ++D+L YL LVI
Sbjct  300  DMFSAGTETSSTTIIWALAEMMKKPSVLAKAQAEVRQAMKGKKGFQLIDLDELKYLKLVI  359

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+R+HPP P++  RE  +++ + G+ IP +TRV++N WAI R+P+ WEDPESF PERF
Sbjct  360  KETLRMHPPIPLLIPRECMEETKINGFNIPLKTRVIVNIWAIGRNPESWEDPESFMPERF  419

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E++P+DFT  +  +++PFG+G+RMCPG+ FGL +V   LA LL+HFDW+LP+G +P  L 
Sbjct  420  ENNPIDFT-GNHHQFIPFGAGRRMCPGMLFGLTNVAQLLAQLLHHFDWKLPNGQSPQDLD  478

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE P ++   K+D+ F+
Sbjct  479  MTESPGVSATRKDDLVFV  496



>ref|XP_009612417.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=497

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 141/183 (77%), Gaps = 4/183 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS+     AMVEM+KNP VLAKAQAEVR+ F+G+   +E++V++L YL LVI
Sbjct  292  DMFAAGTETSSVTIDWAMVEMMKNPSVLAKAQAEVRKAFRGKETFDENDVEELNYLKLVI  351

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KE  RLHPP P++  RE  +++ + GYTIP + +V++N WAI RDP+YW+D ESFKPERF
Sbjct  352  KEAFRLHPPFPLLLPRECREETDINGYTIPLKAKVMVNVWAIGRDPKYWDDAESFKPERF  411

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E + MDF   + F+Y+PFGSG+R CPGISFGLA+VY PLA LLYHFDW+LP+GI P+ L 
Sbjct  412  EHNSMDFV-GNNFEYLPFGSGRRNCPGISFGLANVYYPLAQLLYHFDWKLPNGINPNELD  470

Query  229  LTE  221
            LTE
Sbjct  471  LTE  473



>ref|XP_009619325.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=509

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 148/200 (74%), Gaps = 6/200 (3%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRV---EESN-VDKLAYLNL  593
            D+F G  +TS+T+ + A+ E++KNP V+AKAQ+EVR+VFKG+    EE N V+KL+YL L
Sbjct  304  DIFLGGTETSSTVLIWALAELMKNPNVMAKAQSEVRQVFKGKKIYDEEDNIVEKLSYLKL  363

Query  592  VIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPE  416
            VI ET+RLH P P++  RE  +++ + GY IP +T+VL+NAWA++RD + W DPESF PE
Sbjct  364  VIMETLRLHTPAPLMGPRECREETNIAGYNIPNKTKVLVNAWALARDVESWNDPESFIPE  423

Query  415  RFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHT  236
            RF++  +DF   + F+Y+PFG+G+R+CPGI FGLA++  PLA LLY+F+W+LP+GI P  
Sbjct  424  RFDNSSIDFM-GNYFEYIPFGTGRRICPGIQFGLANIGVPLAQLLYNFEWKLPYGINPQD  482

Query  235  LKLTELPRMAMGVKNDIFFI  176
            L +TE   +    + D++ +
Sbjct  483  LDMTETHGLTGAKQKDLYLV  502



>ref|XP_006474921.1| PREDICTED: cytochrome P450 71D11-like isoform X2 [Citrus sinensis]
Length=507

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 141/195 (72%), Gaps = 4/195 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK--GRVEESNVDKLAYLNLVI  587
            D+F    +TS T    AM EM+KNPRV+ KAQAEVREVF   G+V E+++D++ +L LV+
Sbjct  301  DIFAAGSETSATTVDWAMCEMMKNPRVMKKAQAEVREVFHRTGKVNETSIDEMKFLKLVV  360

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHP  P++  RE  +   + G+ IP + RV++NAWAI RDP+YW +PESF PERF
Sbjct  361  KETLRLHPAAPLLIPRECGQRCQINGFDIPVKARVIVNAWAIGRDPEYWTEPESFIPERF  420

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D  +D+ + + F+Y+PFG+G+R+CPG+SFGLASV  PLA LLYHFDW+LP+GI    L 
Sbjct  421  LDHSVDY-KGTNFEYIPFGAGRRICPGMSFGLASVELPLAMLLYHFDWKLPNGIKHEDLD  479

Query  229  LTELPRMAMGVKNDI  185
            +TE   + +  K D+
Sbjct  480  MTEAFGVTVRRKQDL  494



>ref|XP_006452556.1| hypothetical protein CICLE_v10008047mg [Citrus clementina]
 ref|XP_006474920.1| PREDICTED: cytochrome P450 71D11-like isoform X1 [Citrus sinensis]
 gb|ESR65796.1| hypothetical protein CICLE_v10008047mg [Citrus clementina]
Length=510

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 141/195 (72%), Gaps = 4/195 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK--GRVEESNVDKLAYLNLVI  587
            D+F    +TS T    AM EM+KNPRV+ KAQAEVREVF   G+V E+++D++ +L LV+
Sbjct  304  DIFAAGSETSATTVDWAMCEMMKNPRVMKKAQAEVREVFHRTGKVNETSIDEMKFLKLVV  363

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHP  P++  RE  +   + G+ IP + RV++NAWAI RDP+YW +PESF PERF
Sbjct  364  KETLRLHPAAPLLIPRECGQRCQINGFDIPVKARVIVNAWAIGRDPEYWTEPESFIPERF  423

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D  +D+ + + F+Y+PFG+G+R+CPG+SFGLASV  PLA LLYHFDW+LP+GI    L 
Sbjct  424  LDHSVDY-KGTNFEYIPFGAGRRICPGMSFGLASVELPLAMLLYHFDWKLPNGIKHEDLD  482

Query  229  LTELPRMAMGVKNDI  185
            +TE   + +  K D+
Sbjct  483  MTEAFGVTVRRKQDL  497



>ref|XP_002514827.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF47381.1| cytochrome P450, putative [Ricinus communis]
Length=524

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 140/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            DMF G  DTS+      M E++KN RV+ KAQAEVR++F  KG V+E+ + +L YL LVI
Sbjct  318  DMFFGGTDTSSATIEWTMSELIKNQRVMEKAQAEVRQIFGAKGDVDEAGLHQLIYLKLVI  377

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
             ET+RLHPP P++  RE   + V+ GY IP  ++V+INAWAI RDP+YW +PE + PERF
Sbjct  378  NETLRLHPPAPMLLPRECIANCVINGYDIPTMSKVIINAWAIGRDPRYWVEPEKYNPERF  437

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
              D +D  +++ F+++PFG G+RMCPGISFG+A+V  PLA +LYHFDW+LP G  P  L 
Sbjct  438  LCDSIDHKKTN-FEFLPFGGGRRMCPGISFGMATVELPLARMLYHFDWKLPEGQNPENLD  496

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   +A   KND++ I
Sbjct  497  MTEYLGVAGRRKNDLYLI  514



>emb|CDP18847.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 143/197 (73%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F G  DT++  +  AM E++K+PRV+AKAQAEVR+VFKG+  +EE +V KL YL +V+
Sbjct  283  DIFTGGTDTASVTSEWAMAELMKHPRVMAKAQAEVRQVFKGKKPIEEDDVQKLVYLKMVV  342

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RLHPP P+I R + ++  V G  IP ++++++NAWAI RDP+YW+DPE F PERFE
Sbjct  343  KETLRLHPPIPLIPRASRENRQVKGCMIPNKSQIMVNAWAIGRDPEYWDDPEIFLPERFE  402

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
             + +D+T  +  +Y+PFG+G+RMCPG +FG+ +V  PLAHLLYHFDW LP  +    L +
Sbjct  403  QNSIDYT-GTHCQYLPFGTGRRMCPGTAFGIVNVELPLAHLLYHFDWRLPDRMNVIDLDM  461

Query  226  TELPRMAMGVKNDIFFI  176
             E   + +  KN++  +
Sbjct  462  DEAAGINIKRKNNLNLV  478



>gb|AEX07771.1| cytochrome P450 [Catharanthus roseus]
Length=506

 Score =   216 bits (549),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 139/199 (70%), Gaps = 6/199 (3%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+  G  +TS+T    AM EM++NP V++KAQ E+RE F G+  +EE+++  L YL LVI
Sbjct  305  DIIAGGTETSSTAVDWAMSEMMRNPHVMSKAQKEIREAFNGKEKIEENDIQNLKYLKLVI  364

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            +ET+RLHPP P++ R+  +   + GY IP  T+  IN WAI RDP YW +PESF PERF+
Sbjct  365  QETLRLHPPAPLLMRQCREKCEIGGYHIPVGTKAFINVWAIGRDPAYWPNPESFIPERFD  424

Query  406  DDPMDFTRSSQ--FKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTL  233
            D+  +FT+S    F+Y+PFG+G+RMCPGISFGLA+V  PLA LLYHF+W+LP G T  TL
Sbjct  425  DNTYEFTKSEHHAFEYLPFGAGRRMCPGISFGLANVELPLALLLYHFNWQLPDGST--TL  482

Query  232  KLTELPRMAMGVKNDIFFI  176
             +TE   +A   K D+  I
Sbjct  483  DMTEATGLAARRKYDLQLI  501



>ref|XP_004228511.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=493

 Score =   216 bits (549),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 145/198 (73%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    +TS+      MVEM++NP VL+KAQ EVR  FKG+   +E++V++L YL LV+
Sbjct  292  DIFAAGTETSSATIDWIMVEMMRNPNVLSKAQEEVRNAFKGKETFDENDVEELKYLKLVV  351

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KE+ RLHPP P++  RE  ++  + GYTIP +T+V++NAWAI RDP+YW+D ESFKPERF
Sbjct  352  KESFRLHPPFPLLLPRECREEVEINGYTIPLKTKVMVNAWAIGRDPKYWDDAESFKPERF  411

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            ED+ MDF   + F+Y+PFGSG+R CPGISFGLA+VY PLA LLYHFDW+LP+GI    L 
Sbjct  412  EDNSMDFI-GNNFEYLPFGSGRRNCPGISFGLANVYFPLAQLLYHFDWKLPNGINSSELD  470

Query  229  LTELPRMAMGVKNDIFFI  176
            LTE        KN+++ I
Sbjct  471  LTESAGSTCARKNNLYLI  488



>ref|XP_009598320.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=502

 Score =   216 bits (549),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 147/198 (74%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F G  +TS++    AMVEM+KNP +L KAQ+EVR+ FKG+   +E++V++L YL LVI
Sbjct  297  DLFAGGTETSSSTVTWAMVEMMKNPSILIKAQSEVRDAFKGKEAFDENDVEELKYLKLVI  356

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET RLHPP P++  RE  +++ + GYTIP +T +++N WA+ RDP+YW D E+FKPERF
Sbjct  357  KETFRLHPPLPLLIPRECREETNINGYTIPLKTTIMVNVWAMGRDPKYWVDAENFKPERF  416

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            +   MDFT  + F+++PFGSG+R+CPGISFGLA++Y PLA LLYHFDW LP GI P  L 
Sbjct  417  QHSTMDFT-GNNFEFLPFGSGRRICPGISFGLANIYLPLAQLLYHFDWNLPTGINPSDLD  475

Query  229  LTELPRMAMGVKNDIFFI  176
            L E   +A+  K+D + I
Sbjct  476  LAESAGLAVLRKSDFYLI  493



>gb|EYU39554.1| hypothetical protein MIMGU_mgv1a004505mg [Erythranthe guttata]
Length=523

 Score =   216 bits (550),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 139/199 (70%), Gaps = 5/199 (3%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK---GRVEESNVDKLAYLNLV  590
            DMFG  VDTS T+   AM EM++NPRVL KAQ EVR VF    G V+E   D+L Y  LV
Sbjct  309  DMFGAGVDTSPTVIDWAMSEMLRNPRVLKKAQEEVRRVFDSKGGIVDERYFDELKYFKLV  368

Query  589  IKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPER  413
            IKET+R HP  P++  RE+ +  ++ GY IP +TRV++NAWAI RDP+YWE+PESFKPER
Sbjct  369  IKETLRAHPVVPLLLPRESREPCLINGYEIPVKTRVVVNAWAIGRDPEYWEEPESFKPER  428

Query  412  FEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTL  233
            F + P++FT  + F+Y+PFGSG+R CPG+  GLA+V  PLA  LYHFDW LP G+ P  L
Sbjct  429  FIETPIEFT-GNNFEYIPFGSGRRACPGMMIGLANVELPLAMFLYHFDWMLPDGMKPEDL  487

Query  232  KLTELPRMAMGVKNDIFFI  176
             +TEL   +   K D+  +
Sbjct  488  DMTELAGASARRKFDLCVV  506



>gb|KEH34014.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=507

 Score =   216 bits (549),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 141/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+FG   +TS +    AM EMVKNPR++ KAQAEVRE+F  KGRVEE+ +++L YL  ++
Sbjct  301  DIFGAGGETSASTIDWAMAEMVKNPRIMKKAQAEVREIFNMKGRVEENCINELNYLKSIV  360

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE  +   + GY IP +T+V++NAWAI+RDP YW +PE F PERF
Sbjct  361  KETLRLHPPAPLLIPRECAQSCKIDGYDIPTKTKVIVNAWAIARDPNYWTEPERFYPERF  420

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D  +D+ + S F+Y+PFG+G+R+CPG  FGL SV   LA LLYHFDW+LP+GI    L 
Sbjct  421  IDSDIDY-KGSNFEYIPFGAGRRICPGSIFGLRSVELALAKLLYHFDWKLPNGIKSEELD  479

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   + +  K+D+  +
Sbjct  480  MTEKFGITVCRKDDLLLL  497



>gb|KEH25843.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=500

 Score =   215 bits (548),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 136/200 (68%), Gaps = 5/200 (3%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKG--RVEESNVDKLAYLNLVI  587
            DMFGG  DTS      AM E++KNPRV+ KAQAE+RE  KG  R+ ES++ KL YL LVI
Sbjct  296  DMFGGGSDTSAITIEWAMSELMKNPRVMKKAQAEIREAVKGKKRIYESDLHKLGYLKLVI  355

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RLHPP  ++ RE  +   + GY IP +T +++NAWAI RDP++W D E F PERF 
Sbjct  356  KETLRLHPPATLLMRECREACNIGGYEIPLKTNLILNAWAIGRDPEHWSDAEKFIPERFH  415

Query  406  DDP-MDFTR--SSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHT  236
            D    DF +   + F+Y PFG G+RMCPGI FGLA++  PLA LLYHFDW++P+ +    
Sbjct  416  DSTGFDFNKVNDNSFQYFPFGGGRRMCPGILFGLANIELPLAALLYHFDWKIPNEMKEED  475

Query  235  LKLTELPRMAMGVKNDIFFI  176
            L +TE+    +  KN++F I
Sbjct  476  LDMTEVFGATVSRKNNLFLI  495



>ref|XP_003537457.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 gb|KHN42026.1| Cytochrome P450 71D8 [Glycine soja]
Length=505

 Score =   215 bits (548),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 139/197 (71%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    DTS +    AM EM+KNPRV  KAQA +R+ FKG+  + E+++++L+YL  VI
Sbjct  303  DIFAAGTDTSASTLEWAMAEMMKNPRVREKAQAVIRQAFKGKETIRETDLEELSYLKSVI  362

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RLHPP  +I RE  K + + GY IP +++V+IN WAI RDPQYW D E F PERF+
Sbjct  363  KETLRLHPPSQLIPRECIKSTNIDGYEIPIKSKVMINTWAIGRDPQYWSDAERFIPERFD  422

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
               +DF + + ++Y+PFG+G+RMCPG++FGLAS+  PLA LLYHF+WELP+ + P  L +
Sbjct  423  GSYIDF-KGNSYEYIPFGAGRRMCPGMTFGLASITLPLALLLYHFNWELPNKMKPEDLDM  481

Query  226  TELPRMAMGVKNDIFFI  176
             E   M +G KN +  I
Sbjct  482  NEHFGMTVGRKNKLCLI  498



>ref|XP_006359503.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=503

 Score =   215 bits (548),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 145/199 (73%), Gaps = 5/199 (3%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRV---EESNVDKLAYLNLV  590
            DMF    DTS+   + A+ EM+K+P V+AKAQAEVREVFKG+    ++++++KL YL LV
Sbjct  300  DMFVAGSDTSSATVIWALSEMMKSPSVMAKAQAEVREVFKGKETCNDDTDLEKLNYLKLV  359

Query  589  IKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPER  413
            IKET+RLHPP P++  RE  +++ + G+TIP +++VL+N WAI RDP+ WE+PE F PER
Sbjct  360  IKETLRLHPPTPLLVPRECREETKIDGFTIPLKSKVLVNVWAIGRDPKSWENPECFIPER  419

Query  412  FEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTL  233
            FE+  ++FT  + F+ +PFG+G+RMCPGI FG+A V  PLAHLLY FDW+LP GI    L
Sbjct  420  FENSSIEFT-GNCFQLLPFGAGRRMCPGIHFGIALVTLPLAHLLYKFDWKLPEGIHVRDL  478

Query  232  KLTELPRMAMGVKNDIFFI  176
             +TE   +    +ND++ I
Sbjct  479  DMTESNGITARRENDLYLI  497



>gb|KCW68415.1| hypothetical protein EUGRSUZ_F02064 [Eucalyptus grandis]
Length=476

 Score =   214 bits (546),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 142/197 (72%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+F    +TS T    A+ EM+KNPR+L KAQAEVREVF  +G+ +E+ + +L YL LVI
Sbjct  271  DIFVAGGETSATQVDWALAEMMKNPRILKKAQAEVREVFDRRGKADETGLPELEYLKLVI  330

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KE +R+HP  P++ RE  +   + GY IP +T+V++NAWAI RDP+YW++PE+F PERF+
Sbjct  331  KECLRMHPSIPLLLRECRERFEINGYEIPVKTKVVVNAWAIGRDPKYWDNPEAFYPERFK  390

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            D P+D+ + + F+Y+PFG+G+RMCPG++FG+ +V  PLA LLYHFDWELP G+    L +
Sbjct  391  DSPVDY-KGTSFEYIPFGAGRRMCPGMNFGIVNVELPLAMLLYHFDWELPEGMKREELDM  449

Query  226  TELPRMAMGVKNDIFFI  176
             EL  +    K D++ +
Sbjct  450  GELLGVTQRRKRDLYLV  466



>ref|XP_011081964.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=513

 Score =   215 bits (548),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 140/197 (71%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    +TS+T     M E+++NP V+ K Q E+R+ FKG   +E+++V  L YL LVI
Sbjct  309  DIFAAGTETSSTTVDWIMAELIRNPHVMGKVQNEIRQTFKGNKTIEDADVQNLKYLKLVI  368

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KE +RLH P P+I R + +D+ + GY IP R +VL+NAW + RDP+ W +PESF+PERF+
Sbjct  369  KEGLRLHAPIPLIPRVSREDTEIAGYLIPARAKVLVNAWGMGRDPEIWSNPESFEPERFD  428

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            ++  DFT  + F+Y+PFG+G+RMCPG++FGLASV  PLAHLLY+FDW+LP G++P+ L +
Sbjct  429  NNSTDFT-GNHFEYIPFGAGRRMCPGMTFGLASVELPLAHLLYNFDWKLPDGMSPNDLDM  487

Query  226  TELPRMAMGVKNDIFFI  176
             E P +    + ++  +
Sbjct  488  VERPAITAARRQNLELV  504



>emb|CDP08464.1| unnamed protein product [Coffea canephora]
Length=415

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 141/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF G  +TS++    AM EM++ P V+AKAQ E+R+ FKG+  ++E +V +L YL  VI
Sbjct  209  DMFAGGTETSSSTVEWAMSEMIRTPMVMAKAQEEIRQAFKGKQKIDEIDVQELRYLKFVI  268

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE  +   V GYTIP +T+V++N WA+ RDP+YW DPESF+PERF
Sbjct  269  KETLRLHPPAPLLIPRECREQCEVNGYTIPIKTKVVVNCWALGRDPEYWSDPESFEPERF  328

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            +++P+DFT  + F+++PFG G+R+CPG+SFGL ++   LA LLYHF+W LP G+    L 
Sbjct  329  DNNPVDFT-GNHFEFVPFGGGRRICPGMSFGLVNMELQLALLLYHFNWRLPDGMNSEDLD  387

Query  229  LTELPRMAMGVKNDIFFI  176
            + E   +    KN+++ +
Sbjct  388  MIENNGITATRKNNLYLV  405



>ref|XP_004512032.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=508

 Score =   215 bits (548),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 143/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    DTS+T    +M EM+KNPRV  KAQAE+RE F+G+  + E+++ +L YLNLVI
Sbjct  306  DIFVAGTDTSSTTIEWSMSEMMKNPRVRDKAQAELREAFRGKDKICETDMHQLTYLNLVI  365

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE  + + + GY IP +T +LINAWA+ RDP++W D E F PERF
Sbjct  366  KETLRLHPPSPLLVPRECYELTNIDGYDIPKKTTILINAWAMGRDPEHWSDAERFIPERF  425

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            +   +DF + + F+Y+PFG+G+RMCPG+SFGLASV  PLA LLYHF+WELP+ + PH   
Sbjct  426  DGSFIDF-KGNNFEYIPFGAGRRMCPGMSFGLASVMFPLALLLYHFNWELPNHMKPHDFD  484

Query  229  LTELPRMAMGVKNDIFFI  176
            + E   M +G KN++  I
Sbjct  485  MIEHFGMTVGRKNELCLI  502



>gb|KJB11068.1| hypothetical protein B456_001G239400, partial [Gossypium raimondii]
Length=369

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 141/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+FGG  +TS+T    AM EM++NP+VL +AQ EVR+V  G+  V+E+++ +L YL LVI
Sbjct  163  DIFGGGGETSSTTVDWAMAEMLRNPKVLKRAQNEVRQVCHGKRDVDEASLKELKYLALVI  222

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KETMRLHPP P++  RE+ ++  + GY +P +TRV+INAWA+ RDP+YW + E+F PERF
Sbjct  223  KETMRLHPPFPLLVPRESRENCEINGYQVPTKTRVIINAWAMGRDPKYWSEVETFYPERF  282

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             +   DF + +  +Y+PFG+G+RMCPGISF L ++  PLA LLYHFDWELP G+    L 
Sbjct  283  LNSSCDF-KGTNLEYIPFGAGRRMCPGISFALPNIELPLAKLLYHFDWELPSGLPHENLD  341

Query  229  LTELPRMAMGVKNDIFFI  176
            ++E   M    K+D+  I
Sbjct  342  MSETFGMTARRKDDLILI  359



>ref|XP_006365979.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=521

 Score =   215 bits (548),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 135/197 (69%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS    + A+ EM++ P ++AKAQ EVR+VFKG   + E ++DKL YL LVI
Sbjct  316  DMFAAGTETSAATIIWALSEMMRRPNIMAKAQNEVRQVFKGNTTINEDDLDKLIYLKLVI  375

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RLHPP  ++ RE  K + + GYTIPP+TRVLIN WA+ RD + W+D ESF PERFE
Sbjct  376  KETLRLHPPSTLLPRECRKQTYINGYTIPPKTRVLINTWALGRDSESWDDTESFIPERFE  435

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            +  +D+   + F+++PFGSG+R+CPG+ FGL +V  PLA LLYHFDW LP+G  P  L +
Sbjct  436  NSHVDYM-GNYFEFIPFGSGRRICPGMQFGLTNVKHPLAQLLYHFDWVLPYGANPEDLDM  494

Query  226  TELPRMAMGVKNDIFFI  176
             E   ++     D+  I
Sbjct  495  IEKNGLSAAKHKDLCLI  511



>sp|Q6WKZ1.1|C71DI_MENGR RecName: Full=Cytochrome P450 71D18; AltName: Full=(-)-(4S)-Limonene-6-hydroxylase 
[Mentha x gracilis]
 sp|Q9XHE8.1|C71DI_MENSP RecName: Full=Cytochrome P450 71D18; AltName: Full=(-)-(4S)-Limonene-6-hydroxylase 
[Mentha spicata]
 gb|AAD44150.1| cytochrome p450 [Mentha spicata]
 gb|AAQ18706.1| limonene-6-hydroxylase [Mentha x gracilis]
Length=496

 Score =   215 bits (547),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 140/197 (71%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D F    +TS+T    A+ E+++NP  +AK QAEVRE  KG+  V+ S V +L YL  V+
Sbjct  294  DTFSAGAETSSTTISWALSELMRNPAKMAKVQAEVREALKGKTVVDLSEVQELKYLRSVL  353

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RLHPP P+I R++ ++  V GYTIP +TR+ IN WAI RDPQYWEDP++F+PERF+
Sbjct  354  KETLRLHPPFPLIPRQSREECEVNGYTIPAKTRIFINVWAIGRDPQYWEDPDTFRPERFD  413

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            +   DF   + F+++PFG+G+R+CPG+ FGLA+V  PLA LLYHFDW+LP G+T   L +
Sbjct  414  EVSRDFM-GNDFEFIPFGAGRRICPGLHFGLANVEIPLAQLLYHFDWKLPQGMTDADLDM  472

Query  226  TELPRMAMGVKNDIFFI  176
            TE P ++   K ++  +
Sbjct  473  TETPGLSGPKKKNVCLV  489



>ref|XP_007156882.1| hypothetical protein PHAVU_002G025100g [Phaseolus vulgaris]
 gb|ESW28876.1| hypothetical protein PHAVU_002G025100g [Phaseolus vulgaris]
Length=506

 Score =   215 bits (547),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 145/198 (73%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    DTS ++    + E++K+PRV+ KAQ+E+RE F+G+  + ES++D+L YL LVI
Sbjct  304  DVFVAGSDTSASVLEWVVAEIMKSPRVMEKAQSEIREAFRGKETIHESDLDELNYLKLVI  363

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE  K + + GY IP +T+V+INAWA+ RDP+YW D E F PERF
Sbjct  364  KETLRLHPPVPLLIPRECTKLTNIGGYEIPKKTKVMINAWALGRDPEYWSDAERFIPERF  423

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E + +DF R + F+Y+PFG+G+RMCPG++FGLAS+  PLA LLYHF+WELP+ + P  + 
Sbjct  424  EGNSVDF-RGNNFEYVPFGAGRRMCPGMTFGLASIMLPLALLLYHFNWELPNKMKPEDMD  482

Query  229  LTELPRMAMGVKNDIFFI  176
            + E   + +G +N++  I
Sbjct  483  MVEHFGLVVGRENELRLI  500



>gb|KHN36162.1| Cytochrome P450 71D8 [Glycine soja]
Length=453

 Score =   213 bits (543),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 142/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    DTS +    AM EM++NPRV  KAQAEVR+ F+    + E++V++L YL LVI
Sbjct  251  DVFTAGTDTSASTLEWAMAEMMRNPRVREKAQAEVRQAFRELKIINETDVEELIYLKLVI  310

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLH P P++  RE +K +++ GY IP +T+V+INAWAI+RDPQYW D E F PERF
Sbjct  311  KETLRLHTPSPLLLPRECSKRTIIDGYEIPVKTKVMINAWAIARDPQYWTDAERFVPERF  370

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            +   +DF + + F+Y+PFG+G+RMCPG++ GLA++  PLA LLYHF+WELP+ + P  + 
Sbjct  371  DGSSIDF-KGNNFEYLPFGAGRRMCPGMTLGLANIMLPLALLLYHFNWELPNEMKPEYMD  429

Query  229  LTELPRMAMGVKNDIFFI  176
            + E   + +G KN++  I
Sbjct  430  MVENFGLTVGRKNELCLI  447



>ref|XP_006363816.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006363817.1| PREDICTED: premnaspirodiene oxygenase-like isoform X2 [Solanum 
tuberosum]
Length=503

 Score =   214 bits (546),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 141/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            ++F G  DTS+T+   A+ EM+KNP+V+ KAQAEVR VFKG+  + ES + KL Y+ LVI
Sbjct  297  EIFIGGTDTSSTVLEWAISEMMKNPQVMEKAQAEVRRVFKGKSKITESEIQKLDYMKLVI  356

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+R+HPP P++  RE  +   + GY IP +T+V+INAWAI R P++W++ E F+PERF
Sbjct  357  KETLRMHPPAPLLLPREAIEKCDIGGYEIPAKTKVIINAWAIGRHPEHWKNAECFEPERF  416

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            +D  +DF   +  +Y+PFG G+R+CPG  FG+A+V  PLA LL+HFDW+LP GI    L 
Sbjct  417  QDSDLDFI-GTNLEYIPFGGGRRICPGTLFGIANVELPLAKLLFHFDWKLPDGIEASNLD  475

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE     +G KND++ +
Sbjct  476  MTETFGATVGRKNDLYLV  493



>ref|XP_007020553.1| Cytochrome P450 71D10, putative [Theobroma cacao]
 gb|EOY12078.1| Cytochrome P450 71D10, putative [Theobroma cacao]
Length=518

 Score =   215 bits (547),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 144/198 (73%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+FG   + S+     AM EMV+NP+++ +AQAEVR VF  KG+V+E  +++L +L L++
Sbjct  311  DIFGAGSEASSNTVEWAMSEMVRNPKLMKEAQAEVRRVFHGKGKVDEVGLEELKFLKLIV  370

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RL+P GP++  RE ++D V+ GY IP +T+V++NAWAI RDP YW++ E F+PERF
Sbjct  371  KETLRLYPAGPLLIPRECSEDCVIGGYEIPAKTKVIVNAWAIGRDPSYWKEAEKFQPERF  430

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D  +DF R + F+Y+PFG+G+RMCPGISF L ++  PLA LLYHFDW+LP+ +    L 
Sbjct  431  IDKRIDF-RGTNFEYIPFGAGRRMCPGISFALPNIELPLAKLLYHFDWKLPNEMKCDDLD  489

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   + +  KND+F I
Sbjct  490  MTESFGLTVRRKNDLFLI  507



>ref|XP_004245943.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=499

 Score =   214 bits (546),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 145/198 (73%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F G  +TS+ I   A+ E++KNP+V+AKAQAEVR V KG+  + ++ V++L YL LVI
Sbjct  298  DLFFGGTETSSVIIQWALSELMKNPKVMAKAQAEVRRVCKGKKDLNDNVVEELKYLKLVI  357

Query  586  KETMRLHPPGPVI-YRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
             ET+RLHP  P++  R+  +++ + GYTIP +++V++N WAI+RDP+ W+DPE+F PERF
Sbjct  358  NETLRLHPASPLLGLRQCREETKIDGYTIPLKSQVVVNGWAIARDPESWDDPEAFVPERF  417

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E + +DF   + F+Y+PFG+G RMCPG+ FGLA+V  PLA LLYHFDW+LP+G  P  L 
Sbjct  418  EKNSVDFN-GNHFQYIPFGAGSRMCPGMHFGLANVVYPLAQLLYHFDWKLPYGQQPEDLD  476

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   ++   KND+  I
Sbjct  477  MTETLGISATRKNDLNLI  494



>ref|XP_003611884.1| Cytochrome P450 [Medicago truncatula]
 gb|AES94842.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=506

 Score =   214 bits (546),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 141/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    DTS+T    AM EM+KNPRV  KAQAE+R+ F G+  + E++V+KL+YL LVI
Sbjct  304  DVFVAGTDTSSTTIEWAMSEMMKNPRVREKAQAELRQAFNGKELIYETDVEKLSYLKLVI  363

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  R + + + + GY IP  T V INAWAI RDP+YW D E F PERF
Sbjct  364  KETLRLHPPSPLLVPRLSTELTKIDGYDIPKNTTVFINAWAIGRDPKYWNDAERFIPERF  423

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            +D  +DF + + F+Y+PFG+G+RMCPG++FGLASV  PLA LLYHF+WELP+ +    L 
Sbjct  424  DDSLIDF-KGNNFEYIPFGAGRRMCPGMTFGLASVIFPLALLLYHFNWELPNQMKSQDLD  482

Query  229  LTELPRMAMGVKNDIFFI  176
            + E   + +G KN++  I
Sbjct  483  MIEDFGLTVGRKNELCLI  500



>gb|AGH68502.1| cytochrome p450, partial [Ipomoea batatas]
Length=219

 Score =   206 bits (524),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 127/171 (74%), Gaps = 5/171 (3%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMFG   +TS+T  V AM EM+KNPRVLAKAQAEVREVF+G+  +EE +V++L YL LV+
Sbjct  48   DMFGAGTETSSTTVVWAMSEMMKNPRVLAKAQAEVREVFRGKEKLEEDDVEQLQYLKLVV  107

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+R HPP P++  RE  +++VVCGYTIP + RVLIN WA  RDP+YWEDPESF PERF
Sbjct  108  KETLRCHPPAPLLIPRECTEETVVCGYTIPQKARVLINVWANGRDPKYWEDPESFIPERF  167

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAH-LLYHFDWEL  260
            E+  +DFT  + F+++PFG G+R+CP ++F    +   L H    HFDW L
Sbjct  168  ENSSIDFT-GNNFEFLPFGGGRRICPALTFWFLPILCLLLHTCCAHFDWTL  217



>ref|XP_010061471.1| PREDICTED: cytochrome P450 71D11-like [Eucalyptus grandis]
Length=503

 Score =   214 bits (546),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 142/197 (72%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+F    +TS T    A+ EM+KNPR+L KAQAEVREVF  +G+ +E+ + +L YL LVI
Sbjct  298  DIFVAGGETSATQVDWALAEMMKNPRILKKAQAEVREVFDRRGKADETGLPELEYLKLVI  357

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KE +R+HP  P++ RE  +   + GY IP +T+V++NAWAI RDP+YW++PE+F PERF+
Sbjct  358  KECLRMHPSIPLLLRECRERFEINGYEIPVKTKVVVNAWAIGRDPKYWDNPEAFYPERFK  417

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            D P+D+ + + F+Y+PFG+G+RMCPG++FG+ +V  PLA LLYHFDWELP G+    L +
Sbjct  418  DSPVDY-KGTSFEYIPFGAGRRMCPGMNFGIVNVELPLAMLLYHFDWELPEGMKREELDM  476

Query  226  TELPRMAMGVKNDIFFI  176
             EL  +    K D++ +
Sbjct  477  GELLGVTQRRKRDLYLV  493



>ref|XP_003611883.1| Cytochrome P450 [Medicago truncatula]
 gb|AES94841.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=507

 Score =   214 bits (546),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 141/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D F    DT+T+  V AM E++KNP V+ KAQAE+RE  KG+  + E+++ +L YL LVI
Sbjct  306  DAFAAGTDTTTSTIVWAMSELMKNPSVMNKAQAEIREACKGKEIISENDIQELPYLKLVI  365

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLH P P++  RE  + + + GY IP +T+V+IN WA++RDPQYW D E F PERF
Sbjct  366  KETLRLHSPTPLLLPRECTELTNIDGYDIPKKTKVMINVWAMARDPQYWTDAEMFNPERF  425

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +DF R + F+Y+PFG+G+R+CPG+ FG+A +  P+A LLYHF+WELP+ + P  L 
Sbjct  426  EGSSIDF-RGNNFEYLPFGAGRRICPGLQFGIAGIMLPVALLLYHFNWELPNKMKPMDLD  484

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   +A+G K+D+  I
Sbjct  485  MTEHYGLAIGKKSDLCLI  502



>ref|XP_010064672.1| PREDICTED: cytochrome P450 71D11-like [Eucalyptus grandis]
Length=506

 Score =   214 bits (546),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 143/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+F    +TS T    A+ EM+KNPR+L KAQAEVREVF  +G+ +E+ + +L YL LVI
Sbjct  300  DIFAAGSETSATQVDWALAEMMKNPRILKKAQAEVREVFDRRGKADETGLPELEYLKLVI  359

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KE +RL P  P++  RE  +   + GY IP +TRVL+NAWAI RDP+YW+DPESF PERF
Sbjct  360  KECLRLRPSIPLLLPRECTERCEINGYEIPVKTRVLVNAWAIGRDPKYWDDPESFYPERF  419

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            +D P+D+ + + F+Y+PFG+G+R+CPG++FG+A+V  PLA LLYHFDWELP G+    + 
Sbjct  420  KDSPVDY-KGTSFEYIPFGAGRRICPGMNFGIANVELPLAMLLYHFDWELPEGMKSEEMD  478

Query  229  LTELPRMAMGVKNDIFFI  176
            ++E   ++   K D++ +
Sbjct  479  MSETLGVSQRRKRDLYVV  496



>ref|XP_003615865.1| Cytochrome P450 [Medicago truncatula]
 gb|AES98823.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=502

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 143/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            DMFG   +TS+   +  + EMVKNP+++ KAQAEVR+VF  KG V+E+ + +L YL  +I
Sbjct  300  DMFGAGTETSSGAVLWGISEMVKNPKIMEKAQAEVRKVFDKKGYVDETELHQLIYLKSII  359

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            +ET+RLHP  P++  RE+ +   + GY IP +TRV IN WAI RD +YW + ESFKPERF
Sbjct  360  RETLRLHPSVPLLVPRESRERCQINGYEIPAKTRVAINVWAIGRDERYWAEAESFKPERF  419

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             +  +DF + + F+Y+PFG+G+RMCPG++FGL+++  PLA LLYHFDW+LP+G+    L 
Sbjct  420  LNSTIDF-KGTNFEYIPFGAGRRMCPGMAFGLSNIELPLAQLLYHFDWKLPNGMKNEELD  478

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   MA+G K+D+  I
Sbjct  479  MTESFGMAIGRKHDLCLI  496



>gb|KCW76838.1| hypothetical protein EUGRSUZ_D01192 [Eucalyptus grandis]
Length=508

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 142/197 (72%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+     +TS+T+ + AM EM+KNP V+AKAQ E R V KG+  V+ESN++KL+YL  VI
Sbjct  304  DIIAAGSETSSTVLIWAMSEMLKNPNVMAKAQDETRRVLKGKDGVQESNIEKLSYLKCVI  363

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+R+HPPG +I R   ++  + GY IP  +RVLINA+AI RDP+YW +PE F+PERF 
Sbjct  364  KETLRMHPPGSLIPRAPREECKINGYDIPRNSRVLINAYAIGRDPRYWTNPEKFEPERFF  423

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            +  +D+ +    +++PFGSG+R+CPGISF  ASV   LA LLYH+DW+L +G TP  L +
Sbjct  424  ESSVDY-KGLHHQFLPFGSGRRICPGISFATASVELILASLLYHYDWKLANGQTPEQLDM  482

Query  226  TELPRMAMGVKNDIFFI  176
            TE+   A+G K+D++ I
Sbjct  483  TEVFGTAVGRKDDLYVI  499



>gb|KDP39250.1| hypothetical protein JCGZ_01007 [Jatropha curcas]
Length=457

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 140/197 (71%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK--GRVEESNVDKLAYLNLVI  587
            DMF    +TS+T    AM EM+KNPR+L KAQ EVR+V+K  G V+E+N+ +L YLN +I
Sbjct  248  DMFSAGSETSSTTVEWAMSEMLKNPRILEKAQNEVRQVYKNKGTVDETNIHELKYLNSII  307

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RLHPP P+I RE+     + GY IP +T+VL+NAWAI RDP+ W +PE F PERF 
Sbjct  308  KETLRLHPPLPLIPRESRARVEIIGYVIPIKTKVLVNAWAIGRDPKNWTEPEIFCPERFL  367

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            D+ + + + + F+++PFGSG+R+CPGISF L ++  PLA LLYHFDW+L +G+    L +
Sbjct  368  DNAISY-KGTDFEFIPFGSGRRICPGISFALPNIELPLAQLLYHFDWKLGNGMKNEDLDM  426

Query  226  TELPRMAMGVKNDIFFI  176
            TE   + +  K D+F +
Sbjct  427  TEGYGLTIRRKQDLFLV  443



>ref|XP_011047803.1| PREDICTED: cytochrome P450 71D8-like [Populus euphratica]
Length=376

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 137/197 (70%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK--GRVEESNVDKLAYLNLVI  587
            DMF G  DT+ T+   AM E++KNPRV  KAQ EVR +F   G ++ES+V +L +LNL +
Sbjct  170  DMFAGGGDTTLTVLEWAMSELMKNPRVREKAQKEVRALFNDVGYIDESSVHELQFLNLTL  229

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RLHPP  +  RE   +  V GY +  +TRVLINAW I RDP++W +PE F PERF 
Sbjct  230  KETLRLHPPLCIYPRECKVNCKVAGYDLEAKTRVLINAWMIGRDPKFWTEPEKFYPERFL  289

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            D   D+ + + F+++PFGSGKR+CPG++FG+A+V  PLA LL HFDW++P+GI P    +
Sbjct  290  DCSTDY-KGASFEFLPFGSGKRICPGMAFGIATVELPLARLLLHFDWKIPNGIKPEDFDM  348

Query  226  TELPRMAMGVKNDIFFI  176
            +E+   ++  KNDI  I
Sbjct  349  SEIVSASVTRKNDIVLI  365



>emb|CDP20311.1| unnamed protein product [Coffea canephora]
Length=640

 Score =   216 bits (551),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 137/183 (75%), Gaps = 4/183 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF G  +TS+T    AM E++KNP+V+ K Q E+R+ F G+  +EE+ + +L YL LVI
Sbjct  273  DMFLGGTETSSTTLEWAMSELMKNPKVMTKVQNEIRKAFTGKRTIEENEIQQLQYLKLVI  332

Query  586  KETMRLHPPGPV-IYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P+ + ++  +   + GY+IP +TR+ +N WAI+RDP+YW+DPESFKPERF
Sbjct  333  KETLRLHPPAPLSVPKQCREQCEIDGYSIPVKTRLFVNTWAIARDPEYWDDPESFKPERF  392

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E+  +DFT  + F+ +PFGSG+R+CPGISFG+A+V  PL  LLYHFDW LP+G++P  L 
Sbjct  393  ENSSIDFT-GNHFELLPFGSGRRICPGISFGIANVELPLTLLLYHFDWRLPNGLSPDDLD  451

Query  229  LTE  221
            + E
Sbjct  452  MIE  454



>ref|XP_011077043.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=504

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 139/198 (70%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            DMFGG ++  TT    AM EMV+NP VL KAQ EVR+VF  KGRV E+  D+L YL LVI
Sbjct  299  DMFGGGIEAPTTTIDWAMAEMVRNPSVLIKAQDEVRQVFDGKGRVNEAYFDELKYLKLVI  358

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPPG ++  R+N +   + GY IP R+RVL+N WAI  D +YWED E FKPERF
Sbjct  359  KETLRLHPPGALLLPRQNKERYEINGYEIPARSRVLVNVWAIGTDSEYWEDAEEFKPERF  418

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             +  +DF + +  +++PFG+G+R+CPGISF +A+V   LA LLYHFDW LP+G+ P  + 
Sbjct  419  LEKQVDF-QGNCLEFIPFGAGRRICPGISFAIANVELALAMLLYHFDWILPNGMKPEEMD  477

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   ++   K +++ I
Sbjct  478  MTEFSGVSARRKANLYVI  495



>ref|XP_010910607.1| PREDICTED: premnaspirodiene oxygenase-like [Elaeis guineensis]
Length=503

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 143/201 (71%), Gaps = 10/201 (5%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF G  +TS T     M E++++P ++ KAQ EVR+ FKG+  +EE ++ KL Y+ LVI
Sbjct  299  DMFAGGTETSATKLQWTMAELMRHPEIMVKAQVEVRQAFKGKTKIEEEDITKLHYIKLVI  358

Query  586  KETMRLHPP----GPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKP  419
            KE++RLHPP    GP + RE  K   V GY IP  +R++INAWA++RDP+YWEDPESFKP
Sbjct  359  KESLRLHPPVPLLGPKVCREACK---VDGYDIPFGSRIIINAWAVARDPRYWEDPESFKP  415

Query  418  ERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPH  239
            ERF+   +D+ +   F+Y+PFG G+R+CPGI+FG+A V T LAHLLY+FDW++P G+ P 
Sbjct  416  ERFDGSSVDY-KGGNFEYLPFGGGRRICPGITFGMAQVETVLAHLLYYFDWKIPDGMDPK  474

Query  238  TLKLTELPRMAMGVKNDIFFI  176
             L +TEL    + +K+ ++ I
Sbjct  475  DLDITELFGGTVSLKSPLWLI  495



>ref|XP_006374280.1| hypothetical protein POPTR_0015s05640g [Populus trichocarpa]
 gb|ERP52077.1| hypothetical protein POPTR_0015s05640g [Populus trichocarpa]
Length=500

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 137/197 (70%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK--GRVEESNVDKLAYLNLVI  587
            DMF G  DT+ T+   AM E++KNPRV  KAQ EVR +F   G ++ESNV +L +LNL +
Sbjct  294  DMFAGGGDTTLTVLEWAMSELMKNPRVREKAQKEVRALFNDVGYIDESNVHELQFLNLTL  353

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RLHPP  V  RE   +  V GY +  +TRVLINAW I RDP+YW +PE F PERF 
Sbjct  354  KETLRLHPPLCVYPRECKVNCKVAGYDLEAKTRVLINAWMIGRDPKYWTEPEKFYPERFL  413

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            D   D+ + + F+++PFGSGKR+CPG++FG+A+V  PLA LL HFDW++P+GI P    +
Sbjct  414  DCSTDY-KGANFEFLPFGSGKRICPGMAFGIATVELPLARLLLHFDWKIPNGIKPEDFDM  472

Query  226  TELPRMAMGVKNDIFFI  176
            +E+   ++  KNDI  I
Sbjct  473  SEIVSASVTRKNDIVLI  489



>gb|AAF27282.1|AF122821_1 cytochrome P450 [Capsicum annuum]
Length=502

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 144/198 (73%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS+T  + A+ EM+K P VLAKAQAEVR+V K +   ++ ++D+L YL LVI
Sbjct  300  DMFSAGSETSSTTIIWALAEMMKKPSVLAKAQAEVRQVLKEKKGFQQIDLDELKYLKLVI  359

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+R+HPP P++  RE  KD+ + GY IP +TRV++NAWAI RDP+ W+DPESF PERF
Sbjct  360  KETLRMHPPIPLLVPRECMKDTKIDGYNIPFKTRVIVNAWAIGRDPESWDDPESFSPERF  419

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E+  +DF   S  +++PFG+G+R+CPG+ FGLA+V  PLA LLYHFD +LP+G +   L 
Sbjct  420  ENSSVDFL-GSHHQFIPFGAGRRICPGMLFGLANVGQPLAQLLYHFDRKLPNGQSHENLD  478

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE P ++   K+D+  I
Sbjct  479  MTESPGISATRKDDLVLI  496



>gb|KHN37234.1| Cytochrome P450 71D11 [Glycine soja]
Length=507

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 138/198 (70%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+F G +D   T    AM EM+++PRV+ KAQ EVRE+F  KGRV+ES +D+L YL  V+
Sbjct  287  DIFAGGIDAVATAINWAMAEMIRDPRVMKKAQIEVREIFNMKGRVDESCMDELKYLKSVV  346

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P+I  RE  +   + G+ IP +T+V IN WAI+RDP YW +PE F PERF
Sbjct  347  KETLRLHPPAPLILPRECAQACEINGFHIPVKTKVFINVWAIARDPNYWSEPERFYPERF  406

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D  +DF +   F+Y+PFG+G+R+CPG +FGLASV   LA LLYHFDW+LP+G+      
Sbjct  407  IDSSIDF-KGCNFEYIPFGAGRRICPGSTFGLASVELILAFLLYHFDWKLPNGMKNEDFD  465

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   + +  K+DI+ I
Sbjct  466  MTEEFGVTVARKDDIYLI  483



>ref|XP_008779150.1| PREDICTED: premnaspirodiene oxygenase-like [Phoenix dactylifera]
Length=502

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 141/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKG--RVEESNVDKLAYLNLVI  587
            DMF G  +TS T     M E++++P ++ K QAEVR+  KG  R+EE +++K  Y+ LVI
Sbjct  299  DMFAGGTETSATTLEWTMAELMRHPEIMEKVQAEVRQALKGKARIEEEDINKFHYMKLVI  358

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KE++RLH PGP++  R   +   V GY IP  +R+++NAWA + DP+YWEDPESFKPERF
Sbjct  359  KESLRLHQPGPLLLPRVCRETCQVGGYNIPAGSRIIVNAWAAATDPRYWEDPESFKPERF  418

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            +   +D+ +   F+YMPFG+G+R+CP ++FGLA V   LA+LLYHFDW+LP+G+ P+ L 
Sbjct  419  DGSSVDY-KGGNFEYMPFGAGRRICPAMTFGLAQVEVALANLLYHFDWKLPNGMAPNDLD  477

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE    A+G+K+ ++ I
Sbjct  478  MTESFAAAVGLKSRLWLI  495



>ref|XP_007148448.1| hypothetical protein PHAVU_006G209700g [Phaseolus vulgaris]
 gb|ESW20442.1| hypothetical protein PHAVU_006G209700g [Phaseolus vulgaris]
Length=508

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 147/198 (74%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+F G  ++S+++    M E++KNPR++ KAQAEVR+V+  KG V+E+ + +L YL  +I
Sbjct  303  DIFTGGGESSSSVVEWGMSELIKNPRMMEKAQAEVRKVYGEKGCVDETKLHELIYLKSII  362

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  REN +   + GY IP +TRV+INAWAI R+P+YW + +SFKPERF
Sbjct  363  KETLRLHPPIPLLVPRENRERCQINGYEIPSKTRVIINAWAIGRNPEYWSEAQSFKPERF  422

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D+ +DF + + F+++PFG+G+R+CPGI+F + +V  PLA LLYHFDW+LP+ +  H L+
Sbjct  423  LDNSIDF-KGTHFEFIPFGAGRRICPGITFAIPNVELPLAQLLYHFDWKLPNKMKNHELE  481

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   +++  KND+  I
Sbjct  482  MTESSGVSLRRKNDLCLI  499



>gb|AHH25653.1| cytochrome P450 CYP71D [Nicotiana tabacum]
Length=497

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 145/198 (73%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D F    +TS+     AMVEM+KNP VLAKAQAEVR+ F+G+   +E++V++L YL LVI
Sbjct  292  DTFAAGTETSSVTIDWAMVEMMKNPSVLAKAQAEVRKAFRGKETFDENDVEELNYLKLVI  351

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KE  RLHPP P++  RE  +++ + GYTIP + +V++N WAI RDP+YW+D ESFKPERF
Sbjct  352  KEAFRLHPPFPLLLPRECREETDINGYTIPLKAKVMVNVWAIGRDPKYWDDVESFKPERF  411

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E + MDF   + F+Y+PFGSG+R CPGISFGLA+VY PLA LLYHFDW+LP+GI P+ L 
Sbjct  412  EHNSMDFV-GNNFEYLPFGSGRRNCPGISFGLANVYYPLAQLLYHFDWKLPNGINPNELD  470

Query  229  LTELPRMAMGVKNDIFFI  176
            LTE        K+++  I
Sbjct  471  LTESAGATCARKSNLHLI  488



>ref|XP_009608635.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=511

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 143/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    +TS+T  + A+ EM+KNP ++AKAQ+EVR+VFKG+   +E +++KL YLNLVI
Sbjct  305  DIFLAGSETSSTAIIWALSEMIKNPNIMAKAQSEVRQVFKGKKKYDEEDLEKLTYLNLVI  364

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHP   ++  RE  + + + GYTIP +TR+++NAWA+ RDP+ W DPESF PERF
Sbjct  365  KETLRLHPSVSLLPPRECREQTDIDGYTIPLKTRIIVNAWALGRDPESWHDPESFIPERF  424

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            ++  ++FT  + F+++PFG+G+RMCPGI FGL +V  PLA LL HF+WELPH      L 
Sbjct  425  KNSSIEFT-GNHFEFIPFGAGRRMCPGIQFGLVNVGLPLAQLLQHFEWELPHETNSQDLD  483

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   ++   + D++ +
Sbjct  484  MTETRGLSAAKQKDLYLV  501



>gb|ABC68406.1| cytochrome P450 monooxygenase CYP71D54 [Glycine max]
Length=266

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 140/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    DTS +    AM EM++NPRV  KAQAEVR+ F+    + E++V KL YL LVI
Sbjct  64   DVFTAGTDTSASTLEWAMAEMMRNPRVREKAQAEVRQAFRELKIIHETDVGKLTYLKLVI  123

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLH P P++  RE ++ +++ GY IP +T+V+IN WAI RDPQYW D E F PERF
Sbjct  124  KETLRLHAPSPLLVPRECSELTIIDGYEIPVKTKVMINVWAIGRDPQYWTDAERFVPERF  183

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            +   +DF + + F+Y+PFG+G+RMCPG++FGLA++  PLA LLYHF+WELP+ + P  + 
Sbjct  184  DGSSIDF-KGNNFEYLPFGAGRRMCPGMTFGLANIMLPLALLLYHFNWELPNEMKPEDMD  242

Query  229  LTELPRMAMGVKNDIFFI  176
            ++E   + +  K+++  I
Sbjct  243  MSENFGLTVTRKSELCLI  260



>ref|XP_010054541.1| PREDICTED: premnaspirodiene oxygenase-like [Eucalyptus grandis]
Length=508

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 142/197 (72%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+     +TS+T+ + AM EM+KNP V+AKAQ E R V KG+  V+ESN++KL+YL  VI
Sbjct  304  DIIAAGSETSSTVLIWAMSEMLKNPNVMAKAQDETRRVLKGKDGVQESNIEKLSYLKCVI  363

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+R+HPPG +I R   ++  + GY IP  +RVLINA+AI RDP+YW +PE F+PERF 
Sbjct  364  KETLRMHPPGSLIPRAPREECKINGYDIPRNSRVLINAYAIGRDPRYWTNPEKFEPERFF  423

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            +  +D+ +    +++PFGSG+R+CPGISF  ASV   LA LLYH+DW+L +G TP  L +
Sbjct  424  ESSVDY-KGLHHQFLPFGSGRRICPGISFATASVELILASLLYHYDWKLANGQTPEQLDM  482

Query  226  TELPRMAMGVKNDIFFI  176
            TE+   A+G K+D++ I
Sbjct  483  TEVFGTAVGRKDDLYVI  499



>ref|XP_006596106.1| PREDICTED: cytochrome P450 71D11-like [Glycine max]
Length=525

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 138/198 (70%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+F G +D   T    AM EM+++PRV+ KAQ EVRE+F  KGRV+ES +D+L YL  V+
Sbjct  305  DIFAGGIDAVATAINWAMAEMIRDPRVMKKAQIEVREIFNMKGRVDESCMDELKYLKSVV  364

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P+I  RE  +   + G+ IP +T+V IN WAI+RDP YW +PE F PERF
Sbjct  365  KETLRLHPPAPLILPRECAQACEINGFHIPVKTKVFINVWAIARDPNYWSEPERFYPERF  424

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D  +DF +   F+Y+PFG+G+R+CPG +FGLASV   LA LLYHFDW+LP+G+      
Sbjct  425  IDSSIDF-KGCNFEYIPFGAGRRICPGSTFGLASVELILAFLLYHFDWKLPNGMKNEDFD  483

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   + +  K+DI+ I
Sbjct  484  MTEEFGVTVARKDDIYLI  501



>ref|XP_010027347.1| PREDICTED: premnaspirodiene oxygenase-like [Eucalyptus grandis]
Length=521

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 132/182 (73%), Gaps = 3/182 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            ++F    DTS+T TV A  EMV+NPRV+ KAQAEVR V KG+  V E ++  L YL LV+
Sbjct  311  ELFCAGSDTSSTTTVWAFSEMVRNPRVMEKAQAEVRAVLKGKTQVREQDIQGLEYLKLVV  370

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+R+H PGP++ RE+ +   + GY IP +T+++IN +A+ RDP++W DPESF PERF 
Sbjct  371  KETLRMHSPGPLMARESREACTINGYEIPKKTKIVINTYAVGRDPEFWSDPESFVPERFL  430

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            +  +DF R S F+Y+PFG G+R+CPGI+FG+A++  PLA LLYHFDW L  G+    L +
Sbjct  431  NSSVDF-RGSSFEYIPFGGGRRICPGINFGIANIELPLAQLLYHFDWSLADGVKAQDLDM  489

Query  226  TE  221
            +E
Sbjct  490  SE  491



>gb|KJB61458.1| hypothetical protein B456_009G359100 [Gossypium raimondii]
Length=507

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 142/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+F G  +TS T    AM EM+KNPRV+ KAQAEVR+VF  KG V+E+ V +L YL  VI
Sbjct  300  DVFSGGSETSATAVEWAMSEMIKNPRVMTKAQAEVRQVFEGKGNVDETGVHQLKYLKCVI  359

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHP  P++  RE++K+ VV G+ IP +TRV++NAWAI RDP +W +PE F+PERF
Sbjct  360  KETLRLHPVIPLLIPRESSKNCVVNGFEIPAKTRVIVNAWAIGRDPNHWVEPEKFEPERF  419

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             +  +DF   + F+++PFG+G+R+CPGI F L +V  PLA LL+HFDW+LP G+    + 
Sbjct  420  VNSSVDFI-GTNFEFIPFGAGRRICPGILFALPNVELPLAQLLFHFDWKLPGGMKQEDMD  478

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   ++M  +ND+  +
Sbjct  479  MTEKFGVSMKRENDLVLV  496



>gb|KCW62217.1| hypothetical protein EUGRSUZ_H04878 [Eucalyptus grandis]
Length=515

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 132/182 (73%), Gaps = 3/182 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            ++F    DTS+T TV A  EMV+NPRV+ KAQAEVR V KG+  V E ++  L YL LV+
Sbjct  305  ELFCAGSDTSSTTTVWAFSEMVRNPRVMEKAQAEVRAVLKGKTQVREQDIQGLEYLKLVV  364

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+R+H PGP++ RE+ +   + GY IP +T+++IN +A+ RDP++W DPESF PERF 
Sbjct  365  KETLRMHSPGPLMARESREACTINGYEIPKKTKIVINTYAVGRDPEFWSDPESFVPERFL  424

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            +  +DF R S F+Y+PFG G+R+CPGI+FG+A++  PLA LLYHFDW L  G+    L +
Sbjct  425  NSSVDF-RGSSFEYIPFGGGRRICPGINFGIANIELPLAQLLYHFDWSLADGVKAQDLDM  483

Query  226  TE  221
            +E
Sbjct  484  SE  485



>ref|XP_010027345.1| PREDICTED: cytochrome P450 71D95-like [Eucalyptus grandis]
Length=212

 Score =   205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 129/182 (71%), Gaps = 3/182 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            ++F    DTS+T    A  EM++NPRV+ KAQAEVR V KG+  V E ++  L YL  V+
Sbjct  2    EIFSAGSDTSSTTIEWAFSEMLRNPRVMEKAQAEVRAVLKGKTQVREQDIQGLEYLKHVV  61

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+R+H PGP++ RE+ +   + GY IP +T+++IN +A+ RDP++W DPESF PERF 
Sbjct  62   KETLRMHSPGPLMARESREACTINGYEIPKKTKIVINTYAVGRDPEFWSDPESFVPERFL  121

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            +  +DF R S F+Y+PFG G+R+CPGI+FG+A++  PLA LLYHFDW L  G+    L +
Sbjct  122  NSSVDF-RGSSFEYIPFGGGRRICPGINFGIANIELPLAQLLYHFDWSLADGVKAQDLDM  180

Query  226  TE  221
            +E
Sbjct  181  SE  182



>gb|KDO62258.1| hypothetical protein CISIN_1g0123662mg, partial [Citrus sinensis]
Length=397

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 138/197 (70%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+FG   +TS T    AM EM+KNP V+ KAQAEVREVF  KG+++E+ + ++ YL LV+
Sbjct  192  DIFGAGSETSATTVDWAMCEMMKNPGVMKKAQAEVREVFNRKGKIDETGISEMKYLKLVV  251

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RL P  P+I RE  +   + G+ IP + R+++N+WA  RDP YW  PESF PERF 
Sbjct  252  KETLRLRPSAPLIPRECGESCEINGFNIPVKARIIVNSWATGRDPMYWTQPESFIPERFI  311

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            D  +DF + S F+Y+PFG+G+R+CPG+ +GLA+V  PLA LLYHFDW+LP+G+    L++
Sbjct  312  DHSVDF-KGSNFEYIPFGAGRRICPGMLYGLANVEFPLAMLLYHFDWKLPNGMNHEDLEM  370

Query  226  TELPRMAMGVKNDIFFI  176
            TE   + +  K D+  I
Sbjct  371  TETFGVTVRRKQDLCMI  387



>gb|ABC69394.1| CYP71D47v1 [Nicotiana tabacum]
Length=503

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 143/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS+T  + A+ EM+K P VLAKAQAEVR+  K +   ++ ++D+L YL LVI
Sbjct  300  DMFSAGSETSSTTIIWALAEMMKKPSVLAKAQAEVRQALKEKKGFQQIDLDELKYLKLVI  359

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+R+HPP P++  RE  +D+ + GY IP +TRV++NAWAI RDP+ W+DPESF PERF
Sbjct  360  KETLRMHPPIPLLVPRECMEDTKIDGYNIPFKTRVIVNAWAIGRDPESWDDPESFMPERF  419

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E+  +DF   +  +++PFG+G+R+CPG+ FGLA+V  PLA LLYHFDW+LP+G +     
Sbjct  420  ENSSIDFL-GNHHQFIPFGAGRRICPGMLFGLANVGQPLAQLLYHFDWKLPNGQSHENFD  478

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE P ++   K+D+  I
Sbjct  479  MTESPGISATRKDDLVLI  496



>ref|XP_009766832.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=503

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 143/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS+T  + A+ EM+K P VLAKAQAEVR+  K +   ++ ++D+L YL LVI
Sbjct  300  DMFSAGSETSSTTIIWALAEMMKKPSVLAKAQAEVRQALKEKKGFQQIDLDELKYLKLVI  359

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+R+HPP P++  RE  +D+ + GY IP +TRV++NAWAI RDP+ W+DPESF PERF
Sbjct  360  KETLRMHPPIPLLVPRECMEDTKIDGYNIPFKTRVIVNAWAIGRDPESWDDPESFMPERF  419

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E+  +DF   +  +++PFG+G+R+CPG+ FGLA+V  PLA LLYHFDW+LP+G +     
Sbjct  420  ENSSIDFL-GNHHQFIPFGAGRRICPGMLFGLANVGQPLAQLLYHFDWKLPNGQSHENFD  478

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE P ++   K+D+  I
Sbjct  479  MTESPGISATRKDDLVLI  496



>gb|ABC69395.1| CYP71D47v2 [Nicotiana tabacum]
Length=503

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 143/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS+T  + A+ EM+K P VLAKAQAEVR+  K +   ++ ++D+L YL LVI
Sbjct  300  DMFSAGSETSSTTIIWALAEMMKKPSVLAKAQAEVRQALKEKKGFQQIDLDELKYLKLVI  359

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+R+HPP P++  RE  +D+ + GY IP +TRV++NAWAI RDP+ W+DPESF PERF
Sbjct  360  KETLRMHPPIPLLVPRECMEDTKIDGYNIPFKTRVIVNAWAIGRDPESWDDPESFMPERF  419

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E+  +DF   +  +++PFG+G+R+CPG+ FGLA+V  PLA LLYHFDW+LP+G +     
Sbjct  420  ENSSIDFL-GNHHQFIPFGAGRRICPGMLFGLANVGQPLAQLLYHFDWKLPNGQSHENFD  478

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE P ++   K+D+  I
Sbjct  479  MTESPGISATRKDDLVLI  496



>ref|XP_006367128.1| PREDICTED: premnaspirodiene oxygenase-like isoform X2 [Solanum 
tuberosum]
Length=434

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 141/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    DTS++    A+ EM+K+P V+AKAQAEVREVFKG+   ++ +++K+ YL LVI
Sbjct  233  DMFVAGSDTSSSTVTWALSEMMKSPSVMAKAQAEVREVFKGKKTFDDDDLEKVDYLKLVI  292

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE  +++ + GY IP +++VL+N WAI RDP+ WED ESF PERF
Sbjct  293  KETLRLHPPTPLLVPRECREETEIDGYIIPVKSKVLVNVWAIGRDPESWEDSESFIPERF  352

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E+  +DF+  + F+++PFG+G+R CPG  FGLA V  PLAHLLY+F+W LP+G+ P  L 
Sbjct  353  ENSSVDFS-GTHFQFLPFGAGRRTCPGRLFGLALVTLPLAHLLYNFNWTLPNGMDPRDLD  411

Query  229  LTELPRMAMGVKNDIFFI  176
            + E   M      D++ I
Sbjct  412  MNEANGMTARRDKDLYLI  429



>ref|XP_003557037.1| PREDICTED: cytochrome P450 71D8-like, partial [Glycine max]
Length=202

 Score =   204 bits (518),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 140/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    DTS +    AM EM++NPRV  KAQAE+R+ F+ +  + ES++++L YL LVI
Sbjct  1    DIFAAGTDTSASTLEWAMAEMMRNPRVREKAQAELRQAFREKEIIHESDLEQLTYLKLVI  60

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET R+HPP P++  RE ++ +++ GY IP +T+V++NA+AI +D QYW D + F PERF
Sbjct  61   KETFRVHPPTPLLLPRECSQPTIIDGYEIPAKTKVMVNAYAICKDSQYWIDADRFVPERF  120

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +DF + + F Y+PFG G+R+CPG++ GLAS+  PLA LLYHF+WELP+ + P  + 
Sbjct  121  EGSSIDF-KGNNFNYLPFGGGRRICPGMTLGLASIMLPLALLLYHFNWELPNKMKPEEMN  179

Query  229  LTELPRMAMGVKNDIFFI  176
            + E   +A+G KN++  I
Sbjct  180  MDEHFGLAIGRKNELHLI  197



>ref|XP_007033124.1| Cytochrome P450 71D10, putative [Theobroma cacao]
 gb|EOY04050.1| Cytochrome P450 71D10, putative [Theobroma cacao]
Length=509

 Score =   213 bits (542),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 142/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+ G   +TS+T    AM EM++NPRV+ +AQAEVR+VF  KG ++E+ + +L +L  ++
Sbjct  303  DILGAGSETSSTTMEWAMSEMLRNPRVMKQAQAEVRQVFDRKGNLDEAGIHELKFLRSIV  362

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHP  P++  RE +++ V+ GY I  +++V++NAWAI RD +YW+D E F PERF
Sbjct  363  KETLRLHPAAPLLVPRECDENCVISGYDILAKSKVIVNAWAIGRDSRYWKDAEKFNPERF  422

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D P+DF R + F+Y+PFG+G+R+CPGISF L ++  PLA LLYHFDW+LP+G     L 
Sbjct  423  LDSPIDF-RGTHFEYIPFGAGRRICPGISFALPNIELPLAQLLYHFDWKLPNGSNCEDLD  481

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   + +  KND+F I
Sbjct  482  MTECFGITVRRKNDLFLI  499



>gb|AET00662.2| cytochrome P450 family 71 protein [Medicago truncatula]
Length=502

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 142/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+F    +TS+T  + A+ EMVKNP+V+ +AQAEVR VF  KG V+E+ + +L YL  VI
Sbjct  300  DIFDAGTETSSTTVLWAISEMVKNPKVMEEAQAEVRRVFDRKGFVDETELHQLIYLKSVI  359

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KETMRLHP  P++  RE+ +   + GY IP +TRV++NAWAI RDP+YW D ESFKPERF
Sbjct  360  KETMRLHPTVPLLLPRESRERCQINGYEIPAKTRVMVNAWAIGRDPRYWVDAESFKPERF  419

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             + P+DF + + F+Y+PFG+G+RMCPGI+F L +V  PLA LLYHFDW+LP+ +    L 
Sbjct  420  VNSPIDF-KGTDFEYIPFGAGRRMCPGIAFALPNVELPLASLLYHFDWKLPNKMKNEELD  478

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   +  G K+++  I
Sbjct  479  MTESFGITAGRKHNLCLI  496



>gb|EYU21978.1| hypothetical protein MIMGU_mgv1a004623mg [Erythranthe guttata]
Length=517

 Score =   213 bits (542),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 134/194 (69%), Gaps = 3/194 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    +TS+T     M E+++NPRV++K Q E+RE FK      ES+V KL YL LVI
Sbjct  310  DIFAAGTETSSTTIDWIMAELIRNPRVMSKLQTEIRETFKDNPNFGESDVQKLKYLKLVI  369

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KE  RLH P P+I R +  D+ + GY IP   +VL+NAWA+ RDP  W DPE F+PERFE
Sbjct  370  KEGFRLHAPIPLIPRVSRADTEIEGYVIPIGAKVLVNAWAMGRDPGLWSDPERFEPERFE  429

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            +DP DFT  + F+Y+PFG+G+RMCPG++FGLASV  PLAHLLY FDW+LP G++   L +
Sbjct  430  NDPRDFT-GNDFEYIPFGAGRRMCPGMTFGLASVELPLAHLLYSFDWKLPAGMSSGDLDM  488

Query  226  TELPRMAMGVKNDI  185
            TE P +    + ++
Sbjct  489  TERPAITAARRQNL  502



>ref|XP_003615871.1| Cytochrome P450 [Medicago truncatula]
 gb|AES98829.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=503

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 142/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            DMF    +TS+ + +  + EMVKNP+++ +AQAEVR +F  KG V+E+ + +L YL  +I
Sbjct  301  DMFAAGSETSSGVVLWGISEMVKNPKIMEEAQAEVRNMFDKKGHVDETELHQLIYLKSII  360

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            +ET+RLHP  P++  RE+ +   + GY IP +TRV IN WAI RD +YW + ESFKPERF
Sbjct  361  RETLRLHPSAPLLVPRESRERCQINGYEIPAKTRVAINVWAIGRDERYWAEAESFKPERF  420

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             +  +DF + + F+Y+PFG+G+RMCPG++FGL+++  PLA LLYHFDW+LP+G+    L 
Sbjct  421  LNSTIDF-KGTNFEYIPFGAGRRMCPGMAFGLSNIELPLAQLLYHFDWKLPNGMKNEELD  479

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   +++G KND+  I
Sbjct  480  MTESFGLSVGRKNDLCLI  497



>ref|XP_003516583.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=506

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 142/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    DTS +    AM EM++NPRV  KAQAEVR+ F+    + E++V++L YL LVI
Sbjct  304  DVFTAGTDTSASTLEWAMAEMMRNPRVREKAQAEVRQAFRELKIINETDVEELIYLKLVI  363

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLH P P++  RE +K +++ GY IP +T+V+INAWAI+RDPQYW D E F PERF
Sbjct  364  KETLRLHTPSPLLLPRECSKRTIIDGYEIPVKTKVMINAWAIARDPQYWTDAERFVPERF  423

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            +   +DF + + F+Y+PFG+G+RMCPG++ GLA++  PLA LLYHF+WELP+ + P  + 
Sbjct  424  DGSSIDF-KGNNFEYLPFGAGRRMCPGMTLGLANIMLPLALLLYHFNWELPNEMKPEYMD  482

Query  229  LTELPRMAMGVKNDIFFI  176
            + E   + +G KN++  I
Sbjct  483  MVENFGLTVGRKNELCLI  500



>gb|KHN01537.1| Cytochrome P450 71D11 [Glycine soja]
Length=508

 Score =   213 bits (541),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 137/198 (69%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+FGG V+   T    AM EM++NPRV+  AQ EVREVF  KGRV+E+ +++L YL  V+
Sbjct  288  DIFGGGVEPIATTINWAMAEMIRNPRVMKTAQVEVREVFNIKGRVDETCINELKYLKSVV  347

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P+I  RE  +   + GY IP +T+V INAWAI RDP YW +PE F PERF
Sbjct  348  KETLRLHPPAPLILPRECQETCKINGYDIPVKTKVFINAWAIGRDPNYWSEPERFYPERF  407

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D  +D+ +   F+Y+PFG+G+R+CPGI+FGL +V   LA LLYH DW+LP+G+      
Sbjct  408  IDSSVDY-KGGNFEYIPFGAGRRICPGITFGLVNVELTLAFLLYHLDWKLPNGMKNEDFD  466

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   + +  K+DI+ I
Sbjct  467  MTEKFGVTVARKDDIYLI  484



>ref|XP_003549267.1| PREDICTED: cytochrome P450 71D11-like [Glycine max]
Length=526

 Score =   213 bits (542),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 137/198 (69%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+FGG V+   T    AM EM++NPRV+  AQ EVREVF  KGRV+E+ +++L YL  V+
Sbjct  306  DIFGGGVEPIATTINWAMAEMIRNPRVMKTAQVEVREVFNIKGRVDETCINELKYLKSVV  365

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P+I  RE  +   + GY IP +T+V INAWAI RDP YW +PE F PERF
Sbjct  366  KETLRLHPPAPLILPRECQETCKINGYDIPVKTKVFINAWAIGRDPNYWSEPERFYPERF  425

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D  +D+ +   F+Y+PFG+G+R+CPGI+FGL +V   LA LLYH DW+LP+G+      
Sbjct  426  IDSSVDY-KGGNFEYIPFGAGRRICPGITFGLVNVELTLAFLLYHLDWKLPNGMKNEDFD  484

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   + +  K+DI+ I
Sbjct  485  MTEKFGVTVARKDDIYLI  502



>gb|KHN39921.1| Cytochrome P450 71D8 [Glycine soja]
Length=508

 Score =   212 bits (540),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 143/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    DTS +    AM EM++NPRV  KAQAE+R+ F+G+  + ES++++L YL LVI
Sbjct  303  DIFAAGTDTSASTLEWAMAEMMRNPRVREKAQAELRQAFRGKEIIHESDLEQLTYLKLVI  362

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET R+HPP P++  RE ++ +++ GY IP +T+V++N +A+ +DP+YW D E F PERF
Sbjct  363  KETFRVHPPTPLLLPRECSQLTIIDGYEIPAKTKVMVNVYAVCKDPKYWVDAEMFVPERF  422

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +DF + + F+Y+PFG G+R+CPG++FGLA++  PLA LLYHF+WELP+ I P  + 
Sbjct  423  EASSIDF-KGNNFEYLPFGGGRRICPGMTFGLATIMLPLALLLYHFNWELPNKIKPENMD  481

Query  229  LTELPRMAMGVKNDIFFI  176
            + E   +A+G KN++  I
Sbjct  482  MAEQFGVAIGRKNELHLI  499



>ref|XP_012070986.1| PREDICTED: cytochrome P450 71D10-like [Jatropha curcas]
 gb|KDP39254.1| hypothetical protein JCGZ_01011 [Jatropha curcas]
Length=510

 Score =   212 bits (540),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 141/197 (72%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK--GRVEESNVDKLAYLNLVI  587
            DMF    +TS+T    AM EM+KNPR+L KAQ EVR+V+K  G V+E+++ +L YLN +I
Sbjct  301  DMFSAGSETSSTTVEWAMSEMLKNPRILEKAQNEVRQVYKNKGTVDETSIHELKYLNSII  360

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RLHPP P+I RE+     + GY IP +T+VL+NAWAI RDP+ W +PE+F PERF 
Sbjct  361  KETLRLHPPLPLIPRESRARVEIIGYDIPIKTKVLVNAWAIGRDPKNWTEPENFCPERFL  420

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            D+ + + + + F+++PFGSG+R+CPGISF L ++  PLA LLYHFDW+L +G+    L +
Sbjct  421  DNAISY-KGTDFEFIPFGSGRRICPGISFALPNIELPLAQLLYHFDWKLGNGMKNEDLDM  479

Query  226  TELPRMAMGVKNDIFFI  176
            TE   + +  K D+F +
Sbjct  480  TEGYGLTIRRKQDLFLV  496



>ref|XP_007033123.1| Cytochrome P450 71D10, putative [Theobroma cacao]
 gb|EOY04049.1| Cytochrome P450 71D10, putative [Theobroma cacao]
Length=509

 Score =   212 bits (540),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 142/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+     DTS+T    AM EM+KNPRV+ +AQAEVR+VF  KG V+E+ + +L +L  ++
Sbjct  303  DILVAGGDTSSTTMEWAMSEMLKNPRVMKQAQAEVRQVFDRKGNVDEAGIHELKFLRSIV  362

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHP  P++  RE +++ V+ GY I  +++V++NAWAI RD +YW+D E+F PERF
Sbjct  363  KETLRLHPAAPLLVPRECDENCVISGYDILAKSKVIVNAWAIGRDSRYWKDAENFNPERF  422

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D P+DF R + F+Y+PFG+G+R+CPGISF L ++  PLA LLYHFDW+LP+G     L 
Sbjct  423  LDSPIDF-RGTHFEYIPFGAGRRICPGISFALPNIELPLAQLLYHFDWKLPNGSNCEDLD  481

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   + +  KND+F I
Sbjct  482  MTECFGITVRRKNDLFLI  499



>gb|KCW68417.1| hypothetical protein EUGRSUZ_F02067, partial [Eucalyptus grandis]
Length=484

 Score =   212 bits (539),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 136/183 (74%), Gaps = 4/183 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+F    +TS T    A+ EM+KNPR+L KAQAEVREVF  +G+ +E+ + +L YL LVI
Sbjct  300  DIFAAGSETSATQVDWALAEMMKNPRILKKAQAEVREVFDRRGKADETGLPELEYLKLVI  359

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KE +RL P  P++  RE  +   + GY IP +TRVL+NAWAI RDP+YW+DPESF PERF
Sbjct  360  KECLRLRPSIPLLLPRECTERCEINGYEIPVKTRVLVNAWAIGRDPKYWDDPESFYPERF  419

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            +D P+D+ + + F+Y+PFG+G+R+CPG++FG+A+V  PLA LLYHFDWELP G+    + 
Sbjct  420  KDSPVDY-KGTSFEYIPFGAGRRICPGMNFGIANVELPLAMLLYHFDWELPEGMKSEEMD  478

Query  229  LTE  221
            ++E
Sbjct  479  MSE  481



>ref|XP_006365962.1| PREDICTED: cytochrome P450 71D7-like [Solanum tuberosum]
Length=504

 Score =   212 bits (540),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 145/198 (73%), Gaps = 5/198 (3%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRVE--ESNVDKLAYLNLVI  587
            DMF    +TS+T  + A+ E++K+P V+AKAQ+EVR+ FK +++  E ++D L YL LVI
Sbjct  298  DMFTAGTETSSTTIIWALSELMKHPNVMAKAQSEVRQAFKEKIDFDEEDLDNLPYLKLVI  357

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RLH P  +++RE  ++++V GYTIP +  VL+N WA+ RDP+ W+DPESF PERFE
Sbjct  358  KETLRLHAPS-IVHRECREETIVDGYTIPAKATVLVNTWAMGRDPEVWDDPESFIPERFE  416

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGI-TPHTLK  230
            + P+D+   + ++++PFG+GKR+CPG+ FGLA+V  PLA LLYHF+W LP GI TP  L 
Sbjct  417  NSPIDYL-GNNYEFLPFGAGKRICPGMQFGLANVKQPLARLLYHFNWGLPCGINTPKDLD  475

Query  229  LTELPRMAMGVKNDIFFI  176
            ++E   ++   + D++ I
Sbjct  476  MSEKSGLSAAKEKDLYLI  493



>ref|XP_009595835.1| PREDICTED: premnaspirodiene oxygenase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=506

 Score =   212 bits (540),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 146/199 (73%), Gaps = 5/199 (3%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK---GRVEESNVDKLAYLNLV  590
            DMF     ++TT+T  A+ E+V+NPR++ KAQ EVR+VFK    R++++++ KL YL +V
Sbjct  300  DMFVAGTTSTTTVTEWALSELVRNPRIMKKAQGEVRQVFKFGTERIDQTHIQKLTYLRMV  359

Query  589  IKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPER  413
            IKET+RLHPPGP+ + RE+ ++  + GYTIP +T VL+N WAI RDP+YWE+PE+F+PER
Sbjct  360  IKETLRLHPPGPLSFPRESREECKINGYTIPNKTVVLVNLWAIGRDPKYWENPETFEPER  419

Query  412  FEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTL  233
            FE  P+D T  + F+Y PFG G+RMCPG+ FG+A V  PLA LLYHFDW+LP+G++P  +
Sbjct  420  FECSPIDIT-GTHFEYTPFGVGRRMCPGMPFGMAGVEVPLALLLYHFDWKLPNGMSPEEI  478

Query  232  KLTELPRMAMGVKNDIFFI  176
             + E    ++  KN +  +
Sbjct  479  DMAEKFSTSLERKNALCLV  497



>ref|XP_009595834.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=509

 Score =   212 bits (540),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 146/199 (73%), Gaps = 5/199 (3%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK---GRVEESNVDKLAYLNLV  590
            DMF     ++TT+T  A+ E+V+NPR++ KAQ EVR+VFK    R++++++ KL YL +V
Sbjct  303  DMFVAGTTSTTTVTEWALSELVRNPRIMKKAQGEVRQVFKFGTERIDQTHIQKLTYLRMV  362

Query  589  IKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPER  413
            IKET+RLHPPGP+ + RE+ ++  + GYTIP +T VL+N WAI RDP+YWE+PE+F+PER
Sbjct  363  IKETLRLHPPGPLSFPRESREECKINGYTIPNKTVVLVNLWAIGRDPKYWENPETFEPER  422

Query  412  FEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTL  233
            FE  P+D T  + F+Y PFG G+RMCPG+ FG+A V  PLA LLYHFDW+LP+G++P  +
Sbjct  423  FECSPIDIT-GTHFEYTPFGVGRRMCPGMPFGMAGVEVPLALLLYHFDWKLPNGMSPEEI  481

Query  232  KLTELPRMAMGVKNDIFFI  176
             + E    ++  KN +  +
Sbjct  482  DMAEKFSTSLERKNALCLV  500



>gb|ABC69405.1| CYP71D51v3 [Nicotiana tabacum]
Length=514

 Score =   212 bits (540),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 145/198 (73%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS++  V AMVEMVKNP V AKAQAEVRE F+G+   +E++V++L YL LVI
Sbjct  309  DMFAAGTETSSSTIVWAMVEMVKNPAVFAKAQAEVREAFRGKETFDENDVEELNYLKLVI  368

Query  586  KETMRLHPPGPVIYR-ENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++   E  +++ + GYTIP +T+V++N WA+ RDP+YW D E+F PERF
Sbjct  369  KETLRLHPPVPLLLPRECREETNINGYTIPVKTKVMVNVWALGRDPKYWNDAETFMPERF  428

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E    DF   + F+Y+PFG G+R+CPGISFGLA+ Y PLA LLYHFDW+LP GI P  L 
Sbjct  429  EQCSKDFV-GNNFEYLPFGGGRRICPGISFGLANAYLPLAQLLYHFDWKLPAGIEPSDLD  487

Query  229  LTELPRMAMGVKNDIFFI  176
            LTEL  +    K+D++ +
Sbjct  488  LTELVGVTAARKSDLYLV  505



>gb|ABC69403.1| CYP71D51v1 [Nicotiana tabacum]
Length=514

 Score =   212 bits (540),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 145/198 (73%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS++  V AMVEMVKNP V AKAQAEVRE F+G+   +E++V++L YL LVI
Sbjct  309  DMFAAGTETSSSTIVWAMVEMVKNPAVFAKAQAEVREAFRGKETFDENDVEELNYLKLVI  368

Query  586  KETMRLHPPGPVIYR-ENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++   E  +++ + GYTIP +T+V++N WA+ RDP+YW D E+F PERF
Sbjct  369  KETLRLHPPVPLLLPRECREETNINGYTIPVKTKVMVNVWALGRDPKYWNDAETFMPERF  428

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E    DF   + F+Y+PFG G+R+CPGISFGLA+ Y PLA LLYHFDW+LP GI P  L 
Sbjct  429  EQCSKDFV-GNNFEYLPFGGGRRICPGISFGLANAYLPLAQLLYHFDWKLPAGIEPSDLD  487

Query  229  LTELPRMAMGVKNDIFFI  176
            LTEL  +    K+D++ +
Sbjct  488  LTELVGVTAARKSDLYLV  505



>ref|XP_009758268.1| PREDICTED: premnaspirodiene oxygenase [Nicotiana sylvestris]
 gb|ABC69404.1| CYP71D51v2 [Nicotiana tabacum]
 gb|AGK30193.1| cytochrome P450 CYP71D51 [Nicotiana tabacum]
Length=514

 Score =   212 bits (540),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 145/198 (73%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS++  V AMVEMVKNP V AKAQAEVRE F+G+   +E++V++L YL LVI
Sbjct  309  DMFAAGTETSSSTIVWAMVEMVKNPAVFAKAQAEVREAFRGKETFDENDVEELNYLKLVI  368

Query  586  KETMRLHPPGPVIYR-ENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++   E  +++ + GYTIP +T+V++N WA+ RDP+YW D E+F PERF
Sbjct  369  KETLRLHPPVPLLLPRECREETNINGYTIPVKTKVMVNVWALGRDPKYWNDAETFMPERF  428

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E    DF   + F+Y+PFG G+R+CPGISFGLA+ Y PLA LLYHFDW+LP GI P  L 
Sbjct  429  EQCSKDFV-GNNFEYLPFGGGRRICPGISFGLANAYLPLAQLLYHFDWKLPAGIEPSDLD  487

Query  229  LTELPRMAMGVKNDIFFI  176
            LTEL  +    K+D++ +
Sbjct  488  LTELVGVTAARKSDLYLV  505



>ref|XP_008778500.1| PREDICTED: premnaspirodiene oxygenase-like [Phoenix dactylifera]
Length=502

 Score =   212 bits (539),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 145/198 (73%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKG--RVEESNVDKLAYLNLVI  587
            DMF G  ++S T     M E++++P+++ K QAEVR+ FKG  R+EE +++K  Y+ LVI
Sbjct  299  DMFAGGTESSATTLDWTMAELMRHPKIMEKVQAEVRQAFKGKARIEEEDINKFHYMKLVI  358

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KE++RLH PGP++  R   +   V GY IP  +R++INAWA++RDP+YWEDPESF+PERF
Sbjct  359  KESLRLHQPGPLLLPRVCRETCQVDGYNIPAGSRIIINAWAVARDPRYWEDPESFRPERF  418

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            +   +D+ +   F+Y+PFG+G+R+CP ++FGLA V   LA+LLY+FDW+LP+G+ P+ + 
Sbjct  419  DGSSVDY-KGGNFEYLPFGAGRRICPAMTFGLAQVEMALANLLYYFDWKLPNGMGPNDVD  477

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE    A+G+K+ ++ I
Sbjct  478  MTESFGAAVGLKSPLWLI  495



>ref|XP_006365938.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=514

 Score =   212 bits (539),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 140/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F G   +S++  + A+ EM+KNP V+ KAQ+EVR+VFKG+    E  V+ L YL  VI
Sbjct  308  DIFLGGTGSSSSTIIWALSEMIKNPNVMIKAQSEVRQVFKGKQNFSEEEVENLTYLKSVI  367

Query  586  KETMRLHPPGPVI-YRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLH P P++  RE  +  V+ GYTIP + RVL+NAWA++RDP+ W+DPE+F PERF
Sbjct  368  KETLRLHTPAPLLGSRECREQRVIDGYTIPLKARVLVNAWALARDPESWDDPENFIPERF  427

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E+  +DF   + F+++PFGSG+R+CPG+  G+A+V  PLA LLYHF+WELP+G  P  L 
Sbjct  428  ENSSIDFM-GNHFEFIPFGSGRRVCPGLLLGVANVIHPLAQLLYHFEWELPNGTNPEDLD  486

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   +    K +++ I
Sbjct  487  MTETHGLTAEKKENLYLI  504



>ref|XP_006357930.1| PREDICTED: cytochrome P450 71D7-like [Solanum tuberosum]
Length=498

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 143/199 (72%), Gaps = 5/199 (3%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRVE---ESNVDKLAYLNLV  590
            D+F    +TS+TIT+  + EM+KN  ++AKAQ EVR+V +G+     E +++KL YL LV
Sbjct  299  DIFIAGSETSSTITIWVLSEMMKNSTIMAKAQKEVRQVLRGKKNYDNEEDLEKLTYLKLV  358

Query  589  IKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPER  413
            IKET+RLH P P++  RE  + + + GYTIP +T++L+NAWA++RDP+ W DPE F PER
Sbjct  359  IKETLRLHTPAPLLGPRECREQTNIDGYTIPLKTKILVNAWALARDPESWHDPECFIPER  418

Query  412  FEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTL  233
            FE+  +DF   + F+++PFG+G+RMCPG+ FGL +V   LA LLYHF+WELP+G+ P  L
Sbjct  419  FENSSIDFL-GNHFEFIPFGAGRRMCPGVLFGLTNVELSLAQLLYHFEWELPYGMKPKDL  477

Query  232  KLTELPRMAMGVKNDIFFI  176
             +TE   ++ G + D++ +
Sbjct  478  DMTETYGLSGGKQRDLYLV  496



>gb|EYU31465.1| hypothetical protein MIMGU_mgv1a004885mg [Erythranthe guttata]
Length=506

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 145/198 (73%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKG--RVEESNVDKLAYLNLVI  587
            DMF    ++S++    AM E+++NPRV+ K Q EVRE  KG  RV++S+V+ L YL LV+
Sbjct  302  DMFSAGTESSSSAIDWAMAELMRNPRVMEKVQREVREGLKGKKRVDDSDVEGLKYLKLVV  361

Query  586  KETMRLHPPGPVIYRENNKDSV-VCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++ R   ++ V V GY+IP  +RV+I+ WA+ RDP YW+DPE+F+PERF
Sbjct  362  KETLRLHPPIPLLPRACREEGVKVNGYSIPINSRVMISIWAMGRDPLYWDDPETFQPERF  421

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E+  +DFT +S F+Y+PFG+G+R+CPG++FGLASV  PLA +LYHF+W LP GI+   + 
Sbjct  422  ENSCIDFTGNS-FEYLPFGAGRRICPGMNFGLASVELPLAQILYHFNWTLPTGISFDHVD  480

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   + +  KN +F +
Sbjct  481  MTEQEGITVSRKNRLFLV  498



>gb|KEH34013.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=509

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 141/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK--GRVEESNVDKLAYLNLVI  587
            D+FGG  +TS + T  AM+EM++NPR++ KAQ EVR+V K  GRV+E  +++L+YL  V+
Sbjct  303  DIFGGGGETSASTTDWAMIEMIRNPRIMKKAQDEVRDVIKMKGRVDEKCINELSYLKSVV  362

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHP  P++  RE  K   + GY IP +T+V+INAWAI+RDP YW +PE F PERF
Sbjct  363  KETLRLHPSVPLLLPRECGKACEIHGYHIPVKTKVIINAWAIARDPNYWTEPEKFYPERF  422

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D+ +D+ + S F+Y+PFG G+R+CPG +FGL +V   LA LLYHFDW+LP GI    L 
Sbjct  423  IDNGIDY-KGSNFEYIPFGGGRRICPGSTFGLRNVELALAMLLYHFDWKLPGGIKCDELD  481

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   + M  K+D+  +
Sbjct  482  MTEQFGVTMRRKDDLLLL  499



>ref|XP_003520239.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=503

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 142/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    DTS +    AM EM++NPRV  KAQAE+R+ F+ +  + ES++++L YL LVI
Sbjct  301  DIFAAGTDTSASTLEWAMAEMMRNPRVREKAQAELRQTFREKEIIHESDLEQLTYLKLVI  360

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET R+HPP P++  RE ++ +++ GY IP +T+V++NA+AI +DP+YW D E F PERF
Sbjct  361  KETFRVHPPTPLLLPRECSQPTIIDGYEIPTKTKVMVNAYAICKDPKYWTDAERFVPERF  420

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            ED  +DF + + F Y+PFG G+R+CPG++ GLAS+  PLA LLYHF+WELP+ + P  + 
Sbjct  421  EDSSIDF-KGNNFNYLPFGGGRRICPGMTLGLASIMLPLALLLYHFNWELPNKMKPEEMN  479

Query  229  LTELPRMAMGVKNDIFFI  176
            + E   +A+G KN++  +
Sbjct  480  MDEHFGLAIGRKNELHLV  497



>ref|XP_004511999.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=505

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 140/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    DTS+T    +M EM+KNPRV  KAQAE+R+ F+G+  + ES++ +L YLNLVI
Sbjct  303  DIFVAGTDTSSTTIEWSMSEMMKNPRVRDKAQAELRQAFRGKDKICESDMHQLTYLNLVI  362

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE  + + + GY IP +T +LINAW   RDPQYW D E F PERF
Sbjct  363  KETLRLHPPSPLLVPRECYELTNIDGYDIPKKTIILINAWTKGRDPQYWSDAERFIPERF  422

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            +   +DF + + F+Y+PFG+G+RMCPG+SFGLASV  PLA LLYHF+WELP+ + P    
Sbjct  423  DGSFIDF-KGNNFEYIPFGAGRRMCPGMSFGLASVMFPLALLLYHFNWELPNHMKPDHFD  481

Query  229  LTELPRMAMGVKNDIFFI  176
            + E   M +G KN++  I
Sbjct  482  MIEHFGMTVGRKNELCLI  499



>ref|XP_009794007.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=497

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 144/197 (73%), Gaps = 4/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS+     AMVEM+KNP VLAKAQ EVR+ F+G+   +E++V++L YL LVI
Sbjct  292  DMFAAGTETSSVAIDWAMVEMMKNPNVLAKAQTEVRKAFRGKETFDENDVEELKYLKLVI  351

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET RLHPP P++  RE  +++ + GYTIP + +V++N WAI RDP+YW+D E FKPERF
Sbjct  352  KETFRLHPPFPLLLPRECREETDINGYTIPLKAKVMVNVWAIGRDPKYWDDAEIFKPERF  411

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E + MDF   + F+Y+PFGSG+R CPGISFGLA+VY PLA LLYHF+W+LP GI P  L 
Sbjct  412  EHNSMDFV-GNNFEYLPFGSGRRNCPGISFGLANVYFPLAQLLYHFNWKLPTGINPSELD  470

Query  229  LTELPRMAMGVKNDIFF  179
            LTE    +   K++++ 
Sbjct  471  LTESAGASCARKSNLYL  487



>gb|KEH28447.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=428

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 139/198 (70%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            DMFG   +TS+   + AM  MVKN  V+ +AQAEVR VF  KG V+E+ + +L YL  VI
Sbjct  226  DMFGAGTETSSEAVIWAMSAMVKNSNVMEQAQAEVRRVFDKKGYVDETELYQLIYLKSVI  285

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RL+P  P++  RE+ +   + GY IP +TRV +NAWAI RDP+YW + ESFKPERF
Sbjct  286  KETLRLYPVAPLLVPRESRERCQINGYEIPAKTRVAVNAWAIGRDPRYWVEAESFKPERF  345

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             + P+DF + + F+++PFG+G+RMCPGI+F L +V  PLA LLYHFDW+LP+G+    L 
Sbjct  346  VNSPIDF-KGTDFEFIPFGAGRRMCPGIAFALPNVELPLAKLLYHFDWKLPNGMKNEELD  404

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   +  G K+D+  I
Sbjct  405  MTESFGITAGRKHDLCLI  422



>gb|KHN48844.1| Cytochrome P450 71D8 [Glycine soja]
Length=508

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 142/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    DTS +    AM EM++NPRV  KAQAE+R+ F+ +  + ES++++L YL LVI
Sbjct  306  DIFAAGTDTSASTLEWAMAEMMRNPRVREKAQAELRQTFREKEIIHESDLEQLTYLKLVI  365

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET R+HPP P++  RE ++ +++ GY IP +T+V++NA+AI +DP+YW D E F PERF
Sbjct  366  KETFRVHPPTPLLLPRECSQPTIIDGYEIPTKTKVMVNAYAICKDPKYWTDAERFVPERF  425

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            ED  +DF + + F Y+PFG G+R+CPG++ GLAS+  PLA LLYHF+WELP+ + P  + 
Sbjct  426  EDSSIDF-KGNNFNYLPFGGGRRICPGMTLGLASIMLPLALLLYHFNWELPNKMKPEEMN  484

Query  229  LTELPRMAMGVKNDIFFI  176
            + E   +A+G KN++  +
Sbjct  485  MDEHFGLAIGRKNELHLV  502



>ref|XP_003600322.1| Cytochrome P450 [Medicago truncatula]
 gb|AES70573.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=499

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 141/198 (71%), Gaps = 3/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKG--RVEESNVDKLAYLNLVI  587
            DM+GG  +TS +  + AM EM+KNPR++ K QAEVREVF+   +  ES+++KL YL  V+
Sbjct  296  DMYGGGSETSASTILWAMAEMIKNPRIMKKLQAEVREVFEKERKPNESDMEKLKYLKCVV  355

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPPG  +  RE  +   + GY IP +++V++NAWAI RDP  W+DPE F PERF
Sbjct  356  KETLRLHPPGAFLLPRECGQACEINGYGIPFKSKVIVNAWAIGRDPNNWDDPERFYPERF  415

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D+ +D+ + + F+++PFGSG+RMCPG++FGL ++   LA L+YHFDW+LP+ +    L 
Sbjct  416  IDNCVDYYKGNNFEFIPFGSGRRMCPGVTFGLVNIEFSLALLMYHFDWKLPNAMKKEDLD  475

Query  229  LTELPRMAMGVKNDIFFI  176
            ++E   +A+  KND+  I
Sbjct  476  MSESFGVAVTRKNDLHLI  493



>ref|XP_007213422.1| hypothetical protein PRUPE_ppa025696mg [Prunus persica]
 gb|EMJ14621.1| hypothetical protein PRUPE_ppa025696mg [Prunus persica]
Length=475

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 132/173 (76%), Gaps = 4/173 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+F    +TS+T    A+ EM+KNPRV+  AQ EVREVF  KG+V+E+ + ++ YLNLVI
Sbjct  304  DIFAAGSETSSTAVDWAIAEMIKNPRVMNMAQNEVREVFNRKGQVDETCIREMKYLNLVI  363

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPPGP++  RE  +   + G+ IP +++V++NAWAI RDP YW +PESF P RF
Sbjct  364  KETLRLHPPGPLLVPRECGEKCEIDGHEIPVKSKVIVNAWAIGRDPNYWNEPESFNPNRF  423

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHG  251
             D+ +D+ + + F+Y+PFG+G+RMCPG+SFGLA+V  PLA LLYHFDW+LP G
Sbjct  424  LDNSIDY-KGTNFEYIPFGAGRRMCPGVSFGLANVELPLALLLYHFDWKLPMG  475



>ref|XP_007213458.1| hypothetical protein PRUPE_ppa024556mg [Prunus persica]
 gb|EMJ14657.1| hypothetical protein PRUPE_ppa024556mg [Prunus persica]
Length=507

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 135/197 (69%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    +TS T    AM E++KNPRV+ KAQ EVR+VFKG+  +EE +V+KL YL LV+
Sbjct  303  DIFSAGSETSATTMEWAMSELLKNPRVMEKAQLEVRQVFKGKNKIEEEDVEKLHYLKLVM  362

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET RLHPP P+I RE  +   + GYTIP + ++LINA+AI RDP+ W DPE F+PERF+
Sbjct  363  KETFRLHPPVPLIPREARERCEIGGYTIPAKAKILINAYAIGRDPKLWADPECFQPERFQ  422

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
               +DF + + F+ +PFG+G+RMCPGISF  + V   LA LLYHF+W LP+G     L +
Sbjct  423  GSSIDF-KGNNFELLPFGAGRRMCPGISFATSKVELGLAQLLYHFNWNLPNGTKLEALDM  481

Query  226  TELPRMAMGVKNDIFFI  176
             E   MA   KN++  I
Sbjct  482  AEKFGMAARKKNNLNLI  498



>ref|XP_006367127.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Solanum 
tuberosum]
Length=505

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 141/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    DTS++    A+ EM+K+P V+AKAQAEVREVFKG+   ++ +++K+ YL LVI
Sbjct  304  DMFVAGSDTSSSTVTWALSEMMKSPSVMAKAQAEVREVFKGKKTFDDDDLEKVDYLKLVI  363

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE  +++ + GY IP +++VL+N WAI RDP+ WED ESF PERF
Sbjct  364  KETLRLHPPTPLLVPRECREETEIDGYIIPVKSKVLVNVWAIGRDPESWEDSESFIPERF  423

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E+  +DF+  + F+++PFG+G+R CPG  FGLA V  PLAHLLY+F+W LP+G+ P  L 
Sbjct  424  ENSSVDFS-GTHFQFLPFGAGRRTCPGRLFGLALVTLPLAHLLYNFNWTLPNGMDPRDLD  482

Query  229  LTELPRMAMGVKNDIFFI  176
            + E   M      D++ I
Sbjct  483  MNEANGMTARRDKDLYLI  500



>ref|XP_006361719.1| PREDICTED: 5-epiaristolochene 1,3-dihydroxylase-like [Solanum 
tuberosum]
Length=461

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 148/199 (74%), Gaps = 5/199 (3%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRV--EESNVDKLAYLNLVI  587
            DMF G  +T++T T+ AM EM+KNP + AKAQ EVRE F+ +V  ++ +V++L Y  LV+
Sbjct  258  DMFTGGTETTSTTTIWAMAEMMKNPSIFAKAQEEVREAFRDKVKFDKYDVEELKYQKLVV  317

Query  586  KETMRLHPPGPV-IYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P+ I RE  +++ + GYTIP +T+VLIN WA+ RDP+YW+D ESFKPERF
Sbjct  318  KETLRLHPPIPLSIPRECREETDINGYTIPVKTKVLINVWALGRDPKYWDDAESFKPERF  377

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELP-HGITPHTL  233
            +   +DF+  + F+++PFGSG+R+CPGISFGLA++Y PLA  LYHFDW+LP  G+ P  L
Sbjct  378  DQCSVDFS-GNNFEFLPFGSGRRVCPGISFGLANIYLPLAQSLYHFDWKLPTTGMEPRDL  436

Query  232  KLTELPRMAMGVKNDIFFI  176
             LT+   +    KND++ I
Sbjct  437  DLTKSDGITTSRKNDLYLI  455



>ref|XP_009616520.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=520

 Score =   211 bits (537),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 140/184 (76%), Gaps = 5/184 (3%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK---GRVEESNVDKLAYLNLV  590
            ++F     TS T  + A  E+VKNP+++ KAQAEVR+V+K    R+++S++ KL YL +V
Sbjct  309  ELFVAGTSTSATAMLWAFSELVKNPKMMKKAQAEVRQVYKLGTERIDQSHIQKLTYLRMV  368

Query  589  IKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPER  413
            IKET+R+HPPGP+ + RE+ ++S + GYTIP +T VL+N WA+ RDP++WE+PE+F P+R
Sbjct  369  IKETLRIHPPGPLSFARESREESEIDGYTIPNKTLVLLNLWAVGRDPKHWENPETFDPDR  428

Query  412  FEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTL  233
            F+  P++ +  + F+Y PFG+G+R+CPGISFG+ASV   LA LLYHFDW+LP G++P  L
Sbjct  429  FDGSPIE-SVPTHFEYTPFGAGRRICPGISFGMASVEVSLALLLYHFDWKLPSGMSPQEL  487

Query  232  KLTE  221
             +TE
Sbjct  488  DMTE  491



>ref|XP_003537216.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=508

 Score =   211 bits (536),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 143/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    DTS +    AM E+++NPRV  KAQAE+R+ F+G+  + ES++++L YL LVI
Sbjct  303  DIFAAGTDTSASTLEWAMTEVMRNPRVREKAQAELRQAFRGKEIIHESDLEQLTYLKLVI  362

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET R+HPP P++  RE ++ +++ GY IP +T+V++N +A+ +DP+YW D E F PERF
Sbjct  363  KETFRVHPPTPLLLPRECSQLTIIDGYEIPAKTKVMVNVYAVCKDPKYWVDAEMFVPERF  422

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +DF + + F+Y+PFG G+R+CPG++FGLA++  PLA LLYHF+WELP+ I P  + 
Sbjct  423  EASSIDF-KGNNFEYLPFGGGRRICPGMTFGLATIMLPLALLLYHFNWELPNKIKPENMD  481

Query  229  LTELPRMAMGVKNDIFFI  176
            + E   +A+G KN++  I
Sbjct  482  MAEQFGVAIGRKNELHLI  499



>ref|XP_006589940.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=328

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 140/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    DTS +    AM EM++NPRV  KAQAE+R+ F+ +  + ES++++L YL LVI
Sbjct  127  DIFAAGTDTSASTLEWAMAEMMRNPRVWEKAQAELRQAFREKEIIHESDLEQLTYLKLVI  186

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET R+HPP P++  RE ++ +++ GY IP +T+V++NA+AI +D QYW D + F PERF
Sbjct  187  KETFRVHPPTPLLLPRECSQPTIIDGYEIPAKTKVMVNAYAICKDSQYWIDADRFVPERF  246

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +DF + + F Y+PFG G+R+CPG++ GLAS+  PLA LLYHF+WELP+ + P  + 
Sbjct  247  EGSSIDF-KGNNFNYLPFGGGRRICPGMTLGLASIMLPLALLLYHFNWELPNKMKPEEMN  305

Query  229  LTELPRMAMGVKNDIFFI  176
            + E   +A+G KN++  I
Sbjct  306  MDEHFGLAIGRKNELHLI  323



>ref|XP_004246079.1| PREDICTED: cytochrome P450 71D7-like [Solanum lycopersicum]
Length=504

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 140/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    +TS T  + A+ EM+K+P V+AKAQAEVR+VFK     +E+++DKL YL  VI
Sbjct  300  DLFIAGTETSYTAIIWALTEMMKHPNVMAKAQAEVRQVFKDNENFDENDLDKLPYLKSVI  359

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+R+HPP P++  RE  + + + GYT+P   RV++NAWAI RDP+ WEDPESFKPERF
Sbjct  360  KETLRMHPPVPLLGPRECREQTEIDGYTVPLNARVMVNAWAIGRDPESWEDPESFKPERF  419

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E+  +D T  + ++++PFGSG+RMCPG+SFGL +   PLA  LY FDW+LP  +  +  +
Sbjct  420  ENVAVDLT-GNHYQFIPFGSGRRMCPGMSFGLVNTGHPLAQFLYQFDWKLPDKVNANDFR  478

Query  229  LTELPRMAMGVKNDIFFI  176
             TE  R+    K+D++ I
Sbjct  479  TTETSRVFAASKDDLYLI  496



>gb|KJB11069.1| hypothetical protein B456_001G239600 [Gossypium raimondii]
Length=506

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 141/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+FGG  +TS+T    AM EM++NP+VL +AQ EVR+V  G+  V+E+++ +L YL LVI
Sbjct  300  DIFGGGGETSSTTVDWAMAEMLRNPKVLKRAQNEVRQVCHGKRDVDEASLKELKYLALVI  359

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KETMRLHPP P++  RE+ ++  + GY +P +TRV+INAWA+ RDP+YW + E+F PERF
Sbjct  360  KETMRLHPPFPLLVPRESRENCEINGYQVPTKTRVIINAWAMGRDPKYWSEVETFYPERF  419

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             +   DF + +  +Y+PFG+G+RMCPGISF L ++  PLA LLYHFDWELP G+    L 
Sbjct  420  LNSSCDF-KGTNLEYIPFGAGRRMCPGISFALPNIELPLAKLLYHFDWELPSGLPHENLD  478

Query  229  LTELPRMAMGVKNDIFFI  176
            ++E   M    K+D+  I
Sbjct  479  MSETFGMTARRKDDLILI  496



>ref|XP_006452553.1| hypothetical protein CICLE_v10008076mg [Citrus clementina]
 ref|XP_006474925.1| PREDICTED: cytochrome P450 71D11-like [Citrus sinensis]
 gb|ESR65793.1| hypothetical protein CICLE_v10008076mg [Citrus clementina]
Length=502

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 138/197 (70%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+FG   +TS T    AM EM+KNP V+ KAQAEVREVF  KG+++E+ + ++ YL LV+
Sbjct  297  DIFGAGSETSATTVDWAMCEMMKNPGVMKKAQAEVREVFNRKGKIDETGISEMKYLKLVV  356

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RL P  P+I RE  +   + G+ IP + R+++N+WA  RDP YW  PESF PERF 
Sbjct  357  KETLRLRPSAPLIPRECGESCEINGFNIPVKARIIVNSWATGRDPMYWTQPESFIPERFI  416

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            D  +DF + S F+Y+PFG+G+R+CPG+ +GLA+V  PLA LLYHFDW+LP+G+    L++
Sbjct  417  DHSVDF-KGSNFEYIPFGAGRRICPGMLYGLANVEFPLAMLLYHFDWKLPNGMNHEDLEM  475

Query  226  TELPRMAMGVKNDIFFI  176
            TE   + +  K D+  I
Sbjct  476  TETFGVTVRRKQDLCMI  492



>ref|XP_007222260.1| hypothetical protein PRUPE_ppa005870mg [Prunus persica]
 gb|EMJ23459.1| hypothetical protein PRUPE_ppa005870mg [Prunus persica]
Length=440

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 135/198 (68%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR---VEESNVDKLAYLNLV  590
            DM+    +TS T T  A+ E+VKNPR + KAQAEVR +  G+   ++E ++ KL YL LV
Sbjct  237  DMYLAGAETSATTTEWAITELVKNPRAMDKAQAEVRHLLAGKRKNIQEEDIKKLDYLKLV  296

Query  589  IKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            IKET+RLHPP P+I RE  +   + GY IP   +VLINAWAI RDP++W++ + F PERF
Sbjct  297  IKETLRLHPPAPLIPREATQRIKIGGYDIPTEAKVLINAWAIGRDPKHWDNADCFLPERF  356

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            +   +DF R + F+ +PFG+GKR+CPGISFG+ASV   L+ LLY+F+W+LP G     L 
Sbjct  357  QGSSIDF-RGTNFELIPFGAGKRICPGISFGIASVELALSQLLYYFNWKLPSGKKVEELD  415

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   M    +ND+F I
Sbjct  416  MTESLGMTPRRRNDLFVI  433



>ref|XP_004231934.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=503

 Score =   210 bits (534),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 142/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            +MF G  DTS+T+   A+ EM+KNP+V+ KAQAEVREVFKG+  + ES + KL Y+ +VI
Sbjct  299  EMFIGGTDTSSTVLEWAISEMMKNPQVMEKAQAEVREVFKGKSKITESEIQKLDYIKMVI  358

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+R+HPP P++  RE  +   + GY IP +T+V+INAWAI R PQ+WE+ E F+PERF
Sbjct  359  KETLRMHPPLPLLLPREAIEKCEIGGYDIPAKTKVIINAWAIGRHPQHWENAECFEPERF  418

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            +D  +DF   +  +Y+PFG G+RMCPG  FG+A+V  PLA LL+HFDWELP GI    L 
Sbjct  419  QDLDLDFV-GTNLEYIPFGGGRRMCPGSLFGIANVELPLAKLLFHFDWELPDGIEASDLD  477

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE     +G KND++ +
Sbjct  478  MTETFGATVGRKNDLYLV  495



>ref|XP_012066837.1| PREDICTED: premnaspirodiene oxygenase-like [Jatropha curcas]
 gb|KDP42338.1| hypothetical protein JCGZ_02811 [Jatropha curcas]
Length=504

 Score =   210 bits (534),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 137/183 (75%), Gaps = 4/183 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            DMF    DTS+T    A+ EMVKNP ++ KAQAEVREVF  KG+V+E+++ +L YL LVI
Sbjct  294  DMFIAGSDTSSTTIEWAISEMVKNPSIMEKAQAEVREVFGSKGKVDEADLHELNYLKLVI  353

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHP  P++  R++ +D V+ GY I  ++ V++NAWAI+RDP+YW++ E F PERF
Sbjct  354  KETLRLHPAVPLLLPRQSREDCVIEGYNIATKSTVIVNAWAIARDPKYWDEAERFYPERF  413

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             +  +DF + + F+++PFG+G+RMCPG+ FGLASV  PLA LLYHFDW+LP G  P  L 
Sbjct  414  INSSIDF-KGTNFEFIPFGAGRRMCPGMLFGLASVELPLAQLLYHFDWKLPGGQKPEDLD  472

Query  229  LTE  221
            +++
Sbjct  473  MSD  475



>ref|XP_009622900.1| PREDICTED: cytochrome P450 71D7-like [Nicotiana tomentosiformis]
 gb|ABC69401.1| CYP71D49v2 [Nicotiana tabacum]
Length=505

 Score =   210 bits (534),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 141/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    +TS T  + A+ E++K+P V+AKAQAEVR+VFK    ++E+++DKL YL  VI
Sbjct  301  DLFIAGTETSYTAIIWALSELMKHPSVMAKAQAEVRKVFKENENLDENDLDKLPYLKSVI  360

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+R+HPP P++  RE  + + + GYT+P + RV++NAWAI RDP+ WEDPESFKPERF
Sbjct  361  KETLRMHPPVPLLGPRECREQTEIDGYTVPLKARVMVNAWAIGRDPESWEDPESFKPERF  420

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E+  +D T  + ++++PFGSG+RMCPG+SFGL +   PLA LLY FDW+ PH +      
Sbjct  421  ENISVDLT-GNHYQFIPFGSGRRMCPGMSFGLVNTGHPLAQLLYFFDWKFPHKVNAADFH  479

Query  229  LTELPRMAMGVKNDIFFI  176
             TE  R+    K+D++ I
Sbjct  480  TTETSRVFAASKDDLYLI  497



>gb|ABC69400.1| CYP71D49v3 [Nicotiana tabacum]
Length=505

 Score =   210 bits (534),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 141/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    +TS T  + A+ E++K+P V+AKAQAEVR+VFK    ++E+++DKL YL  VI
Sbjct  301  DLFIAGTETSYTAIIWALSELMKHPSVMAKAQAEVRKVFKENENLDENDLDKLPYLKSVI  360

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+R+HPP P++  RE  + + + GYT+P + RV++NAWAI RDP+ WEDPESFKPERF
Sbjct  361  KETLRMHPPVPLLGPRECREQTEIDGYTVPLKARVMVNAWAIGRDPESWEDPESFKPERF  420

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E+  +D T  + ++++PFGSG+RMCPG+SFGL +   PLA LLY FDW+ PH +      
Sbjct  421  ENISVDLT-GNHYQFIPFGSGRRMCPGMSFGLVNTGHPLAQLLYFFDWKFPHKVNAADFH  479

Query  229  LTELPRMAMGVKNDIFFI  176
             TE  R+    K+D++ I
Sbjct  480  TTETSRVFAASKDDLYLI  497



>ref|XP_012071258.1| PREDICTED: cytochrome P450 71D9-like [Jatropha curcas]
 gb|KDP39285.1| hypothetical protein JCGZ_01042 [Jatropha curcas]
Length=505

 Score =   210 bits (534),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 139/198 (70%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK--GRVEESNVDKLAYLNLVI  587
            DMF    D+S   T+  M E++KNP V+ KAQAEVR+VFK  G+V+E  +++L YL   +
Sbjct  299  DMFSAGSDSSAATTIWTMSELLKNPSVMEKAQAEVRQVFKKKGQVDEEGMEELHYLKAAV  358

Query  586  KETMRLHPPGP-VIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLH PGP V+ RE  ++ V+ GY IP ++R+ +N+WA+ RDP+YW +PE + PERF
Sbjct  359  KETLRLHAPGPLVVPRECTENCVIAGYDIPAKSRINVNSWALGRDPEYWTEPERYSPERF  418

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D  +D  + + F Y+PFGSG+R+CPGI FGL ++   LA+LLY+FDW+LP+G+ P  L 
Sbjct  419  LDGSIDH-KGNNFTYLPFGSGRRLCPGILFGLTNIEFILANLLYYFDWKLPNGLQPEDLD  477

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE+   A   KND+  I
Sbjct  478  MTEVFGSAARRKNDLLVI  495



>emb|CDP07882.1| unnamed protein product [Coffea canephora]
Length=556

 Score =   211 bits (536),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 142/183 (78%), Gaps = 4/183 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    +TS+T    AM EM++NP V+AKAQ+E+R  FKG+   EE +V +L YL LVI
Sbjct  301  DVFSAGTETSSTTVDWAMSEMIRNPSVMAKAQSEIRTAFKGKQMFEEDDVQELKYLKLVI  360

Query  586  KETMRLHPPGPVIYR-ENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            +ET+RLHPP P++   E  ++  + GY IP +TRVL+NAWA+ RDPQYW+DPESFKPERF
Sbjct  361  RETLRLHPPLPLLVPRECREECEIDGYVIPVQTRVLVNAWAMGRDPQYWDDPESFKPERF  420

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E++P+DF   + F+Y+PFG+G+RMCPGI FGLA+VY PLA LLYHF+W+LP+G+ P+ L 
Sbjct  421  ENNPVDFA-GTHFEYLPFGAGRRMCPGIQFGLANVYVPLAFLLYHFNWKLPNGLDPNDLD  479

Query  229  LTE  221
            ++E
Sbjct  480  MSE  482



>gb|EEC66624.1| hypothetical protein OsI_32869 [Oryza sativa Indica Group]
Length=503

 Score =   209 bits (533),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 136/196 (69%), Gaps = 3/196 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+  G  +T TT+   AM E+++NP V++K Q EVREVFK +  V   +++KL YL  VI
Sbjct  299  DILAGGSETVTTVLQWAMAELMRNPTVMSKVQDEVREVFKWKEMVSNDDINKLTYLQFVI  358

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RLH PGP+  RE  +   V GY +P  T+ L+N W+ISRDP+YW+DPE+FKPERFE
Sbjct  359  KETLRLHTPGPLFMRECQEQCQVMGYDMPKGTKFLLNLWSISRDPKYWDDPETFKPERFE  418

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            DD  DF + + F+++ FG+G+RMCPG+ FGLA++   LA+LL++FDW LP G+ P  L +
Sbjct  419  DDARDF-KGNDFEFISFGAGRRMCPGMLFGLANIELALANLLFYFDWSLPDGVLPSELDM  477

Query  226  TELPRMAMGVKNDIFF  179
            TE   + +  K D+  
Sbjct  478  TENFGVTVRKKEDLLL  493



>gb|KDP32263.1| hypothetical protein JCGZ_14784 [Jatropha curcas]
Length=301

 Score =   204 bits (518),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 143/201 (71%), Gaps = 4/201 (2%)
 Frame = -2

Query  769  CM*DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLN  596
             M DMF G  +TS T+   AM EMVK+ RV+ KAQ E+R+V+  K  ++E+ +D+L YL 
Sbjct  90   VMLDMFLGGTETSATLIEWAMSEMVKDSRVMRKAQEEIRQVYYQKENIDETRLDELKYLK  149

Query  595  LVIKETMRLHPPGPVIYRENNKDSV-VCGYTIPPRTRVLINAWAISRDPQYWEDPESFKP  419
            LV+KET+RLHPPGP++ +    ++V + GY +P  T+V +NAWAI R+ +YW + E F P
Sbjct  150  LVVKETLRLHPPGPLLVKRECLEAVEIDGYEVPINTKVNVNAWAIGRNSRYWIEAEKFFP  209

Query  418  ERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPH  239
            ERF+++ +DF + + F+++PFG+G+RMCPGI++G+A V   +A+LLYHFDWE P+GI PH
Sbjct  210  ERFQNNSIDF-KGNDFEFIPFGAGRRMCPGIAYGMAVVELVIANLLYHFDWEQPNGIEPH  268

Query  238  TLKLTELPRMAMGVKNDIFFI  176
             L ++E   +    KN++  I
Sbjct  269  HLDMSESFGITARRKNELHLI  289



>ref|XP_003610580.1| Cytochrome P450 [Medicago truncatula]
 gb|AES92777.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=503

 Score =   209 bits (532),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 136/201 (68%), Gaps = 6/201 (3%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKG--RVEESNVDKLAYLNLVI  587
            DMF    DTS T+   AM E++KN RV+ KAQ+E+RE  KG  R+ ES++ +L+YL  VI
Sbjct  299  DMFAAGSDTSATVIEWAMSELMKNSRVMKKAQSEIREAVKGKKRIYESDLHELSYLKSVI  358

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KETMRLHPP  ++ RE  +   + GY IP +T V++NAWAI RDP++W D + F PERF 
Sbjct  359  KETMRLHPPFTLLPRECREACNIDGYEIPIKTSVIVNAWAIGRDPKHWYDAKKFIPERFN  418

Query  406  DDP-MDFTR---SSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPH  239
            D    DF +   ++ F YMPFG G+RMCPGIS GLA++  PLA LLYHF+WELP+G+ P 
Sbjct  419  DSTGFDFNKLNNNNSFDYMPFGGGRRMCPGISLGLANIELPLAALLYHFNWELPNGMKPE  478

Query  238  TLKLTELPRMAMGVKNDIFFI  176
             L +TE    A   +N ++ I
Sbjct  479  DLDMTEAFGAAAARRNGLYLI  499



>ref|XP_010644547.1| PREDICTED: premnaspirodiene oxygenase-like [Vitis vinifera]
Length=508

 Score =   209 bits (532),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 142/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+F    +TS+T    AM EM+KNP V+AKAQAEVR++F  KG  +E+ + +L +L LVI
Sbjct  302  DLFIAGSETSSTAVEWAMAEMLKNPGVMAKAQAEVRDIFSRKGNADETMIHELKFLKLVI  361

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE+ +   + GY IP +TRV+INAWA++RDP++W D ESF PERF
Sbjct  362  KETLRLHPPVPLLIPRESRESCEINGYEIPVKTRVIINAWAVARDPEHWNDAESFNPERF  421

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D  +D+ + + F+Y+PFG+G+RMCPGI FG+A+V   LA LLY+FDW+LP+G     L 
Sbjct  422  LDSSIDY-QGTNFEYIPFGAGRRMCPGILFGMANVEIALAQLLYYFDWKLPNGTQHEELD  480

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE  R ++  K ++  I
Sbjct  481  MTEDFRTSLRRKLNLHLI  498



>gb|ABC69399.1| CYP71D49v1 [Nicotiana tabacum]
Length=505

 Score =   209 bits (532),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 141/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    +TS T  + A+ E++K+P V+AKAQAEVR+VFK    ++E+++DKL YL  VI
Sbjct  301  DLFIAGTETSYTAIIWALSELMKHPSVMAKAQAEVRKVFKENENLDENDLDKLPYLKSVI  360

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+R+HPP P++  RE  + + + GYT+P + RV++NAWAI RDP+ WEDPESFKPERF
Sbjct  361  KETLRMHPPVPLLGPRECREQTEIDGYTVPLKARVMVNAWAIGRDPESWEDPESFKPERF  420

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E+  +D T  + ++++PFGSG+RMCPG+SFGL +   PLA LLY FDW+ PH +      
Sbjct  421  ENISVDLT-GNHYQFIPFGSGRRMCPGMSFGLVNTGHPLAQLLYLFDWKFPHKVNAADFH  479

Query  229  LTELPRMAMGVKNDIFFI  176
             TE  R+    K+D++ I
Sbjct  480  TTETSRVFAASKDDLYLI  497



>ref|XP_010067810.1| PREDICTED: premnaspirodiene oxygenase-like [Eucalyptus grandis]
Length=427

 Score =   207 bits (527),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 129/182 (71%), Gaps = 3/182 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F     T++T+   AM E+++NP+V+A+AQAEVREV KG+  VEES+++KL YL  +I
Sbjct  222  DLFVAGSITTSTLLEWAMAELIRNPKVMARAQAEVREVLKGKGHVEESDLNKLNYLKAII  281

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KE+ RLHPP P+I RE  K+  + GY IP  +R+LIN  AI RDP YW DPE F+PERF 
Sbjct  282  KESFRLHPPVPLIPREATKECKINGYKIPVNSRILINVMAIGRDPNYWADPEKFEPERFL  341

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            + P+DF   + F+ +PFGSGKR CPGI+F  AS+   LA LLYHFDW+LP G     L +
Sbjct  342  ESPLDFL-GTNFELLPFGSGKRSCPGIAFANASIEFILAALLYHFDWQLPEGEAMEELDM  400

Query  226  TE  221
            TE
Sbjct  401  TE  402



>gb|KCW66024.1| hypothetical protein EUGRSUZ_G03315, partial [Eucalyptus grandis]
Length=424

 Score =   207 bits (527),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 129/182 (71%), Gaps = 3/182 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F     T++T+   AM E+++NP+V+A+AQAEVREV KG+  VEES+++KL YL  +I
Sbjct  222  DLFVAGSITTSTLLEWAMAELIRNPKVMARAQAEVREVLKGKGHVEESDLNKLNYLKAII  281

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KE+ RLHPP P+I RE  K+  + GY IP  +R+LIN  AI RDP YW DPE F+PERF 
Sbjct  282  KESFRLHPPVPLIPREATKECKINGYKIPVNSRILINVMAIGRDPNYWADPEKFEPERFL  341

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            + P+DF   + F+ +PFGSGKR CPGI+F  AS+   LA LLYHFDW+LP G     L +
Sbjct  342  ESPLDFL-GTNFELLPFGSGKRSCPGIAFANASIEFILAALLYHFDWQLPEGEAMEELDM  400

Query  226  TE  221
            TE
Sbjct  401  TE  402



>emb|CDP11813.1| unnamed protein product [Coffea canephora]
Length=277

 Score =   203 bits (516),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 136/198 (69%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+FGG  +TS+T TV AM EM+KNP V+ KAQAEVR ++  +G V+ES + +L YL+ VI
Sbjct  69   DVFGGGGETSSTTTVWAMAEMIKNPAVMKKAQAEVRAIYGKRGTVDESQLHELKYLHAVI  128

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP  +I  RE      + GY IP ++RV +N WAI RDP  W +PE F PERF
Sbjct  129  KETLRLHPPVSLIPPRECGDQCEIFGYEIPAKSRVYVNLWAIGRDPGNWTEPEKFIPERF  188

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D  +DF + S F Y+PFG+G+R+CPG+SF L  +  PLA  L+HFDW+LP  +    L 
Sbjct  189  LDSKIDF-KGSNFNYIPFGAGRRICPGMSFALPMMELPLAQSLFHFDWKLPGALENEELD  247

Query  229  LTELPRMAMGVKNDIFFI  176
            +T++  + +G K+D+F +
Sbjct  248  MTDIFGLTVGRKHDLFLV  265



>ref|XP_003615863.1| Cytochrome P450 [Medicago truncatula]
 gb|AES98821.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=491

 Score =   209 bits (531),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 142/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            DMF G  +TS+ + +  + EM+KNP+++ +AQAEVR+VF  KG V+E+ +  L YL  +I
Sbjct  289  DMFVGGTETSSGVVLWGISEMIKNPKIMKEAQAEVRKVFDKKGHVDETELHHLIYLKSII  348

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHP  P++  RE+ +   + GY IP +TRV IN WAI RD +YW + ESFKPERF
Sbjct  349  KETLRLHPSLPLLIPRESRERCQINGYEIPAKTRVAINVWAIGRDERYWAEAESFKPERF  408

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             +  +DF + + F+Y+PFG+G+RMCPG++FGL+++  PLA LLYHFDW+LP+G+    L 
Sbjct  409  VNSTIDF-KGTNFEYIPFGAGRRMCPGMAFGLSNIELPLAQLLYHFDWKLPNGMKNEELD  467

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   +A+  K+D+  I
Sbjct  468  MTESFGLAVVRKHDLCLI  485



>ref|XP_009794009.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=497

 Score =   209 bits (531),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 144/198 (73%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    DTS+     AMVEM+KN  +LAKAQAEVR+ F+G+   +E+NV++L YL LVI
Sbjct  292  DIFSAGTDTSSATVDWAMVEMMKNQSILAKAQAEVRKTFRGKETFDENNVEELKYLKLVI  351

Query  586  KETMRLHPPGPVIYR-ENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++   E  +++ + GYTIP +T+V+IN WAI RDP+YW+D E FKPERF
Sbjct  352  KETLRLHPPLPLLLPRECREETNINGYTIPLKTKVMINVWAIGRDPKYWDDAEIFKPERF  411

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E + MDFT  + F+Y+PFGSG+R CPGISFGLA+VY PLA LLYHFDW+LP    P  L 
Sbjct  412  EHNSMDFT-GNNFEYLPFGSGRRNCPGISFGLANVYFPLAQLLYHFDWKLPTETNPSDLD  470

Query  229  LTELPRMAMGVKNDIFFI  176
            LTE        K++++ I
Sbjct  471  LTESAGATCSRKSNLYLI  488



>ref|XP_009615716.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=508

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 140/199 (70%), Gaps = 5/199 (3%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRVE---ESNVDKLAYLNLV  590
            D+F G   TS +    A  E++KNP+++ KAQ EVREVFKG++E   ++++ KL YL +V
Sbjct  304  DLFAGGSTTSASTMEWAFSELMKNPKIMKKAQDEVREVFKGKLEGIDQTDIQKLKYLKMV  363

Query  589  IKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPER  413
            +KET+R HP  P++  RE+ ++  + GY IP  T  L+N WAISRDP YW +PE+F PER
Sbjct  364  VKETVRFHPLAPLLAPRESREECEINGYVIPKGTMALVNFWAISRDPNYWPNPETFDPER  423

Query  412  FEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTL  233
            F +  +DFT  + F++ PFG+G+R+CPGISF +A+V   LA LLYHFDW+LP+G+ PH L
Sbjct  424  FNESHLDFT-GAHFEFTPFGTGRRICPGISFSMATVELSLALLLYHFDWKLPNGMNPHEL  482

Query  232  KLTELPRMAMGVKNDIFFI  176
             +TE    A+  KN+++ I
Sbjct  483  DMTEKFGNALERKNNLYLI  501



>ref|XP_003600339.1| Cytochrome P450 [Medicago truncatula]
 gb|AES70590.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=511

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 139/198 (70%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+F    +TS +  + AM EM+K+ RVL KAQAEVRE F   GRV+E+ +D+  YL  VI
Sbjct  305  DVFAAGSETSASTIIWAMAEMMKDQRVLKKAQAEVREGFDRSGRVDEATIDEFKYLKAVI  364

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KE++RLHP  P++  RE  +   + GY IP ++RVL+NAWAI RDP+YW DP+ F PERF
Sbjct  365  KESLRLHPSVPLLLPRECGQACEINGYYIPVKSRVLVNAWAIGRDPKYWNDPDKFYPERF  424

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D  +DF + + F+Y+PFG+G+R+CPG+++G+A+V   LA +LYHFDW+LP+GI    L+
Sbjct  425  IDSSIDF-KGTNFEYIPFGAGRRICPGMNYGMANVEQVLALILYHFDWKLPNGIKNEELE  483

Query  229  LTELPRMAMGVKNDIFFI  176
            L E    AM  K D++ I
Sbjct  484  LIEEFGAAMSRKGDLYLI  501



>ref|XP_012071026.1| PREDICTED: cytochrome P450 71D9-like [Jatropha curcas]
 gb|KDP39287.1| hypothetical protein JCGZ_01044 [Jatropha curcas]
Length=510

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/197 (49%), Positives = 137/197 (70%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+  G  DTS T  V AM E++KNP V+ + Q EVR+VF  KG V+E ++ +L YL  V+
Sbjct  303  DVLSGGTDTSATTVVWAMSELLKNPDVMKRVQTEVRQVFSKKGYVDEESIGELHYLKAVV  362

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KETMRLHP G V+ RE  +D V+ GY IP ++R++INAWA+ RDP YW + E F P+RF 
Sbjct  363  KETMRLHPTGAVLTRECREDCVINGYDIPYKSRIIINAWALGRDPDYWPEAERFNPDRFL  422

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            +  +D+ +   F+++PFG+G+R+CPGI FG+++V  PLA LLYHFDW+LP+G+ P  L +
Sbjct  423  NSSIDY-KGKHFEFLPFGAGRRICPGILFGISNVQFPLARLLYHFDWKLPNGMRPEDLDM  481

Query  226  TELPRMAMGVKNDIFFI  176
             E   +A+   ND+  I
Sbjct  482  NEKYGIAVRRANDLQLI  498



>dbj|BAO45903.1| cytochrome P450 71D10 [Acacia mangium]
Length=503

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 136/183 (74%), Gaps = 4/183 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +T++T    AM E++KNP V+ KAQAEVR ++KGR  V+ES + +L YL+ V+
Sbjct  301  DMFIAGTETTSTALEWAMAELIKNPSVMEKAQAEVRWIYKGRETVDESEIHELKYLSSVV  360

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPPG  +  RE+ K  V+ GY IP  TR+++NAWAI RDP++W++ ++FKPERF
Sbjct  361  KETLRLHPPGVFLLPRESTKRCVINGYQIPENTRIMVNAWAIGRDPKHWDEADTFKPERF  420

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D+P+DF + +   ++PFG G+R+CPGI+F  +++   LA+LLYHFDW+LP+GITP    
Sbjct  421  LDNPIDF-QGANMNFIPFGGGRRICPGINFAESNIDLTLANLLYHFDWKLPNGITPENFD  479

Query  229  LTE  221
            ++E
Sbjct  480  MSE  482



>gb|ABC69402.1| CYP71D5v2 [Nicotiana tabacum]
Length=504

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 141/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    +TS T  + A+ E++K+P V+AKAQAEVR+VFK     +E+++DKL YL  VI
Sbjct  300  DLFIAGTETSYTAIIWALSELMKHPSVMAKAQAEVRKVFKENENFDENDLDKLPYLKSVI  359

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+R+HPP P++  RE    + + GYT+P + RV++NAWAI RDP+ WEDPESFKPERF
Sbjct  360  KETLRMHPPVPLLGPRECRDQTEIDGYTVPIKARVMVNAWAIGRDPESWEDPESFKPERF  419

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E+  +D T  + ++++PFGSG+RMCPG+SFGL +   PLA LLY FDW+LP  +  +  +
Sbjct  420  ENTSVDLT-GNHYQFIPFGSGRRMCPGMSFGLVNTGHPLAQLLYCFDWKLPDKVNANDFR  478

Query  229  LTELPRMAMGVKNDIFFI  176
             TE  R+    K+D++ I
Sbjct  479  TTETSRVFAASKDDLYLI  496



>gb|KDO50397.1| hypothetical protein CISIN_1g020458mg [Citrus sinensis]
Length=326

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 137/198 (69%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK--GRVEESNVDKLAYLNLVI  587
            D+F    +TS T    AM EM++NPRV+ KAQAEVREVF   G+V E+++D++ +  L +
Sbjct  120  DIFAAGSETSATTVDWAMCEMMRNPRVMKKAQAEVREVFHRTGKVNETSIDEMKFFKLFV  179

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHP  P++  RE  +   + G+ IP + +V +NAWAI RDP+YW +P SF PERF
Sbjct  180  KETLRLHPVAPLLLPRECGERCQINGFDIPVKAKVFVNAWAIGRDPKYWTEPASFIPERF  239

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D  +D+ + + F+++PFG+G+R+CPG+SFGLASV  PLA LLYHFDW+LP+G+    L 
Sbjct  240  LDHSIDY-KGTNFEFIPFGAGRRICPGMSFGLASVELPLAMLLYHFDWKLPNGMKHEDLD  298

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE     +  K D+  I
Sbjct  299  MTEAFATTVRRKQDLCMI  316



>ref|XP_009764618.1| PREDICTED: cytochrome P450 71D7-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009764619.1| PREDICTED: cytochrome P450 71D7-like isoform X2 [Nicotiana sylvestris]
Length=504

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 141/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    +TS T  + A+ E++K+P V+AKAQAEVR+VFK     +E+++DKL YL  VI
Sbjct  300  DLFIAGTETSYTAIIWALSELMKHPSVMAKAQAEVRKVFKENENFDENDLDKLPYLKSVI  359

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+R+HPP P++  RE    + + GYT+P + RV++NAWAI RDP+ WEDPESFKPERF
Sbjct  360  KETLRMHPPVPLLGPRECRDQTEIDGYTVPIKARVMVNAWAIGRDPESWEDPESFKPERF  419

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E+  +D T  + ++++PFGSG+RMCPG+SFGL +   PLA LLY FDW+LP  +  +  +
Sbjct  420  ENTSVDLT-GNHYQFIPFGSGRRMCPGMSFGLVNTGHPLAQLLYCFDWKLPDKVNANDFR  478

Query  229  LTELPRMAMGVKNDIFFI  176
             TE  R+    K+D++ I
Sbjct  479  TTETSRVFAASKDDLYLI  496



>ref|XP_009793838.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=217

 Score =   200 bits (509),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 141/200 (71%), Gaps = 6/200 (3%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK---GRVEESNVDKLAYLNLV  590
            ++F     TS T  + A  E+ KNP+++ KAQAE+REVFK    R+ +S++ KL YL +V
Sbjct  5    ELFVAGTSTSATTMLWAFSELAKNPKMMKKAQAELREVFKLGTERINQSHIQKLTYLRMV  64

Query  589  IKETMRLHP-PGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPE  416
            IKET+RLHP  GP+ + RE+ ++S +  YTIP +T VL+N WAI RDP+YWE+PE+F P+
Sbjct  65   IKETLRLHPWSGPLSFARESREESEIDRYTIPNKTLVLLNLWAIGRDPKYWENPETFDPD  124

Query  415  RFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHT  236
            RF+  P++ +  + F+Y PFG+G+R+CPGISFG+ASV   LA LLYHFDW+L +G++P  
Sbjct  125  RFDGSPIE-SVPTHFEYTPFGAGRRICPGISFGMASVEVSLALLLYHFDWKLSNGMSPQE  183

Query  235  LKLTELPRMAMGVKNDIFFI  176
            L +TE    ++  K  +  I
Sbjct  184  LDMTEKFSTSLERKTKLCLI  203



>gb|ABC69398.1| CYP71D5v3 [Nicotiana tabacum]
Length=504

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 141/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    +TS T  + A+ E++K+P V+AKAQAEVR+VFK     +E+++DKL YL  VI
Sbjct  300  DLFIAGTETSYTAIIWALSELMKHPSVMAKAQAEVRKVFKENENFDENDLDKLPYLKSVI  359

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+R+HPP P++  RE    + + GYT+P + RV++NAWAI RDP+ WEDPESFKPERF
Sbjct  360  KETLRMHPPVPLLGPRECRDQTEIDGYTVPIKARVMVNAWAIGRDPESWEDPESFKPERF  419

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E+  +D T  + ++++PFGSG+RMCPG+SFGL +   PLA LLY FDW+LP  +  +  +
Sbjct  420  ENTSVDLT-GNHYQFIPFGSGRRMCPGMSFGLVNTGHPLAQLLYCFDWKLPDKVNANDFR  478

Query  229  LTELPRMAMGVKNDIFFI  176
             TE  R+    K+D++ I
Sbjct  479  TTETSRVFAASKDDLYLI  496



>gb|KEH25835.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=500

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 136/200 (68%), Gaps = 5/200 (3%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKG--RVEESNVDKLAYLNLVI  587
            DMF GA D+S      AM E++KNPRV  KAQAE+REV KG  R+ ES++ +L+YL  VI
Sbjct  296  DMFAGASDSSAITIDWAMSELMKNPRVRMKAQAEIREVCKGKKRIYESDLHELSYLKSVI  355

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RLHPPG ++ RE  +   + GY IP +T +++NAWAI RDP +W D E F PERF 
Sbjct  356  KETLRLHPPGAILTRECREACNIGGYEIPIKTNLILNAWAIGRDPNHWSDAEKFIPERFH  415

Query  406  DDP-MDFTR--SSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHT  236
            D+   DF +   + F+Y+PFG G+RMCPG+ FGLA++  PLA LLYHFDW++P+ +    
Sbjct  416  DNTGFDFNKVNDNSFQYIPFGGGRRMCPGVLFGLANIELPLAALLYHFDWKIPNEMKAED  475

Query  235  LKLTELPRMAMGVKNDIFFI  176
              +TE     +  KN++F I
Sbjct  476  FDMTEEYGATVSRKNNLFLI  495



>gb|KHN08403.1| Cytochrome P450 71D8 [Glycine soja]
Length=434

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 142/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    DTS++     M EM++NPRV  KAQAE+R+ F+ +  + ES++++L YL LVI
Sbjct  232  DIFAAGTDTSSSTLEWTMTEMMRNPRVREKAQAELRQTFREKDIIHESDLEQLTYLKLVI  291

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+R+HPP P++  RE ++ +++ GY IP +T+V++NA+AI +DPQYW   + F PERF
Sbjct  292  KETLRVHPPTPLLLPRECSQLTIIDGYEIPAKTKVMVNAYAICKDPQYWTHADRFIPERF  351

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            ED  +DF + + F+Y+PFG G+R+CPG++ GLAS+  PLA LLYHF+WELP+ + P  + 
Sbjct  352  EDSSIDF-KGNNFEYLPFGGGRRICPGMTLGLASIMLPLALLLYHFNWELPNNMKPEDMD  410

Query  229  LTELPRMAMGVKNDIFFI  176
            + E   +A+  KN++  +
Sbjct  411  MAEHFGLAINRKNELHLV  428



>ref|XP_003617703.1| Cytochrome P450 [Medicago truncatula]
Length=746

 Score =   213 bits (541),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 142/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+F    +TS+T  + A+ EMVKNP+V+ +AQAEVR VF  KG V+E+ + +L YL  VI
Sbjct  544  DIFDAGTETSSTTVLWAISEMVKNPKVMEEAQAEVRRVFDRKGFVDETELHQLIYLKSVI  603

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KETMRLHP  P++  RE+ +   + GY IP +TRV++NAWAI RDP+YW D ESFKPERF
Sbjct  604  KETMRLHPTVPLLLPRESRERCQINGYEIPAKTRVMVNAWAIGRDPRYWVDAESFKPERF  663

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             + P+DF + + F+Y+PFG+G+RMCPGI+F L +V  PLA LLYHFDW+LP+ +    L 
Sbjct  664  VNSPIDF-KGTDFEYIPFGAGRRMCPGIAFALPNVELPLASLLYHFDWKLPNKMKNEELD  722

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   +  G K+++  I
Sbjct  723  MTESFGITAGRKHNLCLI  740



>gb|KJB13844.1| hypothetical protein B456_002G097100 [Gossypium raimondii]
Length=511

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 140/197 (71%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            DMF    +TS+     AM +++KNP ++ KA AEVR+VF  KG V+E+   +L +L LVI
Sbjct  306  DMFAAGSETSSISVEWAMSQLLKNPSLMEKATAEVRQVFNGKGYVDEARFGELKFLKLVI  365

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RLH P P+I RE  ++  + GY IP +T+VLIN+WAI+RD +YW +PESF PERF 
Sbjct  366  KETLRLHNPVPLIPRECRENCKLGGYDIPAKTKVLINSWAIARDSRYWSEPESFNPERFL  425

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            D  +D+ + + F+Y+PFG+G+R+CPGI+FGLA+V   LA L+YHFDW+LP+G+    L +
Sbjct  426  DSSLDY-KGTDFQYIPFGAGRRICPGITFGLANVEQQLAQLVYHFDWKLPNGMKCEDLDI  484

Query  226  TELPRMAMGVKNDIFFI  176
            T  P +    K+D+F I
Sbjct  485  TSGPGLTTRRKHDLFVI  501



>ref|XP_003593442.1| Cytochrome P450 [Medicago truncatula]
Length=431

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 132/198 (67%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+F     TS T    A  EM+KNPRVL KAQAEVR V   KG V+E N+ +L YL  VI
Sbjct  225  DIFFAGSGTSATTLEWAFSEMLKNPRVLKKAQAEVRHVVGSKGYVDEINLQELKYLKAVI  284

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPPGP++  RE  ++ VV GY IP  T+VL+NAWAI RDP+YW + E F PERF
Sbjct  285  KETLRLHPPGPLLIPRECIENCVVNGYIIPAGTQVLVNAWAIGRDPKYWNEGEKFNPERF  344

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D P+D+ + S F+++PFG+G+RMCPGI F    +  PLA LLY+FDW LP G +   L 
Sbjct  345  IDCPIDY-KGSNFEFIPFGAGRRMCPGILFAEVGMEFPLAQLLYYFDWGLPSGTSHENLD  403

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE        KND+F I
Sbjct  404  MTEALGSEAKRKNDLFVI  421



>gb|KHN36161.1| Cytochrome P450 71D8 [Glycine soja]
Length=453

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 140/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    DTS +    AM EM++NPRV  KAQAEVR+ F+    + E++V KL YL LVI
Sbjct  251  DVFTAGTDTSASTLEWAMAEMMRNPRVREKAQAEVRQAFRELKIIHETDVGKLTYLKLVI  310

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLH P P++  RE ++ +++ GY IP +T+V+IN WAI RDPQYW D E F PERF
Sbjct  311  KETLRLHAPSPLLVPRECSELTIIDGYEIPVKTKVMINVWAIGRDPQYWTDAERFVPERF  370

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            +   +DF + + F+Y+PFG+G+RMCPG++FGLA++  PLA LLYHF+WELP+ + P  + 
Sbjct  371  DGSSIDF-KGNNFEYLPFGAGRRMCPGMTFGLANIMLPLALLLYHFNWELPNEMKPEDMD  429

Query  229  LTELPRMAMGVKNDIFFI  176
            ++E   + +  K+++  I
Sbjct  430  MSENFGLTVTRKSELCLI  447



>ref|XP_006365912.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=512

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 142/199 (71%), Gaps = 5/199 (3%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            +MF    +TS+T  + A  EM+KNP V+AKAQ EVRE FKG+   E+ ++++L YL LVI
Sbjct  308  EMFMAGAETSSTTIIWAFSEMIKNPGVMAKAQLEVREAFKGKKTFEDIDLEELKYLKLVI  367

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYW-EDPESFKPER  413
            KET+RLHP  P++  RE  +++ + GY IP +T+V++NAWAI RD +YW +DPESF PER
Sbjct  368  KETLRLHPAAPLLIPRECREETQIDGYNIPIKTKVIVNAWAIGRDSRYWHDDPESFIPER  427

Query  412  FEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTL  233
            FE+  +DF R + F+++PFG+G+RMCPG+  GLA+V   LA LLYHFDW+LP G++    
Sbjct  428  FENSSIDF-RGNNFEFIPFGAGRRMCPGMLSGLATVGHSLAKLLYHFDWKLPDGVSVDDF  486

Query  232  KLTELPRMAMGVKNDIFFI  176
             +TE   +A   KND+  I
Sbjct  487  DMTEAEGVAASRKNDLCLI  505



>ref|XP_004511997.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=506

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 140/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D F    DT+T+  V AM E++KNPRV+ K Q+E+R+  KG+  + E +V  L YL LVI
Sbjct  302  DTFAAGTDTTTSTIVWAMAELMKNPRVMEKLQSELRDACKGKEIITEVDVQDLPYLKLVI  361

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLH P P++  RE+ + + + GY IP +T+V++N WA++RDP YW D E F PERF
Sbjct  362  KETLRLHSPTPLLLPRESTQLTNIGGYDIPKKTKVMVNVWAMARDPYYWNDAEMFIPERF  421

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            + + +D+ + + F+Y+PFG+G+R+CPG+SFG+A +  PLA LLYHFDW+LP+ + P  L 
Sbjct  422  DANSIDY-KGNHFEYLPFGAGRRICPGMSFGIAGIMLPLALLLYHFDWKLPNQMKPQDLD  480

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   +A+G K D+  I
Sbjct  481  MTEHYGLAIGRKTDLCLI  498



>ref|XP_004491658.1| PREDICTED: uncharacterized protein LOC101503808 [Cicer arietinum]
Length=1010

 Score =   214 bits (544),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/198 (52%), Positives = 140/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760   DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
             DMF    DTS+   +  M EMVKNP+V+ +AQAE+R+VF  KG V+E+ + +L YL  VI
Sbjct  808   DMFFAGSDTSSGTVLWVMSEMVKNPKVMEQAQAEIRKVFDKKGCVDETELHQLIYLKFVI  867

Query  586   KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
             KET+RLHPP P++  RE+ +   + GY IP +TRV INAWAI RDP++W + ESFKPERF
Sbjct  868   KETLRLHPPAPLLVPRESREKCQINGYDIPAKTRVTINAWAIGRDPKFWVEAESFKPERF  927

Query  409   EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
              ++P+DF + + F Y+PFG+G+RMCPGI+F L +V   L  LLYHFDW+LP+G+    L 
Sbjct  928   INNPIDF-KGTDFDYIPFGAGRRMCPGIAFALPNVELTLVQLLYHFDWKLPNGMNNEELD  986

Query  229   LTELPRMAMGVKNDIFFI  176
             +TE   +  G K+D+  I
Sbjct  987   MTESFGITAGRKHDLCLI  1004


 Score =   205 bits (521),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 137/198 (69%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMFG   +T+ T  +  M E++KNP+V+ +AQ EVR VF G+  V+E+ + KL YL  VI
Sbjct  300  DMFGAGGETTATTVLWGMSEIIKNPKVMEEAQIEVRNVFDGQGYVDETELHKLIYLKSVI  359

Query  586  KETMRLHPPGPV-IYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLH P P+ + RE+ +   + GY IP +TRV++NAWAI RD +YW   ESF+P+RF
Sbjct  360  KETLRLHTPAPLLVTRESRERCQINGYDIPAKTRVIVNAWAIGRDSKYWVKAESFEPKRF  419

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             +  +DF   + F+Y+PFG+G+R+CPGI+F L ++  PLA LLYHFDW+LP GI    L 
Sbjct  420  LNSLIDFN-GTNFEYIPFGAGRRICPGITFALPNIELPLAQLLYHFDWKLPCGIKNEELD  478

Query  229  LTELPRMAMGVKNDIFFI  176
            + EL  + +G KND+  I
Sbjct  479  MIELFGITVGRKNDLCLI  496



>ref|XP_004228510.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=504

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 147/198 (74%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +T++T    AMVEM+KN  +L KAQ EVREVF+G+   +E++V++L YL LV+
Sbjct  299  DMFAAGTETTSTTIDWAMVEMIKNSSILVKAQKEVREVFRGKDTFDENDVEELKYLKLVV  358

Query  586  KETMRLHPPGPVIYRENNKDSV-VCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++     ++ V + GYTIP +T++++N WAI RDP+YW+D ESFKPERF
Sbjct  359  KETLRLHPPLPLMLPRECREEVDIDGYTIPSKTKLIVNVWAIGRDPKYWDDAESFKPERF  418

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +DF   + F+++PFGSG+R+CPGISFGLA+VY PLA+LLYHFDW+LP GI P  L 
Sbjct  419  EQSSLDFV-GNNFEFLPFGSGRRICPGISFGLANVYLPLANLLYHFDWKLPPGIKPSDLD  477

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE    +   K++++ I
Sbjct  478  MTESDGASCTRKSNLYLI  495



>gb|EMS48703.1| Premnaspirodiene oxygenase [Triticum urartu]
Length=507

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/197 (52%), Positives = 134/197 (68%), Gaps = 4/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+FG   +TS T    AM E+++ P V+ KAQAEVR   +G+  V E ++  L YL LVI
Sbjct  303  DLFGAGSETSATTLQWAMSELMRYPNVMRKAQAEVRNNLQGKHKVTEDDLANLKYLRLVI  362

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KETMRLHP  P++  RE  +   + GY IP  T VL+NAWAI RDP+YWEDPE FKPERF
Sbjct  363  KETMRLHPAAPLLLPREAMEPCKILGYDIPKGTTVLVNAWAIGRDPKYWEDPEEFKPERF  422

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +DF + + F+Y+PFG+G+RMCPG++F  AS+   LA LLYHFDWELP G+ P  L 
Sbjct  423  ESGMVDF-KGTNFEYIPFGAGRRMCPGMTFAQASMEIVLASLLYHFDWELPSGVKPDGLD  481

Query  229  LTELPRMAMGVKNDIFF  179
            +TE   + +  KND++ 
Sbjct  482  MTEEMGLTVRRKNDLYL  498



>ref|XP_007022417.1| Cytochrome P450 71D10, putative [Theobroma cacao]
 gb|EOY13942.1| Cytochrome P450 71D10, putative [Theobroma cacao]
Length=509

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 140/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+     +TS+T    A+ EM+KNP+V+ +AQAEVR+VF  KG V+E+ + +L +L L++
Sbjct  303  DILAAGSETSSTTMEWALSEMLKNPKVMKQAQAEVRQVFDRKGNVDEAGIHELKFLRLIV  362

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHP  P++  RE ++  V+ GY I  +T+V++NAWAI RD +YW+D E F P+RF
Sbjct  363  KETLRLHPAAPLLVPRECDEKCVISGYDILAKTKVIVNAWAIGRDSRYWKDAEKFNPDRF  422

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D  +DF R + F+Y+PFG+G+R+CPGISF L ++  PLA LLYHFDW LP+G     L 
Sbjct  423  LDGSIDF-RGTNFEYIPFGAGRRICPGISFALPNIELPLAQLLYHFDWMLPNGSKCEDLD  481

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   +++  KND+F I
Sbjct  482  MTECFGLSVRRKNDLFLI  499



>gb|KCW62218.1| hypothetical protein EUGRSUZ_H04879 [Eucalyptus grandis]
Length=472

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 130/182 (71%), Gaps = 3/182 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            ++F    DTS+T    A  EM++NPRV+ KAQAEVR V KG+  V E ++  L YL LV+
Sbjct  262  EIFSAGSDTSSTTIEWAFSEMLRNPRVMEKAQAEVRAVLKGKTQVREQDIQGLEYLKLVV  321

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+R+H PGP++ RE+ +   + GY IP +T+++IN +A+ RDP++W DPESF PERF 
Sbjct  322  KETLRMHTPGPLMARESREACTINGYEIPKKTKIVINTYAVGRDPEFWSDPESFVPERFL  381

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            +  +DF R S F+Y+PFG G+R+CPGI+FG+A++  PLA LLYHFDW L  G+    L +
Sbjct  382  NSSVDF-RGSSFEYIPFGGGRRICPGINFGIANIELPLALLLYHFDWSLADGVKAQDLDM  440

Query  226  TE  221
            +E
Sbjct  441  SE  442



>gb|AGO03790.1| costunolide [Tanacetum cinerariifolium]
Length=496

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/197 (49%), Positives = 139/197 (71%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR-VEESNVDKLAYLNLVIK  584
            DM     DTS+T    AM E+++NP ++ +AQ EVR V KG  V E+++  L YL L++K
Sbjct  292  DMLTAGTDTSSTTLEWAMTELMRNPDMMKRAQEEVRSVVKGEHVTETDLQSLHYLKLIVK  351

Query  583  ETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            ETMRLH P P++  RE  +D  V GY IP +T+VL+NAWA   DP  WE+PESF PERF+
Sbjct  352  ETMRLHAPTPLLVPRECRQDCNVDGYDIPAKTKVLVNAWACGVDPGSWENPESFIPERFK  411

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            + P++F   + F+Y+PFG+G+R+CPG++FGL+ V  PLAH LYHFDW+LP+G+ PH L +
Sbjct  412  NCPINFM-GADFQYIPFGAGRRICPGLTFGLSMVEYPLAHFLYHFDWKLPNGMKPHELDI  470

Query  226  TELPRMAMGVKNDIFFI  176
            TE+  ++  +K+ +  +
Sbjct  471  TEITTISTSLKHHLKIV  487



>ref|XP_004242036.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=503

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 141/198 (71%), Gaps = 5/198 (3%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRVE--ESNVDKLAYLNLVI  587
            D+F    +TS+   + A+ E++KNP V+AKAQ+EVR+V KG+    E +++KL YL LVI
Sbjct  296  DIFIAGTETSSATIIWALSELMKNPNVMAKAQSEVRQVLKGKKNYGEEDIEKLTYLKLVI  355

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWE-DPESFKPER  413
            KET+RLH P P+I  RE  + + + GYTIP   RVL+NAWA++RDP+ W+ +PESF PER
Sbjct  356  KETLRLHTPVPLIGPRECREKTNIDGYTIPHNARVLVNAWALARDPKNWDKNPESFIPER  415

Query  412  FEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTL  233
            FE+  +DF   + F+++PFG+G+R+CPGI FGLA+V  PLA LLYHF+WELP+G+ P  L
Sbjct  416  FENSSIDFM-GNHFEFIPFGAGRRICPGIQFGLANVALPLAQLLYHFEWELPYGVNPKDL  474

Query  232  KLTELPRMAMGVKNDIFF  179
             ++E   +      D++ 
Sbjct  475  DMSETHGLTASKAKDLYL  492



>emb|CDP18841.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   208 bits (529),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 145/200 (73%), Gaps = 4/200 (2%)
 Frame = -2

Query  766  M*DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNL  593
            M DMF G  +TS T+   AM EM++NP V++KAQ E+R+ F G+  +EE +++ L YL L
Sbjct  302  MFDMFTGGTETSATLVEWAMSEMIRNPNVMSKAQNEIRKAFLGKEKIEEMDIEGLRYLKL  361

Query  592  VIKETMRLHPPGPVIYR-ENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPE  416
            VIKET+RLHPP P++   E  K   + GY IP +TRV +NAWAI RDP+YW+DPESFKPE
Sbjct  362  VIKETLRLHPPLPLLVPMECRKQCEIDGYIIPSKTRVFVNAWAIQRDPKYWDDPESFKPE  421

Query  415  RFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHT  236
            RF ++P+DFT  +QF+Y+PFG G+R+CPGISFGLA+V  PLA LLY+FDW+LP GI  + 
Sbjct  422  RFHNNPVDFT-GTQFEYLPFGGGRRICPGISFGLANVEFPLAQLLYNFDWKLPGGINSNG  480

Query  235  LKLTELPRMAMGVKNDIFFI  176
            L +TE   +    KN +  +
Sbjct  481  LDMTETCGITAPRKNKLCLV  500



>dbj|BAJ90648.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86893.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91717.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=508

 Score =   208 bits (529),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 134/197 (68%), Gaps = 4/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+FG   +TS T    AM E+++ P V+ KAQAEVR   +G+  V E ++  L YL LVI
Sbjct  304  DLFGAGSETSATTLQWAMSELMRYPNVMLKAQAEVRNNLQGKSKVTEDDLANLKYLRLVI  363

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KETMRLHP  P++  RE  +   + GY IP  T VL+NAWAI RDP+YW+DPE FKPERF
Sbjct  364  KETMRLHPAAPLLLPREAMEACKILGYDIPEGTTVLVNAWAIGRDPKYWQDPEEFKPERF  423

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E   +DF + + F+Y+PFG+G+RMCPG++F  AS+   LA LLYHFDWELP G+ P  L 
Sbjct  424  ESGMVDF-KGTNFEYIPFGAGRRMCPGMTFAQASMEIVLASLLYHFDWELPSGVKPDGLD  482

Query  229  LTELPRMAMGVKNDIFF  179
            +TE   + +  KND++ 
Sbjct  483  MTEEMGLTVRRKNDLYL  499



>gb|KJB61438.1| hypothetical protein B456_009G358400 [Gossypium raimondii]
Length=508

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 140/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+F    +TS      A+ EM+KNPRV+ KAQAEVR+VF  KG V+E+ + +L YL  VI
Sbjct  301  DIFSAGSETSAGAVEWALSEMIKNPRVMTKAQAEVRQVFQGKGNVDETGIHQLKYLKCVI  360

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHP  P++  RE+ K+ VV G+ IP +TRV++NAWAI RDP +W +PE F+PERF
Sbjct  361  KETLRLHPVIPLLIPRESMKNCVVNGFEIPAKTRVIVNAWAIGRDPNHWVEPEKFEPERF  420

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             +  +DF   + F+++PFG+G+R+CPGI F L +V  PLA LL+HFDW+LP G+    + 
Sbjct  421  VNSSVDFI-GTNFEFIPFGAGRRVCPGILFALPTVELPLAQLLFHFDWKLPRGMKQEDID  479

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE+  +++  KND+  +
Sbjct  480  MTEVFGVSVRRKNDLVLV  497



>ref|XP_006355212.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=504

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 140/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    +TS T  + A+ EM+K+  V+AKAQAEVR+VFK +  ++E+++DKL YL  VI
Sbjct  300  DLFIAGTETSYTAIIWALSEMMKHQNVMAKAQAEVRQVFKEKENLDENDLDKLPYLKSVI  359

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+R+HPP P++  RE  + + + GYT+P   RV++NAWAI RDP+ WEDPESFKPERF
Sbjct  360  KETLRMHPPVPLLGPRECREQTEIDGYTVPLNARVMVNAWAIGRDPESWEDPESFKPERF  419

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E+  +D T  + ++++PFGSG+RMCPG+SFGL +   PLA  LY FDW+LP  +  +   
Sbjct  420  ENISVDLT-GNHYQFIPFGSGRRMCPGMSFGLVNTGHPLAQFLYQFDWKLPDKVNANDFS  478

Query  229  LTELPRMAMGVKNDIFFI  176
             TE  R+    K+D++ I
Sbjct  479  TTETSRVFAASKDDLYLI  496



>gb|EMT16961.1| Cytochrome P450 71D7 [Aegilops tauschii]
Length=446

 Score =   206 bits (524),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/197 (51%), Positives = 135/197 (69%), Gaps = 4/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+FG   +TS T    AM E+++ P V+ KAQAEVR+  +G+  V E ++  L YL LVI
Sbjct  242  DLFGAGSETSATTLQWAMSELMRYPNVMRKAQAEVRKNLQGKHKVTEDDLANLKYLRLVI  301

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KETMRLHP  P++  RE  +   + GY IP  T VL+NAWAI RDP++WEDPE FKPERF
Sbjct  302  KETMRLHPAAPLLLPREAMEPCKILGYDIPKGTTVLVNAWAIGRDPKHWEDPEEFKPERF  361

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            +   +DF + + F+Y+PFG+G+RMCPG++F  AS+   LA LLYHFDWELP G+ P  L 
Sbjct  362  KSGMVDF-KGTNFEYIPFGAGRRMCPGMTFAQASMEIVLASLLYHFDWELPSGVKPDGLD  420

Query  229  LTELPRMAMGVKNDIFF  179
            +TE   + +  KND++ 
Sbjct  421  MTEEMGLTVRRKNDLYL  437



>ref|XP_003617704.1| Cytochrome P450 [Medicago truncatula]
 gb|AET00663.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=502

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 141/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            DMF    +TS+ + + AM EMVKNP+V+ +AQ EV  VF  K  V+E+ + +L YL  VI
Sbjct  300  DMFLAGTETSSQVLLWAMSEMVKNPKVMEEAQDEVSRVFDKKEYVDETELHQLIYLKSVI  359

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHP  P++  RE+ +   + GY IP +TRV++NAWAI RD +YW + ESFKPERF
Sbjct  360  KETLRLHPVAPLLVPRESRERCQINGYEIPAKTRVMVNAWAIGRDSRYWVEAESFKPERF  419

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             + P+DF + + F+++PFG+G+RMCPGISF + +V  PLA LLYHFDW+LP+G++   L 
Sbjct  420  VNSPIDF-KGTDFEFIPFGAGRRMCPGISFAIPNVELPLAKLLYHFDWKLPNGMSHQELD  478

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   + +G K+D+  I
Sbjct  479  MTEFFGITVGRKHDLCLI  496



>gb|KDO62257.1| hypothetical protein CISIN_1g038414mg [Citrus sinensis]
Length=475

 Score =   207 bits (526),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 144/198 (73%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+F    +TS T    AM EM+KNP+++ KAQ EVREVF  KG+V+ES ++++ +L LVI
Sbjct  262  DIFTAGSETSATTIDWAMCEMMKNPKLMKKAQMEVREVFNRKGKVDESGIEEMKFLKLVI  321

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            +ET+RLHPP P++  RE  +   + G+ IP +  +++NAWAI RDP+YW +PESF PERF
Sbjct  322  RETLRLHPPVPMLLPRECWEKCEINGFEIPTKATLIVNAWAIGRDPEYWTEPESFIPERF  381

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D  +D+ + + F+Y+PFG+G+R+CPGI+FG+A+V  PLA LLYHFDW+LP+G  P  + 
Sbjct  382  LDSFIDY-KGTNFEYIPFGAGRRICPGITFGMANVELPLAMLLYHFDWKLPNGKKPEDMN  440

Query  229  LTELPRMAMGVKNDIFFI  176
            ++E   +A+  K+D+  I
Sbjct  441  MSEAFGVAVRRKDDLCMI  458



>ref|XP_004242219.2| PREDICTED: cytochrome P450 71D7-like [Solanum lycopersicum]
Length=504

 Score =   207 bits (527),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 143/198 (72%), Gaps = 5/198 (3%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRVE--ESNVDKLAYLNLVI  587
            DMF    +TS+T  + A+ E++K+P V+AKAQ+EVR+ FK +++  E ++D L YL LVI
Sbjct  298  DMFTAGTETSSTAIIWALSELMKHPNVMAKAQSEVRQAFKEKIDFDEEDLDNLPYLKLVI  357

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RLH P  +++RE  +++ V GYTIP +  VL+N WA+ RDP+ W+DPESF PERFE
Sbjct  358  KETLRLHAPS-IVHRECREETTVDGYTIPAKATVLVNTWAMGRDPEVWDDPESFIPERFE  416

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGI-TPHTLK  230
            + P+D+   + ++++PFG+GKR+CPG+ FG+A+V  PLA LLYHF+W LP+G   P  L 
Sbjct  417  NSPIDYL-GNNYEFLPFGAGKRICPGMQFGIANVKQPLARLLYHFNWGLPYGTNNPKHLD  475

Query  229  LTELPRMAMGVKNDIFFI  176
            ++E   ++   + D++ I
Sbjct  476  MSEKSGLSAAKEKDLYLI  493



>ref|XP_004516743.1| PREDICTED: cytochrome P450 71D10-like [Cicer arietinum]
Length=502

 Score =   207 bits (527),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 142/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+F    +TS++  +  M EMVKNP+V+ +AQAEVR V+  KG V+E+ +++L YL  VI
Sbjct  300  DLFVAGSETSSSTVLWGMFEMVKNPKVMEEAQAEVRRVYGSKGYVDETELNQLIYLKSVI  359

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHPP P++  RE+ +   + GY IP +T V +N WAI RDP+YW + E FKPERF
Sbjct  360  KETLRLHPPVPLLIPRESREKCQINGYVIPAKTIVAVNVWAIGRDPRYWVEAECFKPERF  419

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            ++ P+DF R + F+++PFG+G+R+CPGI F + ++  PLA LLYHFDW+LP+G+    L 
Sbjct  420  DNSPVDF-RGTDFEFLPFGAGRRVCPGIIFAIPNIELPLAQLLYHFDWKLPNGLKNEELD  478

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   +++G K+D+  I
Sbjct  479  MTEQFGISVGRKHDLCLI  496



>ref|XP_011097779.1| PREDICTED: cytochrome P450 71D11-like [Sesamum indicum]
Length=510

 Score =   207 bits (527),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 138/184 (75%), Gaps = 5/184 (3%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            DMF    +TS++    AM EM+K+PR+L KAQ EVR+VF  KG ++E  + +L YL  VI
Sbjct  303  DMFSAGSETSSSTIDWAMAEMLKHPRILKKAQDEVRQVFDKKGYIDEVYIHELKYLKCVI  362

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KE++R+HPP P++  RE ++   + GY IP +TRV++NAWA+ RDP+YW++ ESFKPER+
Sbjct  363  KESLRMHPPIPLLLPRECHEQCEIDGYEIPAKTRVMVNAWALGRDPKYWKEAESFKPERY  422

Query  409  ED-DPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTL  233
             D D +D+ + + F+Y+PFG+G+RMCPGISFGLA+V  PLA LLYHFDW LP G+ P  +
Sbjct  423  LDIDSVDY-KGNNFEYIPFGAGRRMCPGISFGLANVELPLAMLLYHFDWLLPGGMKPEKV  481

Query  232  KLTE  221
            ++TE
Sbjct  482  EMTE  485



>gb|AJD25166.1| cytochrome P450 CYP71D413 [Salvia miltiorrhiza]
Length=511

 Score =   207 bits (527),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 140/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    ++S+T    AM E+++NPRV+AKA+ E+R+ F+GR  ++ES +  L YL +VI
Sbjct  301  DMFAAGTESSSTTVDWAMAELMRNPRVMAKARDEIRQAFRGRETIKESEIRTLKYLKMVI  360

Query  586  KETMRLHPPGPVIYRENNKDSV-VCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
             ET+RLHPP  +I R   ++ + + GY IP    V++N W+I RDP+YW D ESF+PERF
Sbjct  361  NETLRLHPPVSIIPRACREEELEIDGYHIPLNANVIVNIWSIGRDPKYWHDAESFEPERF  420

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            E++P+DF   S F+Y+PFGSGKR+CPG++FG+A+V   LA LLYHFDWELP G++   L 
Sbjct  421  EENPIDFL-GSHFEYIPFGSGKRICPGMAFGVANVEFVLAQLLYHFDWELPLGVSRDDLD  479

Query  229  LTELPRMAMGVKNDIFFI  176
            + E   +A+  K+++  I
Sbjct  480  MAEAAGIAVSRKSNLRLI  497



>gb|KHG11859.1| Cytochrome P450 [Gossypium arboreum]
Length=511

 Score =   207 bits (527),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/197 (49%), Positives = 139/197 (71%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            DMF    +TS+     AM +++KNP ++ KA AEVR+VF G   V+E+   +L +L LVI
Sbjct  306  DMFAAGSETSSISVEWAMSQLLKNPSLMEKATAEVRQVFNGNGYVDEAQFGELKFLKLVI  365

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RLH P P+I RE  ++  + GY IP  T+VLIN+WAI+RD +YW +PESF PERF 
Sbjct  366  KETLRLHNPVPLIPRECRENCKLGGYDIPANTKVLINSWAIARDSRYWSEPESFNPERFL  425

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            D  +D+ + + F+Y+PFG+G+R+CPGI+FGLA+V   LA L+YHFDW+LP+G+    L +
Sbjct  426  DSSLDY-KGTDFQYIPFGAGRRICPGITFGLANVEQQLAQLVYHFDWKLPNGMKCEDLDM  484

Query  226  TELPRMAMGVKNDIFFI  176
            T  P + +  K+D+F I
Sbjct  485  TSGPGLTIRRKHDLFVI  501



>ref|XP_012077832.1| PREDICTED: cytochrome P450 71D10-like [Jatropha curcas]
 gb|KDP33178.1| hypothetical protein JCGZ_13443 [Jatropha curcas]
Length=331

 Score =   202 bits (515),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 133/197 (68%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+  G  DTS    V  M E+ KNP V+ + Q EVR+VF  KG V+E ++ +L YL  V+
Sbjct  126  DVLSGGSDTSANTVVWVMSELQKNPDVMKRVQTEVRQVFSEKGYVDEESIGELHYLKAVV  185

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KETMRL PPG ++ RE   D V+ GY IP ++RV+INAWA+ RDP YW + E F P+RF 
Sbjct  186  KETMRLRPPGTILTRECMADCVINGYDIPHKSRVIINAWALGRDPDYWPEAERFNPDRFL  245

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            +  +DF + + F+++PFG+G+R+CPGI FG+++V  PLA LLYHFDW+LP+G+ P  L +
Sbjct  246  NSSIDF-KGNHFEFLPFGAGRRVCPGILFGISNVQFPLARLLYHFDWKLPNGMQPEDLDM  304

Query  226  TELPRMAMGVKNDIFFI  176
                 +A+   ND+  I
Sbjct  305  NAKYGIAVTRVNDLQLI  321



>ref|XP_003617701.1| Cytochrome P450 [Medicago truncatula]
 gb|AET00660.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=533

 Score =   207 bits (528),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 139/198 (70%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            DMFG   +TS+   + AM  MVKN  V+ +AQAEVR VF  KG V+E+ + +L YL  VI
Sbjct  331  DMFGAGTETSSEAVIWAMSAMVKNSNVMEQAQAEVRRVFDKKGYVDETELYQLIYLKSVI  390

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RL+P  P++  RE+ +   + GY IP +TRV +NAWAI RDP+YW + ESFKPERF
Sbjct  391  KETLRLYPVAPLLVPRESRERCQINGYEIPAKTRVAVNAWAIGRDPRYWVEAESFKPERF  450

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             + P+DF + + F+++PFG+G+RMCPGI+F L +V  PLA LLYHFDW+LP+G+    L 
Sbjct  451  VNSPIDF-KGTDFEFIPFGAGRRMCPGIAFALPNVELPLAKLLYHFDWKLPNGMKNEELD  509

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   +  G K+D+  I
Sbjct  510  MTESFGITAGRKHDLCLI  527



>gb|AIS36973.1| (-)-limonene 3 hydroxylase PM17 isoform-like cytochrome p450-dependent 
oxygenase, partial [Mentha aquatica]
Length=227

 Score =   199 bits (506),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 134/197 (68%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRV--EESNVDKLAYLNLVI  587
            D F    +TS+T T+  M E+++NP V+AKAQAEVR   KG+   +  +V +L Y+  V+
Sbjct  24   DTFSAGTETSSTTTLWVMAELMRNPAVMAKAQAEVRAALKGKTNWDVDDVQELKYMKSVV  83

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KETMR+HPP P+I R   ++  V GYTIP + R++IN W++ R+P YWE PE+F+PERF+
Sbjct  84   KETMRMHPPIPLIPRSCREECKVNGYTIPNKARIMINVWSMGRNPLYWEKPETFRPERFD  143

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
                DF   + F+++PFG+G+R+CPG++FGLA+V  PL  LLYHFDW+L  G+ P  + +
Sbjct  144  QVSRDFM-GNDFEFIPFGAGRRICPGLNFGLANVEVPLTQLLYHFDWKLAEGMKPSDMDM  202

Query  226  TELPRMAMGVKNDIFFI  176
            +E   +    KN++  +
Sbjct  203  SEAEGLTGIRKNNLLLV  219



>ref|XP_003589691.1| Cytochrome P450 [Medicago truncatula]
 gb|AES59942.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=505

 Score =   207 bits (526),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 139/197 (71%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+ G   +TS+T  V AM E+V++PRV+ KAQ EVR++F  KG V E+ +++L YL LV+
Sbjct  301  DIIGAGGETSSTTIVWAMAELVRDPRVMKKAQYEVRKIFNKKGTVGENYINELEYLKLVV  360

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RLHPP P++ RE  +   + GY IP +++V++NAW I RDP+YW +PE F PERF 
Sbjct  361  KETLRLHPPTPLLLRECGQACEIEGYHIPAKSKVIVNAWTIGRDPKYWTEPERFHPERFI  420

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
               +D+ + + F+Y+PFG+G+R+CPGI+FGL +V   LA LLYHFDW LP+G+    L +
Sbjct  421  GSSIDY-KGNNFEYIPFGAGRRICPGITFGLINVELALALLLYHFDWRLPNGMKGEDLDM  479

Query  226  TELPRMAMGVKNDIFFI  176
            TE     +  K+D++ I
Sbjct  480  TEQFGANVKRKSDLYLI  496



>emb|CBI39704.3| unnamed protein product [Vitis vinifera]
Length=275

 Score =   201 bits (510),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 137/198 (69%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F G  +TS+T  V AM EM+K+P V+ KAQAEVR VF G+  + E+ + +L YLN V+
Sbjct  69   DIFSGGGETSSTAVVWAMAEMLKSPIVMEKAQAEVRRVFDGKRDINETGIHELKYLNSVV  128

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHP  P++  RE  +  V+ GY IP  T+V+INAWAI++DP +W +P  F PERF
Sbjct  129  KETLRLHPSVPLLLPRECRERCVINGYEIPENTKVIINAWAIAQDPDHWFEPNKFFPERF  188

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D  +DF + + FKY+PFG+G+RMCPGI F + +V  PLA+LLYHFDW+LP G+    L 
Sbjct  189  LDSSIDF-KGTDFKYIPFGAGRRMCPGILFAIPNVELPLANLLYHFDWKLPDGMKHEDLD  247

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   + +  K D+  I
Sbjct  248  MTEEFGLTIRRKEDLNLI  265



>ref|XP_009345818.1| PREDICTED: cytochrome P450 71D9-like [Pyrus x bretschneideri]
Length=508

 Score =   207 bits (526),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 139/198 (70%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+F    + S T    A+ EM+KNPRV+ KAQ EVREVF  KG+ +E+++ ++ YLN VI
Sbjct  303  DVFSAGSERSATTVDWAISEMMKNPRVMKKAQREVREVFNRKGKADETSIGEMKYLNTVI  362

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHP  P++  RE  +   + GY IP +++V++NAWAI RDP+YW +PE FKPERF
Sbjct  363  KETLRLHPSVPLLLPRECGEKCEIGGYGIPGKSKVIVNAWAIGRDPKYWTEPERFKPERF  422

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D  +D+ + + F+Y+PFG+G+R+CPGI +GLA+V  PLA LLYHFDW+LP G     L 
Sbjct  423  LDSSIDY-KGTNFEYIPFGAGRRICPGILYGLANVELPLALLLYHFDWKLPDGTKHEDLD  481

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE   +A+  K D+  I
Sbjct  482  MTETFGIAVRRKQDLHLI  499



>ref|XP_010104090.1| Cytochrome P450 71D10 [Morus notabilis]
 gb|EXB98291.1| Cytochrome P450 71D10 [Morus notabilis]
Length=509

 Score =   207 bits (526),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 136/197 (69%), Gaps = 3/197 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+F    +T+ T    AM E+VKNP++L KAQAEVREV   KG+V+ES++ KL Y+  ++
Sbjct  305  DIFAAGSETAATTLEWAMSELVKNPKILEKAQAEVREVVGGKGKVKESDIQKLDYMKCIV  364

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+RLHPP P + RE+ K  V+ GY IP ++RV +NAWA+ RDP+ W++ E F+PERF 
Sbjct  365  KETLRLHPPVPFVARESRKRCVILGYEIPSKSRVAVNAWALGRDPEVWDNAECFQPERFI  424

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
               +D  R + F+++PFG+G+RMCPGI+   A+V   LA +LYHFDW LPHG     L +
Sbjct  425  GSSIDL-RGTNFEFLPFGAGRRMCPGITLAFANVELILAQMLYHFDWGLPHGAKGEELDM  483

Query  226  TELPRMAMGVKNDIFFI  176
            +++  +    ++D++ +
Sbjct  484  SDVYGITCRRRDDLYLV  500



>ref|XP_006421138.1| hypothetical protein CICLE_v10004785mg [Citrus clementina]
 gb|ESR34378.1| hypothetical protein CICLE_v10004785mg [Citrus clementina]
Length=509

 Score =   207 bits (526),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 138/198 (70%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK--GRVEESNVDKLAYLNLVI  587
            D+F    +TS T    AM EM++NPRV+ KAQAEVREVF   G+V E+++D++ +  L +
Sbjct  303  DIFAAGSETSATTVDWAMCEMMRNPRVMKKAQAEVREVFHRTGKVNETSIDEMKFFKLFV  362

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLHP  P++  RE  +   + G+ IP +T+V +NAWAI RDP+YW +P SF PERF
Sbjct  363  KETLRLHPVAPLLLPRECGERCQINGFDIPVKTKVFVNAWAIGRDPKYWTEPASFIPERF  422

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
             D  +D+ + + F+++PFG+G+R+CPGISFGLASV  PLA LLYHFDW+LP+G+    L 
Sbjct  423  LDHSIDY-KGTNFEFIPFGAGRRICPGISFGLASVELPLAMLLYHFDWKLPNGMKHEDLD  481

Query  229  LTELPRMAMGVKNDIFFI  176
            +TE     +  K D+  I
Sbjct  482  MTEAFATTVRRKQDLCMI  499



>ref|XP_003517257.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=506

 Score =   207 bits (526),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 97/198 (49%), Positives = 140/198 (71%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            D+F    DTS +    AM EM++NPRV  KAQAEVR+ F+    + E++V KL YL LVI
Sbjct  304  DVFTAGTDTSASTLEWAMAEMMRNPRVREKAQAEVRQAFRELKIIHETDVGKLTYLKLVI  363

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KET+RLH P P++  RE ++ +++ GY IP +T+V+IN WAI RDPQYW D E F PERF
Sbjct  364  KETLRLHAPSPLLVPRECSELTIIDGYEIPVKTKVMINVWAIGRDPQYWTDAERFVPERF  423

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
            +   +DF + + F+Y+PFG+G+RMCPG++FGLA++  PLA LLYHF+WELP+ + P  + 
Sbjct  424  DGSSIDF-KGNNFEYLPFGAGRRMCPGMTFGLANIMLPLALLLYHFNWELPNEMKPEDMD  482

Query  229  LTELPRMAMGVKNDIFFI  176
            ++E   + +  K+++  I
Sbjct  483  MSENFGLTVTRKSELCLI  500



>ref|XP_010027348.1| PREDICTED: cytochrome P450 CYP71D312-like [Eucalyptus grandis]
Length=521

 Score =   207 bits (527),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 130/182 (71%), Gaps = 3/182 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVI  587
            ++F    DTS+T    A  EM++NPRV+ KAQAEVR V KG+  V E ++  L YL LV+
Sbjct  311  EIFSAGSDTSSTTIEWAFSEMLRNPRVMEKAQAEVRAVLKGKTQVREQDIQGLEYLKLVV  370

Query  586  KETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFE  407
            KET+R+H PGP++ RE+ +   + GY IP +T+++IN +A+ RDP++W DPESF PERF 
Sbjct  371  KETLRMHTPGPLMARESREACTINGYEIPKKTKIVINTYAVGRDPEFWSDPESFVPERFL  430

Query  406  DDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKL  227
            +  +DF R S F+Y+PFG G+R+CPGI+FG+A++  PLA LLYHFDW L  G+    L +
Sbjct  431  NSSVDF-RGSSFEYIPFGGGRRICPGINFGIANIELPLALLLYHFDWSLADGVKAQDLDM  489

Query  226  TE  221
            +E
Sbjct  490  SE  491



>ref|XP_007146291.1| hypothetical protein PHAVU_006G028100g [Phaseolus vulgaris]
 gb|ESW18285.1| hypothetical protein PHAVU_006G028100g [Phaseolus vulgaris]
Length=507

 Score =   207 bits (526),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/198 (48%), Positives = 138/198 (70%), Gaps = 4/198 (2%)
 Frame = -2

Query  760  DMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--KGRVEESNVDKLAYLNLVI  587
            D+F    DTS T+   AM EMVK+PR++ KAQ+EVRE F  KGRV+E+++++L YL LV+
Sbjct  301  DIFAAGGDTSATVIDWAMAEMVKDPRIMKKAQSEVREAFSGKGRVDENSINELKYLKLVV  360

Query  586  KETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERF  410
            KETMRLHPP  ++  RE  +   + GY IP +++V+INAW I RDP YW +PE F PERF
Sbjct  361  KETMRLHPPASLLLPRECGQACEIHGYHIPAKSKVIINAWTIGRDPNYWTEPERFYPERF  420

Query  409  EDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLK  230
                +D+ + + F+++PFG+G+R+CPG +F L ++   LA LLYHFDW+LP G+    L 
Sbjct  421  TASTIDY-KGTNFEFIPFGAGRRICPGSTFALRTIELALAMLLYHFDWKLPSGMRSEELN  479

Query  229  LTELPRMAMGVKNDIFFI  176
            ++E+  + M  K D+F +
Sbjct  480  MSEVFGVTMKRKYDLFLV  497



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1812563152356