BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13886

Length=1145
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU32139.1|  hypothetical protein MIMGU_mgv1a011795mg                322   7e-105   Erythranthe guttata [common monkey flower]
gb|KJB22336.1|  hypothetical protein B456_004G042000                    320   7e-105   Gossypium raimondii
gb|KJB22334.1|  hypothetical protein B456_004G042000                    320   4e-104   Gossypium raimondii
gb|EYU32140.1|  hypothetical protein MIMGU_mgv1a011795mg                320   4e-104   Erythranthe guttata [common monkey flower]
gb|KHG18490.1|  Ribosomal RNA small subunit methyltransferase G         320   4e-104   Gossypium arboreum [tree cotton]
gb|KJB22339.1|  hypothetical protein B456_004G042000                    319   6e-104   Gossypium raimondii
ref|XP_009768013.1|  PREDICTED: uncharacterized protein LOC104219077    319   1e-103   Nicotiana sylvestris
ref|XP_007051771.1|  Uncharacterized protein TCM_005310                 319   1e-103   Theobroma cacao [chocolate]
ref|XP_009622825.1|  PREDICTED: uncharacterized protein LOC104114152    314   1e-101   Nicotiana tomentosiformis
ref|XP_010326971.1|  PREDICTED: uncharacterized protein LOC101253...    313   1e-101   Solanum lycopersicum
gb|EYU32143.1|  hypothetical protein MIMGU_mgv1a011872mg                313   1e-101   Erythranthe guttata [common monkey flower]
ref|XP_004248047.1|  PREDICTED: uncharacterized protein LOC101253...    313   3e-101   Solanum lycopersicum
gb|KDO86223.1|  hypothetical protein CISIN_1g024415mg                   310   1e-100   Citrus sinensis [apfelsine]
ref|XP_006445009.1|  hypothetical protein CICLE_v10021690mg             310   4e-100   Citrus clementina [clementine]
ref|XP_002511878.1|  conserved hypothetical protein                     310   4e-100   Ricinus communis
ref|XP_006364150.1|  PREDICTED: uncharacterized protein LOC102604822    310   4e-100   Solanum tuberosum [potatoes]
ref|XP_011036565.1|  PREDICTED: uncharacterized protein LOC105134...    306   3e-99    Populus euphratica
emb|CDP08796.1|  unnamed protein product                                307   6e-99    Coffea canephora [robusta coffee]
ref|XP_011036556.1|  PREDICTED: uncharacterized protein LOC105134...    306   8e-99    Populus euphratica
ref|XP_010523762.1|  PREDICTED: uncharacterized protein LOC104802037    305   3e-98    Tarenaya hassleriana [spider flower]
ref|XP_002320140.1|  hypothetical protein POPTR_0014s08190g             305   3e-98    Populus trichocarpa [western balsam poplar]
ref|XP_012083365.1|  PREDICTED: uncharacterized protein LOC105642...    305   3e-98    Jatropha curcas
ref|XP_006601835.1|  PREDICTED: uncharacterized protein LOC100810...    303   4e-98    Glycine max [soybeans]
ref|XP_004138497.1|  PREDICTED: uncharacterized protein LOC101221288    305   4e-98    Cucumis sativus [cucumbers]
ref|NP_001239728.1|  uncharacterized protein LOC100810003               303   2e-97    Glycine max [soybeans]
ref|XP_008458208.1|  PREDICTED: uncharacterized protein LOC103497707    303   2e-97    Cucumis melo [Oriental melon]
ref|XP_008244645.1|  PREDICTED: uncharacterized protein LOC103342...    303   2e-97    Prunus mume [ume]
ref|XP_008244646.1|  PREDICTED: uncharacterized protein LOC103342...    302   3e-97    
ref|XP_010670120.1|  PREDICTED: uncharacterized protein LOC104887219    301   2e-96    Beta vulgaris subsp. vulgaris [field beet]
gb|AFK38203.1|  unknown                                                 300   2e-96    Lotus japonicus
ref|XP_007218810.1|  hypothetical protein PRUPE_ppa009991mg             300   2e-96    Prunus persica
ref|XP_002275801.1|  PREDICTED: uncharacterized protein LOC100260183    300   3e-96    Vitis vinifera
ref|XP_009384561.1|  PREDICTED: uncharacterized protein LOC103972086    300   3e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007139823.1|  hypothetical protein PHAVU_008G061600g             300   4e-96    Phaseolus vulgaris [French bean]
ref|XP_010056396.1|  PREDICTED: uncharacterized protein LOC104444425    298   2e-95    Eucalyptus grandis [rose gum]
ref|XP_004492754.1|  PREDICTED: uncharacterized protein LOC101510...    298   3e-95    Cicer arietinum [garbanzo]
ref|XP_004492755.1|  PREDICTED: uncharacterized protein LOC101510...    297   4e-95    
gb|AFK49194.1|  unknown                                                 295   2e-94    Lotus japonicus
ref|XP_006445011.1|  hypothetical protein CICLE_v10021689mg             293   3e-94    Citrus clementina [clementine]
ref|XP_003623980.1|  hypothetical protein MTR_7g077870                  294   4e-94    Medicago truncatula
gb|KDO86214.1|  hypothetical protein CISIN_1g024003mg                   292   8e-94    Citrus sinensis [apfelsine]
ref|XP_006491134.1|  PREDICTED: uncharacterized protein LOC102608...    293   1e-93    Citrus sinensis [apfelsine]
ref|XP_006445012.1|  hypothetical protein CICLE_v10021689mg             293   1e-93    
ref|XP_002880212.1|  hypothetical protein ARALYDRAFT_904052             293   2e-93    Arabidopsis lyrata subsp. lyrata
gb|KDO86211.1|  hypothetical protein CISIN_1g024003mg                   292   3e-93    Citrus sinensis [apfelsine]
gb|KDO86210.1|  hypothetical protein CISIN_1g024003mg                   292   4e-93    Citrus sinensis [apfelsine]
ref|XP_010508078.1|  PREDICTED: uncharacterized protein LOC104784717    293   4e-93    Camelina sativa [gold-of-pleasure]
ref|XP_004306764.1|  PREDICTED: uncharacterized protein LOC101294106    291   5e-93    Fragaria vesca subsp. vesca
ref|XP_007139822.1|  hypothetical protein PHAVU_008G061500g             291   6e-93    Phaseolus vulgaris [French bean]
ref|XP_009367812.1|  PREDICTED: uncharacterized protein LOC103957377    291   6e-93    Pyrus x bretschneideri [bai li]
ref|XP_010255310.1|  PREDICTED: uncharacterized protein LOC104596...    290   1e-92    Nelumbo nucifera [Indian lotus]
ref|XP_010918743.1|  PREDICTED: uncharacterized protein LOC105043034    291   1e-92    Elaeis guineensis
ref|XP_010518258.1|  PREDICTED: uncharacterized protein LOC104793570    290   2e-92    Camelina sativa [gold-of-pleasure]
ref|NP_566060.1|  uncharacterized protein                               290   3e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006397785.1|  hypothetical protein EUTSA_v10001586mg             290   3e-92    Eutrema salsugineum [saltwater cress]
ref|XP_010255309.1|  PREDICTED: uncharacterized protein LOC104596...    290   3e-92    Nelumbo nucifera [Indian lotus]
gb|KFK37383.1|  hypothetical protein AALP_AA4G250000                    289   4e-92    Arabis alpina [alpine rockcress]
emb|CAN70694.1|  hypothetical protein VITISV_002394                     289   5e-92    Vitis vinifera
ref|XP_003623981.1|  hypothetical protein MTR_7g077880                  288   1e-91    Medicago truncatula
ref|XP_004492759.1|  PREDICTED: uncharacterized protein LOC101511624    288   1e-91    Cicer arietinum [garbanzo]
ref|XP_010508079.1|  PREDICTED: uncharacterized protein LOC104784718    288   2e-91    
ref|XP_011469002.1|  PREDICTED: uncharacterized protein LOC101295560    288   2e-91    Fragaria vesca subsp. vesca
ref|XP_008343405.1|  PREDICTED: uncharacterized protein LOC103406175    289   2e-91    
gb|KHM99365.1|  hypothetical protein glysoja_028822                     288   2e-91    Glycine soja [wild soybean]
gb|KJB22335.1|  hypothetical protein B456_004G042000                    283   2e-91    Gossypium raimondii
ref|XP_008344005.1|  PREDICTED: uncharacterized protein LOC103406759    288   3e-91    
ref|XP_011624852.1|  PREDICTED: uncharacterized protein LOC184228...    286   6e-91    Amborella trichopoda
ref|XP_010255308.1|  PREDICTED: uncharacterized protein LOC104596...    287   8e-91    Nelumbo nucifera [Indian lotus]
emb|CDY18881.1|  BnaC04g04690D                                          285   1e-90    Brassica napus [oilseed rape]
ref|NP_001276321.1|  uncharacterized protein LOC100809469               283   1e-89    Glycine max [soybeans]
ref|XP_008801330.1|  PREDICTED: uncharacterized protein LOC103715476    283   2e-89    
ref|XP_009143199.1|  PREDICTED: uncharacterized protein LOC103866942    283   2e-89    Brassica rapa
emb|CDX74783.1|  BnaA05g05290D                                          281   4e-89    
ref|XP_010506594.1|  PREDICTED: uncharacterized protein LOC104783176    278   7e-88    Camelina sativa [gold-of-pleasure]
gb|ABK26606.1|  unknown                                                 278   1e-87    Picea sitchensis
ref|XP_004492756.1|  PREDICTED: uncharacterized protein LOC101510...    278   1e-87    Cicer arietinum [garbanzo]
gb|EMT00704.1|  hypothetical protein F775_08758                         277   2e-87    
gb|EMS45488.1|  hypothetical protein TRIUR3_03694                       273   1e-86    Triticum urartu
gb|ABR16780.1|  unknown                                                 275   2e-86    Picea sitchensis
gb|KJB22338.1|  hypothetical protein B456_004G042000                    273   3e-86    Gossypium raimondii
ref|XP_003568582.1|  PREDICTED: uncharacterized protein LOC100823061    271   4e-85    Brachypodium distachyon [annual false brome]
gb|KDO86216.1|  hypothetical protein CISIN_1g024415mg                   270   6e-85    Citrus sinensis [apfelsine]
ref|NP_001031546.1|  uncharacterized protein                            270   7e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_012083366.1|  PREDICTED: uncharacterized protein LOC105642...    270   8e-85    Jatropha curcas
gb|EEC76618.1|  hypothetical protein OsI_14495                          268   8e-84    Oryza sativa Indica Group [Indian rice]
ref|NP_001059469.1|  Os07g0418000                                       268   9e-84    
ref|XP_006657631.1|  PREDICTED: uncharacterized protein LOC102713007    265   9e-83    Oryza brachyantha
ref|XP_002989978.1|  hypothetical protein SELMODRAFT_428440             263   5e-82    Selaginella moellendorffii
gb|AAL27556.1|AF420411_1  hypothetical protein                          258   1e-81    Musa acuminata AAA Group [Cavendish banana]
gb|KDO86212.1|  hypothetical protein CISIN_1g024003mg                   262   2e-81    Citrus sinensis [apfelsine]
ref|XP_002968931.1|  hypothetical protein SELMODRAFT_90693              262   2e-81    Selaginella moellendorffii
ref|XP_004306768.1|  PREDICTED: uncharacterized protein LOC101295853    261   4e-81    Fragaria vesca subsp. vesca
dbj|BAJ92002.1|  predicted protein                                      259   8e-81    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFK34805.1|  unknown                                                 257   9e-80    Medicago truncatula
ref|XP_001759804.1|  predicted protein                                  256   5e-79    
ref|XP_004984348.1|  PREDICTED: uncharacterized protein LOC101783107    257   1e-78    Setaria italica
ref|XP_006827564.1|  PREDICTED: uncharacterized protein LOC184228...    253   1e-77    Amborella trichopoda
ref|XP_002461895.1|  hypothetical protein SORBIDRAFT_02g009970          254   2e-77    Sorghum bicolor [broomcorn]
ref|XP_004295150.1|  PREDICTED: uncharacterized protein LOC101305350    250   1e-76    Fragaria vesca subsp. vesca
ref|XP_001771402.1|  predicted protein                                  245   4e-75    
ref|XP_011092616.1|  PREDICTED: uncharacterized protein LOC105172...    242   1e-74    
tpg|DAA39436.1|  TPA: hypothetical protein ZEAMMB73_910853              245   5e-74    
ref|NP_001143648.1|  uncharacterized protein LOC100276370               243   5e-73    Zea mays [maize]
ref|XP_008338880.1|  PREDICTED: uncharacterized protein LOC103401933    239   1e-72    Malus domestica [apple tree]
gb|KJB22340.1|  hypothetical protein B456_004G042000                    235   1e-71    Gossypium raimondii
gb|KHN29347.1|  hypothetical protein glysoja_005071                     234   2e-71    Glycine soja [wild soybean]
gb|EYU32142.1|  hypothetical protein MIMGU_mgv1a011872mg                230   8e-70    Erythranthe guttata [common monkey flower]
gb|KEH23368.1|  hypothetical protein MTR_7g077880                       218   4e-65    Medicago truncatula
gb|ACF83654.1|  unknown                                                 216   7e-65    Zea mays [maize]
gb|AFK48185.1|  unknown                                                 214   2e-63    Lotus japonicus
gb|EPS59432.1|  hypothetical protein M569_15374                         213   2e-63    Genlisea aurea
ref|NP_001031547.1|  uncharacterized protein                            213   4e-63    Arabidopsis thaliana [mouse-ear cress]
gb|KDO86213.1|  hypothetical protein CISIN_1g024003mg                   208   2e-61    Citrus sinensis [apfelsine]
ref|XP_002989896.1|  hypothetical protein SELMODRAFT_130886             208   1e-60    Selaginella moellendorffii
ref|XP_002968647.1|  hypothetical protein SELMODRAFT_91208              204   3e-59    Selaginella moellendorffii
ref|XP_006445007.1|  hypothetical protein CICLE_v10021690mg             194   4e-56    
ref|XP_006445008.1|  hypothetical protein CICLE_v10021690mg             194   8e-56    
ref|XP_006295045.1|  hypothetical protein CARUB_v10024113mg             181   4e-51    
dbj|BAC83355.2|  unknown protein                                        181   4e-50    Oryza sativa Japonica Group [Japonica rice]
gb|KJB22341.1|  hypothetical protein B456_004G042000                    177   1e-49    Gossypium raimondii
ref|XP_005846994.1|  hypothetical protein CHLNCDRAFT_24112              162   6e-43    Chlorella variabilis
gb|KIZ05430.1|  hypothetical protein MNEG_2528                          160   2e-42    Monoraphidium neglectum
ref|XP_011092625.1|  PREDICTED: uncharacterized protein LOC105172...    154   4e-41    
ref|XP_005651981.1|  hypothetical protein COCSUDRAFT_26736              157   6e-41    Coccomyxa subellipsoidea C-169
emb|CBN78330.1|  conserved unknown protein                              156   2e-40    Ectocarpus siliculosus
ref|XP_005706460.1|  hypothetical protein Gasu_27250                    150   2e-38    Galdieria sulphuraria
ref|XP_001698105.1|  hypothetical protein CHLREDRAFT_151387             149   3e-38    Chlamydomonas reinhardtii
ref|XP_005715963.1|  unnamed protein product                            148   6e-38    Chondrus crispus [carageen]
ref|XP_002946102.1|  hypothetical protein VOLCADRAFT_101579             148   8e-38    Volvox carteri f. nagariensis
gb|KDO86218.1|  hypothetical protein CISIN_1g024415mg                   145   1e-37    Citrus sinensis [apfelsine]
ref|XP_006445010.1|  hypothetical protein CICLE_v10021690mg             143   3e-37    
gb|KDD75212.1|  hypothetical protein H632_c807p0                        142   8e-37    Helicosporidium sp. ATCC 50920
gb|KDO86219.1|  hypothetical protein CISIN_1g024415mg                   142   2e-36    Citrus sinensis [apfelsine]
ref|XP_011401855.1|  hypothetical protein F751_6329                     142   8e-36    Auxenochlorella protothecoides
ref|XP_003057547.1|  predicted protein                                  141   4e-35    Micromonas pusilla CCMP1545
ref|XP_010087947.1|  hypothetical protein L484_012399                   135   2e-34    
gb|ACJ84457.1|  unknown                                                 132   4e-33    Medicago truncatula
ref|XP_003082555.1|  unnamed protein product                            135   7e-33    
ref|WP_015131278.1|  hypothetical protein                               132   4e-32    Calothrix sp. PCC 7507
ref|XP_001421063.1|  predicted protein                                  131   2e-31    Ostreococcus lucimarinus CCE9901
ref|XP_010087945.1|  hypothetical protein L484_012397                   125   2e-31    
ref|XP_002501989.1|  predicted protein                                  130   4e-31    Micromonas commoda
ref|WP_027403505.1|  haloacid dehalogenase                              129   4e-31    Aphanizomenon flos-aquae
ref|WP_039201064.1|  haloacid dehalogenase                              129   5e-31    Aphanizomenon flos-aquae
ref|WP_037222861.1|  haloacid dehalogenase                              129   5e-31    
ref|WP_015079130.1|  hypothetical protein                               129   5e-31    Anabaena sp. 90
gb|ADI63213.1|  conserved hypothetical protein                          129   7e-31    'Nostoc azollae' 0708
ref|WP_041642504.1|  haloacid dehalogenase                              129   7e-31    Trichormus azollae
ref|XP_007514480.1|  predicted protein                                  128   2e-30    Bathycoccus prasinos
ref|WP_026092903.1|  haloacid dehalogenase                              127   2e-30    Calothrix sp. PCC 7103
emb|CEG00058.1|  HAD-like domain                                        124   5e-30    Ostreococcus tauri
ref|WP_008178737.1|  haloacid dehalogenase                              124   3e-29    Moorea producens
ref|WP_009343992.1|  haloacid dehalogenase                              124   4e-29    Aphanizomenonaceae
ref|WP_017312377.1|  haloacid dehalogenase                              124   4e-29    Fischerella sp. PCC 9339
ref|WP_017655827.1|  haloacid dehalogenase                              124   5e-29    Fortiea contorta
ref|WP_026719826.1|  haloacid dehalogenase                              123   7e-29    Fischerella sp. PCC 9431
ref|WP_015199791.1|  hypothetical protein                               123   8e-29    Calothrix parietina
ref|WP_044450319.1|  haloacid dehalogenase                              123   1e-28    Mastigocladus laminosus
ref|WP_042157165.1|  haloacid dehalogenase                              122   2e-28    
gb|KEI66178.1|  hypothetical protein A19Y_1066                          122   2e-28    Planktothrix agardhii NIVA-CYA 126/8
ref|WP_028083768.1|  haloacid dehalogenase                              121   4e-28    Dolichospermum circinale
ref|WP_015174527.1|  Haloacid dehalogenase domain protein hydrolase     120   6e-28    Oscillatoria nigro-viridis
ref|WP_015206271.1|  putative phosphatase                               120   7e-28    Cylindrospermum stagnale
ref|WP_040010123.1|  haloacid dehalogenase                              120   7e-28    Cylindrospermopsis
ref|WP_045870278.1|  haloacid dehalogenase                              120   1e-27    Nostocales
ref|WP_010998004.1|  haloacid dehalogenase                              120   1e-27    Nostocaceae
gb|EFA68351.1|  conserved hypothetical protein                          120   1e-27    Cylindrospermopsis raciborskii CS-505
ref|WP_028090660.1|  haloacid dehalogenase                              119   2e-27    Dolichospermum circinale
ref|WP_026786338.1|  MULTISPECIES: haloacid dehalogenase                119   2e-27    Planktothrix
ref|WP_015215388.1|  Haloacid dehalogenase domain protein hydrolase     119   2e-27    Anabaena cylindrica
ref|WP_026794243.1|  MULTISPECIES: haloacid dehalogenase                119   3e-27    Planktothrix
ref|WP_011318635.1|  haloacid dehalogenase                              119   3e-27    Trichormus variabilis
ref|WP_016860473.1|  haloacid dehalogenase                              118   4e-27    Fischerella muscicola
ref|WP_006508461.1|  hypothetical protein                               117   6e-27    Xenococcus sp. PCC 7305
ref|WP_006633089.1|  haloacid dehalogenase                              117   7e-27    Microcoleus vaginatus
ref|WP_006197088.1|  haloacid dehalogenase                              117   8e-27    Nodularia spumigena
ref|WP_016950352.1|  haloacid dehalogenase                              117   1e-26    Anabaena sp. PCC 7108
ref|WP_041038913.1|  haloacid dehalogenase                              117   2e-26    Tolypothrix campylonemoides
ref|WP_026734080.1|  haloacid dehalogenase                              116   2e-26    Fischerella sp. PCC 9605
ref|XP_006421478.1|  hypothetical protein CICLE_v10006592mg             110   2e-26    
ref|WP_012411534.1|  haloacid dehalogenase                              116   2e-26    Nostoc punctiforme
gb|AFY42515.1|  hypothetical protein Nos7107_1884                       116   3e-26    Nostoc sp. PCC 7107
ref|WP_044499870.1|  haloacid dehalogenase                              116   3e-26    Nostoc sp. PCC 7107
ref|WP_015121532.1|  putative phosphatase                               115   3e-26    Rivularia sp. PCC 7116
ref|WP_010474936.1|  haloacid dehalogenase                              115   4e-26    Acaryochloris sp. CCMEE 5410
ref|WP_044194906.1|  haloacid dehalogenase                              115   5e-26    Oscillatoria acuminata
gb|AFY81797.1|  putative phosphatase                                    115   5e-26    Oscillatoria acuminata PCC 6304
ref|WP_016878059.1|  haloacid dehalogenase                              115   5e-26    Chlorogloeopsis fritschii
ref|WP_012164384.1|  haloacid dehalogenase                              115   6e-26    Acaryochloris marina
ref|WP_006101549.1|  haloacid dehalogenase                              115   7e-26    Coleofasciculus chthonoplastes
ref|WP_015184379.1|  phosphatase                                        115   7e-26    Microcoleus sp. PCC 7113
ref|WP_015146026.1|  putative phosphatase                               114   1e-25    Pleurocapsa minor
gb|EJK46873.1|  hypothetical protein THAOC_34443                        113   2e-25    Thalassiosira oceanica
ref|WP_027845700.1|  haloacid dehalogenase                              113   2e-25    Mastigocoleus testarum
ref|WP_017746998.1|  hypothetical protein                               112   6e-25    Scytonema hofmannii
gb|KIE10076.1|  haloacid dehalogenase                                   112   8e-25    Tolypothrix bouteillei VB521301
ref|WP_039747511.1|  haloacid dehalogenase                              112   9e-25    
ref|WP_017318162.1|  hypothetical protein                               111   9e-25    Mastigocladopsis repens
ref|WP_015140311.1|  putative phosphatase                               111   1e-24    Nostoc sp. PCC 7524
ref|WP_015187321.1|  Haloacid dehalogenase domain protein hydrolase     111   1e-24    Gloeocapsa sp. PCC 7428
ref|WP_011142041.1|  haloacid dehalogenase                              111   1e-24    Gloeobacter violaceus
ref|XP_005537811.1|  hypothetical protein, conserved                    112   1e-24    Cyanidioschyzon merolae strain 10D
ref|WP_011433086.1|  haloacid dehalogenase                              113   2e-24    Synechococcus sp. JA-2-3B'a(2-13)
ref|WP_029634503.1|  haloacid dehalogenase [                            110   2e-24    [Scytonema hofmanni] UTEX B 1581
ref|WP_008275611.1|  haloacid dehalogenase                              109   6e-24    Cyanothece sp. CCY0110
ref|WP_018396275.1|  hypothetical protein                               109   6e-24    filamentous cyanobacterium ESFC-1
ref|WP_006527905.1|  hypothetical protein                               108   8e-24    Gloeocapsa sp. PCC 73106
ref|WP_014276064.1|  hypothetical protein                               108   1e-23    Arthrospira platensis
ref|WP_023065886.1|  haloacid dehalogenase-like hydrolase family ...    108   1e-23    Lyngbya aestuarii
gb|EMR14228.1|  hypothetical protein MPL1_00832                         108   1e-23    Methylophaga lonarensis MPL
ref|WP_006616368.1|  haloacid dehalogenase                              108   1e-23    Arthrospira platensis
ref|WP_016866134.1|  haloacid dehalogenase                              108   1e-23    Fischerella muscicola
ref|WP_009633880.1|  hypothetical protein                               108   1e-23    Synechocystis sp. PCC 7509
ref|WP_040576735.1|  hypothetical protein                               108   1e-23    
gb|AFI83122.1|  hypothetical protein Q7A_263                            108   1e-23    Methylophaga nitratireducenticrescens
ref|WP_041354791.1|  hypothetical protein                               108   1e-23    
ref|WP_041596806.1|  haloacid dehalogenase                              108   2e-23    
gb|AFZ45828.1|  hypothetical protein PCC7418_3724                       108   2e-23    Halothece sp. PCC 7418
ref|WP_009785783.1|  haloacid dehalogenase                              107   2e-23    Lyngbya sp. PCC 8106
gb|KDO86222.1|  hypothetical protein CISIN_1g024415mg                   104   3e-23    Citrus sinensis [apfelsine]
ref|WP_041550020.1|  haloacid dehalogenase                              107   3e-23    
ref|WP_016871260.1|  haloacid dehalogenase                              107   3e-23    Fischerella thermalis
gb|AFY96345.1|  putative phosphatase                                    107   3e-23    Chamaesiphon minutus PCC 6605
ref|WP_015191689.1|  hypothetical protein                               107   4e-23    Stanieria cyanosphaera
ref|WP_035156169.1|  haloacid dehalogenase                              107   4e-23    Calothrix sp. 336/3
ref|WP_017288113.1|  hypothetical protein                               106   6e-23    Leptolyngbya boryana
ref|WP_039714896.1|  haloacid dehalogenase                              106   6e-23    
ref|WP_009756647.1|  haloacid dehalogenase                              106   6e-23    Fischerella thermalis
ref|WP_019504810.1|  hypothetical protein                               106   7e-23    Pleurocapsa sp. PCC 7319
ref|WP_009547672.1|  MULTISPECIES: haloacid dehalogenase                106   8e-23    Cyanothece
ref|WP_005374404.1|  hypothetical protein                               105   1e-22    
ref|WP_017322990.1|  hypothetical protein                               105   2e-22    cyanobacterium PCC 7702
ref|WP_015230580.1|  phosphatase                                        104   3e-22    Dactylococcopsis salina
ref|WP_012629361.1|  haloacid dehalogenase                              104   3e-22    Cyanothece sp. PCC 7425
ref|WP_007144204.1|  hypothetical protein                               103   3e-22    Methylophaga aminisulfidivorans
ref|WP_011243209.1|  MULTISPECIES: hypothetical protein                 103   4e-22    Synechococcus
gb|KIJ84882.1|  haloacid dehalogenase                                   103   4e-22    Scytonema tolypothrichoides VB-61278
ref|WP_028946803.1|  hypothetical protein                               103   5e-22    Synechocystis sp. PCC 6714
ref|WP_015152307.1|  hypothetical protein                               103   5e-22    Cyanobacteria [blue-green bacteria]
ref|WP_014704511.1|  hypothetical protein                               103   5e-22    Methylophaga frappieri
ref|WP_023493253.1|  hypothetical protein                               103   6e-22    Methyloglobulus morosus
ref|WP_015170218.1|  haloacid dehalogenase domain-containing prot...    103   6e-22    Geitlerinema sp. PCC 7407
ref|WP_007309971.1|  haloacid dehalogenase                              103   7e-22    
ref|WP_015279855.1|  phosphatase                                        103   7e-22    Thioflavicoccus mobilis
ref|WP_021831172.1|  hypothetical protein                               103   7e-22    Crocosphaera watsonii
ref|WP_031430000.1|  hypothetical protein                               103   7e-22    Methylomicrobium agile
ref|WP_013818695.1|  hypothetical protein                               103   7e-22    Methylomonas methanica
ref|WP_039727199.1|  MULTISPECIES: haloacid dehalogenase                103   9e-22    Lyngbya confervoides
ref|WP_002759691.1|  haloacid dehalogenase                              102   1e-21    Microcystis aeruginosa
ref|WP_007304566.1|  haloacid dehalogenase                              102   1e-21    Crocosphaera watsonii
gb|EDZ93720.1|  conserved hypothetical protein                          102   1e-21    Arthrospira maxima CS-328
ref|WP_012307840.1|  hypothetical protein                               102   1e-21    Synechococcus
ref|WP_002787050.1|  haloacid dehalogenase                              102   1e-21    Microcystis aeruginosa
emb|CCE18400.1|  conserved hypothetical protein                         102   2e-21    Arthrospira sp. PCC 8005
ref|WP_033374266.1|  haloacid dehalogenase                              102   2e-21    
ref|WP_031433473.1|  hypothetical protein                               101   2e-21    Methylomarinum vadi
ref|WP_035991286.1|  haloacid dehalogenase                              101   3e-21    Leptolyngbya sp. KIOST-1
ref|WP_045356203.1|  haloacid dehalogenase                              101   3e-21    Microcystis aeruginosa
gb|ABG51809.1|  Haloacid dehalogenase-like hydrolase                    101   3e-21    Trichodesmium erythraeum IMS101
ref|WP_011430328.1|  haloacid dehalogenase                              103   3e-21    Synechococcus
ref|WP_044136779.1|  haloacid dehalogenase                              101   3e-21    Trichodesmium erythraeum
ref|WP_006623877.1|  haloacid dehalogenase                              101   4e-21    Arthrospira platensis
ref|WP_013320481.1|  haloacid dehalogenase                              101   4e-21    Cyanothece sp. PCC 7822
ref|WP_012267643.1|  haloacid dehalogenase                              101   4e-21    Microcystis aeruginosa
gb|KHN29345.1|  hypothetical protein glysoja_005069                   95.9    5e-21    Glycine soja [wild soybean]
ref|WP_004267989.1|  haloacid dehalogenase                              100   6e-21    Microcystis aeruginosa
ref|WP_002739267.1|  haloacid dehalogenase-like hydrolase               100   7e-21    Microcystis aeruginosa
ref|WP_017714753.1|  hypothetical protein                               100   7e-21    Oscillatoria sp. PCC 10802
ref|WP_015202722.1|  hypothetical protein                               100   7e-21    Crinalium epipsammum
ref|WP_008196136.1|  haloacid dehalogenase                              100   9e-21    Microcystis
ref|WP_002744911.1|  haloacid dehalogenase-like hydrolase             99.8    1e-20    Microcystis aeruginosa
ref|WP_040929828.1|  haloacid dehalogenase                            99.8    1e-20    
ref|WP_002755415.1|  haloacid dehalogenase                            99.8    1e-20    Microcystis aeruginosa
ref|WP_036535946.1|  haloacid dehalogenase                            99.8    1e-20    
gb|KIY95718.1|  hypothetical protein MNEG_12244                         103   1e-20    Monoraphidium neglectum
ref|WP_038026617.1|  haloacid dehalogenase                            99.8    1e-20    Synechococcus sp. PCC 7336
ref|WP_002780839.1|  hypothetical protein                             99.4    2e-20    Microcystis aeruginosa
ref|WP_024969493.1|  haloacid dehalogenase                            99.4    2e-20    Microcystis aeruginosa
ref|WP_036311170.1|  hypothetical protein                             99.0    2e-20    
ref|WP_007356536.1|  MULTISPECIES: haloacid dehalogenase              99.4    2e-20    
ref|WP_002796039.1|  haloacid dehalogenase                            99.4    2e-20    
ref|WP_043997497.1|  haloacid dehalogenase                            99.0    2e-20    
emb|CCI08463.1|  conserved hypothetical protein                       99.4    3e-20    
ref|WP_024298779.1|  hypothetical protein                             98.6    3e-20    
ref|WP_008290968.1|  hypothetical protein                             98.6    3e-20    
ref|WP_017840617.1|  hypothetical protein                             98.2    4e-20    
ref|WP_015955923.1|  haloacid dehalogenase                            98.2    4e-20    
ref|WP_002792802.1|  haloacid dehalogenase                            98.2    4e-20    
ref|WP_002770231.1|  haloacid dehalogenase                            97.8    6e-20    
ref|WP_015122841.1|  hypothetical protein                             97.8    7e-20    
ref|WP_023176030.1|  phosphoglycolate phosphatase                     97.8    7e-20    
ref|WP_006453791.1|  haloacid dehalogenase                            97.1    1e-19    
ref|WP_015136053.1|  hypothetical protein                             97.1    1e-19    
ref|WP_011057528.1|  hypothetical protein                             96.7    1e-19    
ref|WP_044106449.1|  haloacid dehalogenase                            96.7    2e-19    
ref|WP_016516585.1|  hypothetical protein                             96.7    2e-19    
ref|WP_036616608.1|  haloacid dehalogenase                            96.7    2e-19    
gb|EKQ69724.1|  putative phosphatase                                  96.7    2e-19    
ref|WP_022607958.1|  putative phosphatase                             96.3    2e-19    
ref|WP_010873270.1|  hypothetical protein                             96.3    2e-19    
ref|WP_014149639.1|  hypothetical protein                             95.9    3e-19    
ref|WP_008317668.1|  hypothetical protein                             95.1    5e-19    
ref|WP_020562493.1|  hypothetical protein                             94.4    7e-19    
ref|WP_030007316.1|  hypothetical protein                             94.4    8e-19    
ref|WP_033157026.1|  hypothetical protein                             94.4    9e-19    
ref|WP_024124739.1|  putative phosphatase                             94.4    1e-18    
ref|WP_012593780.1|  MULTISPECIES: haloacid dehalogenase              93.6    2e-18    
ref|XP_005848313.1|  hypothetical protein CHLNCDRAFT_22194            94.0    2e-18    
ref|WP_017659807.1|  hypothetical protein                             92.4    5e-18    
ref|WP_038027741.1|  hypothetical protein                             92.0    5e-18    
ref|WP_036295326.1|  hypothetical protein                             91.7    7e-18    
ref|WP_017297876.1|  hypothetical protein                             91.7    9e-18    
ref|WP_012953481.1|  haloacid dehalogenase                            91.3    1e-17    
ref|WP_020157299.1|  hypothetical protein                             90.9    1e-17    
ref|XP_006428288.1|  hypothetical protein CICLE_v10013186mg           87.0    2e-17    
ref|XP_006428290.1|  hypothetical protein CICLE_v10013186mg           87.0    2e-17    
ref|WP_036254257.1|  hypothetical protein                             90.1    2e-17    
ref|WP_017712180.1|  hypothetical protein                             90.9    3e-17    
ref|WP_020483023.1|  hypothetical protein                             89.7    4e-17    
ref|WP_006518563.1|  hypothetical protein                             89.4    6e-17    
ref|XP_006480381.1|  PREDICTED: uncharacterized protein LOC102607...  85.9    6e-17    
ref|WP_036277314.1|  hypothetical protein                             88.6    8e-17    
ref|WP_045225015.1|  hypothetical protein                             88.2    1e-16    
ref|WP_036000399.1|  haloacid dehalogenase                            87.8    2e-16    
gb|KHN29346.1|  hypothetical protein glysoja_005070                   85.1    2e-16    
ref|WP_036479689.1|  haloacid dehalogenase                            86.7    4e-16    
emb|CDX74780.1|  BnaA05g05260D                                        81.3    1e-15    
ref|XP_004997785.1|  hypothetical protein PTSG_01805                  84.3    3e-15    
ref|WP_017296142.1|  hypothetical protein                             82.4    1e-14    
ref|WP_040055189.1|  haloacid dehalogenase                            82.0    2e-14    
ref|WP_025781389.1|  hypothetical protein                             80.9    5e-14    
ref|XP_006428289.1|  hypothetical protein CICLE_v10013186mg           77.4    5e-14    
ref|WP_031293122.1|  haloacid dehalogenase                            81.3    7e-14    
gb|ESA35625.1|  haloacid dehalogenase                                 80.9    8e-14    
ref|XP_002952821.1|  hypothetical protein VOLCADRAFT_93606            80.1    1e-13    
ref|WP_038001611.1|  HAD family hydrolase                             79.3    2e-13    
gb|EAQ68538.1|  hypothetical protein RS9917_03113                     79.0    2e-13    
ref|WP_015221067.1|  haloacid dehalogenase domain-containing prot...  77.4    7e-13    
ref|WP_015222635.1|  haloacid dehalogenase domain-containing prot...  74.7    6e-12    
ref|XP_005842419.1|  hypothetical protein GUITHDRAFT_131635           74.7    2e-11    
ref|WP_010314914.1|  HAD family hydrolase                             72.8    3e-11    
gb|KGG10745.1|  HAD hydrolase                                         71.6    6e-11    
ref|WP_011125864.1|  MULTISPECIES: HAD family hydrolase               72.0    6e-11    
gb|EDY38479.1|  HAD superfamily hydrolase                             70.5    2e-10    
ref|WP_043369754.1|  HAD family hydrolase                             70.5    2e-10    
ref|WP_036900102.1|  phosphatase                                      70.5    2e-10    
ref|WP_011826901.1|  HAD family hydrolase                             70.1    3e-10    
ref|XP_007052235.1|  TRAF-like family protein                         70.1    6e-10    
dbj|BAQ64178.1|  hypothetical protein GM3709_943                      68.9    7e-10    
ref|XP_002289937.1|  predicted protein                                67.4    2e-09    
emb|CAE21903.1|  conserved hypothetical protein                       67.0    2e-09    
ref|WP_041385202.1|  HAD family hydrolase                             67.0    3e-09    
gb|KGG34559.1|  HAD hydrolase                                         67.0    3e-09    
ref|WP_036972538.1|  HAD family hydrolase                             67.0    3e-09    
ref|WP_036912733.1|  MULTISPECIES: HAD family hydrolase               67.0    3e-09    
gb|KGG27360.1|  HAD hydrolase                                         66.6    4e-09    
ref|WP_011618403.1|  HAD family hydrolase                             66.6    4e-09    
ref|WP_011128921.1|  HAD family hydrolase                             66.2    4e-09    
ref|WP_006854832.1|  HAD family hydrolase                             66.2    5e-09    
dbj|BAQ62016.1|  hypothetical protein GM3708_2422                     66.2    6e-09    
ref|WP_011360709.1|  HAD family hydrolase                             65.9    7e-09    
emb|CCH66610.1|  hypothetical protein RINTHH_4550                     62.4    1e-08    
ref|WP_019474314.1|  hypothetical protein                             64.3    3e-08    
ref|WP_025930950.1|  phosphatase                                      63.5    4e-08    
ref|WP_009788939.1|  HAD family hydrolase                             62.8    7e-08    
ref|WP_025973548.1|  hypothetical protein                             60.8    1e-07    
ref|XP_006432614.1|  hypothetical protein CICLE_v10003222mg           60.8    1e-07    
ref|WP_025952932.1|  phosphatase                                      62.0    1e-07    
ref|WP_025954901.1|  phosphatase                                      61.6    1e-07    
ref|WP_025974121.1|  phosphatase                                      62.0    1e-07    
ref|WP_038654367.1|  HAD family hydrolase                             62.0    2e-07    
ref|WP_025893596.1|  phosphatase                                      62.0    2e-07    
ref|WP_025923610.1|  phosphatase                                      62.0    2e-07    
gb|EAR19074.1|  hypothetical protein WH7805_06951                     61.6    2e-07    
ref|WP_025968861.1|  phosphatase                                      61.6    2e-07    
ref|WP_025889528.1|  MULTISPECIES: phosphatase                        61.6    2e-07    
ref|WP_025974782.1|  phosphatase                                      61.6    2e-07    
ref|WP_025944910.1|  MULTISPECIES: phosphatase                        61.6    2e-07    
ref|WP_036900675.1|  HAD family hydrolase                             61.6    2e-07    
ref|WP_025947572.1|  MULTISPECIES: phosphatase                        61.6    2e-07    
ref|WP_025960089.1|  phosphatase                                      61.6    2e-07    
ref|WP_025927705.1|  MULTISPECIES: phosphatase                        61.6    2e-07    
ref|WP_025946469.1|  phosphatase                                      61.6    2e-07    
ref|WP_025945392.1|  phosphatase                                      61.6    2e-07    
ref|WP_025967318.1|  phosphatase                                      61.6    2e-07    
ref|WP_025939944.1|  MULTISPECIES: phosphatase                        61.6    2e-07    
ref|WP_025962658.1|  phosphatase                                      61.6    2e-07    
ref|WP_038005155.1|  HAD family hydrolase                             61.2    2e-07    
ref|WP_038543158.1|  HAD family hydrolase                             61.2    2e-07    
ref|WP_025972594.1|  phosphatase                                      61.2    3e-07    
ref|WP_025938715.1|  phosphatase                                      60.8    3e-07    
ref|WP_011377195.1|  hypothetical protein                             60.8    3e-07    
emb|CAK29015.1|  HAD superfamily hydrolase                            60.8    3e-07    
ref|WP_043737349.1|  hypothetical protein                             60.8    4e-07    
gb|ABE11158.1|  conserved hypothetical protein                        60.8    4e-07    
ref|WP_025943441.1|  phosphatase                                      60.8    4e-07    
ref|WP_025923895.1|  phosphatase                                      60.8    4e-07    
ref|WP_025969517.1|  phosphatase                                      60.8    4e-07    
ref|WP_025956210.1|  phosphatase                                      60.8    4e-07    
ref|WP_025928894.1|  phosphatase                                      60.5    4e-07    
ref|XP_006494209.1|  PREDICTED: uncharacterized protein LOC102628...  58.5    4e-07    
ref|WP_025922646.1|  MULTISPECIES: phosphatase                        60.5    4e-07    
ref|WP_036919373.1|  MULTISPECIES: HAD family hydrolase               60.5    5e-07    
ref|WP_011863663.1|  phosphatase                                      60.5    5e-07    
ref|WP_025958602.1|  phosphatase                                      60.5    6e-07    
ref|WP_025970018.1|  MULTISPECIES: phosphatase                        60.1    6e-07    
ref|WP_025934046.1|  phosphatase                                      60.1    6e-07    
gb|EWM29999.1|  uncharacterized protein Naga_100379g1                 57.4    8e-07    
ref|WP_035830861.1|  HAD family hydrolase                             60.1    8e-07    
ref|WP_025947017.1|  phosphatase                                      60.1    8e-07    
ref|WP_025960626.1|  phosphatase                                      59.7    8e-07    
ref|WP_043694935.1|  HAD family hydrolase                             59.7    9e-07    
ref|WP_028953641.1|  HAD family hydrolase                             59.3    1e-06    
ref|WP_025895070.1|  hypothetical protein                             57.8    1e-06    
ref|WP_032522121.1|  phosphatase                                      59.3    1e-06    
ref|WP_011932352.1|  HAD family hydrolase                             59.3    1e-06    
ref|WP_025937657.1|  phosphatase                                      58.9    1e-06    
ref|WP_032516228.1|  phosphatase                                      58.9    2e-06    
ref|WP_025915162.1|  phosphatase                                      58.9    2e-06    
ref|WP_007099893.1|  HAD family hydrolase                             58.9    2e-06    
ref|WP_011819173.1|  phosphatase                                      58.5    2e-06    
ref|WP_025942073.1|  phosphatase                                      58.2    3e-06    
gb|KGG03134.1|  HAD hydrolase                                         57.4    4e-06    
ref|WP_019476972.1|  hypothetical protein                             57.8    4e-06    
ref|WP_019477865.1|  hypothetical protein                             57.8    4e-06    
ref|WP_032517888.1|  phosphatase                                      57.4    5e-06    
ref|WP_036922432.1|  phosphatase                                      57.4    6e-06    
ref|WP_032520051.1|  phosphatase                                      57.4    6e-06    
ref|WP_012196231.1|  HAD family hydrolase                             57.0    6e-06    
gb|AJW30868.1|  HAD hydrolase                                         57.0    7e-06    
ref|WP_011133189.1|  hypothetical protein                             56.6    1e-05    
ref|WP_029960535.1|  phosphatase                                      55.8    1e-05    
ref|WP_010311684.1|  HAD family hydrolase                             56.2    1e-05    
gb|AFY28945.1|  putative phosphatase                                  56.2    1e-05    
ref|WP_043326884.1|  HAD family hydrolase                             56.2    2e-05    
ref|WP_011295476.1|  HAD family hydrolase                             55.8    2e-05    
ref|WP_032525076.1|  phosphatase                                      55.8    2e-05    
ref|WP_042851088.1|  phosphatase                                      55.8    2e-05    
ref|WP_011824517.1|  HAD family hydrolase                             55.5    2e-05    
ref|WP_036904543.1|  HAD family hydrolase                             55.5    2e-05    
gb|AIK01863.1|  hypothetical protein                                  52.0    2e-05    
ref|WP_037978933.1|  HAD family hydrolase                             53.5    2e-05    
ref|WP_013254274.1|  hypothetical protein                             55.5    2e-05    
gb|EAQ73699.1|  hypothetical protein WH5701_00370                     53.5    2e-05    
gb|AJW30799.1|  HAD hydrolase                                         55.5    3e-05    
ref|WP_002806315.1|  HAD superfamily hydrolase                        55.1    3e-05    
ref|WP_035304665.1|  hypothetical protein                             54.3    5e-05    
ref|WP_012008450.1|  hypothetical protein                             53.9    7e-05    
ref|WP_025925623.1|  hypothetical protein                             52.0    8e-05    
ref|WP_006850422.1|  HAD family hydrolase                             53.5    9e-05    
ref|WP_011821040.1|  phosphatase                                      53.9    9e-05    
ref|WP_032513818.1|  phosphatase                                      53.5    9e-05    
ref|WP_038556628.1|  HAD family hydrolase                             53.1    1e-04    
ref|WP_032526280.1|  phosphatase                                      53.1    1e-04    
ref|WP_020612365.1|  hypothetical protein                             52.8    2e-04    
ref|WP_011363393.1|  HAD family hydrolase                             52.0    3e-04    
ref|WP_025979063.1|  hypothetical protein                             50.1    3e-04    
ref|WP_033442167.1|  hypothetical protein                             51.2    6e-04    



>gb|EYU32139.1| hypothetical protein MIMGU_mgv1a011795mg [Erythranthe guttata]
Length=270

 Score =   322 bits (825),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -1

Query  722  TVKVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRF  543
            + KVAEGLTV+E+LENW+ IKPVI+ EW+ENRDALIDLFGKVRDEW+DNDL+TWIGANRF
Sbjct  83   SYKVAEGLTVEEVLENWLTIKPVIMSEWDENRDALIDLFGKVRDEWLDNDLATWIGANRF  142

Query  542  YPGVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQE  363
            YPGVADALKFASSK+YIVTTKQ RF  ALLREL G+  PPERIYGLGTGPK KVLKQLQ+
Sbjct  143  YPGVADALKFASSKLYIVTTKQGRFVEALLRELGGIDFPPERIYGLGTGPKVKVLKQLQD  202

Query  362  MPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            MPEHQGLTLHFVEDRLATLKNVI EPEL+ WNLYLGDWGYNTPKEREEAA+I+RIR+
Sbjct  203  MPEHQGLTLHFVEDRLATLKNVINEPELSKWNLYLGDWGYNTPKEREEAARISRIRL  259



>gb|KJB22336.1| hypothetical protein B456_004G042000 [Gossypium raimondii]
Length=218

 Score =   320 bits (820),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTV++ILENW KIKPVI+EEW+ENRDALIDLFGKVRDEWMDNDL+TWIGANRFYPG
Sbjct  34   VAEGLTVEDILENWSKIKPVIMEEWDENRDALIDLFGKVRDEWMDNDLATWIGANRFYPG  93

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V DALKF+SS +YIVTTKQSRFA ALLRELAGVTIPPERIYGLGTGPK KVLKQLQ  PE
Sbjct  94   VPDALKFSSSTIYIVTTKQSRFADALLRELAGVTIPPERIYGLGTGPKVKVLKQLQLRPE  153

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQG+ LHFVEDRLATLKNVIKEPEL+GWNLYLGDWGYNT KEREEAA I+RI++
Sbjct  154  HQGMKLHFVEDRLATLKNVIKEPELDGWNLYLGDWGYNTQKEREEAANISRIQL  207



>gb|KJB22334.1| hypothetical protein B456_004G042000 [Gossypium raimondii]
Length=268

 Score =   320 bits (820),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTV++ILENW KIKPVI+EEW+ENRDALIDLFGKVRDEWMDNDL+TWIGANRFYPG
Sbjct  84   VAEGLTVEDILENWSKIKPVIMEEWDENRDALIDLFGKVRDEWMDNDLATWIGANRFYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V DALKF+SS +YIVTTKQSRFA ALLRELAGVTIPPERIYGLGTGPK KVLKQLQ  PE
Sbjct  144  VPDALKFSSSTIYIVTTKQSRFADALLRELAGVTIPPERIYGLGTGPKVKVLKQLQLRPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQG+ LHFVEDRLATLKNVIKEPEL+GWNLYLGDWGYNT KEREEAA I+RI++
Sbjct  204  HQGMKLHFVEDRLATLKNVIKEPELDGWNLYLGDWGYNTQKEREEAANISRIQL  257



>gb|EYU32140.1| hypothetical protein MIMGU_mgv1a011795mg [Erythranthe guttata]
Length=268

 Score =   320 bits (820),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VAEGLTV+E+LENW+ IKPVI+ EW+ENRDALIDLFGKVRDEW+DNDL+TWIGANRFYP
Sbjct  83   SVAEGLTVEEVLENWLTIKPVIMSEWDENRDALIDLFGKVRDEWLDNDLATWIGANRFYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GVADALKFASSK+YIVTTKQ RF  ALLREL G+  PPERIYGLGTGPK KVLKQLQ+MP
Sbjct  143  GVADALKFASSKLYIVTTKQGRFVEALLRELGGIDFPPERIYGLGTGPKVKVLKQLQDMP  202

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            EHQGLTLHFVEDRLATLKNVI EPEL+ WNLYLGDWGYNTPKEREEAA+I+RIR+
Sbjct  203  EHQGLTLHFVEDRLATLKNVINEPELSKWNLYLGDWGYNTPKEREEAARISRIRL  257



>gb|KHG18490.1| Ribosomal RNA small subunit methyltransferase G [Gossypium arboreum]
Length=266

 Score =   320 bits (820),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VAEGLTV++ILENW KIKPVI+EEW+ENRDALIDLFGKVRDEWMDNDL+TWIGANRFYP
Sbjct  81   SVAEGLTVEDILENWSKIKPVIMEEWDENRDALIDLFGKVRDEWMDNDLATWIGANRFYP  140

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GV DALKF+SS +YIVTTKQSRFA ALLRELAGVTIPPERIYGLGTGPK KVLKQLQ  P
Sbjct  141  GVPDALKFSSSTIYIVTTKQSRFADALLRELAGVTIPPERIYGLGTGPKVKVLKQLQLRP  200

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            EHQG+ LHFVEDRLATLKNVIKEPEL+GWNLYLGDWGYNT KEREEAA I+RI++
Sbjct  201  EHQGMKLHFVEDRLATLKNVIKEPELDGWNLYLGDWGYNTQKEREEAANISRIQL  255



>gb|KJB22339.1| hypothetical protein B456_004G042000 [Gossypium raimondii]
Length=260

 Score =   319 bits (818),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTV++ILENW KIKPVI+EEW+ENRDALIDLFGKVRDEWMDNDL+TWIGANRFYPG
Sbjct  76   VAEGLTVEDILENWSKIKPVIMEEWDENRDALIDLFGKVRDEWMDNDLATWIGANRFYPG  135

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V DALKF+SS +YIVTTKQSRFA ALLRELAGVTIPPERIYGLGTGPK KVLKQLQ  PE
Sbjct  136  VPDALKFSSSTIYIVTTKQSRFADALLRELAGVTIPPERIYGLGTGPKVKVLKQLQLRPE  195

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQG+ LHFVEDRLATLKNVIKEPEL+GWNLYLGDWGYNT KEREEAA I+RI++
Sbjct  196  HQGMKLHFVEDRLATLKNVIKEPELDGWNLYLGDWGYNTQKEREEAANISRIQL  249



>ref|XP_009768013.1| PREDICTED: uncharacterized protein LOC104219077 [Nicotiana sylvestris]
Length=268

 Score =   319 bits (817),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VAEGLTV+ ILENW KIKP+IV EWNE+RD+LIDLFGKVRDEWMDNDL+TWIG NRFYP
Sbjct  83   SVAEGLTVEGILENWAKIKPIIVAEWNEDRDSLIDLFGKVRDEWMDNDLATWIGTNRFYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GV DALKFASSK+YIVTTKQSRFA ALLRELAG+TIP ERIYGLGTGPK KVLKQLQEMP
Sbjct  143  GVPDALKFASSKLYIVTTKQSRFADALLRELAGITIPVERIYGLGTGPKVKVLKQLQEMP  202

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            EHQGLTLHFVEDRLATLKNVIKE EL+GWNLYLGDWGYNT KEREEAA I RIR+
Sbjct  203  EHQGLTLHFVEDRLATLKNVIKESELDGWNLYLGDWGYNTQKEREEAASIPRIRL  257



>ref|XP_007051771.1| Uncharacterized protein TCM_005310 [Theobroma cacao]
 gb|EOX95928.1| Uncharacterized protein TCM_005310 [Theobroma cacao]
Length=268

 Score =   319 bits (817),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VAEGLTV+ ILENW K+KPVI+EEWNENRDALIDLFGKVRDEWMDNDL+TWIGANRFYP
Sbjct  83   SVAEGLTVEGILENWSKLKPVIMEEWNENRDALIDLFGKVRDEWMDNDLATWIGANRFYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GV DALKFASS VYIVTTKQSRFA ALLRELAGVTIPPERIYGLGTGPK K+LKQLQ  P
Sbjct  143  GVPDALKFASSTVYIVTTKQSRFADALLRELAGVTIPPERIYGLGTGPKVKILKQLQLRP  202

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            EHQG+ LHFVEDRLATLKNVIKEPEL+GWNLYLGDWGYNT KEREEAA I RI++
Sbjct  203  EHQGMKLHFVEDRLATLKNVIKEPELDGWNLYLGDWGYNTQKEREEAASIPRIQL  257



>ref|XP_009622825.1| PREDICTED: uncharacterized protein LOC104114152 [Nicotiana tomentosiformis]
Length=268

 Score =   314 bits (804),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VAEGLTV+ ILENW KIKP+I+ EW+E+RD LIDLFGKVRDEWMDNDL+TWIGANRFYP
Sbjct  83   SVAEGLTVEGILENWAKIKPIIMAEWDEDRDFLIDLFGKVRDEWMDNDLATWIGANRFYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GV DALKFA+SK+YIVTTKQSRFA ALLRELAG+TIP ERIYGLGTGPK KVLK LQEMP
Sbjct  143  GVPDALKFATSKLYIVTTKQSRFADALLRELAGITIPAERIYGLGTGPKVKVLKLLQEMP  202

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            EHQGLTLHFVEDRLATLKNVIKE EL+GWNLYLGDWGYNT KEREEAA I+RIR+
Sbjct  203  EHQGLTLHFVEDRLATLKNVIKESELDGWNLYLGDWGYNTQKEREEAASISRIRL  257



>ref|XP_010326971.1| PREDICTED: uncharacterized protein LOC101253323 isoform X2 [Solanum 
lycopersicum]
Length=238

 Score =   313 bits (801),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTV+ ILENW KIKP+I+ EWNE+RD LIDLFGKVRDEWMDNDL+TWIGANRFYPG
Sbjct  54   VAEGLTVEGILENWSKIKPIIMAEWNEDRDFLIDLFGKVRDEWMDNDLATWIGANRFYPG  113

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V DALKFASSK+YIVTTKQSRFA ALL+ +AG+TIP ERIYGLGTGPK KVLKQLQEMPE
Sbjct  114  VPDALKFASSKLYIVTTKQSRFADALLKGIAGITIPAERIYGLGTGPKVKVLKQLQEMPE  173

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGL LHFVEDRLATLKNVIKE EL+GWNLYLGDWGYNT KEREEAA I+RIR+
Sbjct  174  HQGLKLHFVEDRLATLKNVIKESELDGWNLYLGDWGYNTQKEREEAAGISRIRV  227



>gb|EYU32143.1| hypothetical protein MIMGU_mgv1a011872mg [Erythranthe guttata]
Length=268

 Score =   313 bits (803),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             +AEGLTV+EILENW  IKPVI+ EW+E+RD LIDLFGKVRDEW+DNDL+TWIGANRFYP
Sbjct  83   SIAEGLTVEEILENWSTIKPVIMAEWDEDRDVLIDLFGKVRDEWIDNDLATWIGANRFYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GVADALKFASSK+YIVTTKQ RFA ALLRE+AGV IPPERIYGLGTGPK KVLKQLQ+MP
Sbjct  143  GVADALKFASSKLYIVTTKQGRFAEALLREIAGVVIPPERIYGLGTGPKVKVLKQLQDMP  202

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            EH+GLTLHFVEDRLATLKNVIKEPEL+ WNLYLGDWGYNT  ER+EAA I+RIRI
Sbjct  203  EHEGLTLHFVEDRLATLKNVIKEPELSKWNLYLGDWGYNTLNERDEAATISRIRI  257



>ref|XP_004248047.1| PREDICTED: uncharacterized protein LOC101253323 isoform X1 [Solanum 
lycopersicum]
Length=268

 Score =   313 bits (801),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 149/174 (86%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTV+ ILENW KIKP+I+ EWNE+RD LIDLFGKVRDEWMDNDL+TWIGANRFYPG
Sbjct  84   VAEGLTVEGILENWSKIKPIIMAEWNEDRDFLIDLFGKVRDEWMDNDLATWIGANRFYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V DALKFASSK+YIVTTKQSRFA ALL+ +AG+TIP ERIYGLGTGPK KVLKQLQEMPE
Sbjct  144  VPDALKFASSKLYIVTTKQSRFADALLKGIAGITIPAERIYGLGTGPKVKVLKQLQEMPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGL LHFVEDRLATLKNVIKE EL+GWNLYLGDWGYNT KEREEAA I+RIR+
Sbjct  204  HQGLKLHFVEDRLATLKNVIKESELDGWNLYLGDWGYNTQKEREEAAGISRIRV  257



>gb|KDO86223.1| hypothetical protein CISIN_1g024415mg [Citrus sinensis]
Length=218

 Score =   310 bits (793),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            V+EGLTV+ ILENW KIKPVI+E+W+ENRDAL+DLFGKVRDEWMD DL+TWIGANRFYPG
Sbjct  34   VSEGLTVEGILENWSKIKPVIMEDWSENRDALVDLFGKVRDEWMDKDLTTWIGANRFYPG  93

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            + DALKFASS++YIVTTKQSRFA ALLRELAGVTIPP+RIYGLGTGPK +VLKQLQ+ PE
Sbjct  94   IPDALKFASSRIYIVTTKQSRFADALLRELAGVTIPPDRIYGLGTGPKVEVLKQLQKKPE  153

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
             QG+TLHFVEDRLATLKNVIKEPEL+GWNLYLGDWGYNT KEREEAA I RI++
Sbjct  154  LQGMTLHFVEDRLATLKNVIKEPELDGWNLYLGDWGYNTQKEREEAASIPRIQL  207



>ref|XP_006445009.1| hypothetical protein CICLE_v10021690mg [Citrus clementina]
 ref|XP_006491136.1| PREDICTED: uncharacterized protein LOC102608684 [Citrus sinensis]
 gb|ESR58249.1| hypothetical protein CICLE_v10021690mg [Citrus clementina]
 gb|KDO86215.1| hypothetical protein CISIN_1g024415mg [Citrus sinensis]
Length=268

 Score =   310 bits (794),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            V+EGLTV+ ILENW KIKPVI+E+W+ENRDAL+DLFGKVRDEWMD DL+TWIGANRFYPG
Sbjct  84   VSEGLTVEGILENWSKIKPVIMEDWSENRDALVDLFGKVRDEWMDKDLTTWIGANRFYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            + DALKFASS++YIVTTKQSRFA ALLRELAGVTIPP+RIYGLGTGPK +VLKQLQ+ PE
Sbjct  144  IPDALKFASSRIYIVTTKQSRFADALLRELAGVTIPPDRIYGLGTGPKVEVLKQLQKKPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
             QG+TLHFVEDRLATLKNVIKEPEL+GWNLYLGDWGYNT KEREEAA I RI++
Sbjct  204  LQGMTLHFVEDRLATLKNVIKEPELDGWNLYLGDWGYNTQKEREEAASIPRIQL  257



>ref|XP_002511878.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50547.1| conserved hypothetical protein [Ricinus communis]
Length=268

 Score =   310 bits (793),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTV+ ILENW K+KPVI+EEW E+RD+LI LFGK+RDEWMD DL+TWI ANRFYPG
Sbjct  84   VAEGLTVEGILENWSKLKPVIMEEWGEDRDSLIHLFGKIRDEWMDKDLATWIAANRFYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V DALKFASS++YIVTTKQSRFA ALLRELAG+TIPPE+IYGLGTGPK KVLKQLQE PE
Sbjct  144  VPDALKFASSRIYIVTTKQSRFADALLRELAGLTIPPEKIYGLGTGPKVKVLKQLQEKPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            +QGLTLHFVEDRLATLKNVIKEPEL+GWNLYLGDWGYNT KEREEAA I RIR+
Sbjct  204  YQGLTLHFVEDRLATLKNVIKEPELDGWNLYLGDWGYNTQKEREEAASIPRIRL  257



>ref|XP_006364150.1| PREDICTED: uncharacterized protein LOC102604822 [Solanum tuberosum]
Length=268

 Score =   310 bits (793),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 161/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTV+ ILENW KIKP+I+ EWNE++D LIDLFGKVRDEWMDNDL+TWIGANRFYPG
Sbjct  84   VAEGLTVEGILENWAKIKPIIMAEWNEDKDFLIDLFGKVRDEWMDNDLATWIGANRFYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V DALKFASSK+YIVTTKQSRFA ALL+ +AG+TIP ERI+GLGTGPK KVLKQLQEMPE
Sbjct  144  VPDALKFASSKLYIVTTKQSRFADALLKGIAGITIPAERIFGLGTGPKVKVLKQLQEMPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGL LHFVEDRLATLKNVIKE EL+GWNLYLGDWGYNT KEREEAA I+RIR+
Sbjct  204  HQGLKLHFVEDRLATLKNVIKESELDGWNLYLGDWGYNTQKEREEAAGISRIRV  257



>ref|XP_011036565.1| PREDICTED: uncharacterized protein LOC105134023 isoform X2 [Populus 
euphratica]
Length=218

 Score =   306 bits (783),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            V+EGLTVD ILENW KIKPVI+EEW ENRDALI+LFGKVRDEWMDNDL+TWIGANRFYPG
Sbjct  34   VSEGLTVDGILENWSKIKPVIMEEWAENRDALIELFGKVRDEWMDNDLATWIGANRFYPG  93

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V DALKFASS +YIVTTKQSRFA ALL+ELAG+ IPPERIYGLGTGPK +VLKQLQ  PE
Sbjct  94   VPDALKFASSSIYIVTTKQSRFADALLQELAGLKIPPERIYGLGTGPKVEVLKQLQRKPE  153

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGL LHFVEDRLATLKNVIK+PEL+GWNLYLGDWGYNT KER EAA I RI +
Sbjct  154  HQGLKLHFVEDRLATLKNVIKDPELDGWNLYLGDWGYNTHKERGEAASIPRITL  207



>emb|CDP08796.1| unnamed protein product [Coffea canephora]
Length=268

 Score =   307 bits (786),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTV  IL+NW KIKP+I+EEW+E RD LIDLFGK+RDEWMDNDL+TWIGANRFYPG
Sbjct  84   VAEGLTVKGILDNWSKIKPIIMEEWDEKRDPLIDLFGKIRDEWMDNDLATWIGANRFYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V DALKFASS VYIVTTKQSRFA ALL+ LAGVTIP ERIYGLGTGPK +VLKQLQ+MPE
Sbjct  144  VPDALKFASSTVYIVTTKQSRFADALLQGLAGVTIPQERIYGLGTGPKVEVLKQLQKMPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGL+LHFVEDRLATLKNVIKEPEL+ WNLYLGDWGYNT KEREEAA I RI I
Sbjct  204  HQGLSLHFVEDRLATLKNVIKEPELDNWNLYLGDWGYNTQKEREEAASIPRIHI  257



>ref|XP_011036556.1| PREDICTED: uncharacterized protein LOC105134023 isoform X1 [Populus 
euphratica]
Length=268

 Score =   306 bits (785),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            V+EGLTVD ILENW KIKPVI+EEW ENRDALI+LFGKVRDEWMDNDL+TWIGANRFYPG
Sbjct  84   VSEGLTVDGILENWSKIKPVIMEEWAENRDALIELFGKVRDEWMDNDLATWIGANRFYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V DALKFASS +YIVTTKQSRFA ALL+ELAG+ IPPERIYGLGTGPK +VLKQLQ  PE
Sbjct  144  VPDALKFASSSIYIVTTKQSRFADALLQELAGLKIPPERIYGLGTGPKVEVLKQLQRKPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGL LHFVEDRLATLKNVIK+PEL+GWNLYLGDWGYNT KER EAA I RI +
Sbjct  204  HQGLKLHFVEDRLATLKNVIKDPELDGWNLYLGDWGYNTHKERGEAASIPRITL  257



>ref|XP_010523762.1| PREDICTED: uncharacterized protein LOC104802037 [Tarenaya hassleriana]
Length=268

 Score =   305 bits (782),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VAEGLTVD ILE+W KIKPVI+E WNE+RDAL+DLFGKVRDEWMD DL+TW+GANRFYP
Sbjct  83   SVAEGLTVDVILESWSKIKPVIMEAWNEDRDALVDLFGKVRDEWMDKDLTTWMGANRFYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GV+DAL+FASS+VYIVTTKQSRFA ALLRELAGVTIP ERIYGLGTGPK +VLK LQ  P
Sbjct  143  GVSDALRFASSRVYIVTTKQSRFADALLRELAGVTIPSERIYGLGTGPKVEVLKLLQNKP  202

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            EHQGLTLHFVEDRLATLKNVIKEPELN WNLYLG+WGYNT KER EAA I RI++
Sbjct  203  EHQGLTLHFVEDRLATLKNVIKEPELNKWNLYLGNWGYNTEKERAEAAGIPRIQV  257



>ref|XP_002320140.1| hypothetical protein POPTR_0014s08190g [Populus trichocarpa]
 gb|EEE98455.1| hypothetical protein POPTR_0014s08190g [Populus trichocarpa]
Length=268

 Score =   305 bits (781),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VAEGLTVD IL+NW KIKPVI+EEW ENRDALI+LFGKVRDEWMDNDL+TWIGANRFYP
Sbjct  83   SVAEGLTVDGILDNWSKIKPVIMEEWAENRDALIELFGKVRDEWMDNDLATWIGANRFYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GV DALKFASS +YIVTTKQSRFA ALL+ELAG+ IPPERIYGLGTGPK +VLKQLQ  P
Sbjct  143  GVPDALKFASSSIYIVTTKQSRFADALLQELAGLKIPPERIYGLGTGPKVEVLKQLQRKP  202

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            EHQGL LHFVEDRLATLKNVIK+PEL+GWNLYLGDWGYNT +ER EAA I RI +
Sbjct  203  EHQGLKLHFVEDRLATLKNVIKDPELDGWNLYLGDWGYNTHQERGEAASIPRITL  257



>ref|XP_012083365.1| PREDICTED: uncharacterized protein LOC105642967 isoform X1 [Jatropha 
curcas]
 gb|KDP28611.1| hypothetical protein JCGZ_14382 [Jatropha curcas]
Length=269

 Score =   305 bits (781),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 159/175 (91%), Gaps = 1/175 (1%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNEN-RDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
            VAEGLTV+ ILENW+K+KPVI+EEW EN RD LI+LFGKVRDEWM  DL  WIGANRFYP
Sbjct  84   VAEGLTVERILENWLKLKPVIMEEWGENHRDDLINLFGKVRDEWMYKDLPAWIGANRFYP  143

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GVADALKFASSKVYIVTTKQSRFA ALLRELAGVTIP ERIYGLGTGPK KVLKQLQ+ P
Sbjct  144  GVADALKFASSKVYIVTTKQSRFADALLRELAGVTIPSERIYGLGTGPKVKVLKQLQQKP  203

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            EH+GLTLHFVEDRLATLKNVIKEPEL+GWNLYLGDWGYNT KEREEAA I RI +
Sbjct  204  EHRGLTLHFVEDRLATLKNVIKEPELDGWNLYLGDWGYNTQKEREEAASIPRIHL  258



>ref|XP_006601835.1| PREDICTED: uncharacterized protein LOC100810003 isoform X1 [Glycine 
max]
Length=236

 Score =   303 bits (777),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTV+ ILENW K+KP+I+EEW+E RD LIDLFGKVRDEW++ D +TWIGANR YPG
Sbjct  52   VAEGLTVEGILENWSKLKPIIMEEWDEKRDDLIDLFGKVRDEWLEQDFATWIGANRLYPG  111

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V+DALKFASS+VYIVTTKQSRFA ALLRELAGVTIPPERIYGLGTGPK +VLKQLQ+ PE
Sbjct  112  VSDALKFASSRVYIVTTKQSRFADALLRELAGVTIPPERIYGLGTGPKVEVLKQLQKKPE  171

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGLTLHFVEDRLATLKNVIKEPEL+ WNLYLG+WGYNT KEREEAA I RI +
Sbjct  172  HQGLTLHFVEDRLATLKNVIKEPELDQWNLYLGNWGYNTQKEREEAAAIPRIHV  225



>ref|XP_004138497.1| PREDICTED: uncharacterized protein LOC101221288 [Cucumis sativus]
 gb|KGN45668.1| hypothetical protein Csa_6G004590 [Cucumis sativus]
Length=268

 Score =   305 bits (780),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTV  ILENW K+KPVI+EEW ENRDALIDLFGKVRD+W+D DL+TWIGANRFYPG
Sbjct  84   VAEGLTVHGILENWSKLKPVIMEEWGENRDALIDLFGKVRDQWIDEDLATWIGANRFYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V+DALKFASS++YIVTTKQ RFA ALLRELAGVTIPPERIYGLGTGPK +VLK LQ+MPE
Sbjct  144  VSDALKFASSRIYIVTTKQGRFADALLRELAGVTIPPERIYGLGTGPKVEVLKMLQKMPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGL LHFVEDRLATLKNVIKE EL+GWN+YL DWGYNT KEREEAA I RI++
Sbjct  204  HQGLKLHFVEDRLATLKNVIKESELDGWNIYLVDWGYNTQKEREEAAAIKRIQL  257



>ref|NP_001239728.1| uncharacterized protein LOC100810003 [Glycine max]
 gb|ACU24371.1| unknown [Glycine max]
 gb|KHM99366.1| hypothetical protein glysoja_028823 [Glycine soja]
Length=268

 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTV+ ILENW K+KP+I+EEW+E RD LIDLFGKVRDEW++ D +TWIGANR YPG
Sbjct  84   VAEGLTVEGILENWSKLKPIIMEEWDEKRDDLIDLFGKVRDEWLEQDFATWIGANRLYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V+DALKFASS+VYIVTTKQSRFA ALLRELAGVTIPPERIYGLGTGPK +VLKQLQ+ PE
Sbjct  144  VSDALKFASSRVYIVTTKQSRFADALLRELAGVTIPPERIYGLGTGPKVEVLKQLQKKPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGLTLHFVEDRLATLKNVIKEPEL+ WNLYLG+WGYNT KEREEAA I RI +
Sbjct  204  HQGLTLHFVEDRLATLKNVIKEPELDQWNLYLGNWGYNTQKEREEAAAIPRIHV  257



>ref|XP_008458208.1| PREDICTED: uncharacterized protein LOC103497707 [Cucumis melo]
Length=269

 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 160/175 (91%), Gaps = 1/175 (1%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNE-NRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
            VAEGLTV  ILENW K+KPVI+EEW E NRDALIDLFGKVRD+W+D DL+TWIGANRFYP
Sbjct  84   VAEGLTVHGILENWSKLKPVIMEEWGEKNRDALIDLFGKVRDQWIDEDLATWIGANRFYP  143

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GV+DALKFASS++YIVTTKQ RFA ALLRELAGVTIPPERIYGLGTGPK +VLK LQ+MP
Sbjct  144  GVSDALKFASSRIYIVTTKQGRFAEALLRELAGVTIPPERIYGLGTGPKVEVLKMLQKMP  203

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            EHQGL LHFVEDRLATLKNVIKEPEL+GWN+YL DWGYNT KEREEAA I RI++
Sbjct  204  EHQGLKLHFVEDRLATLKNVIKEPELDGWNIYLVDWGYNTQKEREEAAAIQRIQL  258



>ref|XP_008244645.1| PREDICTED: uncharacterized protein LOC103342773 isoform X1 [Prunus 
mume]
Length=268

 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEG+TV+ ILE W ++KPVI+EEW E RDALI+LFGKVRDEWMD DL+TWIGANR YPG
Sbjct  84   VAEGITVEGILEKWSELKPVIMEEWGEERDALINLFGKVRDEWMDEDLTTWIGANRLYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V DALKFASS +YIVTTKQSRFA ALLRELAGVTIPPERI+GLG+GPK +VLKQLQ+ PE
Sbjct  144  VPDALKFASSTIYIVTTKQSRFADALLRELAGVTIPPERIFGLGSGPKVEVLKQLQKKPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGL LHFVEDRLATLKNVIKEPEL+GWNLYLGDWGYNT KEREEAA I RIRI
Sbjct  204  HQGLKLHFVEDRLATLKNVIKEPELDGWNLYLGDWGYNTQKEREEAATIPRIRI  257



>ref|XP_008244646.1| PREDICTED: uncharacterized protein LOC103342773 isoform X2 [Prunus 
mume]
 ref|XP_008244647.1| PREDICTED: uncharacterized protein LOC103342773 isoform X2 [Prunus 
mume]
Length=265

 Score =   302 bits (774),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VAEG+TV+ ILE W ++KPVI+EEW E RDALI+LFGKVRDEWMD DL+TWIGANR YP
Sbjct  83   SVAEGITVEGILEKWSELKPVIMEEWGEERDALINLFGKVRDEWMDEDLTTWIGANRLYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GV DALKFASS +YIVTTKQSRFA ALLRELAGVTIPPERI+GLG+GPK +VLKQLQ+ P
Sbjct  143  GVPDALKFASSTIYIVTTKQSRFADALLRELAGVTIPPERIFGLGSGPKVEVLKQLQKKP  202

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            EHQGL LHFVEDRLATLKNVIKEPEL+GWNLYLGDWGYNT KEREEAA I RIRI
Sbjct  203  EHQGLKLHFVEDRLATLKNVIKEPELDGWNLYLGDWGYNTQKEREEAATIPRIRI  257



>ref|XP_010670120.1| PREDICTED: uncharacterized protein LOC104887219 [Beta vulgaris 
subsp. vulgaris]
Length=269

 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 161/175 (92%), Gaps = 1/175 (1%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNE-NRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
            VAEGLT++ ILENW K+K VI+EEW+E NR+ LIDLFGK+RDEW++NDL+TWIGANR YP
Sbjct  84   VAEGLTIEGILENWPKLKAVIMEEWDEKNREVLIDLFGKIRDEWIENDLATWIGANRLYP  143

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GV+DAL+F SSK+YIVTTKQSRFA ALLRELAGVTIPPERIYGLGTGPK +VLK LQ++P
Sbjct  144  GVSDALRFTSSKIYIVTTKQSRFADALLRELAGVTIPPERIYGLGTGPKVEVLKMLQKLP  203

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            EHQGL LHFVEDRLATLKNVIKEPEL+GWNLYLGDWGYNT KEREEAA I RIR+
Sbjct  204  EHQGLALHFVEDRLATLKNVIKEPELDGWNLYLGDWGYNTKKEREEAATIPRIRV  258



>gb|AFK38203.1| unknown [Lotus japonicus]
Length=268

 Score =   300 bits (769),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/174 (82%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTVD ILE W K+KPVI+EEW ENRDALIDLFGKVRDEW++ + +TWIGANR YPG
Sbjct  84   VAEGLTVDGILEKWSKLKPVIMEEWGENRDALIDLFGKVRDEWLEQNFATWIGANRIYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V+DALKFASS+VYIVTTKQSRFA A+LRELAGVTIPPERIYGLG+GPK +VLKQLQ+ PE
Sbjct  144  VSDALKFASSRVYIVTTKQSRFADAILRELAGVTIPPERIYGLGSGPKVEVLKQLQKKPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQG TLHFVEDRLATLKNVIKEPEL+ WNLYLG+WGYNT KE+EEAA I+RI++
Sbjct  204  HQGPTLHFVEDRLATLKNVIKEPELDQWNLYLGNWGYNTRKEKEEAAAISRIQV  257



>ref|XP_007218810.1| hypothetical protein PRUPE_ppa009991mg [Prunus persica]
 gb|EMJ20009.1| hypothetical protein PRUPE_ppa009991mg [Prunus persica]
Length=268

 Score =   300 bits (768),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEG+TV+ ILE W ++KPVI+EEW E RDALI+LFGKVRDEWMD  L+TWIGANR YPG
Sbjct  84   VAEGITVEGILEKWSELKPVIMEEWGEERDALINLFGKVRDEWMDEGLTTWIGANRLYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V DALKFASS +YIVTTKQSRFA ALLRELAGVTIPPERI+GLG+GPK +VLKQLQ+ PE
Sbjct  144  VPDALKFASSTIYIVTTKQSRFADALLRELAGVTIPPERIFGLGSGPKVEVLKQLQKKPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGL LHFVEDRLATLKNVIKEPEL+GWNLYLGDWGYNT KEREEAA I RIRI
Sbjct  204  HQGLKLHFVEDRLATLKNVIKEPELDGWNLYLGDWGYNTQKEREEAATIPRIRI  257



>ref|XP_002275801.1| PREDICTED: uncharacterized protein LOC100260183 [Vitis vinifera]
 emb|CBI40393.3| unnamed protein product [Vitis vinifera]
Length=268

 Score =   300 bits (768),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/174 (82%), Positives = 159/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            V EGLT++ ILENW K+KPVI+EEW+E R+ L+DLFGKVRDEWM++DL+TWI ANRFYPG
Sbjct  84   VVEGLTIEGILENWSKLKPVIMEEWDEKREPLVDLFGKVRDEWMEDDLATWIDANRFYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            VADALKFASSKVYIVTTKQ RFA ALLRELAGVTIP ERIYGLGTGPK +VLKQLQ+  E
Sbjct  144  VADALKFASSKVYIVTTKQGRFAEALLRELAGVTIPSERIYGLGTGPKVEVLKQLQKQSE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGLTLHFVEDRLATLKNVIKEPEL+GWNLYLG WGYNT KEREEAA I+RI++
Sbjct  204  HQGLTLHFVEDRLATLKNVIKEPELDGWNLYLGKWGYNTQKEREEAAGISRIQL  257



>ref|XP_009384561.1| PREDICTED: uncharacterized protein LOC103972086 [Musa acuminata 
subsp. malaccensis]
Length=269

 Score =   300 bits (768),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VA+GLTV+ ILENW ++KP+I++EW+E RDALIDLFG++RDEW+DNDLS WIGANRFYP
Sbjct  84   SVADGLTVEAILENWSQMKPIIMKEWDEERDALIDLFGRIRDEWIDNDLSGWIGANRFYP  143

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GVADAL+FASS++YIVTTKQ+RFA ALLRELAGVTIP ERIYGLGTGPK KVLKQLQEMP
Sbjct  144  GVADALRFASSQLYIVTTKQARFADALLRELAGVTIPAERIYGLGTGPKVKVLKQLQEMP  203

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            EHQGL+LHFVEDRLATLKNVIKEP L GWNLYLG WGYNT KER EA  I RI++
Sbjct  204  EHQGLSLHFVEDRLATLKNVIKEPALAGWNLYLGRWGYNTEKERAEAESIPRIQL  258



>ref|XP_007139823.1| hypothetical protein PHAVU_008G061600g [Phaseolus vulgaris]
 gb|ESW11817.1| hypothetical protein PHAVU_008G061600g [Phaseolus vulgaris]
Length=268

 Score =   300 bits (767),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTV+ ILE W K+KP+I+EEW ENRDALIDLFGKVRDEW++ D + WIGANR YPG
Sbjct  84   VAEGLTVEAILEKWFKLKPIIMEEWGENRDALIDLFGKVRDEWLEQDFAAWIGANRIYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V+DALKFASS+VYIVTTKQSRFA ALLRELAGV+IPPERIYGLGTGPK +VLKQLQ+ PE
Sbjct  144  VSDALKFASSRVYIVTTKQSRFADALLRELAGVSIPPERIYGLGTGPKVEVLKQLQKKPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGLTLHFVEDRLATLKNVIKEPEL+ W LYLG+WGYNT KERE+AA I RI +
Sbjct  204  HQGLTLHFVEDRLATLKNVIKEPELDKWKLYLGNWGYNTQKEREDAAAIPRIHV  257



>ref|XP_010056396.1| PREDICTED: uncharacterized protein LOC104444425 [Eucalyptus grandis]
 gb|KCW73107.1| hypothetical protein EUGRSUZ_E01551 [Eucalyptus grandis]
Length=268

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLT+D ILE+W KIKPVI+EEW ENR+ L+DLFGKVRDEWMD DL TWI ANRFYPG
Sbjct  84   VAEGLTIDGILESWSKIKPVIMEEWGENRETLVDLFGKVRDEWMDKDLGTWIAANRFYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V DAL+ ASS ++IVTTKQSRFA ALL++LAGVTIP E+IYGLGTGPK +VLKQLQ+ PE
Sbjct  144  VPDALQLASSSIFIVTTKQSRFADALLQKLAGVTIPREKIYGLGTGPKVEVLKQLQKRPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGL LHFVEDRLATLKNVIKEPEL+GWNLYLGDWGYNT KEREEAA I+RI I
Sbjct  204  HQGLKLHFVEDRLATLKNVIKEPELDGWNLYLGDWGYNTKKEREEAASISRIEI  257



>ref|XP_004492754.1| PREDICTED: uncharacterized protein LOC101510342 isoform X1 [Cicer 
arietinum]
Length=277

 Score =   298 bits (762),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGL V+ ILENW K+KP+I+EEW EN+DALIDLFGKVRDEW++ D + WIGANR YPG
Sbjct  93   VAEGLAVEGILENWSKLKPIIMEEWGENKDALIDLFGKVRDEWLEQDFAAWIGANRIYPG  152

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V+DALKFASS+VYIVTTKQ RFA ALLRELAGVTIPPERIYGLGTGPK ++LKQLQ+ PE
Sbjct  153  VSDALKFASSRVYIVTTKQGRFADALLRELAGVTIPPERIYGLGTGPKVEILKQLQKRPE  212

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGLTLHFVEDRLATLKNVIK+PEL+ WNLYLG+WGYNT +E+EEA  I+RIR+
Sbjct  213  HQGLTLHFVEDRLATLKNVIKDPELDKWNLYLGNWGYNTAQEKEEAEAISRIRV  266



>ref|XP_004492755.1| PREDICTED: uncharacterized protein LOC101510342 isoform X2 [Cicer 
arietinum]
Length=268

 Score =   297 bits (761),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGL V+ ILENW K+KP+I+EEW EN+DALIDLFGKVRDEW++ D + WIGANR YPG
Sbjct  84   VAEGLAVEGILENWSKLKPIIMEEWGENKDALIDLFGKVRDEWLEQDFAAWIGANRIYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V+DALKFASS+VYIVTTKQ RFA ALLRELAGVTIPPERIYGLGTGPK ++LKQLQ+ PE
Sbjct  144  VSDALKFASSRVYIVTTKQGRFADALLRELAGVTIPPERIYGLGTGPKVEILKQLQKRPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGLTLHFVEDRLATLKNVIK+PEL+ WNLYLG+WGYNT +E+EEA  I+RIR+
Sbjct  204  HQGLTLHFVEDRLATLKNVIKDPELDKWNLYLGNWGYNTAQEKEEAEAISRIRV  257



>gb|AFK49194.1| unknown [Lotus japonicus]
Length=270

 Score =   295 bits (756),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VA+GLTV++ILENW+K+KPVI+EEWNENR+ LI+LFGKVRD+W++ D + WIGANR YP
Sbjct  85   SVADGLTVEDILENWLKLKPVIMEEWNENREDLIELFGKVRDDWLEKDFNGWIGANRLYP  144

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            G ADAL+FASS+VYIVTTKQ RFA ALLRELAGVT+PPERIYGLGTGPK +VLK+LQ+MP
Sbjct  145  GTADALRFASSRVYIVTTKQGRFADALLRELAGVTLPPERIYGLGTGPKVEVLKKLQKMP  204

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            EHQGLTLHFVEDRLATLKNVIKEPEL+GWNLYL DWG+NT KEREEAA   RI++
Sbjct  205  EHQGLTLHFVEDRLATLKNVIKEPELDGWNLYLVDWGFNTQKEREEAAANPRIQV  259



>ref|XP_006445011.1| hypothetical protein CICLE_v10021689mg [Citrus clementina]
 gb|ESR58251.1| hypothetical protein CICLE_v10021689mg [Citrus clementina]
Length=218

 Score =   293 bits (750),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTV+EILENW+KIKPVI+EEW+ENR+ALI+L GKVRDEWMD D +TWIGANR YPG
Sbjct  34   VAEGLTVEEILENWLKIKPVIMEEWSENREALIELSGKVRDEWMDTDFTTWIGANRLYPG  93

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V+DALK ASS++YIVT+ QSRF   LLRELAGVTIPP+R+YGLG GPK  VLKQLQ+ PE
Sbjct  94   VSDALKLASSRIYIVTSNQSRFVETLLRELAGVTIPPDRLYGLGAGPKVNVLKQLQKKPE  153

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGL LHFVEDRLATLKNVIKEPEL+GWNLYL DWGYNT KER EAA + RI++
Sbjct  154  HQGLRLHFVEDRLATLKNVIKEPELDGWNLYLVDWGYNTQKERAEAASMPRIQL  207



>ref|XP_003623980.1| hypothetical protein MTR_7g077870 [Medicago truncatula]
 gb|ACJ85251.1| unknown [Medicago truncatula]
 gb|AES80198.1| hypothetical protein MTR_7g077870 [Medicago truncatula]
 gb|AFK47507.1| unknown [Medicago truncatula]
Length=268

 Score =   294 bits (753),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGL V+ ILE+W  +KP+I+EEW ENR+ALIDLFGKVRDEW++ D + WIGANR YPG
Sbjct  84   VAEGLAVEGILESWSTLKPIIMEEWGENREALIDLFGKVRDEWLEQDFAAWIGANRIYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V+DALKFASSKV+IVTTKQSRFA ALLRELAGVTIP ERIYGLGTGPK ++LKQLQ+ PE
Sbjct  144  VSDALKFASSKVFIVTTKQSRFADALLRELAGVTIPSERIYGLGTGPKVEILKQLQKRPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGLTLHFVEDRLATLKNVIKEPEL+ WNLYLG+WGYNT +E+EEAA I RIR+
Sbjct  204  HQGLTLHFVEDRLATLKNVIKEPELDKWNLYLGNWGYNTAQEKEEAAAIPRIRV  257



>gb|KDO86214.1| hypothetical protein CISIN_1g024003mg [Citrus sinensis]
Length=218

 Score =   292 bits (747),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTV+ ILENW+KIKPVI+EEW+ENR+ALI+L GKVRDEWMD D +TWIGANR YPG
Sbjct  34   VAEGLTVEGILENWLKIKPVIMEEWSENREALIELSGKVRDEWMDTDFTTWIGANRLYPG  93

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V+DALK ASS++YIVT+ QSRF   LLRELAGVTI P+R+YGLGTGPK  VLKQLQ+ PE
Sbjct  94   VSDALKLASSRIYIVTSNQSRFVETLLRELAGVTITPDRLYGLGTGPKVNVLKQLQKKPE  153

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGL LHFVEDRLATLKNVIKEPEL+GWNLYL DWGYNTPKER EAA + RI++
Sbjct  154  HQGLRLHFVEDRLATLKNVIKEPELDGWNLYLVDWGYNTPKERAEAASMPRIQL  207



>ref|XP_006491134.1| PREDICTED: uncharacterized protein LOC102608197 isoform X1 [Citrus 
sinensis]
Length=274

 Score =   293 bits (751),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 155/175 (89%), Gaps = 0/175 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VAEGLTV+EILENW+KIKPVI+EEW+ENR+ALI+L GKVRDEWMD D +TWIGANR YP
Sbjct  89   SVAEGLTVEEILENWLKIKPVIMEEWSENREALIELSGKVRDEWMDTDFTTWIGANRLYP  148

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GV+DALK ASS++YIVT+ QSRF   LLRELAGVTIPP+R+YGLG GPK  VLKQLQ+ P
Sbjct  149  GVSDALKLASSRIYIVTSNQSRFVETLLRELAGVTIPPDRLYGLGAGPKVNVLKQLQKKP  208

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            EHQGL LHFVEDRLATLKNVIKEPEL+GWNLYL DWGYNT KER EAA + RI++
Sbjct  209  EHQGLRLHFVEDRLATLKNVIKEPELDGWNLYLVDWGYNTQKERAEAASMPRIQL  263



>ref|XP_006445012.1| hypothetical protein CICLE_v10021689mg [Citrus clementina]
 ref|XP_006491135.1| PREDICTED: uncharacterized protein LOC102608197 isoform X2 [Citrus 
sinensis]
 gb|ESR58252.1| hypothetical protein CICLE_v10021689mg [Citrus clementina]
Length=268

 Score =   293 bits (750),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 155/175 (89%), Gaps = 0/175 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VAEGLTV+EILENW+KIKPVI+EEW+ENR+ALI+L GKVRDEWMD D +TWIGANR YP
Sbjct  83   SVAEGLTVEEILENWLKIKPVIMEEWSENREALIELSGKVRDEWMDTDFTTWIGANRLYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GV+DALK ASS++YIVT+ QSRF   LLRELAGVTIPP+R+YGLG GPK  VLKQLQ+ P
Sbjct  143  GVSDALKLASSRIYIVTSNQSRFVETLLRELAGVTIPPDRLYGLGAGPKVNVLKQLQKKP  202

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            EHQGL LHFVEDRLATLKNVIKEPEL+GWNLYL DWGYNT KER EAA + RI++
Sbjct  203  EHQGLRLHFVEDRLATLKNVIKEPELDGWNLYLVDWGYNTQKERAEAASMPRIQL  257



>ref|XP_002880212.1| hypothetical protein ARALYDRAFT_904052 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56471.1| hypothetical protein ARALYDRAFT_904052 [Arabidopsis lyrata subsp. 
lyrata]
Length=268

 Score =   293 bits (749),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTVD ILE+W KIKPVI+E W+E++DALIDLFGKVRD+W++ DL+TWIGANRFYPG
Sbjct  84   VAEGLTVDGILESWAKIKPVIMEAWDEDKDALIDLFGKVRDDWINKDLTTWIGANRFYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V+DALKFASSK+YIVTTKQ RFA ALLRE+AGV IP ERIYGLG+GPK +VLK +Q+ PE
Sbjct  144  VSDALKFASSKIYIVTTKQGRFAEALLREIAGVIIPSERIYGLGSGPKVEVLKLIQDKPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGLTLHFVEDRLATLKNVIKEPEL+ WNLYLG+WGYNT KER EAA I RI++
Sbjct  204  HQGLTLHFVEDRLATLKNVIKEPELDKWNLYLGNWGYNTEKERAEAASIPRIQV  257



>gb|KDO86211.1| hypothetical protein CISIN_1g024003mg [Citrus sinensis]
Length=268

 Score =   292 bits (748),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 155/175 (89%), Gaps = 0/175 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VAEGLTV+ ILENW+KIKPVI+EEW+ENR+ALI+L GKVRDEWMD D +TWIGANR YP
Sbjct  83   SVAEGLTVEGILENWLKIKPVIMEEWSENREALIELSGKVRDEWMDTDFTTWIGANRLYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GV+DALK ASS++YIVT+ QSRF   LLRELAGVTI P+R+YGLGTGPK  VLKQLQ+ P
Sbjct  143  GVSDALKLASSRIYIVTSNQSRFVETLLRELAGVTITPDRLYGLGTGPKVNVLKQLQKKP  202

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            EHQGL LHFVEDRLATLKNVIKEPEL+GWNLYL DWGYNTPKER EAA + RI++
Sbjct  203  EHQGLRLHFVEDRLATLKNVIKEPELDGWNLYLVDWGYNTPKERAEAASMPRIQL  257



>gb|KDO86210.1| hypothetical protein CISIN_1g024003mg [Citrus sinensis]
Length=274

 Score =   292 bits (748),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 155/175 (89%), Gaps = 0/175 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VAEGLTV+ ILENW+KIKPVI+EEW+ENR+ALI+L GKVRDEWMD D +TWIGANR YP
Sbjct  89   SVAEGLTVEGILENWLKIKPVIMEEWSENREALIELSGKVRDEWMDTDFTTWIGANRLYP  148

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GV+DALK ASS++YIVT+ QSRF   LLRELAGVTI P+R+YGLGTGPK  VLKQLQ+ P
Sbjct  149  GVSDALKLASSRIYIVTSNQSRFVETLLRELAGVTITPDRLYGLGTGPKVNVLKQLQKKP  208

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            EHQGL LHFVEDRLATLKNVIKEPEL+GWNLYL DWGYNTPKER EAA + RI++
Sbjct  209  EHQGLRLHFVEDRLATLKNVIKEPELDGWNLYLVDWGYNTPKERAEAASMPRIQL  263



>ref|XP_010508078.1| PREDICTED: uncharacterized protein LOC104784717 [Camelina sativa]
Length=302

 Score =   293 bits (750),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTVD ILE+W KIKPVI+E W+E++DALIDLFGKVRD+WM+ DL+TWIGANRFYPG
Sbjct  118  VAEGLTVDGILESWAKIKPVIMEAWDEDKDALIDLFGKVRDDWMNEDLTTWIGANRFYPG  177

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V+DALKFASSK+YIVTTKQ RFA ALLRE+AGV IP ERIYGLG+GPK +VLK LQ  PE
Sbjct  178  VSDALKFASSKIYIVTTKQGRFAEALLREIAGVIIPKERIYGLGSGPKVEVLKLLQYKPE  237

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGL LHFVEDRLATLKNVIKEPEL+ WNLYLG+WGYNT KER EAA I RI++
Sbjct  238  HQGLMLHFVEDRLATLKNVIKEPELDKWNLYLGNWGYNTEKERAEAASIPRIQV  291



>ref|XP_004306764.1| PREDICTED: uncharacterized protein LOC101294106 [Fragaria vesca 
subsp. vesca]
Length=268

 Score =   291 bits (746),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTV+ ILE W  +KPVI++EW E +D L++LFGKVRDEWMD D++TWIGANR YPG
Sbjct  84   VAEGLTVEGILEKWSVLKPVIMKEWGEEKDPLVNLFGKVRDEWMDQDMATWIGANRIYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V+DAL+FASS +YIVTTKQSRFA ALLRELAGV IPPERI+GLG+GPK +VLK LQ+ PE
Sbjct  144  VSDALRFASSTIYIVTTKQSRFADALLRELAGVMIPPERIFGLGSGPKVEVLKMLQKKPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGL LHFVEDRLATLKNVIKEPEL+GWNLYLGDWGYNT KER+EAA+I+RI+I
Sbjct  204  HQGLKLHFVEDRLATLKNVIKEPELDGWNLYLGDWGYNTEKERDEAARISRIQI  257



>ref|XP_007139822.1| hypothetical protein PHAVU_008G061500g [Phaseolus vulgaris]
 gb|ESW11816.1| hypothetical protein PHAVU_008G061500g [Phaseolus vulgaris]
Length=268

 Score =   291 bits (746),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             V+EGL V++ILENW K+KP+I+EEWNENR+ LIDLFGKVRDEW++ D + WIGANR YP
Sbjct  83   SVSEGLAVEDILENWFKLKPIIMEEWNENREDLIDLFGKVRDEWLERDFTGWIGANRLYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GVADAL+FASSKVYIVTTKQ RFA ALLRELAGVTIPPER+YGLGTGPK KVLK+LQ +P
Sbjct  143  GVADALRFASSKVYIVTTKQGRFADALLRELAGVTIPPERLYGLGTGPKVKVLKKLQNLP  202

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            EH+GLTLHFVEDRLATLKNVIKEPEL+ WNLYL +WG+NT KEREEAA   RI++
Sbjct  203  EHKGLTLHFVEDRLATLKNVIKEPELDNWNLYLVNWGFNTQKEREEAAANPRIQV  257



>ref|XP_009367812.1| PREDICTED: uncharacterized protein LOC103957377 [Pyrus x bretschneideri]
Length=268

 Score =   291 bits (746),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTV+ IL+ W ++KPVI+ EW E RDALI LFG+VRDEWMD DL TWIGANR YPG
Sbjct  84   VAEGLTVEGILDKWSELKPVIMAEWGEERDALIHLFGQVRDEWMDEDLKTWIGANRLYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V DAL+FASS +YIVTTKQSRFA ALLRELAGVTIPPE+I+GLG+GPK +VLKQ+Q+ PE
Sbjct  144  VPDALRFASSTIYIVTTKQSRFADALLRELAGVTIPPEKIFGLGSGPKVEVLKQIQKKPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGL LHFVEDRLATLKNVIKEPEL+GWNLYLG+WGYNT KEREEAA I RI+I
Sbjct  204  HQGLKLHFVEDRLATLKNVIKEPELDGWNLYLGNWGYNTQKEREEAATIPRIQI  257



>ref|XP_010255310.1| PREDICTED: uncharacterized protein LOC104596025 isoform X3 [Nelumbo 
nucifera]
Length=238

 Score =   290 bits (741),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VA+GLT+D IL+NW K+KPVI+EEW+ENR++LI+LFGKVRDEW++  LS+WIGANRFYPG
Sbjct  54   VADGLTIDRILDNWSKLKPVIMEEWDENRESLIELFGKVRDEWIEKGLSSWIGANRFYPG  113

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V DALKFASS++YIVTTKQ+RFA ALLRELAGVTIP  RIYGLGTGPK +VLKQLQ   E
Sbjct  114  VPDALKFASSRIYIVTTKQARFADALLRELAGVTIPSHRIYGLGTGPKVEVLKQLQSKEE  173

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            ++GLTLHFVEDRLATLKNVIK PEL+GWNLYLGDWGYNT KEREEAA I RI++
Sbjct  174  NKGLTLHFVEDRLATLKNVIKVPELDGWNLYLGDWGYNTQKEREEAATIPRIQL  227



>ref|XP_010918743.1| PREDICTED: uncharacterized protein LOC105043034 [Elaeis guineensis]
Length=269

 Score =   291 bits (744),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 155/175 (89%), Gaps = 0/175 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VA+GLTV+ IL NW ++KP+I++EWNE+RDALIDLFG+VRD+WM NDLS WI ANRFYP
Sbjct  84   SVADGLTVEAILNNWSQLKPIIMKEWNEDRDALIDLFGRVRDDWMQNDLSGWISANRFYP  143

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GVADAL+FASS+VYIVTTKQSRFA ALLRELAGVTIP ERIYGLGTGPK +VLK+LQ MP
Sbjct  144  GVADALRFASSQVYIVTTKQSRFADALLRELAGVTIPSERIYGLGTGPKVEVLKKLQAMP  203

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            EH  LTLHFVEDRLATLKNVIKEP L+ WNLYLG WGYNT KER+EA  I+RI +
Sbjct  204  EHDSLTLHFVEDRLATLKNVIKEPALDRWNLYLGRWGYNTEKERKEAQSISRIHM  258



>ref|XP_010518258.1| PREDICTED: uncharacterized protein LOC104793570 [Camelina sativa]
Length=268

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTVD ILE+W KIKPVI+E W+E++DALIDLFGKVRD+WM+ DL+TWIGANRFYPG
Sbjct  84   VAEGLTVDGILESWAKIKPVIMEAWDEDKDALIDLFGKVRDDWMNEDLTTWIGANRFYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V+DALKFASSK+YIVTTKQ RFA ALLRE+AGV IP ERIY LG+GPK +VLK LQ  PE
Sbjct  144  VSDALKFASSKIYIVTTKQGRFAEALLREIAGVIIPSERIYALGSGPKVEVLKLLQNKPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGL LHFVEDRLATLKNVIKEPEL+ WNLYLG+WGYNT +ER EAA I RI++
Sbjct  204  HQGLMLHFVEDRLATLKNVIKEPELDKWNLYLGNWGYNTERERAEAASIPRIQV  257



>ref|NP_566060.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_850443.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAC62903.1| expressed protein [Arabidopsis thaliana]
 gb|AAK92725.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14973.1| expressed protein [Arabidopsis thaliana]
 gb|AAM45106.1| unknown protein [Arabidopsis thaliana]
 dbj|BAH19560.1| AT2G45990 [Arabidopsis thaliana]
 gb|AEC10627.1| uncharacterized protein AT2G45990 [Arabidopsis thaliana]
 gb|AEC10628.1| uncharacterized protein AT2G45990 [Arabidopsis thaliana]
Length=268

 Score =   290 bits (742),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTVD ILE+W K KPVI+E W+E+RDAL+DLFGKVRD+W++ DL+TWIGANRFYPG
Sbjct  84   VAEGLTVDGILESWAKFKPVIMEAWDEDRDALVDLFGKVRDDWINKDLTTWIGANRFYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V+DALKFASSK+YIVTTKQ RFA ALLRE+AGV IP ERIYGLG+GPK +VLK LQ+ PE
Sbjct  144  VSDALKFASSKIYIVTTKQGRFAEALLREIAGVIIPSERIYGLGSGPKVEVLKLLQDKPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGLTLHFVEDRLATLKNVIKEPEL+ W+LYLG WGYNT KER EAA I RI++
Sbjct  204  HQGLTLHFVEDRLATLKNVIKEPELDKWSLYLGTWGYNTEKERAEAAGIPRIQV  257



>ref|XP_006397785.1| hypothetical protein EUTSA_v10001586mg [Eutrema salsugineum]
 gb|ESQ39238.1| hypothetical protein EUTSA_v10001586mg [Eutrema salsugineum]
Length=268

 Score =   290 bits (742),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTVD ILE W KIKPVI+E W+E++DAL+DLFGKVRD+W++ DL+TWIGANRFYPG
Sbjct  84   VAEGLTVDGILEGWGKIKPVIMEAWDEDKDALVDLFGKVRDDWINKDLTTWIGANRFYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V+DALKFASSK+YIVTTKQ RFA ALLRE+AGVT+P ER+YGLGTGPK +VLK LQ  PE
Sbjct  144  VSDALKFASSKIYIVTTKQGRFAEALLREIAGVTLPSERVYGLGTGPKVEVLKLLQNKPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGL LHFVEDRLATLKNVIKEP+L+ WNLYLG+WGYNT KER EAA I RI++
Sbjct  204  HQGLKLHFVEDRLATLKNVIKEPQLDNWNLYLGNWGYNTEKERAEAASIPRIQV  257



>ref|XP_010255309.1| PREDICTED: uncharacterized protein LOC104596025 isoform X2 [Nelumbo 
nucifera]
Length=268

 Score =   290 bits (742),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VA+GLT+D IL+NW K+KPVI+EEW+ENR++LI+LFGKVRDEW++  LS+WIGANRFYPG
Sbjct  84   VADGLTIDRILDNWSKLKPVIMEEWDENRESLIELFGKVRDEWIEKGLSSWIGANRFYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V DALKFASS++YIVTTKQ+RFA ALLRELAGVTIP  RIYGLGTGPK +VLKQLQ   E
Sbjct  144  VPDALKFASSRIYIVTTKQARFADALLRELAGVTIPSHRIYGLGTGPKVEVLKQLQSKEE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            ++GLTLHFVEDRLATLKNVIK PEL+GWNLYLGDWGYNT KEREEAA I RI++
Sbjct  204  NKGLTLHFVEDRLATLKNVIKVPELDGWNLYLGDWGYNTQKEREEAATIPRIQL  257



>gb|KFK37383.1| hypothetical protein AALP_AA4G250000 [Arabis alpina]
Length=268

 Score =   289 bits (740),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 155/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGL VD ILE+W KIKPVI+E W+E++DAL+DLFGKVRD+W+  DL+TWIGANRFYPG
Sbjct  84   VAEGLNVDGILESWGKIKPVIMEAWDEDKDALVDLFGKVRDDWIKEDLTTWIGANRFYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V+DALKFASSK+YIVTTKQ RFA ALLRE+AGV IP ERIYGLG+GPK +VLKQLQ  PE
Sbjct  144  VSDALKFASSKIYIVTTKQGRFAEALLREIAGVIIPSERIYGLGSGPKVEVLKQLQNKPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGLTLHFVEDRLATLKNVI EPEL+ WNLYLG+WGYNT KER EA+ I RI++
Sbjct  204  HQGLTLHFVEDRLATLKNVINEPELDKWNLYLGNWGYNTEKERAEASSIPRIQV  257



>emb|CAN70694.1| hypothetical protein VITISV_002394 [Vitis vinifera]
Length=275

 Score =   289 bits (740),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 158/181 (87%), Gaps = 7/181 (4%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            V EGLT++ ILENW K+KPVI+EEW+E R+ L+DLFGKVRDEWM++DL+TWI ANRFYPG
Sbjct  84   VVEGLTIEGILENWSKLKPVIMEEWDEKREPLVDLFGKVRDEWMEDDLATWIDANRFYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            VADALKFASSKVYIVTTKQ RFA ALLRELAGVTIP ERIYGLGTGPK +VLKQLQ+  E
Sbjct  144  VADALKFASSKVYIVTTKQGRFAEALLRELAGVTIPSERIYGLGTGPKVEVLKQLQKQSE  203

Query  353  HQGLTL-------HFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIR  195
            HQGLTL        FVEDRLATLKNVIKEPEL+GWNLYLG WGYNT KEREEAA I+RI+
Sbjct  204  HQGLTLPLYPILSSFVEDRLATLKNVIKEPELDGWNLYLGKWGYNTQKEREEAAGISRIQ  263

Query  194  I  192
            +
Sbjct  264  L  264



>ref|XP_003623981.1| hypothetical protein MTR_7g077880 [Medicago truncatula]
 gb|AES80199.1| hypothetical protein MTR_7g077880 [Medicago truncatula]
Length=268

 Score =   288 bits (737),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTV+ ILE+W K+KP+++EEWNENRD LIDLFGKVRD+W++ND + WI  NRFYPG
Sbjct  84   VAEGLTVEGILEDWFKLKPIVMEEWNENRDDLIDLFGKVRDDWLENDFAGWIQGNRFYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            VADAL+FASSKVYIVTTKQ RFA ALLRELAG+TIPPERIYGLGTGPK + LK+LQ+MPE
Sbjct  144  VADALRFASSKVYIVTTKQGRFADALLRELAGITIPPERIYGLGTGPKVETLKKLQKMPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGLTLHFVEDR+A LKNVIKEPEL+ WNLYL +WG+NT KER+EAA   RI++
Sbjct  204  HQGLTLHFVEDRIAALKNVIKEPELDNWNLYLVNWGFNTQKERDEAAANPRIQL  257



>ref|XP_004492759.1| PREDICTED: uncharacterized protein LOC101511624 [Cicer arietinum]
Length=268

 Score =   288 bits (737),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/174 (76%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGL V+ ILENW+K+KP+++EEWNENRD LIDLFGKVRD+W++ D + WI ANRF+PG
Sbjct  84   VAEGLIVEGILENWLKLKPIVMEEWNENRDELIDLFGKVRDDWLEKDFTGWIEANRFFPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
             ADAL+F+SS+VYIVTTKQ RFA ALL+ELAG+T+PPERIYGLGTGPK +VLK+LQ+MPE
Sbjct  144  AADALRFSSSRVYIVTTKQGRFADALLKELAGITLPPERIYGLGTGPKVEVLKKLQKMPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGLTLHFVEDRLATLKNVIKEPEL+ WNLYL DWG+NT KEREEAA   RI++
Sbjct  204  HQGLTLHFVEDRLATLKNVIKEPELDNWNLYLVDWGFNTQKEREEAAANPRIQL  257



>ref|XP_010508079.1| PREDICTED: uncharacterized protein LOC104784718 [Camelina sativa]
Length=268

 Score =   288 bits (736),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTVD ILE+W KIKPVI+E W+E++DALIDLFGKVRD+WM+ DL+TWIGANRFYPG
Sbjct  84   VAEGLTVDGILESWAKIKPVIMEAWDEDKDALIDLFGKVRDDWMNEDLTTWIGANRFYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V+DALKFASSK+YIVTTKQ RFA ALLRE+AGV IP ERIY LG+GPK +VLK LQ  PE
Sbjct  144  VSDALKFASSKIYIVTTKQGRFAEALLREIAGVIIPSERIYALGSGPKVEVLKLLQNKPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGL LHFVEDRLATLKNVIKEPEL+ WNLYL +WGYNT KER EAA I RI++
Sbjct  204  HQGLMLHFVEDRLATLKNVIKEPELDKWNLYLVNWGYNTEKERAEAASIPRIQV  257



>ref|XP_011469002.1| PREDICTED: uncharacterized protein LOC101295560 [Fragaria vesca 
subsp. vesca]
Length=266

 Score =   288 bits (736),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 153/174 (88%), Gaps = 2/174 (1%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            V EGLTV+ ILE W  +KPVI+EEW E+RD LIDLF KVRDEWMD+DL TWIGANR YPG
Sbjct  84   VGEGLTVEGILEKWSDLKPVIMEEWGEDRDGLIDLFAKVRDEWMDHDLKTWIGANRLYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V DALKF SS +Y+VTTKQSRFA ALLRELAGVTIPPERI+GLG+GPK +VLKQLQ+  +
Sbjct  144  VPDALKFTSSTIYVVTTKQSRFADALLRELAGVTIPPERIFGLGSGPKVEVLKQLQK--K  201

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGL LHF+EDRLATLKNVI EPELNGWNLYLGDWGYNT KEREEAA I+RI+I
Sbjct  202  HQGLKLHFLEDRLATLKNVIGEPELNGWNLYLGDWGYNTQKEREEAASISRIQI  255



>ref|XP_008343405.1| PREDICTED: uncharacterized protein LOC103406175 [Malus domestica]
Length=306

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VA GLTV  IL+ W ++KPVI+ EW E RDALI LFGKVRDEWMD DL TWIGANR YPG
Sbjct  122  VAXGLTVXGILDKWSELKPVIMAEWGEERDALIHLFGKVRDEWMDEDLKTWIGANRLYPG  181

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V DAL+FASS +YIVTTKQSRFA ALLRELAGVTIPPE+I+GLG+GPK +VLKQ+Q+ PE
Sbjct  182  VPDALRFASSTIYIVTTKQSRFADALLRELAGVTIPPEKIFGLGSGPKVEVLKQIQKKPE  241

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGL LHFVEDRLATLKNVIKEPEL+GWNLYLG+WGYNT KERE+AA I RI+I
Sbjct  242  HQGLKLHFVEDRLATLKNVIKEPELDGWNLYLGNWGYNTQKEREDAATIPRIQI  295



>gb|KHM99365.1| hypothetical protein glysoja_028822 [Glycine soja]
Length=268

 Score =   288 bits (736),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 156/174 (90%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            V+EGL V++ILENW K+KP+I+EEWNENR+ LIDLFGKVRD+W++ D + WIGANR YPG
Sbjct  84   VSEGLKVEDILENWFKLKPIIMEEWNENREELIDLFGKVRDDWLERDFTGWIGANRLYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
             ADAL+FASSKVYIVTTKQSRFA ALLRELAGVTI PER+YGLGTGPK +VLK+LQ+MPE
Sbjct  144  TADALRFASSKVYIVTTKQSRFADALLRELAGVTIAPERLYGLGTGPKVEVLKKLQKMPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGLTLHFVEDRLATLKNVIKEPEL+ WNLYL +WG+NT KEREEA    RI++
Sbjct  204  HQGLTLHFVEDRLATLKNVIKEPELDNWNLYLVNWGFNTQKEREEAQANPRIQV  257



>gb|KJB22335.1| hypothetical protein B456_004G042000 [Gossypium raimondii]
 gb|KJB22337.1| hypothetical protein B456_004G042000 [Gossypium raimondii]
Length=164

 Score =   283 bits (725),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 144/153 (94%), Gaps = 0/153 (0%)
 Frame = -1

Query  650  VEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVADALKFASSKVYIVTTKQSR  471
            +EEW+ENRDALIDLFGKVRDEWMDNDL+TWIGANRFYPGV DALKF+SS +YIVTTKQSR
Sbjct  1    MEEWDENRDALIDLFGKVRDEWMDNDLATWIGANRFYPGVPDALKFSSSTIYIVTTKQSR  60

Query  470  FAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPEHQGLTLHFVEDRLATLKNVIK  291
            FA ALLRELAGVTIPPERIYGLGTGPK KVLKQLQ  PEHQG+ LHFVEDRLATLKNVIK
Sbjct  61   FADALLRELAGVTIPPERIYGLGTGPKVKVLKQLQLRPEHQGMKLHFVEDRLATLKNVIK  120

Query  290  EPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            EPEL+GWNLYLGDWGYNT KEREEAA I+RI++
Sbjct  121  EPELDGWNLYLGDWGYNTQKEREEAANISRIQL  153



>ref|XP_008344005.1| PREDICTED: uncharacterized protein LOC103406759 [Malus domestica]
Length=302

 Score =   288 bits (738),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VA GLTV  IL+ W ++KPVI+ EW E RDALI LFGKVRDEWMD DL TWIGANR YPG
Sbjct  118  VAXGLTVXGILDKWSELKPVIMAEWGEERDALIHLFGKVRDEWMDEDLKTWIGANRLYPG  177

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V DAL+FASS +YIVTTKQSRFA ALLRELAGVTIPPE+I+GLG+GPK +VLKQ+Q+ PE
Sbjct  178  VPDALRFASSTIYIVTTKQSRFADALLRELAGVTIPPEKIFGLGSGPKVEVLKQIQKKPE  237

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGL LHFVEDRLATLKNVIKEPEL+GWNLYLG+WGYNT KERE AA I RI+I
Sbjct  238  HQGLKLHFVEDRLATLKNVIKEPELDGWNLYLGNWGYNTQKEREXAATIPRIQI  291



>ref|XP_011624852.1| PREDICTED: uncharacterized protein LOC18422845 isoform X2 [Amborella 
trichopoda]
Length=268

 Score =   286 bits (733),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 152/175 (87%), Gaps = 0/175 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VA GL++D ILENW K+KP+I+EEWNE+RD LI LFGKVRDEW++ D S WIGANRFYP
Sbjct  83   SVAPGLSIDGILENWSKLKPIIMEEWNEDRDTLIGLFGKVRDEWIEKDFSGWIGANRFYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            G+ADALKFASS +YIVTTKQSRFA ALLRELA VTIPP+RIYGLG+GPK +VLKQLQ  P
Sbjct  143  GIADALKFASSTIYIVTTKQSRFADALLRELADVTIPPDRIYGLGSGPKPEVLKQLQRQP  202

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            EH GL LHFVEDRLATL+NVI+E EL+GWNLYLG+WGYNT KEREEA  I RI I
Sbjct  203  EHAGLKLHFVEDRLATLRNVIREGELDGWNLYLGNWGYNTAKEREEAESIPRIHI  257



>ref|XP_010255308.1| PREDICTED: uncharacterized protein LOC104596025 isoform X1 [Nelumbo 
nucifera]
Length=293

 Score =   287 bits (734),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 136/179 (76%), Positives = 158/179 (88%), Gaps = 0/179 (0%)
 Frame = -1

Query  728  QLTVKVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGAN  549
             L  +  +GLT+D IL+NW K+KPVI+EEW+ENR++LI+LFGKVRDEW++  LS+WIGAN
Sbjct  104  HLLPRGGDGLTIDRILDNWSKLKPVIMEEWDENRESLIELFGKVRDEWIEKGLSSWIGAN  163

Query  548  RFYPGVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQL  369
            RFYPGV DALKFASS++YIVTTKQ+RFA ALLRELAGVTIP  RIYGLGTGPK +VLKQL
Sbjct  164  RFYPGVPDALKFASSRIYIVTTKQARFADALLRELAGVTIPSHRIYGLGTGPKVEVLKQL  223

Query  368  QEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            Q   E++GLTLHFVEDRLATLKNVIK PEL+GWNLYLGDWGYNT KEREEAA I RI++
Sbjct  224  QSKEENKGLTLHFVEDRLATLKNVIKVPELDGWNLYLGDWGYNTQKEREEAATIPRIQL  282



>emb|CDY18881.1| BnaC04g04690D [Brassica napus]
Length=269

 Score =   285 bits (730),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 156/175 (89%), Gaps = 1/175 (1%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNEN-RDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
            VAEGLTVD ILE+W KIKPVI+E W+E+ +DALIDLFGKVRD+W++NDL+TWIGANRFYP
Sbjct  84   VAEGLTVDGILESWGKIKPVIMEAWDEDDKDALIDLFGKVRDDWINNDLTTWIGANRFYP  143

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GV+DALKFASSK+YIVTTKQ RFA ALLRE+AGV IPPERIY LG+GPK +VLK LQ  P
Sbjct  144  GVSDALKFASSKIYIVTTKQGRFAEALLREIAGVIIPPERIYALGSGPKVEVLKLLQNKP  203

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            EHQGL LHFVEDRLATLKNVIKEPEL+ WNLYL +WGYNT KER EA  I+RI++
Sbjct  204  EHQGLKLHFVEDRLATLKNVIKEPELDKWNLYLSNWGYNTEKERAEAESISRIQV  258



>ref|NP_001276321.1| uncharacterized protein LOC100809469 [Glycine max]
 gb|ACU19689.1| unknown [Glycine max]
Length=268

 Score =   283 bits (723),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            V+EGL V++ILENW K+KP+I+EEWNENR+ LIDLFGKV D+W++ D + WIGANR YPG
Sbjct  84   VSEGLKVEDILENWFKLKPIIMEEWNENREELIDLFGKVGDDWLERDFTGWIGANRLYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
             ADAL+FASSKVYIVTTKQSRFA ALLRELAGVTI PER+YGLGTGPK +VLK+LQ+MPE
Sbjct  144  TADALRFASSKVYIVTTKQSRFADALLRELAGVTIAPERLYGLGTGPKVEVLKKLQKMPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGLTLHFVEDRLATLKNVIKEPEL+ WNLYL +WG NT KEREEA    RI++
Sbjct  204  HQGLTLHFVEDRLATLKNVIKEPELDNWNLYLVNWGSNTQKEREEAQANPRIQV  257



>ref|XP_008801330.1| PREDICTED: uncharacterized protein LOC103715476 [Phoenix dactylifera]
Length=269

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 152/175 (87%), Gaps = 0/175 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VA+GLT++ IL NW ++KP+I++EWNE+RDALIDLFG+VRD WM  DLS WIGANRFYP
Sbjct  84   SVADGLTIEAILNNWSQLKPIIMKEWNEDRDALIDLFGRVRDNWMQTDLSGWIGANRFYP  143

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            G  DAL+FASS+VYIVTTKQSRFA ALLRELAGVTIP E+IYGLGTGPK +VLK+LQ MP
Sbjct  144  GTGDALRFASSQVYIVTTKQSRFADALLRELAGVTIPSEKIYGLGTGPKVEVLKKLQAMP  203

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            EH+GLTLHFVEDRLATLK V+KEP L+ WNLYLG WGYNT KEREEA   +RI +
Sbjct  204  EHEGLTLHFVEDRLATLKIVMKEPALDRWNLYLGRWGYNTEKEREEAQSFSRIHM  258



>ref|XP_009143199.1| PREDICTED: uncharacterized protein LOC103866942 [Brassica rapa]
Length=269

 Score =   283 bits (723),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 154/176 (88%), Gaps = 1/176 (1%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNEN-RDALIDLFGKVRDEWMDNDLSTWIGANRFY  540
             VAEGLTVD ILE+W KIKPVI+E W+E+ +DALIDLFG VRD+W++NDL+TWIGANRFY
Sbjct  83   SVAEGLTVDGILESWGKIKPVIMEAWDEDDKDALIDLFGSVRDDWINNDLTTWIGANRFY  142

Query  539  PGVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEM  360
            PGV+DALKFASSK+YIVTTKQ RFA ALLRE+AGV IPPERIY LG+GPK +VLK LQ  
Sbjct  143  PGVSDALKFASSKIYIVTTKQGRFAEALLREIAGVIIPPERIYALGSGPKVEVLKLLQNK  202

Query  359  PEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            PEHQGL LHFVEDRLATLKNVIKEPEL+ WNLYL +WGYNT KER EA  I RI++
Sbjct  203  PEHQGLKLHFVEDRLATLKNVIKEPELDKWNLYLSNWGYNTEKERAEAESIPRIQV  258



>emb|CDX74783.1| BnaA05g05290D [Brassica napus]
Length=269

 Score =   281 bits (720),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 154/175 (88%), Gaps = 1/175 (1%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNEN-RDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
            VAEGLTVD IL +W KIKPVI+E W+E+ +DALIDLFGKVRD+W++NDL+TWIGANRFYP
Sbjct  84   VAEGLTVDGILGSWGKIKPVIMEAWDEDDKDALIDLFGKVRDDWINNDLTTWIGANRFYP  143

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GV+DALKFASSK+YIVTTKQ RFA ALLRE+AGV IPPERIY LG+GPK +VLK LQ  P
Sbjct  144  GVSDALKFASSKIYIVTTKQGRFAEALLREIAGVIIPPERIYALGSGPKVEVLKLLQNKP  203

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            EHQGL LHFVEDRLATLKNVIKEPEL+ WNLYL +WGYNT KER EA  I RI++
Sbjct  204  EHQGLKLHFVEDRLATLKNVIKEPELDKWNLYLSNWGYNTEKERAEAESIPRIQV  258



>ref|XP_010506594.1| PREDICTED: uncharacterized protein LOC104783176 [Camelina sativa]
Length=268

 Score =   278 bits (712),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 134/174 (77%), Positives = 150/174 (86%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTVD ILE+W KIKPVI+E W+E++DALIDLFGKVRD+WM+ DL+TWIGANRFYPG
Sbjct  84   VAEGLTVDGILESWAKIKPVIMEAWDEDKDALIDLFGKVRDDWMNEDLTTWIGANRFYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V+DALKFASSK+YIVTTKQ RFA ALLRE+AGV IP ER      GPK +VLK LQ  PE
Sbjct  144  VSDALKFASSKIYIVTTKQGRFAEALLREIAGVIIPSERXDSSEKGPKVEVLKLLQNKPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGL LHFVEDRLATLKNVIKEPEL+ WNLYLG+WGYNT KER EAA I RI++
Sbjct  204  HQGLMLHFVEDRLATLKNVIKEPELDKWNLYLGNWGYNTEKERAEAASIPRIQV  257



>gb|ABK26606.1| unknown [Picea sitchensis]
Length=281

 Score =   278 bits (712),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 152/174 (87%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            V  GLTV+ ILENW K+KPVI+ EW E+ + L++LFGKVRDEW+++DLS+WIGANRFYPG
Sbjct  84   VVPGLTVEGILENWSKLKPVIMMEWGESSEELVELFGKVRDEWLEHDLSSWIGANRFYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
             ADAL+FASSKVYIVTTKQ RFA ALL++LAGV+IPP+RIYGLGTGPK +VLK+LQ  PE
Sbjct  144  TADALRFASSKVYIVTTKQGRFAEALLQKLAGVSIPPDRIYGLGTGPKVEVLKELQNKPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            H  LTLHFVEDRLATLKNVIKEP+L+ WNLYLG WGYNTP EREEA K +RI +
Sbjct  204  HSELTLHFVEDRLATLKNVIKEPQLDKWNLYLGTWGYNTPSEREEANKFSRINL  257



>ref|XP_004492756.1| PREDICTED: uncharacterized protein LOC101510881 isoform X1 [Cicer 
arietinum]
 ref|XP_004492757.1| PREDICTED: uncharacterized protein LOC101510881 isoform X2 [Cicer 
arietinum]
 ref|XP_004492758.1| PREDICTED: uncharacterized protein LOC101510881 isoform X3 [Cicer 
arietinum]
Length=268

 Score =   278 bits (710),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 154/174 (89%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLT + ILENW+K+KP+++EEWNEN+D LIDLFGKVRD+W++ D   WI +NRFYPG
Sbjct  84   VAEGLTAEGILENWLKLKPILMEEWNENKDDLIDLFGKVRDDWLEQDFPGWIESNRFYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            VADAL+FASS+VYIVT KQSRFA ALLRELAG+TIPPER+Y LG+G K +VLK+LQ+MPE
Sbjct  144  VADALRFASSRVYIVTLKQSRFADALLRELAGITIPPERMYALGSGRKIEVLKKLQKMPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQG+TLHFVEDR ATLKNVIKEPEL+ W+LYL DWGYNT KE++EAA   RI++
Sbjct  204  HQGMTLHFVEDRFATLKNVIKEPELDKWSLYLVDWGYNTQKEKDEAAANPRIQL  257



>gb|EMT00704.1| hypothetical protein F775_08758 [Aegilops tauschii]
Length=270

 Score =   277 bits (709),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 153/175 (87%), Gaps = 0/175 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VA+GL++ EIL+NW K+ P +++EW E+R++L+DLFG+VRD+W++NDLS WIGANRFYP
Sbjct  85   SVADGLSIQEILDNWSKLLPTLMDEWQEDRESLVDLFGRVRDDWLENDLSGWIGANRFYP  144

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            G ADALK +SS++YIVTTKQSRF  ALL+ELAGV  P ERIYGLGTGPK KVL+QLQEMP
Sbjct  145  GTADALKLSSSELYIVTTKQSRFTGALLKELAGVDFPSERIYGLGTGPKVKVLQQLQEMP  204

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            +HQGLTLHFVEDRLATLKNVIKEP L+ WNLYL  WGYNT +EREEA  I+RI++
Sbjct  205  QHQGLTLHFVEDRLATLKNVIKEPALDKWNLYLVKWGYNTQEEREEAGAISRIQL  259



>gb|EMS45488.1| hypothetical protein TRIUR3_03694 [Triticum urartu]
Length=216

 Score =   273 bits (699),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VA+GL++ +IL+NW K+ P +++EW E+R++L+DLFG VRD+W++NDLS WIGANRFYPG
Sbjct  32   VADGLSIQQILDNWSKLLPTLMDEWQEDRESLVDLFGCVRDDWLENDLSGWIGANRFYPG  91

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
             ADALK +SS++YIVTTKQSRF  ALL+ELAGV  P ERIYGLG+GPK KVL+QLQEMP+
Sbjct  92   TADALKLSSSELYIVTTKQSRFTGALLKELAGVDFPSERIYGLGSGPKVKVLQQLQEMPQ  151

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGLTLHFVEDRLATLKNVIKEP L+ WNLYL  WGYNT KEREEA  + RI++
Sbjct  152  HQGLTLHFVEDRLATLKNVIKEPALDKWNLYLVKWGYNTQKEREEAGALPRIQL  205



>gb|ABR16780.1| unknown [Picea sitchensis]
Length=268

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 151/174 (87%), Gaps = 0/174 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            V  GLTV+ ILENW K+KPVI+ EW E+ + L++LFGKVRDEW+++DLS+WIGANRFYPG
Sbjct  84   VVPGLTVEGILENWSKLKPVIMMEWGESSEELVELFGKVRDEWLEHDLSSWIGANRFYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
             ADAL+FASS VYIVTTKQ+RFA ALL++LAGV+IPP+RIYGLGTGPK +VLK+LQ  PE
Sbjct  144  TADALRFASSTVYIVTTKQARFAEALLQKLAGVSIPPDRIYGLGTGPKVEVLKELQNKPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            H  LTLHFVEDRLATLKNVIKEP+L+ WNLYLG WGYNTP EREEA   +RI +
Sbjct  204  HSELTLHFVEDRLATLKNVIKEPQLDKWNLYLGTWGYNTPSEREEANTFSRINL  257



>gb|KJB22338.1| hypothetical protein B456_004G042000 [Gossypium raimondii]
Length=247

 Score =   273 bits (699),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 147/175 (84%), Gaps = 21/175 (12%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VAEGLTV++ILENW KIKPVI+EEW+ENRDALIDLFGKVRDEWMDNDL+TWIGANRFYP
Sbjct  83   SVAEGLTVEDILENWSKIKPVIMEEWDENRDALIDLFGKVRDEWMDNDLATWIGANRFYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GV DALKF+SS +YIVTTKQSRFA ALLRELAGVTIPPERIYGLGTG             
Sbjct  143  GVPDALKFSSSTIYIVTTKQSRFADALLRELAGVTIPPERIYGLGTG-------------  189

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
                    FVEDRLATLKNVIKEPEL+GWNLYLGDWGYNT KEREEAA I+RI++
Sbjct  190  --------FVEDRLATLKNVIKEPELDGWNLYLGDWGYNTQKEREEAANISRIQL  236



>ref|XP_003568582.1| PREDICTED: uncharacterized protein LOC100823061 [Brachypodium 
distachyon]
Length=269

 Score =   271 bits (694),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             V++GL+V EILENW+K+KP I+ EWNE+RD+L+DLFG++RD+W++NDL  WIGANRFYP
Sbjct  84   SVSDGLSVQEILENWLKLKPTIMSEWNEDRDSLVDLFGRIRDDWIENDLPGWIGANRFYP  143

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            G ADALKF+SS+VYIVTTKQ RFA ALL+ELAG+ IP ERIYGLGTGPK KVL+QLQ+MP
Sbjct  144  GTADALKFSSSEVYIVTTKQGRFAEALLKELAGIEIPSERIYGLGTGPKVKVLQQLQQMP  203

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            +HQGLTLHFVEDRLATLKNVIKEP L+GWNLYL +WGYNTPKEREEA  I+RI +
Sbjct  204  QHQGLTLHFVEDRLATLKNVIKEPALDGWNLYLVNWGYNTPKEREEAGGISRIEV  258



>gb|KDO86216.1| hypothetical protein CISIN_1g024415mg [Citrus sinensis]
Length=233

 Score =   270 bits (689),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             V+EGLTV+ ILENW KIKPVI+E+W+ENRDAL+DLFGKVRDEWMD DL+TWIGANRFYP
Sbjct  83   SVSEGLTVEGILENWSKIKPVIMEDWSENRDALVDLFGKVRDEWMDKDLTTWIGANRFYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            G+ DALKFASS++YIVTTKQSRFA ALLRELAGVTIPP+RIYGLGTGPK +VLKQLQ+ P
Sbjct  143  GIPDALKFASSRIYIVTTKQSRFADALLRELAGVTIPPDRIYGLGTGPKVEVLKQLQKKP  202

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNL  264
            E QG+TLHFVEDRLATLKNVIKEPEL+GWNL
Sbjct  203  ELQGMTLHFVEDRLATLKNVIKEPELDGWNL  233



>ref|NP_001031546.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC10629.1| uncharacterized protein AT2G45990 [Arabidopsis thaliana]
Length=263

 Score =   270 bits (691),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 151/174 (87%), Gaps = 5/174 (3%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTVD ILE+W K KPVI+E W+E+RDAL+DLFGKVRD+W++ DL+TWIGANRFYPG
Sbjct  84   VAEGLTVDGILESWAKFKPVIMEAWDEDRDALVDLFGKVRDDWINKDLTTWIGANRFYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            V+DALKFASSK+YIVTTKQ RFA ALLRE+AGV IP ERIYGLG+GPK +VLK LQ+ PE
Sbjct  144  VSDALKFASSKIYIVTTKQGRFAEALLREIAGVIIPSERIYGLGSGPKVEVLKLLQDKPE  203

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGLTL     +LATLKNVIKEPEL+ W+LYLG WGYNT KER EAA I RI++
Sbjct  204  HQGLTL-----QLATLKNVIKEPELDKWSLYLGTWGYNTEKERAEAAGIPRIQV  252



>ref|XP_012083366.1| PREDICTED: uncharacterized protein LOC105642967 isoform X2 [Jatropha 
curcas]
Length=237

 Score =   270 bits (689),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 133/153 (87%), Positives = 141/153 (92%), Gaps = 1/153 (1%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNEN-RDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
            VAEGLTV+ ILENW+K+KPVI+EEW EN RD LI+LFGKVRDEWM  DL  WIGANRFYP
Sbjct  84   VAEGLTVERILENWLKLKPVIMEEWGENHRDDLINLFGKVRDEWMYKDLPAWIGANRFYP  143

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GVADALKFASSKVYIVTTKQSRFA ALLRELAGVTIP ERIYGLGTGPK KVLKQLQ+ P
Sbjct  144  GVADALKFASSKVYIVTTKQSRFADALLRELAGVTIPSERIYGLGTGPKVKVLKQLQQKP  203

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYL  258
            EH+GLTLHFVEDRLATLKNVIKEPEL+GWNLYL
Sbjct  204  EHRGLTLHFVEDRLATLKNVIKEPELDGWNLYL  236



>gb|EEC76618.1| hypothetical protein OsI_14495 [Oryza sativa Indica Group]
Length=269

 Score =   268 bits (685),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VA+GL++ EILENW+K+KP I+ EWNE+RD+L+DLFG +RD+W++NDLS WIGANRFYP
Sbjct  84   SVADGLSIQEILENWLKLKPTIMSEWNEDRDSLVDLFGSIRDDWIENDLSGWIGANRFYP  143

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            G ADALKF+SS+VYIVTTKQ RFA ALL+ELAG+  P ERIYGLGTGPK KVL+QLQ+MP
Sbjct  144  GTADALKFSSSEVYIVTTKQGRFAEALLKELAGIEFPSERIYGLGTGPKVKVLQQLQQMP  203

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            +HQGLTLHFVEDRLATLKNVIKEP L+ WNLYL +WGYNTPKERE+A  I+RI++
Sbjct  204  QHQGLTLHFVEDRLATLKNVIKEPALDQWNLYLVNWGYNTPKEREDAEGISRIQV  258



>ref|NP_001059469.1| Os07g0418000 [Oryza sativa Japonica Group]
 dbj|BAC10357.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF21383.1| Os07g0418000 [Oryza sativa Japonica Group]
 dbj|BAG89745.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67036.1| hypothetical protein OsJ_23973 [Oryza sativa Japonica Group]
Length=269

 Score =   268 bits (685),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VA+GL++ EILENW+K+KP I+ EWNE+RD+L+DLFG +RD+W++NDLS WIGANRFYP
Sbjct  84   SVADGLSIQEILENWLKLKPTIMSEWNEDRDSLVDLFGSIRDDWIENDLSGWIGANRFYP  143

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            G ADALKF+SS+VYIVTTKQ RFA ALL+ELAG+  P ERIYGLGTGPK KVL+QLQ+MP
Sbjct  144  GTADALKFSSSEVYIVTTKQGRFAEALLKELAGIEFPSERIYGLGTGPKVKVLQQLQQMP  203

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            +HQGLTLHFVEDRLATLKNVIKEP L+ WNLYL +WGYNTPKERE+A  I+RI++
Sbjct  204  QHQGLTLHFVEDRLATLKNVIKEPALDQWNLYLVNWGYNTPKEREDAEGISRIQV  258



>ref|XP_006657631.1| PREDICTED: uncharacterized protein LOC102713007 [Oryza brachyantha]
Length=269

 Score =   265 bits (678),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 155/175 (89%), Gaps = 0/175 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VA+GL++ EILENW+K+KP I+ EWNE+RD+L+DLFG +RD+W++NDLS WIGANRFYP
Sbjct  84   SVADGLSIQEILENWLKLKPTIMSEWNEDRDSLVDLFGSIRDDWIENDLSGWIGANRFYP  143

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            G ADALKF+SS+VYIVTTKQ RFA ALL+ELAG+  P ERIYGLGTGPK KVL+QLQ+MP
Sbjct  144  GTADALKFSSSEVYIVTTKQGRFAEALLKELAGIEFPSERIYGLGTGPKVKVLQQLQQMP  203

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            +HQGLTLHFVEDRLATLKNVIKEP L+ WNLYL +WGYNT KEREEA  I RI++
Sbjct  204  QHQGLTLHFVEDRLATLKNVIKEPALDQWNLYLVNWGYNTQKEREEAEGIPRIQV  258



>ref|XP_002989978.1| hypothetical protein SELMODRAFT_428440 [Selaginella moellendorffii]
 gb|EFJ08991.1| hypothetical protein SELMODRAFT_428440 [Selaginella moellendorffii]
Length=272

 Score =   263 bits (673),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 148/176 (84%), Gaps = 1/176 (1%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNE-NRDALIDLFGKVRDEWMDNDLSTWIGANRFY  540
             V  GLTV+ +LENW K+KPV+++EW E +RD L++LFG VRDEW+  DL TWI ANRFY
Sbjct  86   SVVNGLTVEGVLENWEKLKPVLMKEWGEASRDELVELFGNVRDEWISKDLGTWISANRFY  145

Query  539  PGVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEM  360
            PG+AD+LKFA+S+V+IVTTKQ+RFAA LL+ELAGV  P ++I+GLGTGPK +VLKQLQ  
Sbjct  146  PGIADSLKFATSRVFIVTTKQARFAATLLKELAGVDFPTDKIFGLGTGPKVEVLKQLQSR  205

Query  359  PEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            PEHQG+ LHFVEDRLATL NVIK+P L+ WNLYLG+WGYNTP ERE AA I RI++
Sbjct  206  PEHQGMILHFVEDRLATLHNVIKDPALDRWNLYLGNWGYNTPAEREAAAAITRIQV  261



>gb|AAL27556.1|AF420411_1 hypothetical protein [Musa acuminata AAA Group]
Length=151

 Score =   258 bits (659),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VA+GLTV+ ILENW ++KP+I++EW+E RDALIDLFG+VRDEW+DNDLS WIGANRFYPG
Sbjct  4    VADGLTVEAILENWSQLKPIIMKEWDEERDALIDLFGRVRDEWIDNDLSGWIGANRFYPG  63

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
            VADAL+FASS++YIVTTKQ+RFA ALLRELAGVTIP ERIYGLGTGPK KVLKQLQEMPE
Sbjct  64   VADALRFASSQLYIVTTKQARFADALLRELAGVTIPAERIYGLGTGPKVKVLKQLQEMPE  123

Query  353  HQGLTLHFVEDRLATLKNVIKEPEL  279
            HQGL+LHFVEDRLATLKNVIKEP  
Sbjct  124  HQGLSLHFVEDRLATLKNVIKEPSF  148



>gb|KDO86212.1| hypothetical protein CISIN_1g024003mg [Citrus sinensis]
Length=263

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VAEGLTV+ ILENW+KIKPVI+EEW+ENR+ALI+L GKVRDEWMD D +TWIGANR YP
Sbjct  83   SVAEGLTVEGILENWLKIKPVIMEEWSENREALIELSGKVRDEWMDTDFTTWIGANRLYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GV+DALK ASS++YIVT+ QSRF   LLRELAGVTI P+R+YGLGTGPK  VLKQLQ+ P
Sbjct  143  GVSDALKLASSRIYIVTSNQSRFVETLLRELAGVTITPDRLYGLGTGPKVNVLKQLQKKP  202

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGD  252
            EHQGL LHFVEDRLATLKNVIKEPEL+GWNLYLG+
Sbjct  203  EHQGLRLHFVEDRLATLKNVIKEPELDGWNLYLGN  237



>ref|XP_002968931.1| hypothetical protein SELMODRAFT_90693 [Selaginella moellendorffii]
 gb|EFJ30047.1| hypothetical protein SELMODRAFT_90693 [Selaginella moellendorffii]
Length=272

 Score =   262 bits (669),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 147/176 (84%), Gaps = 1/176 (1%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNE-NRDALIDLFGKVRDEWMDNDLSTWIGANRFY  540
             V  GLTV+ +LENW K+KPV+++EW E +RD L++LFGKVRDEW+  DL TWI ANRFY
Sbjct  86   SVVNGLTVEGVLENWEKLKPVLMKEWGEASRDELVELFGKVRDEWISKDLGTWISANRFY  145

Query  539  PGVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEM  360
            PG AD+LKFA+S+V+IVTTKQ+RFAA LL+EL GV  P ++I+GLGTGPK +VLKQLQ  
Sbjct  146  PGTADSLKFATSQVFIVTTKQARFAATLLKELGGVDFPTDKIFGLGTGPKVEVLKQLQSR  205

Query  359  PEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            PEHQG+ LHFVEDRLATL NVIK+P L+ WNLYLG+WGYNTP ERE AA I R+++
Sbjct  206  PEHQGMILHFVEDRLATLHNVIKDPALDRWNLYLGNWGYNTPAEREAAAAITRVQV  261



>ref|XP_004306768.1| PREDICTED: uncharacterized protein LOC101295853 [Fragaria vesca 
subsp. vesca]
Length=275

 Score =   261 bits (668),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 149/176 (85%), Gaps = 2/176 (1%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTV+ I+ENW ++K +I++EW E++D+L++L+GKVRDEW D DL TWIGANR YPG
Sbjct  84   VAEGLTVEGIVENWSELKNLILKEWGEDKDSLVNLYGKVRDEWKDQDLGTWIGANRLYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGP--KTKVLKQLQEM  360
            V DALK A+S +YIVT KQSRFA  +LRELAGVTIPPERI+G+G+G   K +V+KQLQ+ 
Sbjct  144  VVDALKSATSTIYIVTGKQSRFAEVILRELAGVTIPPERIFGVGSGSERKLEVMKQLQKK  203

Query  359  PEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            PEHQGL LHFVEDRLATLK V +EPEL GWNLYLGDWGYNT KER+E A I RI+I
Sbjct  204  PEHQGLKLHFVEDRLATLKKVTEEPELVGWNLYLGDWGYNTQKERDEVATIPRIQI  259



>dbj|BAJ92002.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=245

 Score =   259 bits (663),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VA+GL++ EILENW K+ P +++EW E+R++L+DLFG+VRD+W++NDLS WIGANRFYP
Sbjct  85   SVADGLSIQEILENWSKLLPTLMDEWQEDRESLVDLFGRVRDDWLENDLSGWIGANRFYP  144

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            G ADALK ++S++YIVTTKQSRFA ALL+ELAGV  P ERIYGLGTGPK KVL++LQEMP
Sbjct  145  GTADALKLSNSELYIVTTKQSRFAGALLKELAGVDFPSERIYGLGTGPKVKVLQRLQEMP  204

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNT  237
            +HQGLTLHF+EDRLATLKNVIKEP L+ WNLYL  WGYNT
Sbjct  205  QHQGLTLHFIEDRLATLKNVIKEPALDKWNLYLVKWGYNT  244



>gb|AFK34805.1| unknown [Medicago truncatula]
Length=247

 Score =   257 bits (656),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 140/165 (85%), Gaps = 1/165 (1%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VAEGLTV+ ILE+W K+KP+++EEWNENRD LIDLFGKVRD+W++ND + WI  NRFYP
Sbjct  83   SVAEGLTVEGILEDWFKLKPIVMEEWNENRDDLIDLFGKVRDDWLENDFAGWIQGNRFYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GVADAL+FASSKVYIVTTKQ RFA ALLRELAG+TIPPERIYGLGTGPK + LK+LQ+MP
Sbjct  143  GVADALRFASSKVYIVTTKQGRFADALLRELAGITIPPERIYGLGTGPKVETLKKLQKMP  202

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKERE  222
            EHQGLTLHFVEDR+A LKNVIKEPEL+ W     + G     ERE
Sbjct  203  EHQGLTLHFVEDRIAALKNVIKEPELDNWEFVSSELGVQH-SERE  246



>ref|XP_001759804.1| predicted protein [Physcomitrella patens]
 gb|EDQ75308.1| predicted protein [Physcomitrella patens]
Length=269

 Score =   256 bits (653),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 149/175 (85%), Gaps = 1/175 (1%)
 Frame = -1

Query  713  VAEGLTVDEILENW-MKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
            VA  L+VD+IL +W   IKPV+++EW+EN++ L+DLFGKVRD+W+++DL  WIGANRFYP
Sbjct  84   VAGKLSVDDILADWEHGIKPVLMKEWSENKEELVDLFGKVRDDWLEHDLRGWIGANRFYP  143

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            G ADALKF+SS ++IVTTKQ+RFA+ALLRE+ G+  P +RIYGLG+GPK +VLK+LQE P
Sbjct  144  GTADALKFSSSTLFIVTTKQARFASALLREIGGIDFPMDRIYGLGSGPKVEVLKKLQERP  203

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            EH+GLTLHFVEDRLATL+NVIK P L+ W+LYLG WGYNT  ER+EA  I+RI +
Sbjct  204  EHEGLTLHFVEDRLATLRNVIKTPALDNWHLYLGTWGYNTQSERDEAESISRIHV  258



>ref|XP_004984348.1| PREDICTED: uncharacterized protein LOC101783107 [Setaria italica]
Length=337

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 154/175 (88%), Gaps = 0/175 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VA+GL++ EILENW K+KP++++EW E+R++L+DLFG+VRD+W++NDLS WIGANRFYP
Sbjct  152  SVADGLSIQEILENWFKLKPILMDEWQEDRESLVDLFGRVRDDWIENDLSGWIGANRFYP  211

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            G ADALK +SS+ YIVTTKQSRFA ALL+ELAG+  P ERIYGLGTGPK KVL+QLQ+MP
Sbjct  212  GTADALKLSSSETYIVTTKQSRFAEALLKELAGIDFPSERIYGLGTGPKVKVLQQLQQMP  271

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            +HQGLTLHF+EDRLATL NVIKEP L+ WNLYL  WGYNT KEREEA  I+RI++
Sbjct  272  QHQGLTLHFIEDRLATLNNVIKEPALDKWNLYLVTWGYNTQKEREEAQGISRIQL  326



>ref|XP_006827564.1| PREDICTED: uncharacterized protein LOC18422845 isoform X1 [Amborella 
trichopoda]
 gb|ERM94980.1| hypothetical protein AMTR_s00009p00222660 [Amborella trichopoda]
Length=289

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VA GL++D ILENW K+KP+I+EEWNE+RD LI LFGKVRDEW++ D S WIGANRFYP
Sbjct  83   SVAPGLSIDGILENWSKLKPIIMEEWNEDRDTLIGLFGKVRDEWIEKDFSGWIGANRFYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            G+ADALKFASS +YIVTTKQSRFA ALLRELA VTIPP+RIYGLG+GPK +VLKQLQ  P
Sbjct  143  GIADALKFASSTIYIVTTKQSRFADALLRELADVTIPPDRIYGLGSGPKPEVLKQLQRQP  202

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYL  258
            EH GL LHFVEDRLATL+NVI+E EL+GWNLYL
Sbjct  203  EHAGLKLHFVEDRLATLRNVIREGELDGWNLYL  235



>ref|XP_002461895.1| hypothetical protein SORBIDRAFT_02g009970 [Sorghum bicolor]
 gb|EER98416.1| hypothetical protein SORBIDRAFT_02g009970 [Sorghum bicolor]
Length=336

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 152/175 (87%), Gaps = 0/175 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VA+GL++ EILENW+K+KP +++EW E+R++L+DLFG+VRD+W++ND S WIGANRFYP
Sbjct  151  SVADGLSIQEILENWLKLKPTLMDEWQEDRESLVDLFGRVRDDWIENDFSGWIGANRFYP  210

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            G ADALK +SS+ YIVTTKQSRFA ALL+ELAG+  P ERIYGLGTGPK KVL+QLQ+MP
Sbjct  211  GTADALKLSSSETYIVTTKQSRFAEALLKELAGIDFPSERIYGLGTGPKVKVLQQLQQMP  270

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            ++QGL LHFVEDRLATLKNVIKEP L+ WNLYL  WGYNT KEREEA  I R+++
Sbjct  271  QNQGLKLHFVEDRLATLKNVIKEPALDKWNLYLVTWGYNTQKEREEAEAIPRVQL  325



>ref|XP_004295150.1| PREDICTED: uncharacterized protein LOC101305350 [Fragaria vesca 
subsp. vesca]
Length=283

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 144/176 (82%), Gaps = 2/176 (1%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTV+ I+ENW ++K ++  EW E++++L +LF KVRDEW   DL TWIGANR YPG
Sbjct  97   VAEGLTVEGIVENWSELKILLRNEWGEDKESLENLFRKVRDEWKGQDLGTWIGANRLYPG  156

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTK--VLKQLQEM  360
            VADALK A+S +YIVT KQS FA  +LRELAGVT+PPERI+ + +G K K  VLKQLQ+ 
Sbjct  157  VADALKSATSTIYIVTGKQSPFAEVILRELAGVTLPPERIFSVASGSKHKIEVLKQLQKK  216

Query  359  PEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            PEHQGL LHFVEDRLATLK VI+EPEL GWNLYLGDWGYNTPKER+E A I RI+I
Sbjct  217  PEHQGLKLHFVEDRLATLKKVIEEPELVGWNLYLGDWGYNTPKERDEVATIPRIQI  272



>ref|XP_001771402.1| predicted protein [Physcomitrella patens]
 gb|EDQ63792.1| predicted protein, partial [Physcomitrella patens]
Length=247

 Score =   245 bits (625),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 146/177 (82%), Gaps = 2/177 (1%)
 Frame = -1

Query  716  KVAEGLTVDEILENW-MKIKPVIVEEWNE-NRDALIDLFGKVRDEWMDNDLSTWIGANRF  543
             VAE L+V++IL +W   IKPV+++EWNE N++ L++L+GKVRDEWM++D   WIGAN F
Sbjct  60   SVAEKLSVEDILVDWEHGIKPVVMKEWNESNKEELVELYGKVRDEWMEHDFHGWIGANSF  119

Query  542  YPGVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQE  363
            Y G+ADALK++SS V+IVTTKQ+RF +ALL+ELAGV  P +RIYGLG+GPK +VLKQLQE
Sbjct  120  YLGIADALKWSSSTVFIVTTKQARFTSALLKELAGVDFPMDRIYGLGSGPKVEVLKQLQE  179

Query  362  MPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
              EH+GLTLHFVEDRLATL+NVIK P L+ WNLYLG WGYNT  EREE   I+RI +
Sbjct  180  RVEHEGLTLHFVEDRLATLRNVIKLPALDSWNLYLGTWGYNTRSEREETVSISRIHV  236



>ref|XP_011092616.1| PREDICTED: uncharacterized protein LOC105172743 isoform X1 [Sesamum 
indicum]
Length=210

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VAEGLTV+ ILENWMKIKPVI+EEWNENRD LIDLFGKVRDEWMDNDL+TWIGANRFYP
Sbjct  83   SVAEGLTVEGILENWMKIKPVIMEEWNENRDELIDLFGKVRDEWMDNDLATWIGANRFYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GV DALKFASSK+YIVTTKQSRFA ALLRELAGVTIPPERIYGLGTGPK KVLKQLQ+MP
Sbjct  143  GVPDALKFASSKLYIVTTKQSRFADALLRELAGVTIPPERIYGLGTGPKVKVLKQLQDMP  202

Query  356  EHQGLTLH  333
            EHQGLTL 
Sbjct  203  EHQGLTLQ  210



>tpg|DAA39436.1| TPA: hypothetical protein ZEAMMB73_910853 [Zea mays]
Length=336

 Score =   245 bits (625),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 149/175 (85%), Gaps = 0/175 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VA+GL++ EILENW K+KP +++EW E+R++L+DLFG+VRD+W++ND S WIGANRFYP
Sbjct  151  SVADGLSIQEILENWSKLKPTLMDEWQEDRESLVDLFGRVRDDWIENDFSGWIGANRFYP  210

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            G ADALK +SS+ YIVTTKQSRFA ALL+ELAG+  P ERIYGLGTGPK KVL+QLQ+M 
Sbjct  211  GTADALKLSSSEAYIVTTKQSRFAEALLKELAGIDFPSERIYGLGTGPKVKVLQQLQQML  270

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            +HQGL LHF+EDRLATLKNVIKEP L+ WNLYL  WGYNT KEREE   I RI++
Sbjct  271  QHQGLKLHFIEDRLATLKNVIKEPALDNWNLYLVKWGYNTQKEREETEAIPRIQL  325



>ref|NP_001143648.1| uncharacterized protein LOC100276370 [Zea mays]
 gb|ACG33757.1| hypothetical protein [Zea mays]
Length=336

 Score =   243 bits (619),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 149/175 (85%), Gaps = 0/175 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VA+GL++ EILENW K+KP +++EW E+R++L+DLFG+VRD+W++ND S WIGANRFYP
Sbjct  151  SVADGLSIQEILENWSKLKPTLMDEWQEDRESLVDLFGRVRDDWIENDFSGWIGANRFYP  210

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            G ADALK +SS+ YIVTTKQSRFA ALL+ELA +  P ERIYGLGTGPK KVL+QLQ+M 
Sbjct  211  GTADALKLSSSEAYIVTTKQSRFAEALLKELAVIDFPSERIYGLGTGPKIKVLQQLQQML  270

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            +HQGL LHF+EDRLATLKNVIKEP L+ WNLYL  WGYNT KEREEA  I RI++
Sbjct  271  QHQGLKLHFIEDRLATLKNVIKEPALDNWNLYLVKWGYNTQKEREEAEAIPRIQL  325



>ref|XP_008338880.1| PREDICTED: uncharacterized protein LOC103401933 [Malus domestica]
Length=268

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 139/183 (76%), Gaps = 9/183 (5%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRF---  543
            VAEGLT++ ILE W ++K VI+ EW E RDALI LFGKVRDEWMD DL+TWIGANR+   
Sbjct  75   VAEGLTMEGILEKWSELKQVIMAEWGEERDALIHLFGKVRDEWMDEDLTTWIGANRYPNG  134

Query  542  ------YPGVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKV  381
                  Y  V       +S     +  Q+RF  ALLRELAGVTIPPE+I+GLG+GPK +V
Sbjct  135  DLLLGEYSSVFRPCHSLASSFPHSSFAQARFGNALLRELAGVTIPPEKIFGLGSGPKVEV  194

Query  380  LKQLQEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIAR  201
            LKQLQ+ PEHQGL LHFVED+LA LKNVIKEPEL+GWNL+LG+WGYNT KEREEA  I R
Sbjct  195  LKQLQKKPEHQGLKLHFVEDQLAILKNVIKEPELDGWNLFLGNWGYNTQKEREEAETIPR  254

Query  200  IRI  192
            I+I
Sbjct  255  IQI  257



>gb|KJB22340.1| hypothetical protein B456_004G042000 [Gossypium raimondii]
Length=232

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/131 (85%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VAEGLTV++ILENW KIKPVI+EEW+ENRDALIDLFGKVRDEWMDNDL+TWIGANRFYP
Sbjct  83   SVAEGLTVEDILENWSKIKPVIMEEWDENRDALIDLFGKVRDEWMDNDLATWIGANRFYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GV DALKF+SS +YIVTTKQSRFA ALLRELAGVTIPPERIYGLGTGPK KVLKQLQ  P
Sbjct  143  GVPDALKFSSSTIYIVTTKQSRFADALLRELAGVTIPPERIYGLGTGPKVKVLKQLQLRP  202

Query  356  EHQGLTLHFVE  324
            EHQG+ L +V 
Sbjct  203  EHQGMKLQYVH  213



>gb|KHN29347.1| hypothetical protein glysoja_005071 [Glycine soja]
Length=212

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 133/174 (76%), Gaps = 24/174 (14%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTV+ ILENW K+KP+I+EEW+E RD LIDLFGKVRDEW++ D +TWIGAN     
Sbjct  52   VAEGLTVEGILENWSKLKPIIMEEWDEKRDDLIDLFGKVRDEWLEQDFATWIGAN-----  106

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPE  354
                               S FA ALL+ELAGV IPPERI+GLGTGPK +VLKQLQ+ PE
Sbjct  107  -------------------SHFADALLQELAGVAIPPERIFGLGTGPKVEVLKQLQKKPE  147

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HQGLTLHFVEDRLATLKNVI+EPEL+ WNLYLG+WGYNT KERE AA I RI +
Sbjct  148  HQGLTLHFVEDRLATLKNVIQEPELDQWNLYLGNWGYNTRKEREGAAAIPRIHV  201



>gb|EYU32142.1| hypothetical protein MIMGU_mgv1a011872mg [Erythranthe guttata]
Length=215

 Score =   230 bits (586),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             +AEGLTV+EILENW  IKPVI+ EW+E+RD LIDLFGKVRDEW+DNDL+TWIGANRFYP
Sbjct  83   SIAEGLTVEEILENWSTIKPVIMAEWDEDRDVLIDLFGKVRDEWIDNDLATWIGANRFYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GVADALKFASSK+YIVTTKQ RFA ALLRE+AGV IPPERIYGLGTGPK KVLKQLQ+MP
Sbjct  143  GVADALKFASSKLYIVTTKQGRFAEALLREIAGVVIPPERIYGLGTGPKVKVLKQLQDMP  202

Query  356  EHQGLTLHF  330
            EH+GLTL +
Sbjct  203  EHEGLTLQY  211



>gb|KEH23368.1| hypothetical protein MTR_7g077880 [Medicago truncatula]
Length=216

 Score =   218 bits (555),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VAEGLTV+ ILE+W K+KP+++EEWNENRD LIDLFGKVRD+W++ND + WI  NRFYP
Sbjct  83   SVAEGLTVEGILEDWFKLKPIVMEEWNENRDDLIDLFGKVRDDWLENDFAGWIQGNRFYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GVADAL+FASSKVYIVTTKQ RFA ALLRELAG+TIPPERIYGLGTGPK + LK+LQ+MP
Sbjct  143  GVADALRFASSKVYIVTTKQGRFADALLRELAGITIPPERIYGLGTGPKVETLKKLQKMP  202

Query  356  EHQGLTLHF  330
            EHQGLTL  
Sbjct  203  EHQGLTLQL  211



>gb|ACF83654.1| unknown [Zea mays]
Length=164

 Score =   216 bits (549),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -1

Query  650  VEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVADALKFASSKVYIVTTKQSR  471
            ++EW E+R++L+DLFG+VRD+W++ND S WIGANRFYPG ADALK +SS+ YIVTTKQSR
Sbjct  1    MDEWQEDRESLVDLFGRVRDDWIENDFSGWIGANRFYPGTADALKLSSSEAYIVTTKQSR  60

Query  470  FAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPEHQGLTLHFVEDRLATLKNVIK  291
            FA ALL+ELAG+  P ERIYGLGTGPK KVL+QLQ+M +HQGL LHF+EDRLATLKNVIK
Sbjct  61   FAEALLKELAGIDFPSERIYGLGTGPKVKVLQQLQQMLQHQGLKLHFIEDRLATLKNVIK  120

Query  290  EPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            EP L+ WNLYL  WGYNT KEREE   I RI++
Sbjct  121  EPALDNWNLYLVKWGYNTQKEREETEAIPRIQL  153



>gb|AFK48185.1| unknown [Lotus japonicus]
Length=212

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VAEGLTVD ILE W K+KPVI+EEW ENRDALIDLFGKVRDEW++ + +TWIGANR YP
Sbjct  83   SVAEGLTVDGILEKWSKLKPVIMEEWGENRDALIDLFGKVRDEWLEQNFATWIGANRIYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GV+DALKFASS+VYIVTTKQSRFA A+LRELAGVTIPPERIYGLG+GPK +VLKQLQ+ P
Sbjct  143  GVSDALKFASSRVYIVTTKQSRFADAILRELAGVTIPPERIYGLGSGPKVEVLKQLQKKP  202

Query  356  EHQ  348
            EHQ
Sbjct  203  EHQ  205



>gb|EPS59432.1| hypothetical protein M569_15374 [Genlisea aurea]
Length=210

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             V+EGL V++ILENW  IKPVI+ EW+E+++ALIDLFG++RDEW++ND ++WI ANRFYP
Sbjct  83   SVSEGLVVNQILENWAGIKPVIMAEWDEDKEALIDLFGEIRDEWIENDFASWISANRFYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GV DALKF+SSK+YIVTTKQSRFA ALLR LAGVT+PPERIYGLGTGPK +VLKQLQ+MP
Sbjct  143  GVPDALKFSSSKIYIVTTKQSRFADALLRNLAGVTVPPERIYGLGTGPKVEVLKQLQDMP  202

Query  356  EHQGLTLH  333
            EH+GLTL 
Sbjct  203  EHKGLTLQ  210



>ref|NP_001031547.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC10630.1| uncharacterized protein AT2G45990 [Arabidopsis thaliana]
Length=210

 Score =   213 bits (541),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VAEGLTVD ILE+W K KPVI+E W+E+RDAL+DLFGKVRD+W++ DL+TWIGANRFYP
Sbjct  83   SVAEGLTVDGILESWAKFKPVIMEAWDEDRDALVDLFGKVRDDWINKDLTTWIGANRFYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GV+DALKFASSK+YIVTTKQ RFA ALLRE+AGV IP ERIYGLG+GPK +VLK LQ+ P
Sbjct  143  GVSDALKFASSKIYIVTTKQGRFAEALLREIAGVIIPSERIYGLGSGPKVEVLKLLQDKP  202

Query  356  EHQGLTLH  333
            EHQGLTL 
Sbjct  203  EHQGLTLQ  210



>gb|KDO86213.1| hypothetical protein CISIN_1g024003mg [Citrus sinensis]
Length=220

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VAEGLTV+ ILENW+KIKPVI+EEW+ENR+ALI+L GKVRDEWMD D +TWIGANR YP
Sbjct  83   SVAEGLTVEGILENWLKIKPVIMEEWSENREALIELSGKVRDEWMDTDFTTWIGANRLYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMP  357
            GV+DALK ASS++YIVT+ QSRF   LLRELAGVTI P+R+YGLGTGPK  VLKQLQ+ P
Sbjct  143  GVSDALKLASSRIYIVTSNQSRFVETLLRELAGVTITPDRLYGLGTGPKVNVLKQLQKKP  202

Query  356  EHQGLTLH  333
            EHQGL L 
Sbjct  203  EHQGLRLQ  210



>ref|XP_002989896.1| hypothetical protein SELMODRAFT_130886 [Selaginella moellendorffii]
 gb|EFJ08909.1| hypothetical protein SELMODRAFT_130886 [Selaginella moellendorffii]
Length=268

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 130/183 (71%), Gaps = 3/183 (2%)
 Frame = -1

Query  731  VQLTVKVAEGLTVDEILENWMK-IKPVIVEEWNENR--DALIDLFGKVRDEWMDNDLSTW  561
            V+    +A  L  + ILE+W + IK   +EE  E R    L DL G VRD W+  D+  W
Sbjct  75   VENGTSIASHLDEENILESWTESIKRSFMEEIGEARHKQELEDLLGSVRDAWISRDVHGW  134

Query  560  IGANRFYPGVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKV  381
            + ANRFYPG++DA+KF+SSK++IVTTK++RF    L+ELAGV  P E IYGLG+GPK +V
Sbjct  135  LKANRFYPGISDAIKFSSSKLFIVTTKEARFVTMSLKELAGVDFPEENIYGLGSGPKVEV  194

Query  380  LKQLQEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIAR  201
            LK+LQ   EHQG+TLHFVEDRL+TL NVI +  LN WNL+L  WGYNTP EREEA+K  R
Sbjct  195  LKKLQNRAEHQGMTLHFVEDRLSTLLNVIDDRVLNNWNLHLASWGYNTPTEREEASKKPR  254

Query  200  IRI  192
            I +
Sbjct  255  IEV  257



>ref|XP_002968647.1| hypothetical protein SELMODRAFT_91208 [Selaginella moellendorffii]
 gb|EFJ29763.1| hypothetical protein SELMODRAFT_91208 [Selaginella moellendorffii]
Length=268

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 129/183 (70%), Gaps = 3/183 (2%)
 Frame = -1

Query  731  VQLTVKVAEGLTVDEILENWMK-IKPVIVEEWNENR--DALIDLFGKVRDEWMDNDLSTW  561
            V+    +A  L  + ILE+W + IK   +EE  E R    L DL G VRD W+  D+  W
Sbjct  75   VENGTSIASHLDEENILESWTESIKRSFMEEIGEARHKQELEDLLGSVRDAWISRDVHGW  134

Query  560  IGANRFYPGVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKV  381
            +  NRFYPG++DA+KF+SSK++IVTTK++RF    L+ELAGV  P E IYGLG+GPK +V
Sbjct  135  LKTNRFYPGISDAIKFSSSKLFIVTTKEARFVTMSLKELAGVDFPEENIYGLGSGPKVEV  194

Query  380  LKQLQEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIAR  201
            LK+LQ   EH+G+TLHFVEDRL+TL NVI +  LN WNL+L  WGYNTP EREEA+K  R
Sbjct  195  LKKLQNRAEHRGMTLHFVEDRLSTLLNVIDDRVLNNWNLHLASWGYNTPTEREEASKKPR  254

Query  200  IRI  192
            I +
Sbjct  255  IEV  257



>ref|XP_006445007.1| hypothetical protein CICLE_v10021690mg [Citrus clementina]
 gb|ESR58247.1| hypothetical protein CICLE_v10021690mg [Citrus clementina]
 gb|KDO86217.1| hypothetical protein CISIN_1g024415mg [Citrus sinensis]
Length=202

 Score =   194 bits (493),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             V+EGLTV+ ILENW KIKPVI+E+W+ENRDAL+DLFGKVRDEWMD DL+TWIGANRFYP
Sbjct  83   SVSEGLTVEGILENWSKIKPVIMEDWSENRDALVDLFGKVRDEWMDKDLTTWIGANRFYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG  396
            G+ DALKFASS++YIVTTKQSRFA ALLRELAGVTIPP+RIYGLGTG
Sbjct  143  GIPDALKFASSRIYIVTTKQSRFADALLRELAGVTIPPDRIYGLGTG  189



>ref|XP_006445008.1| hypothetical protein CICLE_v10021690mg [Citrus clementina]
 gb|ESR58248.1| hypothetical protein CICLE_v10021690mg [Citrus clementina]
 gb|KDO86220.1| hypothetical protein CISIN_1g024415mg [Citrus sinensis]
Length=208

 Score =   194 bits (492),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             V+EGLTV+ ILENW KIKPVI+E+W+ENRDAL+DLFGKVRDEWMD DL+TWIGANRFYP
Sbjct  83   SVSEGLTVEGILENWSKIKPVIMEDWSENRDALVDLFGKVRDEWMDKDLTTWIGANRFYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG  396
            G+ DALKFASS++YIVTTKQSRFA ALLRELAGVTIPP+RIYGLGTG
Sbjct  143  GIPDALKFASSRIYIVTTKQSRFADALLRELAGVTIPPDRIYGLGTG  189



>ref|XP_006295045.1| hypothetical protein CARUB_v10024113mg [Capsella rubella]
 gb|EOA27943.1| hypothetical protein CARUB_v10024113mg [Capsella rubella]
Length=193

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            VAEGLTVD ILE W KIKPVI+E W+E++DALIDLFG+VRD+W++ DL+TWIGANRFYPG
Sbjct  84   VAEGLTVDGILETWAKIKPVIMEAWDEDKDALIDLFGQVRDDWINKDLTTWIGANRFYPG  143

Query  533  VADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG  396
            V+DALKFASSK+YIVTTKQ RFA ALLRE+AGV IP ERIYGLG+G
Sbjct  144  VSDALKFASSKIYIVTTKQGRFAEALLREIAGVIIPSERIYGLGSG  189



>dbj|BAC83355.2| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG97066.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87392.1| unnamed protein product [Oryza sativa Japonica Group]
Length=294

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 115/153 (75%), Gaps = 25/153 (16%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VA+GL++ EILENW+K+KP I+ EWNE+RD+L+DLFG +RD+W++NDLS WIGANRFYP
Sbjct  84   SVADGLSIQEILENWLKLKPTIMSEWNEDRDSLVDLFGSIRDDWIENDLSGWIGANRFYP  143

Query  536  GVADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-------------  396
            G ADALKF+SS+VYIVTTKQ RFA ALL+ELAG+  P ERIYGLGTG             
Sbjct  144  GTADALKFSSSEVYIVTTKQGRFAEALLKELAGIEFPSERIYGLGTGLVQYFFYFLFSPV  203

Query  395  ------------PKTKVLKQLQEMPEHQGLTLH  333
                        PK KVL+QLQ+MP+HQGLTLH
Sbjct  204  NHFIESVSLCSSPKVKVLQQLQQMPQHQGLTLH  236



>gb|KJB22341.1| hypothetical protein B456_004G042000 [Gossypium raimondii]
Length=189

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 92/108 (85%), Gaps = 0/108 (0%)
 Frame = -1

Query  515  FASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPEHQGLTL  336
               S++  +    SRFA ALLRELAGVTIPPERIYGLGTGPK KVLKQLQ  PEHQG+ L
Sbjct  71   LVESRLPSIRKSSSRFADALLRELAGVTIPPERIYGLGTGPKVKVLKQLQLRPEHQGMKL  130

Query  335  HFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            HFVEDRLATLKNVIKEPEL+GWNLYLGDWGYNT KEREEAA I+RI++
Sbjct  131  HFVEDRLATLKNVIKEPELDGWNLYLGDWGYNTQKEREEAANISRIQL  178



>ref|XP_005846994.1| hypothetical protein CHLNCDRAFT_24112 [Chlorella variabilis]
 gb|EFN54892.1| hypothetical protein CHLNCDRAFT_24112 [Chlorella variabilis]
Length=273

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 114/176 (65%), Gaps = 5/176 (3%)
 Frame = -1

Query  707  EGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVA  528
            EG+   ++L+ W  + P  ++ W  +R  L+ LFG  RDEWM  DL  W+  NR YPGVA
Sbjct  81   EGVDPTDMLQRWHDMLPEYMQRWQLDRVELVHLFGSTRDEWMAADLEGWLAPNRIYPGVA  140

Query  527  DALK--FASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYG--LGTGPKTKVLKQLQEM  360
            +A++      +VYIVTTKQ+RF  A+LR++AG++ PP+RI+   +   PK++VL+ L   
Sbjct  141  EAVRALMQQHEVYIVTTKQARFTEAILRQMAGISFPPDRIFSQTVSGQPKSEVLEMLAAR  200

Query  359  PEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
              H   +LHFVED+++TL+ V K P L  ++LYL DWGYNT +ER  AA   RI +
Sbjct  201  HPH-APSLHFVEDKMSTLEKVAKLPSLEQYHLYLVDWGYNTQQERRRAAANERIAV  255



>gb|KIZ05430.1| hypothetical protein MNEG_2528 [Monoraphidium neglectum]
Length=274

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 120/173 (69%), Gaps = 10/173 (6%)
 Frame = -1

Query  707  EGLTVDEILENWMK-IKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGV  531
            EG+ V+++LE W   +    +++W  +R  L+ LFG+VRD+W+ +DL+ W+  NR YPGV
Sbjct  83   EGVGVEDMLERWHAGMLDDYMKKWQLDRHELVTLFGRVRDDWIASDLAGWLAPNRIYPGV  142

Query  530  ADALKFA---SSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG--PKTKVLKQLQ  366
            ADA++ A     +VY+VTTKQ+RF A LLR++AG+ +PPERI+       PK++VL +L 
Sbjct  143  ADAVRAALAGGDEVYVVTTKQARFTATLLRDMAGIDLPPERIHSTTVSGEPKSRVLARLA  202

Query  365  EMPEHQGLTLH-FVEDRLATLKNVIKEPELNG-WNLYLGDWGYNTPKEREEAA  213
            E  +H G   + FVED+ +TL+ VIK PE  G W L+L DWGYNTP ER++AA
Sbjct  203  E--QHPGAASYVFVEDKFSTLEKVIKAPETAGKWRLFLVDWGYNTPPERQQAA  253



>ref|XP_011092625.1| PREDICTED: uncharacterized protein LOC105172743 isoform X2 [Sesamum 
indicum]
Length=171

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VAEGLTV+ ILENWMKIKPVI+EEWNENRD LIDLFGKVRDEWMDNDL+TWIGANRFYP
Sbjct  83   SVAEGLTVEGILENWMKIKPVIMEEWNENRDELIDLFGKVRDEWMDNDLATWIGANRFYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAAL  456
            GV DALKFASSK+YIVTTKQ  +  +L
Sbjct  143  GVPDALKFASSKLYIVTTKQMLYFESL  169



>ref|XP_005651981.1| hypothetical protein COCSUDRAFT_26736 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE27437.1| hypothetical protein COCSUDRAFT_26736 [Coccomyxa subellipsoidea 
C-169]
Length=310

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 107/176 (61%), Gaps = 6/176 (3%)
 Frame = -1

Query  707  EGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVA  528
            EG + ++IL NW  I P  +  W  +R  L+DLFG  RDEW+  DL  W+ AN  Y G+ 
Sbjct  123  EGDSEEDILNNWHTILPDRMARWQLDRSELVDLFGDFRDEWIARDLDGWLNANEIYEGLP  182

Query  527  DALK--FASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYG--LGTGPKTKVLKQLQEM  360
            D L        +YIVTTKQ+RF  AL+  +A V I P+ I+   +   PK+ +LK LQ+ 
Sbjct  183  DILTHLMQQHDLYIVTTKQARFTEALMHNMAKVPISPDHIFSTTVSGQPKSDILKDLQQ-  241

Query  359  PEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
             +H G + HFVED+L+TL+ V K PEL  W LYL DWGYNT +ERE A    RI +
Sbjct  242  -QHPGTSYHFVEDKLSTLEKVCKVPELQEWQLYLVDWGYNTREERERAEANPRISV  296



>emb|CBN78330.1| conserved unknown protein [Ectocarpus siliculosus]
Length=301

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 102/150 (68%), Gaps = 3/150 (2%)
 Frame = -1

Query  641  WNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVADALKFASSKVYIVTTKQSRFAA  462
            ++ +R+ L+D FG  RDEWM+ D   W+GAN+FY G+ +A+     +VY++TTKQ+RFA+
Sbjct  143  YDLSREELVDAFGSARDEWMEADFQGWLGANKFYEGIPEAISACEGEVYVITTKQTRFAS  202

Query  461  ALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPEHQGLTLHFVEDRLATLKNVIKEPE  282
            ALL E AG+ +P +RI+GLGTGPK  VL QLQ   +H G TL F+EDR+ TL+ V  + +
Sbjct  203  ALL-EHAGIKVPLDRIFGLGTGPKAGVLAQLQT--KHSGCTLVFLEDRVETLEAVCADSK  259

Query  281  LNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            L G  LYL DWG+NT  +R       R+ +
Sbjct  260  LEGVRLYLCDWGFNTAAQRARGESNGRVTV  289



>ref|XP_005706460.1| hypothetical protein Gasu_27250 [Galdieria sulphuraria]
 gb|EME29940.1| hypothetical protein Gasu_27250 [Galdieria sulphuraria]
Length=277

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 108/171 (63%), Gaps = 2/171 (1%)
 Frame = -1

Query  701  LTVDEILENWM-KIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            L+V EI+ENW  +IK  +  E+      L+DLFGK RDEW+  DL  W+G +RFYPG+ D
Sbjct  97   LSVGEIMENWHSQIKDQLWREYKTCDKELVDLFGKTRDEWIRQDLQGWLGKHRFYPGIVD  156

Query  524  ALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPEHQG  345
            AL F+ S ++IVTTK+ RF   LL+  +GV +  +RIYGL  G K KVLK L ++ E +G
Sbjct  157  ALNFSESPLFIVTTKEKRFVCQLLKH-SGVEMEEQRIYGLDAGNKLKVLKTLIKLDELKG  215

Query  344  LTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
             TL+FVEDR+ TL++            YL  WGYNT + R  AA+  +I +
Sbjct  216  RTLYFVEDRVETLEDACLTMLGTPVKFYLASWGYNTEEVRARAARNPQIEV  266



>ref|XP_001698105.1| hypothetical protein CHLREDRAFT_151387 [Chlamydomonas reinhardtii]
 gb|EDO99690.1| predicted protein [Chlamydomonas reinhardtii]
Length=293

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 107/169 (63%), Gaps = 5/169 (3%)
 Frame = -1

Query  707  EGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVA  528
            EG++VD++L +W  + P  + EW   R  +++LFG+VRD+W+  DL+ W+  NR Y GVA
Sbjct  107  EGVSVDDMLSSWEHLLPAKMAEWGLQRGDMVELFGRVRDDWIAADLAGWLAPNRIYDGVA  166

Query  527  DALK--FASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYG--LGTGPKTKVLKQLQEM  360
            D ++   A+  VYIVTTKQ+ +   LLR++A V  P +RI+   +   PK +VL  L   
Sbjct  167  DPVRTALAAHHVYIVTTKQAHYTEILLRDMAAVPFPADRIFSQTVSGRPKGEVLANLAAA  226

Query  359  PEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAA  213
                   + FVED+L+TL+ V K+P L+ W L+L DWGYNTP ER  AA
Sbjct  227  HPGAAAKI-FVEDKLSTLEKVAKDPSLSDWKLFLVDWGYNTPAERARAA  274



>ref|XP_005715963.1| unnamed protein product [Chondrus crispus]
 emb|CDF36144.1| unnamed protein product [Chondrus crispus]
Length=266

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 101/160 (63%), Gaps = 0/160 (0%)
 Frame = -1

Query  695  VDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVADALK  516
            V+ +LE+W  IK  ++ +W  ++D L++ FG  RD+W++ DL +W+ ANR +PGVADAL 
Sbjct  88   VESVLEDWEAIKEALMADWEVSKDDLVEAFGHARDKWIEKDLDSWVNANRIFPGVADALN  147

Query  515  FASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTGPKTKVLKQLQEMPEHQGLTL  336
            FAS+ +YI+TTKQ+RF   LL       I  E ++G GTG K  VLK++   PEH+G  L
Sbjct  148  FASAPLYIITTKQTRFCLLLLERYGIKNIQKENVFGYGTGSKISVLKKILASPEHKGKKL  207

Query  335  HFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEA  216
             FVEDR  TL++          +LYL  WGYNT + +  A
Sbjct  208  VFVEDRYDTLEDASLSLLGTPLDLYLATWGYNTAETKRVA  247



>ref|XP_002946102.1| hypothetical protein VOLCADRAFT_101579 [Volvox carteri f. nagariensis]
 gb|EFJ53097.1| hypothetical protein VOLCADRAFT_101579 [Volvox carteri f. nagariensis]
Length=285

 Score =   148 bits (374),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 110/177 (62%), Gaps = 7/177 (4%)
 Frame = -1

Query  707  EGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVA  528
            EG++VDE+L  W  + P  + EW  NR  +++LFG+VRD+W+  DL  W+  NR Y GVA
Sbjct  84   EGVSVDEMLATWETMLPSRMAEWGLNRGEMVELFGQVRDDWIAADLDGWLAPNRIYEGVA  143

Query  527  DAL--KFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYG--LGTGPKTKVLKQLQEM  360
            D +    +S +VYIVTTKQ+ +   L+R++A V  P +RI+   +   PK +VL  L   
Sbjct  144  DPVCGAMSSHQVYIVTTKQAHYTEILMRDMASVPFPADRIFSQTVSGRPKGEVLAALAA-  202

Query  359  PEHQGLTLH-FVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
             +H  +    FVED+L+TL+ V ++P L+ W L+L DWGYNTP ER  AA    I +
Sbjct  203  -QHPDVNAKIFVEDKLSTLEKVARDPALSDWQLFLVDWGYNTPGERARAAAHPAITV  258



>gb|KDO86218.1| hypothetical protein CISIN_1g024415mg [Citrus sinensis]
Length=190

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             V+EGLTV+ ILENW KIKPVI+E+W+ENRDAL+DLFGKVRDEWMD DL+TWIGANRFYP
Sbjct  83   SVSEGLTVEGILENWSKIKPVIMEDWSENRDALVDLFGKVRDEWMDKDLTTWIGANRFYP  142

Query  536  GVADALKFASSKVYIVTTKQSRFAAAL  456
            G+ DALKFASS++YIVTTKQ  +  +L
Sbjct  143  GIPDALKFASSRIYIVTTKQMLYYESL  169



>ref|XP_006445010.1| hypothetical protein CICLE_v10021690mg [Citrus clementina]
 gb|ESR58250.1| hypothetical protein CICLE_v10021690mg [Citrus clementina]
 gb|KDO86221.1| hypothetical protein CISIN_1g024415mg [Citrus sinensis]
Length=166

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             V+EGLTV+ ILENW KIKPVI+E+W+ENRDAL+DLFGKVRDEWMD DL+TWIGANRFYP
Sbjct  83   SVSEGLTVEGILENWSKIKPVIMEDWSENRDALVDLFGKVRDEWMDKDLTTWIGANRFYP  142

Query  536  GVADALKFASSKVYIVTTKQ  477
            G+ DALKFASS++YIVTTKQ
Sbjct  143  GIPDALKFASSRIYIVTTKQ  162



>gb|KDD75212.1| hypothetical protein H632_c807p0 [Helicosporidium sp. ATCC 50920]
Length=181

 Score =   142 bits (359),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 98/169 (58%), Gaps = 8/169 (5%)
 Frame = -1

Query  683  LENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVADALK--FA  510
            +ENW +  P ++ +WN  R  LI L    RD W+  DL  W GANR Y  V  AL     
Sbjct  1    MENWSRTIPSLMAQWNVERSQLIKLLASTRDGWIAADLRGWTGANRLYSAVGPALHSLVK  60

Query  509  SSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLG-TG-PKTKVLKQLQ-EMPEHQGLT  339
              + +IVTTKQ+++   LLRELAGV + PERI     TG PK  VL+ LQ   P+ +   
Sbjct  61   QQEAFIVTTKQAQYVDVLLRELAGVELAPERIVSTAETGEPKATVLEHLQARFPDTR---  117

Query  338  LHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
             HFVEDR ATL++V   PE+  W L+L DWGYNTP+ERE        RI
Sbjct  118  YHFVEDRAATLESVAAMPEMERWKLHLADWGYNTPEEREACRARPDCRI  166



>gb|KDO86219.1| hypothetical protein CISIN_1g024415mg [Citrus sinensis]
Length=193

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             V+EGLTV+ ILENW KIKPVI+E+W+ENRDAL+DLFGKVRDEWMD DL+TWIGANRFYP
Sbjct  83   SVSEGLTVEGILENWSKIKPVIMEDWSENRDALVDLFGKVRDEWMDKDLTTWIGANRFYP  142

Query  536  GVADALKFASSKVYIVTTK  480
            G+ DALKFASS++YIVTTK
Sbjct  143  GIPDALKFASSRIYIVTTK  161



>ref|XP_011401855.1| hypothetical protein F751_6329 [Auxenochlorella protothecoides]
 gb|KFM28808.1| hypothetical protein F751_6329 [Auxenochlorella protothecoides]
Length=273

 Score =   142 bits (359),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 110/183 (60%), Gaps = 14/183 (8%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDL--------FGKVRDEWMDNDLSTWIGAN  549
            G+    IL++W K+    ++ W  +R  + DL        FG +RD+ M  DL+ WI  N
Sbjct  83   GVDPQAILKDWHKLLGEHMQLWGLDRSEVQDLKARGLLAAFGGMRDQMMQEDLAAWIDMN  142

Query  548  RFYPGVADALK--FASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLG-TG-PKTKV  381
              YPGVA++++   A  + YIVTTKQ+RFA A+L  LAGV +PPERI+    TG PK+++
Sbjct  143  DIYPGVAESVRRLVADHEAYIVTTKQARFAEAILHRLAGVDLPPERIFSQAETGAPKSEI  202

Query  380  LKQLQEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIAR  201
            L  L+E   H G   HFVED+  TL      P+L  WNLYL DWGYNT +ERE   +  R
Sbjct  203  LHLLEE--RHPGTQYHFVEDKALTLHKASAMPQLAHWNLYLVDWGYNTQEEREVVRRQDR  260

Query  200  IRI  192
            I++
Sbjct  261  IKL  263



>ref|XP_003057547.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59192.1| predicted protein [Micromonas pusilla CCMP1545]
Length=282

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 109/180 (61%), Gaps = 10/180 (6%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G +VDEIL +W  + P ++E WN +R +++  +G +RD+WM+ DL+ W+  N  YPG+ +
Sbjct  86   GYSVDEILASWGALMPPLMERWNLDRASMVSGYGAIRDDWMEADLAGWLAPNLIYPGIGE  145

Query  524  ALKFA----SSKVYIVTTKQSRFAAALLRE---LAGVTIPPERIYGLGTG--PKTKVLKQ  372
            A   A    +  V+IVTTKQ+RFAAA++ E    A + +P  R++       PKT VL++
Sbjct  146  ACNVAEASSACDVFIVTTKQARFAAAIMEEKARSANLVVPETRLFSQCVSGIPKTAVLRE  205

Query  371  LQEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            L +    +G    FVED+++TL+ V     L  W L+L DWGYNTP+ER  A    RI +
Sbjct  206  LGDAA-AEGARKVFVEDKMSTLEKVCATEGLEDWELFLVDWGYNTPEERARAEANPRITV  264



>ref|XP_010087947.1| hypothetical protein L484_012399 [Morus notabilis]
 gb|EXB30869.1| hypothetical protein L484_012399 [Morus notabilis]
Length=163

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             V+EGLTV+ IL+NW+K+KP+I+EEW E R+ LIDLFGKVRDEWM+ DL++WIGANRFYP
Sbjct  83   SVSEGLTVERILDNWLKLKPIIMEEWGEQREELIDLFGKVRDEWMEKDLASWIGANRFYP  142

Query  536  GVADALKFASSKVYIVTTKQ  477
            GVADALKF+SS +YIVTTKQ
Sbjct  143  GVADALKFSSSSIYIVTTKQ  162



>gb|ACJ84457.1| unknown [Medicago truncatula]
 gb|AFK49628.1| unknown [Medicago truncatula]
Length=171

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
             VAEGLTV+ +LE+W K+KP+++EEWNENRD LIDLFGKVRD+W++ND + WI  NRFYP
Sbjct  83   SVAEGLTVEGVLEDWFKLKPIVMEEWNENRDDLIDLFGKVRDDWLENDFAGWIQGNRFYP  142

Query  536  GVADALKFASSKVYIVTTK  480
            GVADAL+FASSKVYIVTTK
Sbjct  143  GVADALRFASSKVYIVTTK  161



>ref|XP_003082555.1| unnamed protein product [Ostreococcus tauri]
Length=275

 Score =   135 bits (339),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 109/178 (61%), Gaps = 9/178 (5%)
 Frame = -1

Query  707  EGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVA  528
            +G  V++IL  W +I   +++ W  +R  +++ FG++RD+W++ D   W+  N  YPGVA
Sbjct  88   DGYGVEDILNEWDQISGGLMQRWGLDRAMMVEAFGRIRDDWIEEDFDGWLEPNALYPGVA  147

Query  527  DALKFASSK----VYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG--PKTKVLKQLQ  366
            +A+K A ++    V IVTTKQ RFA A++  + G+ IP E ++       PKT VL+   
Sbjct  148  EAVKRAQARSDAAVKIVTTKQGRFALAIMERMGGLVIPEEDMFSTTVSGIPKTDVLRTFG  207

Query  365  EMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
               + + +   FVED+L+TL+ V K  +LN W LYL +WGYNTP+ER  A    RI++
Sbjct  208  TEGKWRKI---FVEDKLSTLEKVSKADDLNEWELYLVNWGYNTPEERARANANPRIKV  262



>ref|WP_015131278.1| hypothetical protein [Calothrix sp. PCC 7507]
 gb|AFY35487.1| hypothetical protein Cal7507_5146 [Calothrix sp. PCC 7507]
Length=261

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 111/178 (62%), Gaps = 5/178 (3%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            + +G+  ++IL+ W  I P I+ +       +      +RDEW+  DL+ W+  +RFYPG
Sbjct  71   LVDGIADEKILQQWATITPQILLDHKLQAREIGAKLDNIRDEWIATDLAGWLSLHRFYPG  130

Query  533  VADALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQ  366
            V + +K    ++ K+YIVTTK+ RF   LL++  GV +PP  I+G     PK ++L++L+
Sbjct  131  VVEKIKVTLASAVKLYIVTTKEGRFVQQLLQQ-EGVDLPPTAIFGKEEKRPKYEILRELK  189

Query  365  EMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            +  + Q ++L FVEDRL TL+ V K+P+LN   L+L DWGYNT  ERE A K  +I++
Sbjct  190  QKADFQPVSLWFVEDRLKTLQLVQKQPDLNDVKLFLADWGYNTQSERETAKKDPQIQL  247



>ref|XP_001421063.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99356.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=274

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 107/177 (60%), Gaps = 9/177 (5%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G +++EIL +W  +   ++++W+ +R  +++ FG++RD+W+ ND   W+  N  YPGVA+
Sbjct  88   GYSIEEILNDWDGLSGALMDKWSLDRATMVEAFGRIRDDWILNDFDGWLAPNALYPGVAE  147

Query  524  AL----KFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG--PKTKVLKQLQE  363
            A+    K + + V IVTTKQ RFA A+L  +  ++I  + +Y       PKT VL+ L  
Sbjct  148  AVLAAQKRSDAAVKIVTTKQGRFALAILERMGKISIADDDMYSTTVSGIPKTDVLRTLGV  207

Query  362  MPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
                + +   FVED+L+TL+ V K  +L+ W L+L DWGYNT  ER  AA   RI +
Sbjct  208  DGNPRKI---FVEDKLSTLEKVCKADDLDEWELFLVDWGYNTESERARAAANDRITV  261



>ref|XP_010087945.1| hypothetical protein L484_012397 [Morus notabilis]
 gb|EXB30867.1| hypothetical protein L484_012397 [Morus notabilis]
Length=88

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/69 (84%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = -1

Query  398  GPKTKVLKQLQEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREE  219
            GPK KVLKQLQ  PEHQGL LHFVEDRLATLKNVI+EPEL+GWNLYLG+WGYNTPKEREE
Sbjct  9    GPKVKVLKQLQSRPEHQGLRLHFVEDRLATLKNVIREPELDGWNLYLGNWGYNTPKEREE  68

Query  218  AAKIARIRI  192
            AA + RI I
Sbjct  69   AAGVPRISI  77



>ref|XP_002501989.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63247.1| predicted protein [Micromonas sp. RCC299]
Length=281

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 95/161 (59%), Gaps = 7/161 (4%)
 Frame = -1

Query  698  TVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVADAL  519
            TVD+I+ +W  + P ++E W  +R  ++  +GK+RD+WM  DL  W+  N  YPGVA+A 
Sbjct  89   TVDDIIADWGGLMPGLMERWGCDRGEMVAGYGKIRDDWMAADLDGWLAPNLVYPGVAEAC  148

Query  518  ----KFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG--PKTKVLKQLQEMP  357
                  A+  V+IVTTKQ+RFA A++R    + IP  R++       PKT VL  LQ   
Sbjct  149  IAAEDSANCDVFIVTTKQARFAQAIMRRKGNLRIPDNRVFSQTVSGLPKTDVLADLQANA  208

Query  356  EHQGLTLHFVEDRLATLKNVIK-EPELNGWNLYLGDWGYNT  237
                + L FVED+L+TL+ V K    L  W LYL DWGYNT
Sbjct  209  RDDDVRLVFVEDKLSTLEKVCKVGTALERWELYLVDWGYNT  249



>ref|WP_027403505.1| haloacid dehalogenase [Aphanizomenon flos-aquae]
Length=261

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 105/178 (59%), Gaps = 5/178 (3%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            + EG + D+IL++W  I P I+   N    A+      +RDEW+  DL  W+  +RFYPG
Sbjct  71   LIEGFSDDQILQSWTNITPQILAADNLEAKAVSTKLDHLRDEWIQTDLDGWLSLHRFYPG  130

Query  533  VADALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQ  366
            V + LK    +  ++YIVTTK+ RF   LL++  GV +PPE I+G     PK + L++L 
Sbjct  131  VIERLKITLKSEIQLYIVTTKEGRFVKQLLQQ-EGVDLPPEDIFGKEIKRPKYETLRELI  189

Query  365  EMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            +    Q  +L FVEDRL TL+ V ++ +LN   L+L DWGYNT  ERE     +RI +
Sbjct  190  KKANIQSASLWFVEDRLKTLQLVQQQSDLNHVKLFLADWGYNTQPEREAGKNDSRIHL  247



>ref|WP_039201064.1| haloacid dehalogenase [Aphanizomenon flos-aquae]
 gb|KHG42005.1| haloacid dehalogenase [Aphanizomenon flos-aquae 2012/KM1/D3]
Length=261

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 105/178 (59%), Gaps = 5/178 (3%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            + EG + D+IL++W  I P I+   N    A+      +RDEW+  DL+ W+  +RFYPG
Sbjct  71   LIEGFSDDQILQSWTNITPKILAADNLEAKAVSTKLDHLRDEWIQTDLNGWLSLHRFYPG  130

Query  533  VADALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQ  366
            V + LK    +  ++YIVTTK+ RF   LL++  GV +PPE I+G     PK + L++L 
Sbjct  131  VIERLKITLKSEIQLYIVTTKEGRFVKQLLQQ-EGVNLPPENIFGKEIKRPKYETLRELI  189

Query  365  EMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            +    Q  +L FVEDRL TL+ V ++ +LN   L+L DWGYNT  ERE      RI +
Sbjct  190  KKANIQSASLWFVEDRLKTLQLVQQQSDLNHVQLFLADWGYNTQPEREAGKNDPRIHL  247



>ref|WP_037222861.1| haloacid dehalogenase [Richelia intracellularis]
 emb|CDN15340.1| hypothetical protein RintRC_2451 [Richelia intracellularis]
Length=259

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 110/176 (63%), Gaps = 5/176 (3%)
 Frame = -1

Query  707  EGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVA  528
            E +  D+I +NW  +   IVE+ N     +     K+RDEW+ NDL  W+  + FYPGV 
Sbjct  73   EKVNNDDIYQNWASLVKEIVEKDNLIAQEIGAKLDKLRDEWIQNDLEYWLSLHSFYPGVV  132

Query  527  DALKFA---SSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGL-GTGPKTKVLKQLQEM  360
              ++ A   +++VYI+TTK+ RFA  LL++ AG+ I   +I+G     PK ++L+QL   
Sbjct  133  AIIQAAIANNTQVYIITTKEGRFARKLLQK-AGLNIERSKIFGKEAKRPKYEILRQLITE  191

Query  359  PEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
             E +  T+ FVEDRL TL+ V ++P+L   +LY+ DWGYNTP+ERE A   +RI++
Sbjct  192  HEIEAETVWFVEDRLKTLQLVEQQPDLQSVHLYMADWGYNTPQERETAENHSRIQL  247



>ref|WP_015079130.1| hypothetical protein [Anabaena sp. 90]
 gb|AFW93966.1| hypothetical protein ANA_C11184 [Anabaena sp. 90]
Length=261

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 107/178 (60%), Gaps = 5/178 (3%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            + EG + D+IL++W  I P I+   N    A+      +RDEW+  DL+ W+  +RFYPG
Sbjct  71   LIEGFSDDQILQSWTNITPQILAADNLEAKAVSTKLDHLRDEWIQTDLNGWLSLHRFYPG  130

Query  533  VADALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQ  366
            V + LK    +  ++YIVTTK+ RF   LL++  GV +PPE I+G     PK + L++L 
Sbjct  131  VIERLKITLKSERQLYIVTTKEGRFVKELLQQ-EGVNLPPENIFGKEVKRPKYETLRELI  189

Query  365  EMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            +    Q ++L FVEDRL TL+ V ++ +L+   L+L DWGYNT  ERE      RI++
Sbjct  190  KKANIQNVSLWFVEDRLKTLQLVKQQSDLDHVKLFLADWGYNTQPEREAGKNDPRIQL  247



>gb|ADI63213.1| conserved hypothetical protein ['Nostoc azollae' 0708]
Length=266

 Score =   129 bits (324),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 106/178 (60%), Gaps = 5/178 (3%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            + EG + D+IL++W  I   I+   N +   +      +RDEW+  DL +W+  ++FYPG
Sbjct  76   LIEGFSDDKILQDWTNITSQILTADNLDAKEVAKKLDTLRDEWIKADLDSWLNLHKFYPG  135

Query  533  VADALKFASS---KVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQ  366
            V + LK   +   ++YI+TTK+ RF   LLR+  GV +P   I+G     PK + L+QL 
Sbjct  136  VIEKLKMTVTSEVQLYIITTKEGRFVQHLLRK-EGVHLPTTAIFGKEVKRPKYETLRQLI  194

Query  365  EMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            E  EH  +++ FVEDRL TL+ + K+ +LN   L+L DWGYNT +ER+      RI++
Sbjct  195  EKSEHSSVSVWFVEDRLKTLQLIQKQSDLNHVQLFLADWGYNTQRERQTGNNDQRIKL  252



>ref|WP_041642504.1| haloacid dehalogenase [Trichormus azollae]
Length=262

 Score =   129 bits (323),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 106/178 (60%), Gaps = 5/178 (3%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            + EG + D+IL++W  I   I+   N +   +      +RDEW+  DL +W+  ++FYPG
Sbjct  72   LIEGFSDDKILQDWTNITSQILTADNLDAKEVAKKLDTLRDEWIKADLDSWLNLHKFYPG  131

Query  533  VADALKFASS---KVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQ  366
            V + LK   +   ++YI+TTK+ RF   LLR+  GV +P   I+G     PK + L+QL 
Sbjct  132  VIEKLKMTVTSEVQLYIITTKEGRFVQHLLRK-EGVHLPTTAIFGKEVKRPKYETLRQLI  190

Query  365  EMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            E  EH  +++ FVEDRL TL+ + K+ +LN   L+L DWGYNT +ER+      RI++
Sbjct  191  EKSEHSSVSVWFVEDRLKTLQLIQKQSDLNHVQLFLADWGYNTQRERQTGNNDQRIKL  248



>ref|XP_007514480.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14720.1| predicted protein [Bathycoccus prasinos]
Length=276

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 107/179 (60%), Gaps = 7/179 (4%)
 Frame = -1

Query  707  EGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVA  528
            +G  V+ IL++W  +   ++++W  +R  ++  FGK+RD+W+  D  +W+  N  Y  V 
Sbjct  85   DGYDVESILKDWPILSETLMQKWQLDRKTMVLEFGKIRDDWIRTDFKSWLQPNALYEDVP  144

Query  527  DALKFAS----SKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG--PKTKVLKQLQ  366
            +AL+F +    +KV IVTTKQ+RFA A+L ++ GV IP E +        PK  VL +L+
Sbjct  145  EALRFCTERRDAKVTIVTTKQARFADAILVDMGGVKIPEEDLISTTVSGEPKADVLVRLE  204

Query  365  EMPEHQGLT-LHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            E     G + + FVED+L+TL  V  +  L+ W+L+  DWGYNT  ER+ A    R+++
Sbjct  205  ETFNKDGASRMIFVEDKLSTLIKVANDKRLSKWDLFFVDWGYNTEDERQVAKHDYRMKL  263



>ref|WP_026092903.1| haloacid dehalogenase [Calothrix sp. PCC 7103]
Length=258

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 109/178 (61%), Gaps = 7/178 (4%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            + EG++ D IL++W  +   I+ E N     +      +RD+W+ NDL  W+  +RFYPG
Sbjct  70   IVEGISEDNILKDWANMTKKILAESNLQSSDVAHKLDSLRDDWIKNDLEDWMSLHRFYPG  129

Query  533  VADALK--FASS-KVYIVTTKQSRFAAALLRELAGVTIPPERIYGL-GTGPKTKVLKQLQ  366
            VAD ++   AS  K+YIVTTK+ RFA  LL++  G+ +P E I+G     PK ++L++L+
Sbjct  130  VADRIRNMIASDIKIYIVTTKEGRFAHQLLQK-EGIDLPREVIFGKEAKRPKYEILRELK  188

Query  365  EMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
               E  G  + F+EDRL TL+ V K+ +L+   L+L DWGYNTP ER  A   +R+ +
Sbjct  189  ANTE--GANIWFIEDRLKTLQLVKKQSDLDDVTLFLADWGYNTPSERLVAHSDSRMHL  244



>emb|CEG00058.1| HAD-like domain [Ostreococcus tauri]
Length=169

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 98/159 (62%), Gaps = 9/159 (6%)
 Frame = -1

Query  650  VEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVADALKFASSK----VYIVTT  483
            ++ W  +R  +++ FG++RD+W++ D   W+  N  YPGVA+A+K A ++    V IVTT
Sbjct  1    MQRWGLDRAMMVEAFGRIRDDWIEEDFDGWLEPNALYPGVAEAVKRAQARSDAAVKIVTT  60

Query  482  KQSRFAAALLRELAGVTIPPERIYGLGTG--PKTKVLKQLQEMPEHQGLTLHFVEDRLAT  309
            KQ RFA A++  + G+ IP E ++       PKT VL+      + + +   FVED+L+T
Sbjct  61   KQGRFALAIMERMGGLVIPEEDMFSTTVSGIPKTDVLRTFGTEGKWRKI---FVEDKLST  117

Query  308  LKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            L+ V K  +LN W LYL +WGYNTP+ER  A    RI++
Sbjct  118  LEKVSKADDLNEWELYLVNWGYNTPEERARANANPRIKV  156



>ref|WP_008178737.1| haloacid dehalogenase [Moorea producens]
 gb|EGJ35316.1| hypothetical protein LYNGBM3L_08060 [Moorea producens 3L]
Length=260

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 106/176 (60%), Gaps = 6/176 (3%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G++ ++IL++W  +   IV     +R  +      +RD+W+  DL  W+  ++FYPGV +
Sbjct  71   GISEEKILQDWSAVAQSIVNSETLDRTDIAKQLDTIRDKWITTDLDAWLSLHQFYPGVIE  130

Query  524  ----ALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEM  360
                 L   ++++YIV+TK+ RF   LL++  G+ +P ERI G  +  PK + L+QL E 
Sbjct  131  RLDQILSTNTTQLYIVSTKEGRFIKQLLQQ-QGINLPQERIIGKESKRPKHQTLRQLIET  189

Query  359  PEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
               + +TL FVEDRL TL++V ++P+L    LYL DWGYNT  E+E A    RI++
Sbjct  190  FPGEAVTLWFVEDRLKTLQSVQQQPDLKPVKLYLADWGYNTKAEQESAGHDPRIQL  245



>ref|WP_009343992.1| haloacid dehalogenase [Raphidiopsis brookii]
 gb|EFA71918.1| conserved hypothetical protein [Raphidiopsis brookii D9]
Length=267

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 108/178 (61%), Gaps = 5/178 (3%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            + +G + ++IL++W+KI   I+E    +   + +    +RD+W+ NDL  W+G +RFYPG
Sbjct  71   IIDGFSDEQILQDWLKIVTEILETSQLSSQEVGNKLDGLRDQWISNDLGGWLGLHRFYPG  130

Query  533  VADALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQ  366
            V + LK    +  +++IVTTK+ RF   LL E  GV +P + I+G     PK ++L++L 
Sbjct  131  VIERLKLTIDSEVELFIVTTKEERFVKQLL-EQEGVNLPEKAIFGKEVKLPKYEILRELI  189

Query  365  EMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
               E+Q   L FVEDRL TL+ V ++ +L+   L+L DWGYNT  ERE      RI++
Sbjct  190  RTTEYQPARLWFVEDRLKTLQLVQQQSDLDKVGLFLADWGYNTQSEREAGQNDPRIQL  247



>ref|WP_017312377.1| haloacid dehalogenase [Fischerella sp. PCC 9339]
Length=260

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 109/182 (60%), Gaps = 5/182 (3%)
 Frame = -1

Query  725  LTVKVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANR  546
            L   + EG+   EIL+NW  I   I+ + N N   +     K+RDEW+ NDL +W+  +R
Sbjct  66   LVKALLEGIAEVEILQNWHHIHQKILLQDNLNAKEVSTKLDKLRDEWIANDLESWLSLHR  125

Query  545  FYPGVADALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVL  378
            FYPG+ D LK+   ++SK+YI++TK+ RF   LL +  GV +  E I G     PK ++L
Sbjct  126  FYPGIIDKLKWTIASTSKLYIISTKEGRFVQQLLHQ-EGVNLGSEEILGKEVKRPKYEIL  184

Query  377  KQLQEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARI  198
            ++L ++ +    T+ FVEDRL TL+ V ++ +L    L+L DWGYNTP E+  A    RI
Sbjct  185  RELIQLHKTPQETVWFVEDRLKTLQLVDQQIDLKDVKLFLADWGYNTPLEKTTAQNDPRI  244

Query  197  RI  192
            ++
Sbjct  245  QL  246



>ref|WP_017655827.1| haloacid dehalogenase [Microchaete sp. PCC 7126]
Length=261

 Score =   124 bits (310),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 107/170 (63%), Gaps = 5/170 (3%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            + +G+  ++IL+ W+ I P I+ ++      +      +RDEW+  DL  W+  ++FYPG
Sbjct  71   LVDGIPDEKILQQWVTITPQILLDYQIQAREIGAKLDNIRDEWIATDLDNWLSLHKFYPG  130

Query  533  VADALK---FASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQ  366
            V + ++    ++ ++YIVTTK+ RF   LL++ +GV +PP  I+G     PK ++L+QL+
Sbjct  131  VVEKIQATLTSNIQMYIVTTKEGRFVQQLLQQ-SGVDLPPGVIFGKEEKRPKYEILRQLK  189

Query  365  EMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEA  216
            E  E Q ++L FVEDRL TL+ V ++P+L    L+L DWGYNT  ER+ A
Sbjct  190  EKAEFQPVSLWFVEDRLKTLQLVQQQPDLADVQLFLADWGYNTQAERKLA  239



>ref|WP_026719826.1| haloacid dehalogenase [Fischerella sp. PCC 9431]
Length=260

 Score =   123 bits (309),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 111/182 (61%), Gaps = 5/182 (3%)
 Frame = -1

Query  725  LTVKVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANR  546
            L   + EG+  +EIL++W  I   I+ + N N   +     K+RDEW+ +DL  W+  +R
Sbjct  66   LVKALLEGIAEEEILQDWHNINQKILLKHNLNAKEISTKLDKLRDEWIAHDLEGWLSLHR  125

Query  545  FYPGVADALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVL  378
            FYPGV D LK    ++SK+YI++TK+ RF   LL++  GV +  E I+G     PK ++L
Sbjct  126  FYPGVIDKLKSTIASTSKLYIISTKEGRFVQQLLQK-EGVNLGSEDIFGKEVKRPKYEIL  184

Query  377  KQLQEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARI  198
            ++L ++ +    T+ FVEDRL TL+ V ++ +L    L+L DWGYNTP E+  A   +RI
Sbjct  185  RELIQLHKVPQETVWFVEDRLKTLQLVDQQTDLKDVKLFLADWGYNTPLEKTTAQNDSRI  244

Query  197  RI  192
            ++
Sbjct  245  QL  246



>ref|WP_015199791.1| hypothetical protein [Calothrix parietina]
 gb|AFZ03169.1| hypothetical protein Cal6303_4260 [Calothrix sp. PCC 6303]
Length=264

 Score =   123 bits (309),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 107/178 (60%), Gaps = 5/178 (3%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            + E L+ + IL++W+ I   I+ E + N   L      +RDEW+ +DL  W+  +RFYPG
Sbjct  71   LTEKLSEEVILKDWVNITQRILRENDLNSQDLAVKLDGIRDEWIKHDLEDWMSLHRFYPG  130

Query  533  VADALKFASS---KVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQ  366
            V + ++   S   K+YIVTTK+ RFA  LL E  G+ IP E I+G     PK+++L+++Q
Sbjct  131  VVEKIQDMISSNIKLYIVTTKEGRFAHKLL-EKEGINIPRECIFGKELKRPKSQILREIQ  189

Query  365  EMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
               E     + F+EDRL TL++V  +P+L+   L+L DWGYNTP +R  A   + I +
Sbjct  190  NNGEQTDKNIWFIEDRLKTLQSVKAQPDLSDVKLFLADWGYNTPSDRLVAHNDSEINL  247



>ref|WP_044450319.1| haloacid dehalogenase [Mastigocladus laminosus]
 gb|KIY12673.1| haloacid dehalogenase [Mastigocladus laminosus UU774]
Length=260

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 109/182 (60%), Gaps = 5/182 (3%)
 Frame = -1

Query  725  LTVKVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANR  546
            L   + EG+   EIL+NW  I   I+ + N N   +     K+RDEW+ NDL +W+  +R
Sbjct  66   LVKALLEGIAEVEILQNWHHIHQKILLQDNLNAKEVSTKLDKLRDEWIANDLESWLSLHR  125

Query  545  FYPGVADALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVL  378
            FYPG+ D LK+   ++SK+YI++TK+ RF   LL +  GV +  E I+G     PK ++L
Sbjct  126  FYPGIIDKLKWTIASTSKLYIISTKEGRFVQQLLHQ-EGVNLGSEEIFGKEVKRPKYEIL  184

Query  377  KQLQEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARI  198
            ++L ++ +    T+ FVEDRL TL+ V ++ +L    L+L DWGYNT  E+  A    RI
Sbjct  185  RELIQLHKTPQETVWFVEDRLKTLQLVDQQIDLKDVKLFLADWGYNTALEKTTAQNDPRI  244

Query  197  RI  192
            ++
Sbjct  245  QL  246



>ref|WP_042157165.1| haloacid dehalogenase [Planktothrix agardhii]
Length=262

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 107/175 (61%), Gaps = 6/175 (3%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G++  EIL NW  I   IV E   + + +     +VRDEW+D DLS W+G +RFYPGV +
Sbjct  73   GISEGEILHNWSGIAHNIVTEEQLHAEIIGPHLDRVRDEWIDTDLSGWLGLHRFYPGVIE  132

Query  524  ALKFASSK---VYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMP  357
             +K    K   VYI+TTK+ RF  +LL+E  GVT P  +++G G   PK ++L++L    
Sbjct  133  RIKPLIEKGFPVYIITTKEERFVRSLLQE-QGVTPPENQLFGKGYKRPKYEILRELLASI  191

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            E     + F+EDRL TL +V ++P+LN   L+L +WGYN  KER+ A + + I +
Sbjct  192  EPTP-NIWFIEDRLQTLLSVQQQPDLNKVQLFLANWGYNLQKERDLALESSAIHL  245



>gb|KEI66178.1| hypothetical protein A19Y_1066 [Planktothrix agardhii NIVA-CYA 
126/8]
Length=263

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 107/175 (61%), Gaps = 6/175 (3%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G++  EIL NW  I   IV E   + + +     +VRDEW+D DLS W+G +RFYPGV +
Sbjct  74   GISEGEILHNWSGIAHNIVTEEQLHAEIIGPHLDRVRDEWIDTDLSGWLGLHRFYPGVIE  133

Query  524  ALKFASSK---VYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMP  357
             +K    K   VYI+TTK+ RF  +LL+E  GVT P  +++G G   PK ++L++L    
Sbjct  134  RIKPLIEKGFPVYIITTKEERFVRSLLQE-QGVTPPENQLFGKGYKRPKYEILRELLASI  192

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            E     + F+EDRL TL +V ++P+LN   L+L +WGYN  KER+ A + + I +
Sbjct  193  EPTP-NIWFIEDRLQTLLSVQQQPDLNKVQLFLANWGYNLQKERDLALESSAIHL  246



>ref|WP_028083768.1| haloacid dehalogenase [Dolichospermum circinale]
Length=261

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 100/175 (57%), Gaps = 5/175 (3%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G +  +IL++W  I   I+   N    A+      +RDEW++ DL  W+  +RFYPGV +
Sbjct  74   GFSDAQILQSWTTITAEILVANNLEAKAVSTQLDNLRDEWIEKDLDGWLSLHRFYPGVIE  133

Query  524  ALKFA---SSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGT-GPKTKVLKQLQEMP  357
             LK       ++YIVTTK+ RF   LL++  GV +P E I+G     PK   L++L E  
Sbjct  134  RLKITLETEVQLYIVTTKEGRFVKQLLQQ-EGVNLPSENIFGKEVKCPKYATLRELIEKA  192

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
              Q + L FVEDRL TL+ V ++ +LN   L+L DWGYNT  ERE     +RI++
Sbjct  193  NTQTVNLWFVEDRLKTLQLVQQQSDLNHVKLFLADWGYNTSLEREAGKNDSRIQL  247



>ref|WP_015174527.1| Haloacid dehalogenase domain protein hydrolase [Oscillatoria 
nigro-viridis]
 gb|AFZ05196.1| Haloacid dehalogenase domain protein hydrolase [Oscillatoria 
nigro-viridis PCC 7112]
Length=264

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 104/169 (62%), Gaps = 6/169 (4%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G++ ++IL +W  I P ++ E N    ++  +   +RD W+  DLS W+  +RFYPGVAD
Sbjct  74   GISPEQILLDWPNIVPYLLTENNLKAQSVGAMLDGLRDNWIAEDLSGWLSLHRFYPGVAD  133

Query  524  ---ALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMP  357
               +L+ +S KV IVTTK+ RF   LL +LAGV +P E I+G     PK ++L++     
Sbjct  134  RLHSLQESSVKVAIVTTKEGRFVRELL-QLAGVEMPSELIFGKEYNKPKHQILREFLAAS  192

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAK  210
                 T+ FVEDRL TL +V ++P+L+   L+L DWGYNT  ERE  A+
Sbjct  193  GKDS-TIWFVEDRLKTLLSVKQQPDLSQVRLFLADWGYNTLAERESVAQ  240



>ref|WP_015206271.1| putative phosphatase [Cylindrospermum stagnale]
 gb|AFZ23015.1| putative phosphatase [Cylindrospermum stagnale PCC 7417]
Length=261

 Score =   120 bits (302),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 108/178 (61%), Gaps = 5/178 (3%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            + EG +  +IL+ W+ I P I+   N     + +    +RDEW+++DL  W+  +RFYPG
Sbjct  71   LVEGFSDAKILQEWVTIAPQILLADNIQAKQIGEKLDHLRDEWINSDLDGWLSLHRFYPG  130

Query  533  VADALKFASS---KVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQ  366
            V + +K   +   K++IVTTK+ RF   LL++ AGV +P   I+G     PK ++L++L 
Sbjct  131  VVEKIKATVASEVKLFIVTTKEGRFVQQLLQQ-AGVDLPTAAIFGKEVKRPKYEILRELI  189

Query  365  EMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            +  + + ++L FVEDRL TL+ V ++ +L    L+L DWGYNT  ERE A    RI++
Sbjct  190  QTADVKPVSLWFVEDRLKTLQLVQQQSDLGDVELFLADWGYNTQPEREAAENDPRIQL  247



>ref|WP_040010123.1| haloacid dehalogenase [Cylindrospermopsis raciborskii]
Length=265

 Score =   120 bits (302),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 106/178 (60%), Gaps = 5/178 (3%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            + +G + D+IL++W KI   I++  + +   +      +RD+W+  DL  W+G +RFYPG
Sbjct  71   IIDGFSDDQILQDWPKIVLEILKTSHLSSQEVGKKLDGLRDQWISTDLDGWLGLHRFYPG  130

Query  533  VADALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQ  366
            V + LK    +  +++IVTTK+ RF   LL E  GV +P + I+G     PK ++L++L 
Sbjct  131  VIERLKVTIDSEVELFIVTTKEGRFVKQLL-EQEGVNLPEKAIFGKEVKLPKYEILRKLI  189

Query  365  EMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
               EHQ   L FVEDRL TL+ V ++ +L+   L+L DWGYNT  ERE      RI++
Sbjct  190  PATEHQPARLWFVEDRLKTLQLVQQQSDLDKVGLFLADWGYNTQSEREAGQNDPRIQL  247



>ref|WP_045870278.1| haloacid dehalogenase [Tolypothrix sp. PCC 7601]
 gb|EKF02447.1| hypothetical protein FDUTEX481_06826 [Tolypothrix sp. PCC 7601]
Length=261

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 106/178 (60%), Gaps = 5/178 (3%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            + +G+  D IL++W+KI P I+         +      +RDEW+  DL+ W+  +RFYPG
Sbjct  71   LVDGIADDNILQDWVKIAPQILLNHKLQAREIATALDNIRDEWIATDLNGWLSLHRFYPG  130

Query  533  VADALK--FASS-KVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQ  366
            V D +K   AS+  +YIVTTK+ RF   LL++  GV +  + I+G     PK ++L++L 
Sbjct  131  VIDKIKATIASAVSLYIVTTKEGRFVQQLLQQ-EGVELSSQDIFGKEEKRPKYEILRELI  189

Query  365  EMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            +    + ++L FVEDRL TL+ V ++ +L    L+L DWGYNT  ERE A    RI++
Sbjct  190  QTATQKPVSLWFVEDRLKTLQLVQQQADLADVKLFLADWGYNTQPERETADNDQRIQL  247



>ref|WP_010998004.1| haloacid dehalogenase [Nostoc sp. PCC 7120]
 dbj|BAB75562.1| alr3863 [Nostoc sp. PCC 7120]
Length=261

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 107/182 (59%), Gaps = 5/182 (3%)
 Frame = -1

Query  725  LTVKVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANR  546
            L   + +G + D+IL+ W  I P I+ +       +      +RDEW+ NDL  W+  +R
Sbjct  67   LIKALVDGNSDDQILQEWTSITPKILLDDKLQAKEIATKLDGLRDEWIANDLDGWLSLHR  126

Query  545  FYPGVADALKFASS---KVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVL  378
            FY GV + LK A +   K+YIVTTK+ RF   LL +  GV +P + I+G     PK +++
Sbjct  127  FYQGVIEKLKIAVASEVKLYIVTTKEGRFVEQLLHQ-EGVDLPRDAIFGKEVKRPKYEII  185

Query  377  KQLQEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARI  198
            ++L +  +H+ ++L FVEDR+ TL+ V ++ +L    L+L DWGYNT  ER+ A    RI
Sbjct  186  RELIQAADHEPVSLWFVEDRIKTLQLVQQQSDLEDVKLFLADWGYNTQSERKAAQSDPRI  245

Query  197  RI  192
            ++
Sbjct  246  QL  247



>gb|EFA68351.1| conserved hypothetical protein [Cylindrospermopsis raciborskii 
CS-505]
Length=273

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 106/178 (60%), Gaps = 5/178 (3%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            + +G + D+IL++W KI   I++  + +   +      +RD+W+  DL  W+G +RFYPG
Sbjct  79   IIDGFSDDQILQDWPKIVLEILKTSHLSSQEVGKKLDGLRDQWISTDLDGWLGLHRFYPG  138

Query  533  VADALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQ  366
            V + LK    +  +++IVTTK+ RF   LL E  GV +P + I+G     PK ++L++L 
Sbjct  139  VIERLKVTIDSEVELFIVTTKEGRFVKQLL-EQEGVNLPEKAIFGKEVKLPKYEILRKLI  197

Query  365  EMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
               EHQ   L FVEDRL TL+ V ++ +L+   L+L DWGYNT  ERE      RI++
Sbjct  198  PATEHQPARLWFVEDRLKTLQLVQQQSDLDKVGLFLADWGYNTQSEREAGQNDPRIQL  255



>ref|WP_028090660.1| haloacid dehalogenase [Dolichospermum circinale]
Length=261

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 100/175 (57%), Gaps = 5/175 (3%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G +  +IL++W  I   I+   N    A+      +RDEW++ DL  W+  +RFYPGV +
Sbjct  74   GFSDAQILQSWTTITAEILVANNLEAKAVSTQLDNLRDEWIEKDLDGWLSLHRFYPGVIE  133

Query  524  ALKFA---SSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMP  357
             LK       ++YIVTTK+ RF   LL++  GV +P E I+G     PK   L++L +  
Sbjct  134  RLKITLETQVQLYIVTTKEGRFVKQLLQQ-EGVNLPSENIFGKEVKRPKYATLRELIKKA  192

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
              Q + L FVEDRL TL+ V ++ +LN   L+L DWGYNT  ERE     +RI++
Sbjct  193  NTQTVNLWFVEDRLKTLQLVQQQSDLNHVKLFLADWGYNTSLEREAGKNDSRIQL  247



>ref|WP_026786338.1| MULTISPECIES: haloacid dehalogenase [Planktothrix]
Length=263

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 107/175 (61%), Gaps = 6/175 (3%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G++  EIL+NW  I   IV E     + +     +VRDEW+D DLS W+G +RFYPGV +
Sbjct  74   GISESEILQNWSGIAHNIVTEEQLQAEIIGPHLDRVRDEWIDTDLSGWLGLHRFYPGVIE  133

Query  524  ALKFA---SSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMP  357
             +K        VYI+TTK+ RF  +LL+E  GVTIP  +++G G   PK ++L++L    
Sbjct  134  RIKPLIEDGFPVYIITTKEERFVRSLLQE-QGVTIPENQLFGKGYKRPKYEILRELLASI  192

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            +     + F+EDRL TL +V ++ +LN   L+L +WGYN  KER+ A++ + I +
Sbjct  193  KPTP-NIWFIEDRLQTLLSVQQQLDLNKVQLFLANWGYNLQKERDLASESSAIHL  246



>ref|WP_015215388.1| Haloacid dehalogenase domain protein hydrolase [Anabaena cylindrica]
 gb|AFZ58762.1| Haloacid dehalogenase domain protein hydrolase [Anabaena cylindrica 
PCC 7122]
Length=261

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 100/176 (57%), Gaps = 5/176 (3%)
 Frame = -1

Query  707  EGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVA  528
            EG + D+IL+ W  I P I+   N +   +      +RDEW+  DL  W+  ++FYPGV 
Sbjct  73   EGFSDDKILQKWANITPQILGADNLDAKEVAKKLDTLRDEWIATDLDGWLSLHKFYPGVI  132

Query  527  DALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEM  360
            + LK    +   +YIVTTK+ RF   LL+   GV + P  I+G     PK + L++L E 
Sbjct  133  ERLKMTLVSGVNLYIVTTKEGRFVKQLLQR-EGVDLQPASIFGKEVKRPKYETLRELIEK  191

Query  359  PEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
               +  +L FVEDRL TL+ V K+ +L    L+L DWGYNT  ERE  A  +RI++
Sbjct  192  ANTKPASLWFVEDRLKTLQLVQKQSDLAHVQLFLADWGYNTQPEREAGADDSRIQV  247



>ref|WP_026794243.1| MULTISPECIES: haloacid dehalogenase [Planktothrix]
Length=263

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 106/175 (61%), Gaps = 6/175 (3%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G++  EIL NW  I   IV E     + +     +VRDEW+D DLS W+G +RFYPGV +
Sbjct  74   GISESEILHNWSGIAHNIVTEEQLQAEIIGPHLDRVRDEWIDTDLSGWLGLHRFYPGVIE  133

Query  524  ALKFA---SSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMP  357
             +K        VYI+TTK+ RF  +LL+E  GVTIP  +++G G   PK ++L++L    
Sbjct  134  RIKPLIEDGFPVYIITTKEERFVRSLLQE-QGVTIPENQLFGKGYKRPKYEILRELLASI  192

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            +     + F+EDRL TL +V ++ +LN   L+L +WGYN  KER+ A++ + I +
Sbjct  193  KPTP-NIWFIEDRLQTLLSVQQQLDLNKVQLFLANWGYNLQKERDLASESSAIHL  246



>ref|WP_011318635.1| haloacid dehalogenase [Anabaena variabilis]
 gb|ABA21455.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
Length=261

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 105/178 (59%), Gaps = 5/178 (3%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            + +G + D+IL+ W  I P I+ +       +      +RD+W+ NDL  W+  +RFY G
Sbjct  71   LVDGNSDDQILQEWTSITPKILLDDKLQAKEIATKLDALRDQWIANDLDGWLSLHRFYQG  130

Query  533  VADALKFASS---KVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQ  366
            V + LK   +   K+YIVTTK+ RF   LL +  GV +P + I+G     PK ++L++L 
Sbjct  131  VIEKLKITVASEVKLYIVTTKEGRFVEQLLHQ-EGVDLPRDSIFGKEVKRPKYEILRELI  189

Query  365  EMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            +  +H+ ++L FVEDR+ TL+ V ++ +L    L+L DWGYNT  ER+ A    RI++
Sbjct  190  QAADHKPVSLWFVEDRIKTLQLVQQQTDLEDVKLFLADWGYNTQSERKAAQNDPRIQL  247



>ref|WP_016860473.1| haloacid dehalogenase [Fischerella muscicola]
Length=260

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 108/182 (59%), Gaps = 5/182 (3%)
 Frame = -1

Query  725  LTVKVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANR  546
            L   + +G+   EIL++W  I   I+   N N   +     K+RDEW+ NDL  W+  ++
Sbjct  66   LVKALLDGIAEVEILQDWHNINQKILLHDNLNAKEISTTLDKLRDEWIANDLEGWLSLHQ  125

Query  545  FYPGVADALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVL  378
            FYPGV D L+    ++SK+YI++TK+ RF   LL++  GV +  E I+G     PK ++L
Sbjct  126  FYPGVIDKLQTTIASTSKLYIISTKEGRFVQQLLQQ-EGVNLGSEVIFGKEVKRPKYEIL  184

Query  377  KQLQEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARI  198
            ++L ++ +    T+ FVEDRL TL+ V ++ +L    L+L DWGYNTP E+  A    RI
Sbjct  185  RELIQLHKLPQETVWFVEDRLKTLQLVDQQTDLKDVKLFLADWGYNTPLEKTTAQNDPRI  244

Query  197  RI  192
            ++
Sbjct  245  QL  246



>ref|WP_006508461.1| hypothetical protein [Xenococcus sp. PCC 7305]
 gb|ELS04453.1| hypothetical protein Xen7305DRAFT_00041870 [Xenococcus sp. PCC 
7305]
Length=254

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 102/175 (58%), Gaps = 5/175 (3%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G+T ++IL  W  ++  IV + + ++  L +     RD W++NDL  W+  +RFYPG+  
Sbjct  71   GITPEDILSQWHLLREQIVTKEDLDKKFLSNALDSTRDNWINNDLDNWLSLHRFYPGILS  130

Query  524  ALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMP  357
             L++   +    YIVTTK+ RF   LL +  G+T+P + I G     PK + L+ L++  
Sbjct  131  KLQYIINSDCHFYIVTTKEGRFVKRLLGQ-QGITLPADNIIGKECKRPKYETLRLLRDKI  189

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
                L++ F+EDRL TL+ V ++ +L+   L+L DWGYNT  ERE A +   I++
Sbjct  190  AESDLSIWFIEDRLKTLELVRQQSDLSKVQLFLADWGYNTAPERERAQQHPEIKL  244



>ref|WP_006633089.1| haloacid dehalogenase [Microcoleus vaginatus]
 gb|EGK87533.1| Haloacid dehalogenase domain protein hydrolase [Microcoleus vaginatus 
FGP-2]
Length=264

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 106/175 (61%), Gaps = 6/175 (3%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G++ ++IL  W  I P ++ E N    ++  +   +RD W+  DL+ W+  +RFYPGVAD
Sbjct  74   GISPEQILLEWPNIVPYLLTENNLKAQSVGAMLDGLRDNWIAEDLAGWLSLHRFYPGVAD  133

Query  524  ---ALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMP  357
               +L+ +S KV IVTTK+ RF   LL +LAGV +P E I+G     PK ++L++     
Sbjct  134  RLHSLQKSSVKVAIVTTKEGRFVRELL-QLAGVPMPSELIFGKEYNKPKHQILREFMAA-  191

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
              +   + FVEDRL TL +V ++P+L+   L+L DWGYNT  ERE  A+   +++
Sbjct  192  SGKDSAIWFVEDRLKTLLSVKQQPDLSQVRLFLADWGYNTLPERESVAQNPPVQL  246



>ref|WP_006197088.1| haloacid dehalogenase [Nodularia spumigena]
 gb|EAW44770.1| hypothetical protein N9414_03016 [Nodularia spumigena CCY9414]
 gb|AHJ28224.1| hypothetical protein NSP_18910 [Nodularia spumigena CCY9414]
Length=261

 Score =   117 bits (294),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 104/178 (58%), Gaps = 5/178 (3%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            + + ++ ++IL+ W  I P I+ E N     +      +RDEW+  DL  W+  ++FYPG
Sbjct  71   LVDQISEEKILQEWATITPQILLEHNLQSPTIGTALDNLRDEWITTDLDGWLSLHKFYPG  130

Query  533  VADALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQ  366
            V + +K    + +K+YIVTTK+ RF   LL+   GV +PP  I+G     PK + L++L 
Sbjct  131  VLEKIKLTIASETKLYIVTTKEGRFVQQLLQR-EGVNLPPAAIFGKEVKRPKYQTLRELI  189

Query  365  EMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            +  E + ++L FVEDR+ TL+ V ++ +L    L+L DWGYNT  ER+ A     I++
Sbjct  190  QKAEKKPVSLWFVEDRIKTLQLVQQQTDLENVKLFLADWGYNTQTERKAAQDDPGIQV  247



>ref|WP_016950352.1| haloacid dehalogenase [Anabaena sp. PCC 7108]
Length=261

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 103/175 (59%), Gaps = 5/175 (3%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G + D+IL+ W  I P I+   N     +      +RD+W+  DL  W+  +RFYPGV +
Sbjct  74   GFSDDKILQEWASITPQILVADNLEAKEVSTKLDNLRDDWIQTDLDGWLSLHRFYPGVIE  133

Query  524  ALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMP  357
             LK    ++ ++YIVTTK+ RF   LL++  G+ +P + I+G     PK + L++L +  
Sbjct  134  RLKITLASAVQLYIVTTKEGRFVQQLLQK-EGLDLPADAIFGKEVKRPKYETLRELIDKA  192

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
              Q ++L FVEDRL TL+ V ++ +L+   L+L DWGYNT  ERE     +RI++
Sbjct  193  NTQPVSLWFVEDRLKTLQLVQQQSDLDHVKLFLADWGYNTQPEREAGKNDSRIQL  247



>ref|WP_041038913.1| haloacid dehalogenase [Tolypothrix campylonemoides]
 gb|KIJ75611.1| haloacid dehalogenase [Tolypothrix campylonemoides VB511288]
Length=261

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 107/182 (59%), Gaps = 5/182 (3%)
 Frame = -1

Query  725  LTVKVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANR  546
            L   + EG++ ++IL+ W KI   I+   N     +      +RDEW+  DL++W+  ++
Sbjct  67   LVKALVEGISEEKILQEWAKIAQQILLTDNLKGADIGSKLDNIRDEWIATDLNSWLSLHK  126

Query  545  FYPGVADALKFASSK---VYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVL  378
            FY GV + LK  +S    +YI+TTK+ RF   LL++  G+ IP E I+G     PK ++L
Sbjct  127  FYAGVVEKLKATASSTVHLYIITTKEGRFTQQLLQQ-GGLDIPREAIFGKEVKRPKHEIL  185

Query  377  KQLQEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARI  198
            ++L +       +L FVEDRL TL+ V ++P+L G  L+L DWGYNTP ++  A    ++
Sbjct  186  RELIQATNTSPDSLWFVEDRLKTLQLVQQQPDLEGVKLFLADWGYNTPTDKVTAQNDPQL  245

Query  197  RI  192
            ++
Sbjct  246  KL  247



>ref|WP_026734080.1| haloacid dehalogenase [Fischerella sp. PCC 9605]
Length=260

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 105/176 (60%), Gaps = 5/176 (3%)
 Frame = -1

Query  707  EGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVA  528
            EG+  +EIL+ W  I   I+   N N   +      +RDEW+  DL+ W+  +RFYPGV 
Sbjct  73   EGIAEEEILQKWHSINQKILLADNLNAKEIGAKLDNLRDEWIATDLNGWLSLHRFYPGVI  132

Query  527  DALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEM  360
            D +K    +++K+YI++TK+ RF   LL++  G+ +  E I+G     PK +++++L E+
Sbjct  133  DKIKAITASTTKLYIISTKEGRFVQQLLQQ-EGINLGSEEIFGKEVKRPKYEIIRELIEL  191

Query  359  PEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
             +    TL FVEDRL TL+ V ++ +L    L+L +WGYNTP E+  A    RI++
Sbjct  192  HKISPETLWFVEDRLKTLQLVDRQTDLKDVKLFLANWGYNTPSEKVTAQNDQRIQL  247



>ref|XP_006421478.1| hypothetical protein CICLE_v10006592mg [Citrus clementina]
 gb|ESR34718.1| hypothetical protein CICLE_v10006592mg [Citrus clementina]
Length=73

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 61/67 (91%), Gaps = 0/67 (0%)
 Frame = -1

Query  683  LENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVADALKFASS  504
            ++NW KIK VI++EW+E+RDALI+LFGKVRDEWMD +L+TWIG NR Y G++DALKFASS
Sbjct  1    MKNWFKIKSVIMQEWSESRDALIELFGKVRDEWMDTNLTTWIGDNRLYAGISDALKFASS  60

Query  503  KVYIVTT  483
            ++YIVTT
Sbjct  61   EIYIVTT  67



>ref|WP_012411534.1| haloacid dehalogenase [Nostoc punctiforme]
 gb|ACC83582.1| conserved hypothetical protein [Nostoc punctiforme PCC 73102]
Length=261

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/179 (37%), Positives = 109/179 (61%), Gaps = 7/179 (4%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKP-VIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYP  537
            + +G+  ++I   W+ I P +++ +  + R+    L  + RDEW+  DL  W+  +RFYP
Sbjct  71   LVDGIPDEKIFHEWLSIAPQLLLNDKLQAREIAAKLDNQ-RDEWITTDLDGWLSLHRFYP  129

Query  536  GVADALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQL  369
            GV + +K    +  K+YIVTTK+ RF   LL++  GV +P   I+G     PK ++L++L
Sbjct  130  GVVEKIKLTLDSGVKLYIVTTKEGRFVQQLLQQ-EGVNLPTAAIFGKEVKRPKYEILREL  188

Query  368  QEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            ++  E++ ++L FVEDRL TL+ V ++ +L    L+L DWGYNT  ERE A    +I++
Sbjct  189  KQQAENKPVSLWFVEDRLKTLQLVQQQTDLEDVKLFLADWGYNTQAEREAAQNDLQIQV  247



>gb|AFY42515.1| hypothetical protein Nos7107_1884 [Nostoc sp. PCC 7107]
Length=265

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 103/176 (59%), Gaps = 5/176 (3%)
 Frame = -1

Query  707  EGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVA  528
            EG++ ++IL+ W  I P I+ + N     +      +RDEW+  DL  W+  +RFYPGV 
Sbjct  77   EGMSDEQILQEWTTITPQILLKNNLLAREIGAKLDHIRDEWIATDLQGWLNLHRFYPGVI  136

Query  527  DALKFASS---KVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEM  360
            + +K   +   +++IVTTK+ RF   LL++  GV +P   I+G     PK ++L++L + 
Sbjct  137  EKIKLTVASDVQLFIVTTKEGRFVQQLLQQ-EGVNLPATAIFGKEVKRPKYEILRELIQT  195

Query  359  PEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
               Q ++L FVEDR+ TL+ V ++ +L    L+L DWGYNT  ER+ A    RI +
Sbjct  196  ANQQPVSLWFVEDRIKTLQLVQQQADLEDVKLFLADWGYNTQPERKAAQDDQRIEL  251



>ref|WP_044499870.1| haloacid dehalogenase [Nostoc sp. PCC 7107]
Length=261

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 103/176 (59%), Gaps = 5/176 (3%)
 Frame = -1

Query  707  EGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVA  528
            EG++ ++IL+ W  I P I+ + N     +      +RDEW+  DL  W+  +RFYPGV 
Sbjct  73   EGMSDEQILQEWTTITPQILLKNNLLAREIGAKLDHIRDEWIATDLQGWLNLHRFYPGVI  132

Query  527  DALKFASS---KVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEM  360
            + +K   +   +++IVTTK+ RF   LL++  GV +P   I+G     PK ++L++L + 
Sbjct  133  EKIKLTVASDVQLFIVTTKEGRFVQQLLQQ-EGVNLPATAIFGKEVKRPKYEILRELIQT  191

Query  359  PEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
               Q ++L FVEDR+ TL+ V ++ +L    L+L DWGYNT  ER+ A    RI +
Sbjct  192  ANQQPVSLWFVEDRIKTLQLVQQQADLEDVKLFLADWGYNTQPERKAAQDDQRIEL  247



>ref|WP_015121532.1| putative phosphatase [Rivularia sp. PCC 7116]
 gb|AFY57979.1| putative phosphatase [Rivularia sp. PCC 7116]
Length=262

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 103/182 (57%), Gaps = 5/182 (3%)
 Frame = -1

Query  725  LTVKVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANR  546
            L   + EG   D IL+ W  I   I+ + + +   +       RDEW+ NDL  W+  ++
Sbjct  67   LVKALLEGFEEDNILQAWHDISQKILRQNDFSAQEIAFSLDTQRDEWIANDLDGWLSMHK  126

Query  545  FYPGVADALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVL  378
            FYPGV + ++      + +YIVTTK+ RF   LL++ AG  +P E I+G     PK ++L
Sbjct  127  FYPGVVERIQNIYNTQTALYIVTTKEGRFVKELLQK-AGFDLPREAIFGKEEKRPKYEIL  185

Query  377  KQLQEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARI  198
            ++L++   +  + L F+EDR+ TL+ V  + +L    L+L DWGYNT KERE A +  RI
Sbjct  186  RELKQDSNYSSVNLWFLEDRIKTLQKVKVQEDLQEVELFLCDWGYNTAKERENAQQDTRI  245

Query  197  RI  192
             +
Sbjct  246  NL  247



>ref|WP_010474936.1| haloacid dehalogenase [Acaryochloris sp. CCMEE 5410]
Length=260

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 106/176 (60%), Gaps = 7/176 (4%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            + +G +  ++L +W  I+  IV + + +R +L+     VRD W+ +DL  W+  + FYPG
Sbjct  71   ILKGFSEAQVLADWYSIRDRIVADEDLDRKSLVQQVDGVRDHWIASDLENWLALHEFYPG  130

Query  533  VADALKFASS--KVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGT-GPKTKVLKQLQE  363
            V   L+  S   +V I++TK+SRF   LL++ AGV +  +RIYG     PK + L+ L  
Sbjct  131  VVSVLQTLSQDIEVIIISTKESRFIYTLLQD-AGVKVSRDRIYGKDCRRPKYETLRLL--  187

Query  362  MPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIR  195
            +PE  G  + FVEDR+A L+ V ++P+L    L+LG WGYNT ++R+ A +  RI 
Sbjct  188  IPEVAG-PIWFVEDRIAALEEVKEQPDLAEIGLFLGTWGYNTARDRKRAQQDQRIH  242



>ref|WP_044194906.1| haloacid dehalogenase [Oscillatoria acuminata]
Length=260

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 105/177 (59%), Gaps = 10/177 (6%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G   D+ILE+W  I   IV     N   L  +  +VRDEW+ ++L+ W+  +RFYPGV D
Sbjct  74   GTNPDQILEDWPAICSQIVTAEALNPTDLAAIVDRVRDEWIADNLTDWLSLHRFYPGVID  133

Query  524  ALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQL--QE  363
             L+    +S ++ I+TTK+ RF  +LL+E  G+ +P + I+G     PK ++L++L  + 
Sbjct  134  RLQSYLASSQQLVIITTKEERFVRSLLQE-QGIQLPEDCIFGKNVKRPKHQILRELLGKI  192

Query  362  MPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
             P     T+ FVEDRL TL++V K+ +L    LYL DWGYNTP +R  A   + I +
Sbjct  193  TPTP---TIWFVEDRLKTLESVQKQLDLTAVKLYLADWGYNTPSDRAVAQNNSGIEL  246



>gb|AFY81797.1| putative phosphatase [Oscillatoria acuminata PCC 6304]
Length=259

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 105/177 (59%), Gaps = 10/177 (6%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G   D+ILE+W  I   IV     N   L  +  +VRDEW+ ++L+ W+  +RFYPGV D
Sbjct  73   GTNPDQILEDWPAICSQIVTAEALNPTDLAAIVDRVRDEWIADNLTDWLSLHRFYPGVID  132

Query  524  ALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQL--QE  363
             L+    +S ++ I+TTK+ RF  +LL+E  G+ +P + I+G     PK ++L++L  + 
Sbjct  133  RLQSYLASSQQLVIITTKEERFVRSLLQE-QGIQLPEDCIFGKNVKRPKHQILRELLGKI  191

Query  362  MPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
             P     T+ FVEDRL TL++V K+ +L    LYL DWGYNTP +R  A   + I +
Sbjct  192  TPTP---TIWFVEDRLKTLESVQKQLDLTAVKLYLADWGYNTPSDRAVAQNNSGIEL  245



>ref|WP_016878059.1| haloacid dehalogenase [Chlorogloeopsis fritschii]
Length=265

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 68/175 (39%), Positives = 102/175 (58%), Gaps = 5/175 (3%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G+  ++IL+ W  I   I++  N N   +     K+RDEW+  DL  W+  +RFYPGV D
Sbjct  74   GIAEEKILQKWGSIVQEILQTENLNAKEIGTKLDKLRDEWIATDLEGWLSLHRFYPGVID  133

Query  524  ALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMP  357
             +K    + +K+YI+TTK+ RF   LLR+   V + PE I+G     PK ++L++L ++ 
Sbjct  134  KIKATVASLTKLYIITTKEGRFVQKLLRQ-EEVYLTPEVIFGKEVKRPKYEILRELIKLH  192

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
                  + FVEDRL TL+ V K+ +L    L+L DWGYNTP E+  A    RI++
Sbjct  193  NIAADAVWFVEDRLKTLQVVDKQTDLQEVKLFLADWGYNTPSEKVTAQNDPRIQL  247



>ref|WP_012164384.1| haloacid dehalogenase [Acaryochloris marina]
 gb|ABW29030.1| conserved hypothetical protein [Acaryochloris marina MBIC11017]
Length=258

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 106/176 (60%), Gaps = 7/176 (4%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            + +G +  ++L +W  I+  IV + + +R +L+     VRD W+ +DL  W+  + FYPG
Sbjct  71   ILKGFSEAQVLADWYSIRDRIVADEDLDRKSLVQQVDGVRDHWIASDLENWLALHEFYPG  130

Query  533  VADALKFASS--KVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGT-GPKTKVLKQLQE  363
            V  AL+  S   +V I++TK+SRF   LL++ AGV +  + IYG     PK + L+ L  
Sbjct  131  VVSALQTLSQAIEVIIISTKESRFIYTLLQD-AGVNLSRDHIYGKDCRRPKYETLRLL--  187

Query  362  MPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIR  195
            +PE  G  + FVEDR+A L+ V ++P+L    L+LG WGYNT ++R+ A +  RI 
Sbjct  188  IPEVAG-PIWFVEDRIAALEQVKEQPDLAEIGLFLGTWGYNTARDRKRAQQDQRIH  242



>ref|WP_006101549.1| haloacid dehalogenase [Coleofasciculus chthonoplastes]
 gb|EDX75271.1| haloacid dehalogenase-like hydrolase, putative [Coleofasciculus 
chthonoplastes PCC 7420]
Length=262

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 64/175 (37%), Positives = 102/175 (58%), Gaps = 5/175 (3%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G++  +IL++W  +    V+  N     L     ++RDEW+ +DL +W+  +RFYPGV  
Sbjct  74   GVSESQILQDWSTVLHQCVDSENLQPQKLGQQLDQIRDEWITSDLESWLALHRFYPGVIQ  133

Query  524  ALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMP  357
             L+      ++++IVTTK+ RFA  LL++  G+ +  +RI G     PK + L+QL +  
Sbjct  134  RLQSILETPTQIFIVTTKEGRFAKQLLQQ-QGIELSEDRIIGKEIKRPKHQTLRQLIQEF  192

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
              +  +L FVEDRL TL +V ++ +L    LYL DWGYNT   R+E    +RI++
Sbjct  193  RDESASLWFVEDRLNTLLSVEQQSDLAQVRLYLADWGYNTAAHRDEVRNHSRIQL  247



>ref|WP_015184379.1| phosphatase [Microcoleus sp. PCC 7113]
 gb|AFZ20243.1| putative phosphatase [Microcoleus sp. PCC 7113]
Length=270

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 67/183 (37%), Positives = 104/183 (57%), Gaps = 13/183 (7%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
             ++ ++IL++W K+   ++E  N +   +      VRDEW+  DL +W+G +RFYPGV +
Sbjct  74   NISEEKILQDWSKVAQSLIETENLDSADIGKRVDAVRDEWIATDLESWLGLHRFYPGVIE  133

Query  524  ALKFA-----------SSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKV  381
             L               ++++IVTTK+ RF   LL++  G+ +  ERI G     PK + 
Sbjct  134  RLSKTLCAGQTSSPEIVTQLFIVTTKEGRFVKQLLQQ-QGIELSEERIIGKECKRPKHQT  192

Query  380  LKQLQEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIAR  201
            L+QL E+      TL FVEDRL TL++V ++P+L    LYL DWGYNT   +E A    +
Sbjct  193  LRQLLEIFPGDATTLWFVEDRLKTLQSVQQQPDLTEVRLYLADWGYNTTAHQEVARNDPK  252

Query  200  IRI  192
            I++
Sbjct  253  IQL  255



>ref|WP_015146026.1| putative phosphatase [Pleurocapsa minor]
 gb|AFY79731.1| putative phosphatase [Pleurocapsa sp. PCC 7327]
Length=261

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 96/165 (58%), Gaps = 5/165 (3%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G + ++I  NW  I   I+E    +   +     ++RDEW+++DL  W+  +RFYPGV D
Sbjct  74   GFSEEKIFPNWSIIARKILESERLDPKEVSQKLDRIRDEWIESDLEGWLALHRFYPGVID  133

Query  524  ALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLG-TGPKTKVLKQLQEMP  357
             +     +S K YIVTTK+SRF   LL++  G+ +P + I G     PK ++L+QL E+ 
Sbjct  134  RIACILDSSIKFYIVTTKESRFVKKLLQQ-QGIDLPEKTILGKEYKCPKYEILRQLLEIN  192

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKERE  222
                + L FVEDRL  L+ V ++ +L    LYL DWGYNT + RE
Sbjct  193  SASPVNLWFVEDRLEALELVRQQSDLQKAKLYLADWGYNTQQTRE  237



>gb|EJK46873.1| hypothetical protein THAOC_34443 [Thalassiosira oceanica]
Length=235

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 96/177 (54%), Gaps = 5/177 (3%)
 Frame = -1

Query  710  AEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGV  531
            +  +T  EI+EN+ ++    +         +ID FGKVRD+W+  DL +W+  N FY G+
Sbjct  49   SHAMTASEIIENYEELVGRWLASHELQEQDMIDSFGKVRDDWIAEDLDSWLDINAFYEGM  108

Query  530  ADALKFASSKVYIVTTKQSRFAAALLRELAGV---TIPPERIYGLGT-GPKTKVLKQLQE  363
            A+++        +VTTKQ RFA AL+R  AGV    +P + I+GLG    K+ V+ +  +
Sbjct  109  AESINHCRGDAVLVTTKQQRFAQALVRH-AGVNESAMPDDSIFGLGMYKSKSDVIAEKMK  167

Query  362  MPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
              ++Q    +F EDR  TL   +K+  L G   YL  WGY T  E E A    R+++
Sbjct  168  EGDYQADQTYFFEDRWPTLAKCLKDERLEGVRFYLCSWGYCTEHEVELAKNEPRVQV  224



>ref|WP_027845700.1| haloacid dehalogenase [Mastigocoleus testarum]
Length=260

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 102/182 (56%), Gaps = 5/182 (3%)
 Frame = -1

Query  725  LTVKVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANR  546
            L   + EG++ ++I + W  I   I+E+ N     +      +RDEW++NDL  W+  NR
Sbjct  67   LIKALIEGISEEQIYQEWHNISKQILEKDNLKSQDIAKELDSIRDEWINNDLDGWLSLNR  126

Query  545  FYPGVADALK-FASSKV--YIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVL  378
            FYPG  + ++  ASS V  YI+TTK+ RF   LL+   GV +  E I+G     PK +++
Sbjct  127  FYPGTIEKIRSIASSSVELYIITTKEGRFVKQLLQRW-GVELNSELIFGKEVKRPKYEII  185

Query  377  KQLQEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARI  198
            ++L +        + FVEDRL TL+ V K P+L    L+L  WGYNT  ERE A    RI
Sbjct  186  RELIKKHNISPGNVWFVEDRLKTLQVVKKLPDLQDVKLFLASWGYNTASEREAAKNDERI  245

Query  197  RI  192
            ++
Sbjct  246  KL  247



>ref|WP_017746998.1| hypothetical protein [Scytonema hofmanni]
Length=264

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 107/182 (59%), Gaps = 5/182 (3%)
 Frame = -1

Query  725  LTVKVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANR  546
            L   + +G+  + IL++W  I   I++  N     +     K RD+W+ +DL+ W+  +R
Sbjct  66   LVKALVQGIAEENILQDWNAIAQQILQADNFKPAEIGSKLDKYRDKWIADDLNGWLSRHR  125

Query  545  FYPGVADALK---FASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVL  378
            FYPG+ + L+    +S+K+Y+VTTK+ RFA  LL +  G+ +P E I+G     PK ++L
Sbjct  126  FYPGIVEKLEATTSSSTKLYVVTTKEGRFAQQLLAQ-QGIELPKEVIFGKEMKRPKYEIL  184

Query  377  KQLQEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARI  198
            ++L +  +    +L FVEDRL TL+ V ++P+L    L+  DWGYNT  E+  A   +RI
Sbjct  185  RELIQAEKIAPESLWFVEDRLKTLQLVKQQPDLEEVKLFFADWGYNTGVEKVSAKNDSRI  244

Query  197  RI  192
             +
Sbjct  245  HL  246



>gb|KIE10076.1| haloacid dehalogenase [Tolypothrix bouteillei VB521301]
Length=264

 Score =   112 bits (279),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 103/182 (57%), Gaps = 5/182 (3%)
 Frame = -1

Query  725  LTVKVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANR  546
            L   + EG+  ++IL++W  I   I++  N     +     K RDEW+  DL  W+  ++
Sbjct  66   LVKALVEGIAEEKILQDWSAIAKQILQAGNFQPSDIGSKLDKYRDEWIATDLDGWLSRHK  125

Query  545  FYPGVADALK---FASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVL  378
            FYPGV + L+    +S K+YIVTTK+ RFA  LL +  GV +P E I+G     PK ++L
Sbjct  126  FYPGVIEKLEATISSSIKLYIVTTKEGRFAQQLLAQ-QGVELPKEVIFGKEVKRPKYEIL  184

Query  377  KQLQEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARI  198
            ++L +  +    +L FVEDRL TL+ V ++ +L    L+  DWGYNT  E+  A    RI
Sbjct  185  RELIQAEKIAPESLWFVEDRLKTLQLVKQQADLEAVKLFFADWGYNTAVEKVTAKNDPRI  244

Query  197  RI  192
             +
Sbjct  245  HL  246



>ref|WP_039747511.1| haloacid dehalogenase [Hassallia byssoidea]
 gb|KIF33383.1| haloacid dehalogenase [Hassallia byssoidea VB512170]
Length=263

 Score =   112 bits (279),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 103/174 (59%), Gaps = 4/174 (2%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G+  ++IL+ W  I   I+ E       +      +RDEW+  DL  W+  +RFYPGV +
Sbjct  74   GIDDEKILQEWASIAQQILLEDKLQAKEIATKLDNLRDEWIATDLDGWLSLHRFYPGVVE  133

Query  524  ALKFASSKV--YIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMPE  354
             +K  +SK+  YIVTTK+ RF   LL++  GVT+  E I+G     PK ++L++L +  +
Sbjct  134  KIKAIASKIKLYIVTTKEGRFVQQLLQQ-QGVTLEKEAIFGKEVKRPKYEILRELIQAAQ  192

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
             + ++L FVEDR+ TL+ V ++ +L    L+L DWGYNT  ER  A   +RI++
Sbjct  193  EKAVSLWFVEDRIKTLQLVKQQTDLENVKLFLADWGYNTQPERNAAENDSRIQL  246



>ref|WP_017318162.1| hypothetical protein [Mastigocladopsis repens]
Length=262

 Score =   111 bits (278),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 104/182 (57%), Gaps = 5/182 (3%)
 Frame = -1

Query  725  LTVKVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANR  546
            L   + E +  + IL+ W KI   ++   N     +     K+RDEW+  DL  W+  ++
Sbjct  67   LVKALVEEIAEERILQEWAKIAQELLLRDNVKATEIGSKLDKIRDEWIATDLDGWLSLHK  126

Query  545  FYPGVADALKFASS---KVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVL  378
            F+ GV + LK  ++   K+YI+TTK+ RFA  LL++  GV IP E I+G      K ++L
Sbjct  127  FFQGVKEKLKATATSTVKLYIITTKEGRFAQQLLKQ-GGVEIPREVIFGKEVKRSKHEIL  185

Query  377  KQLQEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARI  198
            ++L +       ++ FVEDRL TL+ V ++P+LN   L+L DWGYNTP E+  A    RI
Sbjct  186  RELIQGTNTLPDSVWFVEDRLKTLQLVQQQPDLNEVKLFLADWGYNTPTEKVTAQNDPRI  245

Query  197  RI  192
            ++
Sbjct  246  QV  247



>ref|WP_015140311.1| putative phosphatase [Nostoc sp. PCC 7524]
 gb|AFY49895.1| putative phosphatase [Nostoc sp. PCC 7524]
Length=261

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 100/164 (61%), Gaps = 7/164 (4%)
 Frame = -1

Query  692  DEILENWMKIKPVIVE-EWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVADALK  516
            D+IL+ W+ I P I+  +  ++++  I L   +RDEW+  DL+ W+  ++FYPGV + LK
Sbjct  78   DKILQEWVNITPHILSTDKLQSKEVAIKL-DSLRDEWIATDLNGWLSLHKFYPGVVEKLK  136

Query  515  F---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMPEHQ  348
                +  K+YIV+TK+ RF   LL+   GV +PP  I+G     PK + L++L    + Q
Sbjct  137  VTIASEVKLYIVSTKEGRFIQQLLQR-EGVDLPPTAIFGKEVKRPKYETLRELIAAADIQ  195

Query  347  GLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEA  216
               L FVEDRL TL+ + K+ +LN   L+L DWGYNT  ER+ A
Sbjct  196  PGNLWFVEDRLKTLELIQKQTDLNNVKLFLADWGYNTQPERKAA  239



>ref|WP_015187321.1| Haloacid dehalogenase domain protein hydrolase [Gloeocapsa sp. 
PCC 7428]
 gb|AFZ29444.1| Haloacid dehalogenase domain protein hydrolase [Gloeocapsa sp. 
PCC 7428]
Length=261

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 101/182 (55%), Gaps = 5/182 (3%)
 Frame = -1

Query  725  LTVKVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANR  546
            L   +  G+T D+IL+ W  I   I++E       +       RD+W+ +DL++W+  + 
Sbjct  67   LIAALLSGVTEDKILQEWNAIARAILQENQLQSTTIAHQLDSFRDQWIRDDLTSWLNLHS  126

Query  545  FYPGVA---DALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGL-GTGPKTKVL  378
            FYPGV    +AL  +  +V+IVTTK+ RF   LL +  G+ +P   ++G     PK ++L
Sbjct  127  FYPGVIEKLNALMSSPIQVFIVTTKEGRFVQQLLAQ-QGIQLPETSVFGKENKRPKHEIL  185

Query  377  KQLQEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARI  198
             +L    +    +L FVEDR+ TL+ V ++  L+   LYL DWGYNT  ER+ A    RI
Sbjct  186  HELIIAAKTLPASLWFVEDRIKTLELVAQQANLDTVKLYLADWGYNTSDERQAAQNHDRI  245

Query  197  RI  192
            ++
Sbjct  246  QL  247



>ref|WP_011142041.1| haloacid dehalogenase [Gloeobacter violaceus]
 ref|NP_924989.1| hypothetical protein glr2043 [Gloeobacter violaceus PCC 7421]
 dbj|BAC89984.1| glr2043 [Gloeobacter violaceus PCC 7421]
Length=261

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 98/183 (54%), Gaps = 9/183 (5%)
 Frame = -1

Query  725  LTVKVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANR  546
            L   +  G+  + IL +W  I   ++ +   +   L     + RD W+  DL  W+  +R
Sbjct  68   LVSAIVGGVEPEAILADWGGISQQLLAQSGVSAPQLAGEVDRTRDAWIARDLEGWLQLHR  127

Query  545  FYPGVADALK----FASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKV  381
             YPGVA  L+         V+++TTK+SRF   LL E AGV  P ERI+G  T  PKT+ 
Sbjct  128  LYPGVAGRLRALCEHPQPAVFMITTKESRFVLLLL-EQAGVDWPGERIFGKDTQQPKTET  186

Query  380  LKQLQEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIAR  201
            L +L      +   + FVEDRLATL+ V +  EL    LYL DWGYNTP ERE     +R
Sbjct  187  LAKLLGAGYER---IWFVEDRLATLEKVARLAELASVQLYLADWGYNTPTERERVRADSR  243

Query  200  IRI  192
            IR+
Sbjct  244  IRL  246



>ref|XP_005537811.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81775.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=348

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 91/175 (52%), Gaps = 12/175 (7%)
 Frame = -1

Query  701  LTVDEILENWMKI-KPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            LTV EI  NW  +    ++ +WN     LI+LFG +RD W+  D STW+  N  YPGVAD
Sbjct  158  LTVGEIAANWKSVLHDRLLRDWNIQPSFLIELFGTIRDAWIARDKSTWLSMNPIYPGVAD  217

Query  524  ALKFASSKVYIVTTKQSRFAAALLRELAGV---TIPPERIYGLGTG-PKTKVLKQLQEMP  357
            AL  +   VYIVTTKQ RF   +L E AG+    IPP  +YG+     K   +K++    
Sbjct  218  ALNMSQQPVYIVTTKQERFVKLIL-EHAGIRPGRIPPANVYGMDRKMTKIATIKEILRKE  276

Query  356  EHQG------LTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAK  210
            E +       + +H VEDRL TL+             +L  WGYN P +R  A K
Sbjct  277  EERSQDSQRKVVVHLVEDRLETLEAATISLLGAPVTYHLATWGYNDPAQRARAEK  331



>ref|WP_011433086.1| haloacid dehalogenase [Synechococcus sp. JA-2-3B'a(2-13)]
 gb|ABD02438.1| HAD hydrolase-like protein/gas vesicle protein K [Synechococcus 
sp. JA-2-3B'a(2-13)]
Length=432

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/179 (36%), Positives = 101/179 (56%), Gaps = 6/179 (3%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            + EG+  +++ ++W   +  ++++      +LI    +VRD W+  DL  W+G +RFYPG
Sbjct  75   LQEGIREEDLRQDWPSWRQRLLQQSGIPALSLIQALDRVRDRWIAEDLQGWLGLHRFYPG  134

Query  533  VADALK----FASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGT-GPKTKVLKQL  369
            VA  ++        ++ I++TK+ RF   LL   AG+ +P  RI G     PK   L++L
Sbjct  135  VAAWMRQLQAAGEPRLAILSTKEGRFIQQLLGR-AGIQLPRHRILGKEVRAPKATTLQRL  193

Query  368  QEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
                +     L FVEDRL TL+ V + PEL    L+L DWGYN P+EREEAA+  R+ +
Sbjct  194  LAAAQLPAEELWFVEDRLQTLRQVQRVPELEQVLLFLADWGYNLPEEREEAARDPRLHL  252



>ref|WP_029634503.1| haloacid dehalogenase [[Scytonema hofmanni] UTEX B 1581]
Length=264

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 100/175 (57%), Gaps = 5/175 (3%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G+  ++IL  W  I   I+ E       +      +RDEW+  DL  W+  +RFYPGV D
Sbjct  74   GIDDEKILREWASIAQQILLEDKLQAKEIATKLDNLRDEWIARDLDGWLSLHRFYPGVVD  133

Query  524  ALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMP  357
             LK       K+YIVTTK+ RF   LL++  GVT+  E I+G     PK ++L++L +  
Sbjct  134  KLKATLACQVKLYIVTTKEGRFVQQLLQQ-QGVTLDKEAIFGKEVKRPKYEILRELIQAA  192

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            + + ++L FVEDR+ TL+ V ++ +L    L+L DWGYNT  ER  A   +RI++
Sbjct  193  QDKAVSLWFVEDRIKTLQLVKEQTDLENVKLFLADWGYNTQSERNAAENDSRIQL  247



>ref|WP_008275611.1| haloacid dehalogenase [Cyanothece sp. CCY0110]
 gb|EAZ91220.1| hypothetical protein CY0110_11372 [Cyanothece sp. CCY0110]
Length=264

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 91/161 (57%), Gaps = 5/161 (3%)
 Frame = -1

Query  692  DEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVADALK-  516
            + I  NW +I   IVE+ N N+  ++     VRD W+  DL  W+  + FYPG+ + L  
Sbjct  79   ENIESNWHQICSEIVEKENLNKQQVMSELDGVRDHWIKTDLDNWLALHEFYPGILEKLGQ  138

Query  515  --FASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGT-GPKTKVLKQLQEMPEHQG  345
               +S+ +YIVTTK+ RF   LL++   ++ P E I+G     PK + L+Q+  M +   
Sbjct  139  LLASSTLLYIVTTKEGRFVKQLLKQ-QNLSFPEEHIFGKEVKQPKYETLRQILTMNQENT  197

Query  344  LTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKERE  222
              L F+ED L TLK+V  + +L+   L+L DWGYNT K  E
Sbjct  198  NHLWFIEDLLKTLKSVQTQSDLSQVKLFLADWGYNTSKTHE  238



>ref|WP_018396275.1| hypothetical protein [filamentous cyanobacterium ESFC-1]
Length=260

 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 96/176 (55%), Gaps = 8/176 (5%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGV--  531
            G T  EILE+W +I   IV + N +   L      VRDEW+  DL  W+  + FYPGV  
Sbjct  73   GKTDSEILEHWPQISQDIVTQDNLDPKRLSHTLDTVRDEWIQADLGGWLQLHEFYPGVLQ  132

Query  530  --ADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEM  360
                AL+    +VYI+TTK+ RF   LL++   V I  +RI+G     PK + LKQL  +
Sbjct  133  KLQQALQNPDLEVYIITTKEGRFVKQLLQQ-QNVEIERDRIFGKEVKRPKAETLKQL--L  189

Query  359  PEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
              H    + FVED L TL  V K+PEL    L+L +WGYNT    + A+   ++++
Sbjct  190  SRHPQAEIWFVEDMLKTLYKVQKQPELASVRLFLANWGYNTESAHQAASADEKVQL  245



>ref|WP_006527905.1| hypothetical protein [Gloeocapsa sp. PCC 73106]
 gb|ELR99273.1| hypothetical protein GLO73106DRAFT_00031230 [Gloeocapsa sp. PCC 
73106]
Length=261

 Score =   108 bits (271),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 97/178 (54%), Gaps = 5/178 (3%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            +A G+T  +I  +W+ I   IV        A+     +VRD+W+++DL +W+   +FYPG
Sbjct  69   LALGMTEADIQADWLGISTEIVNREKLETVAIAQTLDQVRDQWIESDLESWLELQKFYPG  128

Query  533  VADALK---FASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGT-GPKTKVLKQLQ  366
            V   ++     ++K+YIV+TK+ RF   LL++ AGV + PE I G  +  PK + L QL 
Sbjct  129  VIAKMQRTLLNNTKIYIVSTKEGRFVQELLQQ-AGVKLAPESIIGKESKQPKYQTLTQLL  187

Query  365  EMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
                 Q   L FVEDRL  L+ V ++  L G  L+L  WGYNT   R       RI++
Sbjct  188  ASNACQPDQLWFVEDRLKALQLVEQQSHLEGVGLFLASWGYNTSATRSSIKDNPRIKL  245



>ref|WP_014276064.1| hypothetical protein [Arthrospira platensis]
 dbj|BAI91640.1| hypothetical protein [Arthrospira platensis NIES-39]
Length=259

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 99/176 (56%), Gaps = 7/176 (4%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G    +IL +W  I   ++E+ + + + L     ++RD+W+  DL  W+  +RFYPGV D
Sbjct  73   GWAESQILSDWHSISRQLLEQEHLSPEVLGSRLDQIRDQWIATDLPGWLALHRFYPGVCD  132

Query  524  ALKFASSK----VYIVTTKQSRFAAALLRELAGVTIPPERIYGLG-TGPKTKVLKQLQEM  360
             L+    +    + I+TTK+ RF  +LL +  G+ + P  I+G G   PK + L+ L  +
Sbjct  133  RLRVILEQDMIQLRIITTKEERFVRSLLGQ-QGIILDPGIIFGKGHKQPKHQTLRDLMTL  191

Query  359  PEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
             +   L + FVEDR+ TL +V  +P+L    L+L DWGYNTP ER   A+   IR+
Sbjct  192  SDPSPL-IWFVEDRMKTLLSVQGQPDLQQVTLFLADWGYNTPIERRLVAEYPPIRL  246



>ref|WP_023065886.1| haloacid dehalogenase-like hydrolase family protein [Lyngbya 
aestuarii]
 gb|ERT07929.1| haloacid dehalogenase-like hydrolase family protein [Lyngbya 
aestuarii BL J]
Length=261

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 103/186 (55%), Gaps = 14/186 (8%)
 Frame = -1

Query  725  LTVKVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANR  546
            L  ++ +G    +IL +W  I    +   N +   L      +RD+W+  DL +W+  +R
Sbjct  67   LVRELVKGTPEADILHDWQSIAKQTITSENLDPKMLSTQLDGIRDQWISADLPSWLALHR  126

Query  545  FYPGVADALKFA---SSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVL  378
            FYPGV + +K     S  +YI+TTK+ RF  +LL E  GV +   RI+G G   PK ++L
Sbjct  127  FYPGVIERVKAFLENSLDLYIITTKEERFVRSLL-EKEGVNLNRGRIFGKGEKRPKYEIL  185

Query  377  KQL----QEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAK  210
            ++L    Q  P+     + FVEDRL TL  V + P+L   +L+L DWGYNT  ER+  ++
Sbjct  186  RELLAGVQPTPQ-----IWFVEDRLKTLLKVQQHPDLGDVHLFLADWGYNTQTERDSVSE  240

Query  209  IARIRI  192
              RI++
Sbjct  241  YPRIQL  246



>gb|EMR14228.1| hypothetical protein MPL1_00832 [Methylophaga lonarensis MPL]
Length=252

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 97/173 (56%), Gaps = 5/173 (3%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G  V+++LE +      ++ E + +   L  +F  +RD W+ +D   W+  N  YPG+ +
Sbjct  73   GTPVEQLLEFFADTMQQMLSESDCDITQLKTVFAAIRDHWISDDFDGWLANNPLYPGIKE  132

Query  524  AL-KFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMPEH  351
             L      +++IVTTKQ RF +A+L    G+T+    I+GL     K  +L+QLQ   + 
Sbjct  133  LLLSIPQQQLFIVTTKQERFVSAILSA-NGITLDDRHIFGLEKQLRKPLILQQLQAFCQP  191

Query  350  QGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            + L   FVEDR+ TL  VI++  LN   L L  WGYNTPK+R+ A +  R+RI
Sbjct  192  KPLI--FVEDRVNTLYEVIEDGTLNTVQLGLAVWGYNTPKDRQMAQQHCRVRI  242



>ref|WP_006616368.1| haloacid dehalogenase [Arthrospira platensis]
 gb|KDR58444.1| haloacid dehalogenase [Arthrospira platensis str. Paraca]
Length=259

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 99/176 (56%), Gaps = 7/176 (4%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G +   IL +W  +   ++E+ + + + L     ++RD+W+  DL  W+  +RFYPGV D
Sbjct  73   GFSESNILSDWHSVSRQLLEQEHLSPEVLGPRLDQIRDQWIATDLPGWLALHRFYPGVCD  132

Query  524  ALKFASSK----VYIVTTKQSRFAAALLRELAGVTIPPERIYGLG-TGPKTKVLKQLQEM  360
             L+    +    + I+TTK+ RF  +LL +  G+ + P  I+G G   PK + L+ L  +
Sbjct  133  RLRVILEQDMIQLRIITTKEERFVRSLLGQ-QGIILDPGIIFGKGHKQPKHQTLRDLMTL  191

Query  359  PEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
             +   L + FVEDR+ TL +V  +P+L    L+L DWGYNTP ER   A+   IR+
Sbjct  192  SDPSPL-IWFVEDRMNTLLSVQGQPDLQQVTLFLADWGYNTPIERRLVAEYPPIRL  246



>ref|WP_016866134.1| haloacid dehalogenase [Fischerella muscicola]
Length=262

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 103/182 (57%), Gaps = 5/182 (3%)
 Frame = -1

Query  725  LTVKVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANR  546
            L   + EG+   EIL++W  I   I+   + N   +     K+RDEW+  DL  W+  +R
Sbjct  66   LVKALLEGIAEAEILQDWHSINQKILLADHLNAKEISIKLDKLRDEWIATDLEGWLSLHR  125

Query  545  FYPGVADALKFAS---SKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVL  378
            FY GV D LK  S   +K+YI++TK+ RF   LL +  G+ +  + I+G     PK ++L
Sbjct  126  FYSGVIDKLKATSASTTKLYIISTKEGRFVQQLLHQ-EGIELGSKEIFGKEVKRPKYEIL  184

Query  377  KQLQEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARI  198
            ++L ++ +    T+ FVEDRL TL+ V ++ +L    L+L DWGYNTP E+       RI
Sbjct  185  RELIQLYKVPEETVWFVEDRLKTLQLVDQQVDLKDVKLFLADWGYNTPLEKTTTQNDPRI  244

Query  197  RI  192
            ++
Sbjct  245  QL  246



>ref|WP_009633880.1| hypothetical protein [Synechocystis sp. PCC 7509]
Length=258

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 102/174 (59%), Gaps = 8/174 (5%)
 Frame = -1

Query  725  LTVKVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANR  546
            L   + +G++  EIL NW +I   I+ E       +     ++RDEW+  DLS+W+  ++
Sbjct  67   LVKALIDGVSELEILSNWGEIAQAILLEDKLVSANIAFKLDQIRDEWISTDLSSWLSLHQ  126

Query  545  FYPGVADALK-FASSKV--YIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVL  378
            FYPGV + ++    SK+   I+TTK+ RF + LL++  GV +P + I G  +  PK ++L
Sbjct  127  FYPGVVEKMQSLQGSKLPPMIITTKEGRFVSQLLQQ-QGVEMPAKLIIGKESQRPKHQIL  185

Query  377  KQLQEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEA  216
            K+L    + +   + FVEDRL TL+ V ++P L    LYL DWGYNT  ERE A
Sbjct  186  KELIAATQAK---IWFVEDRLKTLQLVQQQPNLASVKLYLADWGYNTASEREHA  236



>ref|WP_040576735.1| hypothetical protein [Methylophaga lonarensis]
Length=251

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 97/173 (56%), Gaps = 5/173 (3%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G  V+++LE +      ++ E + +   L  +F  +RD W+ +D   W+  N  YPG+ +
Sbjct  72   GTPVEQLLEFFADTMQQMLSESDCDITQLKTVFAAIRDHWISDDFDGWLANNPLYPGIKE  131

Query  524  AL-KFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMPEH  351
             L      +++IVTTKQ RF +A+L    G+T+    I+GL     K  +L+QLQ   + 
Sbjct  132  LLLSIPQQQLFIVTTKQERFVSAILSA-NGITLDDRHIFGLEKQLRKPLILQQLQAFCQP  190

Query  350  QGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            + L   FVEDR+ TL  VI++  LN   L L  WGYNTPK+R+ A +  R+RI
Sbjct  191  KPLI--FVEDRVNTLYEVIEDGTLNTVQLGLAVWGYNTPKDRQMAQQHCRVRI  241



>gb|AFI83122.1| hypothetical protein Q7A_263 [Methylophaga nitratireducenticrescens]
Length=251

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 94/172 (55%), Gaps = 5/172 (3%)
 Frame = -1

Query  707  EGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVA  528
            EG+  D ++ ++ +    I+     +   L   FG+ RD W++ND S WI  N  YPG+ 
Sbjct  73   EGIKPDLLMTDFTQRIDAILSRDQLDTTDLKKRFGEYRDNWIENDFSGWIKMNPLYPGIG  132

Query  527  DAL-KFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMPE  354
              L +   S+++I+TTKQ RF  A+L+    + I P  IYGL     K ++L  LQ+   
Sbjct  133  KLLQQIPLSQLFIITTKQERFVQAILQA-NQIDIIPTHIYGLDRKLKKPQILSNLQQ--S  189

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARI  198
            H   T+ F+EDRL TL +VI+ P L+   L    WGYNT K+ + A K  RI
Sbjct  190  HPQTTILFIEDRLPTLLDVIRTPSLSTIQLCFATWGYNTTKDLQAALKNPRI  241



>ref|WP_041354791.1| hypothetical protein [Methylophaga nitratireducenticrescens]
Length=249

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 94/172 (55%), Gaps = 5/172 (3%)
 Frame = -1

Query  707  EGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVA  528
            EG+  D ++ ++ +    I+     +   L   FG+ RD W++ND S WI  N  YPG+ 
Sbjct  71   EGIKPDLLMTDFTQRIDAILSRDQLDTTDLKKRFGEYRDNWIENDFSGWIKMNPLYPGIG  130

Query  527  DAL-KFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMPE  354
              L +   S+++I+TTKQ RF  A+L+    + I P  IYGL     K ++L  LQ+   
Sbjct  131  KLLQQIPLSQLFIITTKQERFVQAILQA-NQIDIIPTHIYGLDRKLKKPQILSNLQQ--S  187

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARI  198
            H   T+ F+EDRL TL +VI+ P L+   L    WGYNT K+ + A K  RI
Sbjct  188  HPQTTILFIEDRLPTLLDVIRTPSLSTIQLCFATWGYNTTKDLQAALKNPRI  239



>ref|WP_041596806.1| haloacid dehalogenase [Halothece sp. PCC 7418]
Length=257

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 93/172 (54%), Gaps = 8/172 (5%)
 Frame = -1

Query  725  LTVKVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANR  546
            L   + EG+T   ILENW  +    +E+    +  +  L  + RD W++ +   W+  ++
Sbjct  64   LLRSLQEGMTDASILENWSAVVTETLEQNGLTQQEMARLLDEKRDHWIETNPQDWLAHHQ  123

Query  545  FYPGV----ADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGL-GTGPKTKV  381
            FYPGV       LK A+++VYI+TTK+ RFA  LL E  G+  P + I G     PK K 
Sbjct  124  FYPGVIPRLQAILKEATTQVYIITTKEGRFARTLLAE-QGIRFPSDHIMGKESQQPKRKT  182

Query  380  LKQLQEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKER  225
            L  L +  +H    L FVEDRL TL +V   PEL+   L+L  WGYNT + R
Sbjct  183  LTSLSQ--KHDQPWLWFVEDRLKTLLSVADSPELDAVRLFLAAWGYNTARSR  232



>gb|AFZ45828.1| hypothetical protein PCC7418_3724 [Halothece sp. PCC 7418]
Length=262

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 93/172 (54%), Gaps = 8/172 (5%)
 Frame = -1

Query  725  LTVKVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANR  546
            L   + EG+T   ILENW  +    +E+    +  +  L  + RD W++ +   W+  ++
Sbjct  69   LLRSLQEGMTDASILENWSAVVTETLEQNGLTQQEMARLLDEKRDHWIETNPQDWLAHHQ  128

Query  545  FYPGV----ADALKFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGL-GTGPKTKV  381
            FYPGV       LK A+++VYI+TTK+ RFA  LL E  G+  P + I G     PK K 
Sbjct  129  FYPGVIPRLQAILKEATTQVYIITTKEGRFARTLLAE-QGIRFPSDHIMGKESQQPKRKT  187

Query  380  LKQLQEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKER  225
            L  L +  +H    L FVEDRL TL +V   PEL+   L+L  WGYNT + R
Sbjct  188  LTSLSQ--KHDQPWLWFVEDRLKTLLSVADSPELDAVRLFLAAWGYNTARSR  237



>ref|WP_009785783.1| haloacid dehalogenase [Lyngbya sp. PCC 8106]
 gb|EAW35656.1| hypothetical protein L8106_08306 [Lyngbya sp. PCC 8106]
Length=260

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 103/184 (56%), Gaps = 10/184 (5%)
 Frame = -1

Query  725  LTVKVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANR  546
            L  ++ +G    +IL +W  I    + E N +   L      +RD+W+  +L +W+  ++
Sbjct  66   LVRELIKGTPEADILHDWQSIAKQTITEENLDPKLLSTQLDGIRDQWISANLPSWLALHQ  125

Query  545  FYPGVADALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVL  378
            FYPGV D +K    +S  +YI+TTK+ RF  +LL E  GV +   RI+G G   PK ++L
Sbjct  126  FYPGVIDRVKLFLESSLSLYIITTKEERFVRSLL-EKEGVNLERGRIFGKGEKRPKYEIL  184

Query  377  KQL--QEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIA  204
            ++L     P  Q   + FVEDRL TL  V ++P+L    L+L DWGYNT  ER+   +  
Sbjct  185  RELLAGTKPTPQ---IWFVEDRLKTLLKVQQQPDLGDVRLFLADWGYNTQIERDSVTEYP  241

Query  203  RIRI  192
            RI++
Sbjct  242  RIQL  245



>gb|KDO86222.1| hypothetical protein CISIN_1g024415mg [Citrus sinensis]
Length=145

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = -1

Query  716  KVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFY  540
             V+EGLTV+ ILENW KIKPVI+E+W+ENRDAL+DLFGKVRDEWMD DL+TWIGANR++
Sbjct  83   SVSEGLTVEGILENWSKIKPVIMEDWSENRDALVDLFGKVRDEWMDKDLTTWIGANRYF  141



>ref|WP_041550020.1| haloacid dehalogenase, partial [Chamaesiphon minutus]
Length=249

 Score =   107 bits (266),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 99/175 (57%), Gaps = 5/175 (3%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G++ + +  +W +I+  I+ +   +   +      VRD W+  D ++W+  ++FYPGV D
Sbjct  72   GISTERMQSSWQRIRDRILADSRLSGVKVSQQLDAVRDNWIQQDPASWLRLHQFYPGVID  131

Query  524  ALK-FASSKV--YIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMP  357
             L+   + K+   I+TTK+SRF   LL++  GV +  E I+G      KT  LKQL +  
Sbjct  132  LLQELPNRKIQPIIITTKESRFVTQLLQD-NGVELASEFIWGKELKRSKTDSLKQLLDRG  190

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
              +   + FVEDRL TL  V  +PEL    LYL DWGYNT  ER+ A + +RI+I
Sbjct  191  SKKAPAIWFVEDRLNTLAKVATQPELESVKLYLADWGYNTAAERQAALQQSRIQI  245



>ref|WP_016871260.1| haloacid dehalogenase [Fischerella thermalis]
Length=262

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 103/182 (57%), Gaps = 5/182 (3%)
 Frame = -1

Query  725  LTVKVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANR  546
            L   + EG+   EIL++W  I   I+   + N   +     K+RDEW+  DL  W+  +R
Sbjct  66   LVKALLEGIAEAEILQDWHSINQKILLADHLNAREISIKLDKLRDEWIATDLEGWLSLHR  125

Query  545  FYPGVADALK---FASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVL  378
            FY GV D LK     ++K+YI++TK+ RF   LL +  G+ +  + I+G     PK ++L
Sbjct  126  FYSGVIDKLKATITTTTKLYIISTKEGRFVQQLLHQ-EGIELGSKEIFGKEVKRPKYEIL  184

Query  377  KQLQEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARI  198
            ++L ++ +    T+ FVEDRL TL+ V ++ +L    L+L DWGYNTP E+       RI
Sbjct  185  RELIQLHKVPQETVWFVEDRLKTLQLVDQQLDLKEVKLFLADWGYNTPLEKTTTQNDPRI  244

Query  197  RI  192
            ++
Sbjct  245  QL  246



>gb|AFY96345.1| putative phosphatase [Chamaesiphon minutus PCC 6605]
Length=276

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 99/175 (57%), Gaps = 5/175 (3%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G++ + +  +W +I+  I+ +   +   +      VRD W+  D ++W+  ++FYPGV D
Sbjct  72   GISTERMQSSWQRIRDRILADSRLSGVKVSQQLDAVRDNWIQQDPASWLRLHQFYPGVID  131

Query  524  ALK-FASSKV--YIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMP  357
             L+   + K+   I+TTK+SRF   LL++  GV +  E I+G      KT  LKQL +  
Sbjct  132  LLQELPNRKIQPIIITTKESRFVTQLLQD-NGVELASEFIWGKELKRSKTDSLKQLLDRG  190

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
              +   + FVEDRL TL  V  +PEL    LYL DWGYNT  ER+ A + +RI+I
Sbjct  191  SKKAPAIWFVEDRLNTLAKVATQPELESVKLYLADWGYNTAAERQAALQQSRIQI  245



>ref|WP_015191689.1| hypothetical protein [Stanieria cyanosphaera]
 gb|AFZ34016.1| hypothetical protein Sta7437_0406 [Stanieria cyanosphaera PCC 
7437]
Length=258

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 95/168 (57%), Gaps = 6/168 (4%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G+   EIL NW  +   I++  N     +       RD W+++DL +W+  ++FYPG+  
Sbjct  72   GINEIEILSNWSLVAKTIIDNENLKPQEISTKLDSNRDNWINHDLDSWLELHQFYPGILS  131

Query  524  ALKFA---SSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLK-QLQEM  360
             LK     S ++YI+TTK+ RFA  LL E  G+ +P ERI G     PK + LK  LQ  
Sbjct  132  ILKHINNLSIELYIITTKEGRFAQKLL-EQQGIDLPKERIIGKEYQRPKYQTLKLLLQAS  190

Query  359  PEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEA  216
               + +T+ FVEDRL TL+ V ++ EL+   L+L DWGYNT  ER  A
Sbjct  191  KSPKDITIWFVEDRLKTLEVVQQQLELSTIKLFLADWGYNTEIERVAA  238



>ref|WP_035156169.1| haloacid dehalogenase [Calothrix sp. 336/3]
 gb|KFB85176.1| haloacid dehalogenase [Calothrix sp. 336/3]
Length=267

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/175 (37%), Positives = 102/175 (58%), Gaps = 5/175 (3%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            GL  ++IL +W  I   I++  N +   +      +RD+W+ NDL  W+  +RFYPGV +
Sbjct  74   GLPEEKILNDWENIVKQILQADNLDAKQVGIKLDALRDDWIANDLPDWLKLHRFYPGVIN  133

Query  524  ALK--FASS-KVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMP  357
             ++   AS  K YI+TTK+ RF   L+++  G+ +P E I+G     PK +++++L +  
Sbjct  134  KIQATLASDIKFYIITTKEGRFVKQLMQQ-GGLDLPTELIFGKEYKRPKYEIIRELIKKH  192

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
                  + FVEDRL TL+ V ++ +L    L+L DWGYNTP ER +A K  R+ +
Sbjct  193  NLAAENVWFVEDRLKTLQLVEQQTDLENMQLFLADWGYNTPSERVKAEKDPRVNL  247



>ref|WP_017288113.1| hypothetical protein [Leptolyngbya boryana]
Length=256

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 64/175 (37%), Positives = 100/175 (57%), Gaps = 8/175 (5%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G+  +EIL+NW+ I    +E+       +      +RD  +  DL  W+  + FYPGV D
Sbjct  72   GVQEEEILQNWLTIATQTIEKEQLKPLEISAAVDGIRDRKIATDLDNWLAEHEFYPGVID  131

Query  524  ALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMP  357
             L     +S+  +I++TK+ RF   LL++  G+ +   ++YG  +  PK +VLK+LQ++ 
Sbjct  132  RLNTILNSSTDFFIISTKEGRFIKQLLKQ-EGIELADSQVYGKESKRPKPQVLKELQQV-  189

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
             +QG  + FVEDRL TL+ V ++  L    L+L DWGYNT  EREEA    R+ +
Sbjct  190  -YQG-AIWFVEDRLKTLQAVEQQESLQEVELFLADWGYNTRSEREEAQNSDRVHL  242



>ref|WP_039714896.1| haloacid dehalogenase [Scytonema millei]
 gb|KIF17331.1| haloacid dehalogenase [Scytonema millei VB511283]
Length=261

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 98/175 (56%), Gaps = 5/175 (3%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G+T  EI +NW  I   ++++ N     +      +RDEW+  DL +W+  +RFYPGV +
Sbjct  74   GVTEAEIWQNWSAIAQKLLQQDNLTAAEVGKQLDTIRDEWISTDLDSWLDLHRFYPGVLE  133

Query  524  ALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMP  357
             L     +  K  I+TTK+ RF   LL+   G+ +P + + G     PK +++++L  + 
Sbjct  134  RLHSLIDSPVKPLIITTKEGRFVERLLQR-QGIQLPSQSVLGKEIKRPKYQIIRELIAIA  192

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
                + L FVEDRL TL+ V ++ +L    L+L DWGYNT  ERE A +  RI++
Sbjct  193  TQTPVLLWFVEDRLKTLQLVQQQADLEDVKLFLADWGYNTAAERELAQQNPRIQL  247



>ref|WP_009756647.1| haloacid dehalogenase [Fischerella sp. JSC-11]
 gb|EHC16211.1| hypothetical protein FJSC11DRAFT_1634 [Fischerella sp. JSC-11]
Length=262

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 103/182 (57%), Gaps = 5/182 (3%)
 Frame = -1

Query  725  LTVKVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANR  546
            L   + EG+   EIL++W  I   I+   + N   +     K+RDEW+  DL  W+  +R
Sbjct  66   LVKALLEGIAEAEILQDWHGINQKILLADHLNAREISIKLDKLRDEWIATDLEGWLSLHR  125

Query  545  FYPGVADALK---FASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVL  378
            FY GV D LK     ++K+YI++TK+ RF   LL +  G+ +  + I+G     PK ++L
Sbjct  126  FYSGVIDKLKATITTTTKLYIISTKEGRFVQQLLHQ-EGIELGSKEIFGKEVKRPKYEIL  184

Query  377  KQLQEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARI  198
            ++L ++ +    T+ FVEDRL TL+ V ++ +L    L+L DWGYNTP E+       RI
Sbjct  185  RELIQLHKVPQETVWFVEDRLKTLQLVDQQLDLKEVKLFLADWGYNTPLEKTTTQNDPRI  244

Query  197  RI  192
            ++
Sbjct  245  QL  246



>ref|WP_019504810.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=261

 Score =   106 bits (264),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 102/177 (58%), Gaps = 7/177 (4%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G+T  EIL  W  I   I+E    ++  ++     VRD W++NDL  W+  +RFYPGV +
Sbjct  72   GITETEILNAWKAIAFQILESEGLDKSFVVQKLDGVRDSWINNDLDEWLSLHRFYPGVIE  131

Query  524  ALK---FASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMP  357
             L+    +  ++YIVTTK+ RF   LL++  G+ +P  +I G  +   K + L+ +++  
Sbjct  132  RLQQIINSVVEIYIVTTKEGRFVRQLLQQ-QGIDLPIAQIIGKESKRSKYETLRIIRDKH  190

Query  356  EHQG--LTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            +  G  L++ FVEDR+  L+ V ++ +L   NL+L DWGYN   +R  A K  RI++
Sbjct  191  QKIGADLSIFFVEDRIKALQQVAQQTDLELVNLFLADWGYNLEGDRNLARKDQRIQL  247



>ref|WP_009547672.1| MULTISPECIES: haloacid dehalogenase [Cyanothece]
 gb|ACB52370.1| unknown [Cyanothece sp. ATCC 51142]
Length=264

 Score =   106 bits (264),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 89/156 (57%), Gaps = 5/156 (3%)
 Frame = -1

Query  677  NWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVADALKF---AS  507
            NW +I   IVE+ N N+  ++    +VRD W+  DL  W+  + FYPGV + L     +S
Sbjct  84   NWHQICSEIVEKENLNKQQVMSELDEVRDHWIKTDLDNWLALHEFYPGVLEKLGQLLESS  143

Query  506  SKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGT-GPKTKVLKQLQEMPEHQGLTLHF  330
            + +YIVTTK+ RF   LL++   ++ P E I+G     PK + L+Q+ +  +     L F
Sbjct  144  TLLYIVTTKEGRFVKQLLKQ-QNLSFPEEHIFGKEVKQPKYETLRQILKKNQEATSNLWF  202

Query  329  VEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKERE  222
            +ED   TLK+V  + +L+   L+L DWGYNT K  +
Sbjct  203  IEDLFKTLKSVQNQSDLSEVKLFLADWGYNTSKTHQ  238



>ref|WP_005374404.1| hypothetical protein [Methylomicrobium album]
 gb|EIC31207.1| hypothetical protein Metal_3559 [Methylomicrobium album BG8]
Length=250

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 88/163 (54%), Gaps = 6/163 (4%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G TV  I  N+      ++EE       L  LFG+ RD W+  D   WI  N  + G+AD
Sbjct  72   GETVASIYSNYEAKSKALMEETRIGPGELKRLFGETRDLWIAEDREHWIRMNPLFDGIAD  131

Query  524  ALKFASSKV--YIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMPE  354
             L+    +   Y+VTTKQ RFA  +L   A + +  ERI+GL     K +VLK L  +  
Sbjct  132  KLRTIGERHTWYVVTTKQERFAKEILAAHA-IELADERIFGLDRNMSKPEVLKGL--LKA  188

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKER  225
            H   TL+F EDRL TL NV K PEL+G  L    WGYNTPK++
Sbjct  189  HSEQTLYFAEDRLPTLLNVRKHPELDGIKLIFALWGYNTPKDK  231



>ref|WP_017322990.1| hypothetical protein [cyanobacterium PCC 7702]
Length=262

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/177 (38%), Positives = 107/177 (60%), Gaps = 16/177 (9%)
 Frame = -1

Query  692  DEILENWMKIKPVIVEEWNENRDAL---IDLFGKVRDEWMDNDLSTWIGANRFYPGVADA  522
            ++IL+ W  I   I++   EN DA    I+L  ++RDEW++ DL  W+  +RFYPG+ D 
Sbjct  78   EKILQEWGNIVKEILQ--TENLDATEIGINL-DRLRDEWIETDLEGWLSLHRFYPGLIDR  134

Query  521  LK---FASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMPE  354
            +K    + +K+YI++TK+ RF   LL++  G+ + P+ I+G  +  PK ++L++L  +  
Sbjct  135  IKEIVASPTKLYIISTKEGRFVHKLLQQ-QGIDLGPKEIFGKESKRPKYEILREL--IHS  191

Query  353  HQGLT---LHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            H  L    + FVEDRL TL+ V  + +L    L+L DWGYNTP E+  A    RI++
Sbjct  192  HNELAPDGVWFVEDRLKTLQLVATQEDLQQVRLFLADWGYNTPSEKVTAKNDPRIQL  248



>ref|WP_015230580.1| phosphatase [Dactylococcopsis salina]
 gb|AFZ51601.1| putative phosphatase [Dactylococcopsis salina PCC 8305]
Length=257

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 97/183 (53%), Gaps = 10/183 (5%)
 Frame = -1

Query  725  LTVKVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANR  546
            L   + +G++  EI ENW  + P ++E        +  L  + RD W++  L  W+  ++
Sbjct  67   LLRSMQQGVSDLEIEENWSSLVPKMLEREGLTSSEIAQLLDEKRDRWLETHLEDWLAHHQ  126

Query  545  FYPGVADALK----FASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLG-TGPKTKV  381
            FYP V   LK      ++K+YI+TTK+ RFA  LL E  G+  P ++I G     PKT+ 
Sbjct  127  FYPHVLPTLKKRLESTATKIYIITTKEGRFARKLL-EKNGINFPSDQIIGKEYQQPKTQT  185

Query  380  LKQLQEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIAR  201
            L  L +       T+ FVEDRL TL +V K   L    L+L DWGYNT + R  A+K   
Sbjct  186  LLSLMKTET----TVWFVEDRLKTLLSVQKFSGLEAVGLFLADWGYNTARSRAIASKNQG  241

Query  200  IRI  192
            IRI
Sbjct  242  IRI  244



>ref|WP_012629361.1| haloacid dehalogenase [Cyanothece sp. PCC 7425]
 gb|ACL46309.1| conserved hypothetical protein [Cyanothece sp. PCC 7425]
Length=269

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/176 (37%), Positives = 100/176 (57%), Gaps = 8/176 (5%)
 Frame = -1

Query  707  EGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVA  528
            +G +  ++LE W  I+  I+ E +     L  L   +RD+W+  DL  W+G +RFYPGV 
Sbjct  78   KGFSEADMLERWSVIRDRIMAEEDLQAKNLGMLVDGLRDQWIAEDLPGWLGLHRFYPGVT  137

Query  527  DALKFASSK---VYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEM  360
            + L+    +   V I+TTK++RF   LL+   G+ I  +RI+G     PK + L+ LQ+ 
Sbjct  138  ERLQQLLDQGFAVVIITTKETRFVQQLLQR-EGIQITTDRIFGKDRHLPKVETLRGLQK-  195

Query  359  PEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
                   + FVED L TL+ V ++P+L    L+L DWGYNTP++R  A+   RI +
Sbjct  196  --DAAGPIWFVEDLLPTLETVKQQPDLPQVELFLADWGYNTPRDRRLASSDDRIHL  249



>ref|WP_007144204.1| hypothetical protein [Methylophaga aminisulfidivorans]
 gb|EGL54318.1| expressed protein [Methylophaga aminisulfidivorans MP]
Length=249

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 99/175 (57%), Gaps = 7/175 (4%)
 Frame = -1

Query  707  EGLTVDEILENWM-KIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGV  531
            EG++ D ++  +  +I+ +++ + +   D L ++FG  RDEW+ +D  +WI  N  + G+
Sbjct  70   EGMSADTLMSAFHHQIEALMIRD-DMFVDELKEVFGSTRDEWIRDDFDSWIAMNPLFEGI  128

Query  530  ADALK-FASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMP  357
            A+ L+   +  + I+TTKQ RF   +L+    +++P  ++YGL     K ++L  L    
Sbjct  129  AEKLRTIPTDNLVIITTKQERFVDHILKA-NQISLPIAQVYGLDRNMSKQQILSDLH--A  185

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            E   + + F+EDRL  L NVI E  L+   LYL  WGYNT  ++E A  I RI +
Sbjct  186  EKPDMEIVFIEDRLPALINVITEDGLDDIKLYLASWGYNTASDKESANNIDRISV  240



>ref|WP_011243209.1| MULTISPECIES: hypothetical protein [Synechococcus]
 dbj|BAD79087.1| hypothetical protein [Synechococcus elongatus PCC 6301]
 gb|ABB56659.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
 gb|AJD58796.1| hypothetical protein M744_13695 [Synechococcus sp. UTEX 2973]
Length=254

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 92/167 (55%), Gaps = 9/167 (5%)
 Frame = -1

Query  689  EILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVADALKFA  510
            E+L +W ++   ++++W      L     +VRD W+  D   W+  + FYPGVA+ L   
Sbjct  75   EVLADWPQLCDRVLKDWGLTTTELSQAMDRVRDRWIKRDRKEWLQLHHFYPGVAERLAQQ  134

Query  509  SSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMPEHQGLTLH  333
            ++   I++TK  RF A LL ++  +  PP  IYG   G PKT+ L QLQ   E     + 
Sbjct  135  TAPWVIISTKDGRFIAELLEQIPNLQ-PPLAIYGKEVGVPKTQTLIQLQVEFEQ----IA  189

Query  332  FVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            FVEDRL  L+      +L   +LYL DWGYNT ++R++A    RI++
Sbjct  190  FVEDRLPALEAAA---QLESVDLYLADWGYNTDRDRQQAMTSDRIQL  233



>gb|KIJ84882.1| haloacid dehalogenase [Scytonema tolypothrichoides VB-61278]
Length=261

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 100/174 (57%), Gaps = 5/174 (3%)
 Frame = -1

Query  725  LTVKVAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANR  546
            L   + E +  + IL+ W+ I   ++ + N     +     K+RDEW+  DL  W+  +R
Sbjct  67   LVKALVEEIPEETILQEWITIAQELLLKDNLKATDIGHQLDKIRDEWIATDLDGWLSLHR  126

Query  545  FYPGVADALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVL  378
            FYPG+ + ++    +++K+YI+TTK+ RFA  LL++  GV +P E I+G     PK ++L
Sbjct  127  FYPGIVEKIQATVDSTTKLYIITTKEGRFAQQLLKQ-GGVDLPREIIFGKEVKRPKHEIL  185

Query  377  KQLQEMPEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEA  216
            ++L +        + FVEDRL TL+ V ++  L    L+L DWGYNTP ++  A
Sbjct  186  RELIQTTNTLPERVWFVEDRLKTLQLVQQQAGLEEVKLFLADWGYNTPTDKVTA  239



>ref|WP_028946803.1| hypothetical protein [Synechocystis sp. PCC 6714]
 gb|AIE72743.1| hypothetical protein D082_02140 [Synechocystis sp. PCC 6714]
Length=262

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 88/165 (53%), Gaps = 7/165 (4%)
 Frame = -1

Query  686  ILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVADAL----  519
            I+ +W  I   +  +   ++  L     KVRD +++NDL  W+G + FYPGV + L    
Sbjct  79   IIADWPNIAQTLQNQEQISKAQLAPALDKVRDNYINNDLEYWLGLHSFYPGVIEQLNQWL  138

Query  518  -KFASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGT-GPKTKVLKQLQEMPEHQG  345
                   +YIVTTK+ RF   LL+    V  P  +I G     PK K L+QL    +  G
Sbjct  139  HSSCPQSLYIVTTKEGRFVQHLLQN-QTVDFPLGQIIGKEIKQPKFKTLEQLLVKHQCAG  197

Query  344  LTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAK  210
              L FVED LATLK V K+P L   +L+L DWGYNT  +RE A +
Sbjct  198  DQLWFVEDMLATLKTVAKQPSLEQTSLFLADWGYNTTTDRELAKQ  242



>ref|WP_015152307.1| hypothetical protein [Chroococcidiopsis thermalis]
 gb|AFY85756.1| hypothetical protein Chro_0201 [Chroococcidiopsis thermalis PCC 
7203]
Length=261

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 96/175 (55%), Gaps = 5/175 (3%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G+T  EI +NW  I    +++ N     +      +RDEW+  +L +W+  +RFYPGV +
Sbjct  74   GVTEAEIWQNWSAIAQKFLQQDNLTAAEIGKQLDAIRDEWISTNLDSWLDLHRFYPGVLE  133

Query  524  ALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMP  357
             L     +  K  I+TTK+ RF   LL+   G+ +P + + G     PK +++++L  + 
Sbjct  134  RLHSLIDSPVKPLIITTKEGRFVEQLLQR-QGIQLPSQSVLGKEIKRPKYQIIRELIAIA  192

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
                +   FVEDRL TL+ V ++ +L    L+L DWGYNT  ERE A +  RI++
Sbjct  193  TQTPVVFWFVEDRLKTLQLVQQQADLEDVRLFLADWGYNTSAERELAQQNPRIQL  247



>ref|WP_014704511.1| hypothetical protein [Methylophaga frappieri]
 gb|AFJ03092.1| hypothetical protein Q7C_1951 [Methylophaga frappieri]
Length=260

 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 98/176 (56%), Gaps = 6/176 (3%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            + +G+ V  ++ ++      +++++  +   L + F +VRD+W+  D S W+  N  YP 
Sbjct  72   LVDGVAVQTLINSFSNNMDRVMQQYQLSPSLLKNQFAEVRDDWIACDFSGWVEKNPLYPT  131

Query  533  VADALK-FASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEM  360
            +   ++   +S++ I+TTKQ RF +A+L     +T+P ++IYG+     K  VL+ LQ  
Sbjct  132  IKQIMQQIPTSQLVIITTKQERFVSAILSA-NEITVPEDQIYGMDRQLSKASVLRMLQ--  188

Query  359  PEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
              H    + FVEDRL TL N+I  PEL    L+L  WGYNT  +++ A    RI +
Sbjct  189  -NHYTGQILFVEDRLPTLCNIITTPELEQIQLWLATWGYNTELDQQTALASPRIEL  243



>ref|WP_023493253.1| hypothetical protein [Methyloglobulus morosus]
 gb|ESS73842.1| hypothetical protein MGMO_9c00380 [Methyloglobulus morosus KoM1]
Length=253

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 89/166 (54%), Gaps = 6/166 (4%)
 Frame = -1

Query  698  TVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVADAL  519
            T++ I  N+ +   V++++ N     L  LFG  RD W+ ND + WI  N  Y G+   L
Sbjct  74   TIEAIYNNYSEKFKVLIDDANLTVGGLKQLFGDTRDAWIKNDANDWINMNPLYDGIVAKL  133

Query  518  KFASSKV--YIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMPEHQ  348
            K        YIVTTK  RF   +L    G+ +  +++YGL     KT+ +K+L  +  H 
Sbjct  134  KALGQHCPWYIVTTKHERFVKLILHA-NGIELAEDQLYGLDRNMSKTEAIKEL--LKSHP  190

Query  347  GLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAK  210
            G TL+FVEDRL TL N+I+  E+    L    WGYN P ++E A +
Sbjct  191  GETLYFVEDRLPTLLNIIRNGEIPDVKLIFASWGYNRPGDKELAKQ  236



>ref|WP_015170218.1| haloacid dehalogenase domain-containing protein hydrolase [Geitlerinema 
sp. PCC 7407]
 gb|AFY64650.1| Haloacid dehalogenase domain protein hydrolase [Geitlerinema 
sp. PCC 7407]
Length=261

 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 94/175 (54%), Gaps = 5/175 (3%)
 Frame = -1

Query  707  EGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVA  528
            +G+   EIL +W  I   +V +   +   L      VRD W+  DL  W+  +RFYPGV 
Sbjct  73   QGMGEAEILADWWAIAHQLVTQEARSPADLAVAVDSVRDAWIARDLEGWLAQHRFYPGVG  132

Query  527  DALKFASSKV--YIVTTKQSRFAAALLRELAGVTIPPERIYGLGT-GPKTKVLKQLQEMP  357
            D L+   + V  YI+TTK+ RF   LL    G+  P ERI+G     PK + L++L    
Sbjct  133  DRLRALEAAVTPYIITTKEGRFVQRLL-AAEGIHWPEERIFGKEVKQPKHQTLRELVVAQ  191

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            E +   + F+EDRL TL +V ++P+L    L+L DWGYNT  +R  A +   I +
Sbjct  192  EAE-TCVWFIEDRLKTLDSVRQQPDLGMVRLFLADWGYNTEGDRRRAQQTDAITL  245



>ref|WP_007309971.1| haloacid dehalogenase [Crocosphaera watsonii]
 gb|EHJ13753.1| hypothetical protein CWATWH0003_1560 [Crocosphaera watsonii WH 
0003]
 emb|CCQ58901.1| hypothetical protein CWATWH0005_5557 [Crocosphaera watsonii WH 
0005]
 emb|CCQ66483.1| HAD superfamily hydrolase [Crocosphaera watsonii WH 0402]
Length=261

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 90/171 (53%), Gaps = 5/171 (3%)
 Frame = -1

Query  692  DEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVADALKF  513
            D I  NW  +   IV + N N+  ++     VRD W+  DL  W+  + FYPGV + L  
Sbjct  77   DNIESNWHNVCSEIVTKENLNKQQVMSALDGVRDHWIQTDLDNWLALHEFYPGVLEKLGK  136

Query  512  ---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGT-GPKTKVLKQLQEMPEHQG  345
               +S+ +YIVTTK+ RF   LL++   ++ P + I+G     PK   L+Q+ ++ +   
Sbjct  137  LLDSSTLLYIVTTKEGRFVKQLLKQ-QNLSFPEDHIFGKEVKQPKFDTLRQILKINQETP  195

Query  344  LTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
              L F+ED L TL  V  +  L   NL+L DWGYNT K  E   + + I +
Sbjct  196  NNLWFIEDLLKTLNKVKSQEYLTEVNLFLADWGYNTIKSHELVKQDSTINL  246



>ref|WP_015279855.1| phosphatase [Thioflavicoccus mobilis]
 gb|AGA89709.1| putative phosphatase [Thioflavicoccus mobilis 8321]
Length=255

 Score =   103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 89/171 (52%), Gaps = 6/171 (4%)
 Frame = -1

Query  707  EGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVA  528
            +G   D +L ++   +P ++     +  AL  LF   RD W+  +   W   +  YPGVA
Sbjct  69   DGADPDALLADFTAREPEVLARAGRDVAALKTLFSTTRDRWLAAEPEAWAALSPLYPGVA  128

Query  527  DALKF--ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMP  357
            D L+   A S  +IVTTK+ RF   LL   AGV    ERI+GL  G PK  VL +L  + 
Sbjct  129  DWLRTLPADSDCFIVTTKERRFVERLLSG-AGVAFASERIFGLDYGRPKEAVLAEL--LA  185

Query  356  EHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIA  204
             H   T+ FVEDRLATL     +P L    + L  WGYNT  ER  A +++
Sbjct  186  CHPISTVCFVEDRLATLTRCRAQPGLERVAMRLAGWGYNTMDERRTAERLS  236



>ref|WP_021831172.1| hypothetical protein [Crocosphaera watsonii]
 emb|CCQ61051.1| HAD superfamily hydrolase [Crocosphaera watsonii WH 0401]
 emb|CCQ52122.1| hypothetical protein CWATWH8502_2741 [Crocosphaera watsonii WH 
8502]
Length=263

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 90/171 (53%), Gaps = 5/171 (3%)
 Frame = -1

Query  692  DEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVADALKF  513
            D I  NW  +   IV + N N+  ++     VRD W+  DL  W+  + FYPGV + L  
Sbjct  79   DNIESNWHNVCSEIVTKENLNKQQVMSALDGVRDHWIQTDLDNWLALHEFYPGVLEKLGK  138

Query  512  ---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGT-GPKTKVLKQLQEMPEHQG  345
               +S+ +YIVTTK+ RF   LL++   ++ P + I+G     PK   L+Q+ ++ +   
Sbjct  139  LLDSSTLLYIVTTKEGRFVKQLLKQ-QNLSFPEDHIFGKEVKQPKFDTLRQILKINQETP  197

Query  344  LTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
              L F+ED L TL  V  +  L   NL+L DWGYNT K  E   + + I +
Sbjct  198  NNLWFIEDLLKTLNKVKSQEYLTEVNLFLADWGYNTIKSHELVKQDSTINL  248



>ref|WP_031430000.1| hypothetical protein [Methylomicrobium agile]
Length=250

 Score =   103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 88/163 (54%), Gaps = 6/163 (4%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G TV  I  N+      ++EE       L  LFG+ RD W+  D   WI  N  + G+AD
Sbjct  72   GETVAGIYSNYEAKSKALMEETRIGPGELKRLFGETRDLWIAEDREHWIRMNPLFDGIAD  131

Query  524  ALKFASSKV--YIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEMPE  354
             L+    +   Y+VTTKQ RFA  +L   A + +  ERI+GL     K +VLK L  +  
Sbjct  132  KLRTIGERHTWYVVTTKQERFAKEILAAHA-IELADERIFGLDRNMSKPEVLKGL--LKA  188

Query  353  HQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKER  225
            H   TL+F EDRL TL NV K PEL+G  L    WGYNTP+++
Sbjct  189  HSEQTLYFAEDRLPTLLNVRKHPELDGIKLIFALWGYNTPEDK  231



>ref|WP_013818695.1| hypothetical protein [Methylomonas methanica]
 gb|AEG00451.1| hypothetical protein Metme_2045 [Methylomonas methanica MC09]
Length=249

 Score =   103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 91/172 (53%), Gaps = 8/172 (5%)
 Frame = -1

Query  713  VAEGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPG  534
            + +G T+ +I   + +    ++ +     D L  LFG  RD+W+  +   WI  N  +PG
Sbjct  69   LQQGDTIGDIYNGYTEKTSALLRQAQVGADDLKQLFGDTRDQWIAENRDEWIAMNPLFPG  128

Query  533  VADALK-FASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEM  360
            VA+ LK   +   YIVTTK  RF   +L+    + +  ERI+GL     K +VL  L  +
Sbjct  129  VAEKLKRLETDSWYIVTTKHERFVRKILKA-NDIRLADERIFGLDRNMSKPEVLTGL--L  185

Query  359  PEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIA  204
            P H G T+HF+EDRL  L  V K P L+   L+   WGYNT   RE+ A +A
Sbjct  186  PNHPGQTMHFLEDRLPALLGVQKHPPLSSVKLFFALWGYNT---REDKAAVA  234



>ref|WP_039727199.1| MULTISPECIES: haloacid dehalogenase [Oscillatoriophycideae]
 gb|KIF15213.1| haloacid dehalogenase [Aphanocapsa montana BDHKU210001]
 gb|KIF40125.1| haloacid dehalogenase [Lyngbya confervoides BDU141951]
Length=264

 Score =   103 bits (256),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 97/179 (54%), Gaps = 8/179 (4%)
 Frame = -1

Query  707  EGLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVA  528
            +G+    +L++W  I   I+ E     D  +     VRD WM +DL+ W+  +RFYPGV 
Sbjct  71   QGVEDAAVLDHWPTIVQEILAETKIPSDVAMAAVDGVRDRWMQSDLAGWLSLHRFYPGVI  130

Query  527  DALKFA-SSKVY--IVTTKQSRFAAALLRELAGVTIPPERIYGLGTG-PKTKVLKQLQEM  360
            + L+ A ++ V+  I++TK+ RF   LL + AGV +P E+I G     PKT  LKQLQ  
Sbjct  131  ERLQGAIAAGVFPVIISTKEGRFIQELLAQ-AGVELPREQIIGKEIQQPKTTTLKQLQAE  189

Query  359  PEHQGLTLH---FVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            P           FVEDRL TL  V  +  LN   L+L DWGYNT  ER+ A    R+ +
Sbjct  190  PPIAAAAAQPIWFVEDRLKTLDKVQADSALNDITLFLADWGYNTAAERDRATSDPRVHL  248



>ref|WP_002759691.1| haloacid dehalogenase [Microcystis aeruginosa]
 emb|CCH97232.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9717]
Length=259

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 100/176 (57%), Gaps = 7/176 (4%)
 Frame = -1

Query  704  GLTVDEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVAD  525
            G+   E L NW  I+  ++E     + AL +    +RD W+++DL +W+  ++FY    D
Sbjct  70   GIPDGEALNNWPSIRQNLLEREKIAKKALSNALDGLRDRWIESDLESWLALHQFYQPAID  129

Query  524  ALKF---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGT-GPKTKVLKQ-LQEM  360
             L     +   VYI+TTK+SRF   LL+++A +  P  R+ G     PK   ++Q L ++
Sbjct  130  RLASLLDSDFLVYIITTKESRFVKQLLQKVA-INFPAARLIGKEIKQPKYLTIQQILADL  188

Query  359  PEHQGLTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
            PE     L FVEDRL  L+ V ++ +LN   LYL DWGYNT + R++ A+  RI++
Sbjct  189  PESPA-NLWFVEDRLDALELVQQQADLNDVGLYLADWGYNTAQMRQKVAQDTRIKL  243



>ref|WP_007304566.1| haloacid dehalogenase [Crocosphaera watsonii]
 gb|EAM51930.1| conserved hypothetical protein [Crocosphaera watsonii WH 8501]
Length=263

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 90/171 (53%), Gaps = 5/171 (3%)
 Frame = -1

Query  692  DEILENWMKIKPVIVEEWNENRDALIDLFGKVRDEWMDNDLSTWIGANRFYPGVADALKF  513
            D I  NW  +   IV + N N+  ++     VRD W+  DL  W+  + FYPGV + L  
Sbjct  79   DNIESNWHNVCSEIVTKENLNKQQVMSALDGVRDHWIQTDLDNWLALHEFYPGVLEKLGK  138

Query  512  ---ASSKVYIVTTKQSRFAAALLRELAGVTIPPERIYGLGT-GPKTKVLKQLQEMPEHQG  345
               +S+ +YIVTTK+ RF   LL++   ++ P + I+G     PK   L+Q+ ++ +   
Sbjct  139  LLDSSTLLYIVTTKEGRFVKQLLKK-QNLSFPEDHIFGKEVKQPKFDTLRQILKINQETP  197

Query  344  LTLHFVEDRLATLKNVIKEPELNGWNLYLGDWGYNTPKEREEAAKIARIRI  192
              L F+ED L TL  V  +  L   NL+L DWGYNT K  E   + + I +
Sbjct  198  NNLWFIEDLLKTLNKVKSQEYLTEVNLFLADWGYNTIKSHELVKQDSTINL  248



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3113196583600