BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13857

Length=859
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011029902.1|  PREDICTED: uncharacterized protein LOC105129478    100   5e-21   Populus euphratica
ref|XP_002312099.2|  hypothetical protein POPTR_0008s05620g           99.8    9e-21   Populus trichocarpa [western balsam poplar]
ref|XP_011091522.1|  PREDICTED: uncharacterized protein LOC105171942  96.7    8e-20   Sesamum indicum [beniseed]
ref|XP_010264758.1|  PREDICTED: uncharacterized protein LOC104602674  97.1    1e-19   Nelumbo nucifera [Indian lotus]
ref|XP_002283687.1|  PREDICTED: uncharacterized protein LOC100251328  95.1    3e-19   Vitis vinifera
gb|KDO69311.1|  hypothetical protein CISIN_1g021888mg                 95.1    3e-19   Citrus sinensis [apfelsine]
ref|XP_006435534.1|  hypothetical protein CICLE_v10032209mg           95.1    3e-19   Citrus clementina [clementine]
emb|CBI31683.3|  unnamed protein product                              94.7    4e-19   Vitis vinifera
gb|KHG26784.1|  Cruciferin BnC2                                       94.7    5e-19   Gossypium arboreum [tree cotton]
ref|XP_012089216.1|  PREDICTED: uncharacterized protein LOC105647...  90.9    9e-18   Jatropha curcas
ref|XP_010256928.1|  PREDICTED: uncharacterized protein LOC104597192  90.9    1e-17   Nelumbo nucifera [Indian lotus]
gb|KJB76091.1|  hypothetical protein B456_012G070400                  90.5    1e-17   Gossypium raimondii
ref|XP_002530865.1|  conserved hypothetical protein                   90.1    2e-17   Ricinus communis
ref|XP_008371702.1|  PREDICTED: uncharacterized protein LOC103435083  89.4    2e-17   Malus domestica [apple tree]
ref|XP_009345484.1|  PREDICTED: uncharacterized protein LOC103937278  89.4    3e-17   
ref|XP_010111132.1|  hypothetical protein L484_010745                 89.4    3e-17   Morus notabilis
ref|XP_008370628.1|  PREDICTED: uncharacterized protein LOC103434094  89.4    3e-17   
ref|XP_008233625.1|  PREDICTED: uncharacterized protein LOC103332654  89.4    3e-17   Prunus mume [ume]
ref|XP_007218741.1|  hypothetical protein PRUPE_ppa009184mg           89.0    3e-17   Prunus persica
ref|XP_008458875.1|  PREDICTED: uncharacterized protein LOC103498149  85.9    4e-16   Cucumis melo [Oriental melon]
ref|XP_007009334.1|  Uncharacterized protein isoform 2                84.7    6e-16   
ref|XP_004307513.1|  PREDICTED: uncharacterized protein LOC101311801  85.1    7e-16   Fragaria vesca subsp. vesca
ref|XP_007009333.1|  Uncharacterized protein isoform 1                85.1    1e-15   
ref|XP_009357728.1|  PREDICTED: uncharacterized protein LOC103948423  84.7    1e-15   Pyrus x bretschneideri [bai li]
ref|XP_004142760.2|  PREDICTED: uncharacterized protein LOC101214727  84.3    2e-15   Cucumis sativus [cucumbers]
ref|XP_011027197.1|  PREDICTED: uncharacterized protein LOC105127551  84.0    2e-15   Populus euphratica
emb|CDP00094.1|  unnamed protein product                              82.8    3e-15   Coffea canephora [robusta coffee]
gb|KHN47258.1|  hypothetical protein glysoja_035049                   82.8    4e-15   Glycine soja [wild soybean]
ref|XP_003518643.1|  PREDICTED: uncharacterized protein LOC100780208  82.8    5e-15   Glycine max [soybeans]
gb|ACU19182.1|  unknown                                               82.8    5e-15   Glycine max [soybeans]
ref|XP_010030963.1|  PREDICTED: uncharacterized protein LOC104420886  82.0    9e-15   Eucalyptus grandis [rose gum]
gb|KCW50202.1|  hypothetical protein EUGRSUZ_J00012                   82.0    9e-15   Eucalyptus grandis [rose gum]
ref|XP_008810607.1|  PREDICTED: uncharacterized protein LOC103721987  82.4    1e-14   
gb|KHG30352.1|  putative yyaP                                         81.6    1e-14   Gossypium arboreum [tree cotton]
gb|KJB73924.1|  hypothetical protein B456_011G261400                  81.6    1e-14   Gossypium raimondii
gb|EYU33214.1|  hypothetical protein MIMGU_mgv1a010457mg              81.3    2e-14   Erythranthe guttata [common monkey flower]
ref|XP_010690601.1|  PREDICTED: uncharacterized protein LOC104904106  80.9    2e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002315221.2|  hypothetical protein POPTR_0010s21120g           80.1    5e-14   
ref|XP_009399868.1|  PREDICTED: uncharacterized protein LOC103984...  79.3    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399867.1|  PREDICTED: uncharacterized protein LOC103984...  79.7    1e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003552704.1|  PREDICTED: uncharacterized protein LOC100794240  79.0    1e-13   Glycine max [soybeans]
ref|XP_007139207.1|  hypothetical protein PHAVU_008G010300g           77.8    3e-13   Phaseolus vulgaris [French bean]
ref|XP_008372765.1|  PREDICTED: uncharacterized protein LOC103436122  74.3    9e-13   
ref|XP_010937620.1|  PREDICTED: uncharacterized protein LOC105056936  76.6    1e-12   Elaeis guineensis
ref|XP_007009339.1|  Uncharacterized protein TCM_042766               73.6    1e-12   
ref|XP_009419933.1|  PREDICTED: uncharacterized protein LOC103999...  76.3    2e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009419931.1|  PREDICTED: uncharacterized protein LOC103999...  76.3    2e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006846187.1|  PREDICTED: uncharacterized protein LOC18436099   70.9    9e-11   Amborella trichopoda
ref|XP_003565173.1|  PREDICTED: uncharacterized protein LOC100838977  70.9    1e-10   Brachypodium distachyon [annual false brome]
ref|XP_003624426.1|  hypothetical protein MTR_7g083080                70.9    1e-10   Medicago truncatula
gb|EAZ15005.1|  hypothetical protein OsJ_04943                        68.2    5e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004971435.1|  PREDICTED: uncharacterized protein LOC101770186  68.6    7e-10   Setaria italica
ref|NP_001045549.1|  Os01g0973600                                     68.6    9e-10   
ref|XP_010554604.1|  PREDICTED: uncharacterized protein LOC104824...  67.8    1e-09   Tarenaya hassleriana [spider flower]
gb|EAY77418.1|  hypothetical protein OsI_05409                        67.8    1e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_010554603.1|  PREDICTED: uncharacterized protein LOC104824...  67.8    2e-09   Tarenaya hassleriana [spider flower]
ref|NP_001147221.1|  plant-specific domain TIGR01615 family protein   65.5    1e-08   Zea mays [maize]
ref|XP_006645399.1|  PREDICTED: uncharacterized protein LOC102705965  64.7    2e-08   Oryza brachyantha
dbj|BAK00401.1|  predicted protein                                    63.2    5e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004492986.1|  PREDICTED: uncharacterized protein LOC101498821  62.4    1e-07   Cicer arietinum [garbanzo]
gb|KFK36851.1|  hypothetical protein AALP_AA4G180000                  61.6    2e-07   Arabis alpina [alpine rockcress]
emb|CDM87136.1|  unnamed protein product                              61.2    2e-07   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006411191.1|  hypothetical protein EUTSA_v10017011mg           60.5    4e-07   Eutrema salsugineum [saltwater cress]
emb|CDY07644.1|  BnaA03g18670D                                        59.7    6e-07   Brassica napus [oilseed rape]
emb|CDY24955.1|  BnaC03g22170D                                        59.7    6e-07   Brassica napus [oilseed rape]
ref|XP_009133373.1|  PREDICTED: uncharacterized protein LOC103857873  59.3    9e-07   Brassica rapa
ref|XP_010534499.1|  PREDICTED: uncharacterized protein LOC104810030  58.9    1e-06   Tarenaya hassleriana [spider flower]
ref|XP_010505645.1|  PREDICTED: uncharacterized protein LOC104782419  58.9    1e-06   Camelina sativa [gold-of-pleasure]
gb|EMS45386.1|  hypothetical protein TRIUR3_11720                     58.5    2e-06   Triticum urartu
gb|EMT10549.1|  hypothetical protein F775_07892                       57.8    3e-06   
ref|XP_006294666.1|  hypothetical protein CARUB_v10023703mg           57.8    4e-06   Capsella rubella
ref|NP_181495.1|  uncharacterized protein                             57.4    4e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010508996.1|  PREDICTED: uncharacterized protein LOC104785472  57.0    7e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010517315.1|  PREDICTED: uncharacterized protein LOC104792788  56.6    9e-06   Camelina sativa [gold-of-pleasure]
ref|XP_002881668.1|  hypothetical protein ARALYDRAFT_903214           56.2    1e-05   Arabidopsis lyrata subsp. lyrata
ref|XP_009783658.1|  PREDICTED: uncharacterized protein LOC104232213  55.8    1e-05   Nicotiana sylvestris
ref|XP_009622353.1|  PREDICTED: uncharacterized protein LOC104113771  52.8    1e-04   Nicotiana tomentosiformis



>ref|XP_011029902.1| PREDICTED: uncharacterized protein LOC105129478 [Populus euphratica]
Length=305

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYLQAKW S YQRKF+PDN N     +S+H QC  HLKRLQS+LQ  TE E
Sbjct  219  MPLPPWRSLAYLQAKWYSPYQRKFDPDNQNFSSVDSSYHKQCGRHLKRLQSSLQFETEGE  278

Query  669  RILRPVNSD  643
            R+++P+NSD
Sbjct  279  RLMKPINSD  287



>ref|XP_002312099.2| hypothetical protein POPTR_0008s05620g [Populus trichocarpa]
 gb|EEE89466.2| hypothetical protein POPTR_0008s05620g [Populus trichocarpa]
Length=306

 Score = 99.8 bits (247),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYLQAKW S YQR+F PDN N     +S+H QC  HLKRLQS+LQ  TE E
Sbjct  220  MPLPPWRSLAYLQAKWYSPYQRQFGPDNQNFSSVDSSYHKQCGGHLKRLQSSLQFETEGE  279

Query  669  RILRPVNSD  643
            R+++P+NSD
Sbjct  280  RLMKPINSD  288



>ref|XP_011091522.1| PREDICTED: uncharacterized protein LOC105171942 [Sesamum indicum]
Length=302

 Score = 96.7 bits (239),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/69 (62%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRSFAYLQAKW+S YQRKF+PD P+   +F+  H +C  HLKRL S+L    EVE
Sbjct  220  MPLPPWRSFAYLQAKWQSPYQRKFDPDEPSYNTTFSVEHKKCAGHLKRLHSSLLSEIEVE  279

Query  669  RILRPVNSD  643
            R L+P N D
Sbjct  280  RTLKPFNRD  288



>ref|XP_010264758.1| PREDICTED: uncharacterized protein LOC104602674, partial [Nelumbo 
nucifera]
Length=368

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRSFAYLQAKW S YQRK NPD   +     S H QC+ HL+RL+S+LQ   E E
Sbjct  283  MPLPPWRSFAYLQAKWHSAYQRKLNPDEQGIHDRSYSDHKQCIGHLRRLKSSLQSEIEAE  342

Query  669  RILRPVNSD  643
            R+L+P+N+D
Sbjct  343  RLLKPINND  351



>ref|XP_002283687.1| PREDICTED: uncharacterized protein LOC100251328 [Vitis vinifera]
Length=307

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS  YL+AKW+S YQR+FNPD  ++    +S H QC  HLKRLQ  LQ   E E
Sbjct  221  MPLPPWRSLDYLEAKWQSSYQRQFNPDGESIKNGISSDHKQCSEHLKRLQHALQLEVEAE  280

Query  669  RILRPVNSD  643
            R+L+P+NSD
Sbjct  281  RLLKPINSD  289



>gb|KDO69311.1| hypothetical protein CISIN_1g021888mg [Citrus sinensis]
Length=306

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYLQAKW+S +QR FNPD  N+  +++  H QC  HLKRLQS+L    E E
Sbjct  220  MPLPPWRSLAYLQAKWQSPHQRDFNPDEQNITTTYSLDHKQCRGHLKRLQSSLHSEVEAE  279

Query  669  RILRPVNSD  643
            R L P+NSD
Sbjct  280  RFLNPINSD  288



>ref|XP_006435534.1| hypothetical protein CICLE_v10032209mg [Citrus clementina]
 ref|XP_006486486.1| PREDICTED: uncharacterized protein LOC102627296 [Citrus sinensis]
 gb|ESR48774.1| hypothetical protein CICLE_v10032209mg [Citrus clementina]
Length=306

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYLQAKW+S +QR FNPD  N+  +++  H QC  HLKRLQS+L    E E
Sbjct  220  MPLPPWRSLAYLQAKWQSPHQRDFNPDEQNITTTYSLDHKQCRGHLKRLQSSLHSEVEAE  279

Query  669  RILRPVNSD  643
            R L P+NSD
Sbjct  280  RFLNPINSD  288



>emb|CBI31683.3| unnamed protein product [Vitis vinifera]
Length=272

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS  YL+AKW+S YQR+FNPD  ++    +S H QC  HLKRLQ  LQ   E E
Sbjct  186  MPLPPWRSLDYLEAKWQSSYQRQFNPDGESIKNGISSDHKQCSEHLKRLQHALQLEVEAE  245

Query  669  RILRPVNSD  643
            R+L+P+NSD
Sbjct  246  RLLKPINSD  254



>gb|KHG26784.1| Cruciferin BnC2 [Gossypium arboreum]
Length=307

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MP PPWRS AYLQAKW S YQRKF PD  N+  +  S H QC  HL+RLQS+LQ   E E
Sbjct  222  MPFPPWRSLAYLQAKWHSPYQRKFTPDEHNISGNILSAHKQCNGHLRRLQSSLQSELEAE  281

Query  669  RILRPVNSDrprlnlgrrrrPSFLAL  592
            R+L+PVN D  R     RRR SF AL
Sbjct  282  RLLKPVNVDCNRRLKLDRRRQSFKAL  307



>ref|XP_012089216.1| PREDICTED: uncharacterized protein LOC105647655 isoform X1 [Jatropha 
curcas]
 gb|KDP44956.1| hypothetical protein JCGZ_01456 [Jatropha curcas]
Length=305

 Score = 90.9 bits (224),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYLQAKW S YQR   PD  N     +S H QC  HLKRLQS+LQ   E E
Sbjct  219  MPLPPWRSLAYLQAKWHSPYQRHLTPDEQNFGSFNSSDHKQCSGHLKRLQSSLQSEMEEE  278

Query  669  RILRPVNSD  643
            R+L+P+N+D
Sbjct  279  RLLKPMNTD  287



>ref|XP_010256928.1| PREDICTED: uncharacterized protein LOC104597192 [Nelumbo nucifera]
Length=338

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 52/71 (73%), Gaps = 2/71 (3%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNM--IRSFASHHIQCVPHLKRLQSTLQPNTE  676
            MPLPPWRSFAYLQAKW S YQRK NPD  ++    +  S H QC+ HLKRLQS++Q   E
Sbjct  251  MPLPPWRSFAYLQAKWHSAYQRKLNPDERSIPEPETCCSDHKQCMGHLKRLQSSIQSEIE  310

Query  675  VERILRPVNSD  643
             ER+L+P ++D
Sbjct  311  AERLLKPKSND  321



>gb|KJB76091.1| hypothetical protein B456_012G070400 [Gossypium raimondii]
Length=307

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MP PPWRS AYLQAKW S YQRKF+PD  ++  +  S H QC  +L+RLQS+LQ   E E
Sbjct  222  MPFPPWRSLAYLQAKWHSPYQRKFSPDEHDISGNILSAHKQCNGNLRRLQSSLQSELEAE  281

Query  669  RILRPVNSDrprlnlgrrrrPSFLAL  592
            R+L+PVN D  R     RRR SF AL
Sbjct  282  RLLKPVNVDCNRRLKLDRRRQSFKAL  307



>ref|XP_002530865.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31539.1| conserved hypothetical protein [Ricinus communis]
Length=307

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYLQAKW S YQR  +PD  +     +S H QC  HLKRLQS+LQ   E E
Sbjct  221  MPLPPWRSLAYLQAKWHSPYQRHLSPDEQDFSSINSSDHKQCCEHLKRLQSSLQSEMEEE  280

Query  669  RILRPVNSD  643
            R+L+P+N+D
Sbjct  281  RLLKPINTD  289



>ref|XP_008371702.1| PREDICTED: uncharacterized protein LOC103435083 [Malus domestica]
Length=304

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYLQAKW+S YQR+FN +  N+  S+   H +C  HLK LQS LQ   E E
Sbjct  218  MPLPPWRSLAYLQAKWQSPYQRQFNLEEQNVNGSYNFDHKKCSAHLKMLQSLLQSEIEAE  277

Query  669  RILRPVNSD  643
            R+LRP+N+D
Sbjct  278  RLLRPINND  286



>ref|XP_009345484.1| PREDICTED: uncharacterized protein LOC103937278 [Pyrus x bretschneideri]
Length=279

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYLQAKWES YQR+FN D  N+  S+   H QC  HLK LQS LQ   E +
Sbjct  193  MPLPPWRSLAYLQAKWESPYQRQFNIDEQNVNGSYNFDHKQCSAHLKMLQSLLQSEIEAD  252

Query  669  RILRPVNSD  643
            R+L+ +N+D
Sbjct  253  RLLKQINND  261



>ref|XP_010111132.1| hypothetical protein L484_010745 [Morus notabilis]
 gb|EXC30497.1| hypothetical protein L484_010745 [Morus notabilis]
Length=304

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYLQAKW+S YQR+  PD   M R+ +  H QC  HLKRLQS LQ   E E
Sbjct  217  MPLPPWRSLAYLQAKWQSPYQRQLYPDEKGMNRANSFDHKQCNGHLKRLQSLLQAEIETE  276

Query  669  RILRPVNSD  643
            R+L+P+ S+
Sbjct  277  RLLKPIKSE  285



>ref|XP_008370628.1| PREDICTED: uncharacterized protein LOC103434094 [Malus domestica]
Length=304

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYLQAKWES YQR+FN D  N+  S+   H QC  HLK LQS LQ   E +
Sbjct  218  MPLPPWRSLAYLQAKWESPYQRQFNIDEQNVNGSYNFDHKQCSAHLKMLQSLLQSEIEAD  277

Query  669  RILRPVNSD  643
            R+L+ +N+D
Sbjct  278  RLLKQINND  286



>ref|XP_008233625.1| PREDICTED: uncharacterized protein LOC103332654 [Prunus mume]
Length=303

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYLQAKW+S YQR+FN D  N   +++S H QC   LK LQS LQ   E +
Sbjct  217  MPLPPWRSLAYLQAKWQSPYQREFNLDEENANGAYSSDHKQCSGQLKMLQSLLQSEIEAD  276

Query  669  RILRPVNSD  643
            R+L+P+N+D
Sbjct  277  RMLKPINND  285



>ref|XP_007218741.1| hypothetical protein PRUPE_ppa009184mg [Prunus persica]
 gb|EMJ19940.1| hypothetical protein PRUPE_ppa009184mg [Prunus persica]
Length=303

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYLQAKW+S YQR+FN D  N   +++S H QC   LK LQS LQ   E +
Sbjct  217  MPLPPWRSLAYLQAKWQSPYQREFNLDEENANGAYSSDHKQCSGQLKMLQSLLQSEIEAD  276

Query  669  RILRPVNSD  643
            R+L+P+N+D
Sbjct  277  RMLKPINND  285



>ref|XP_008458875.1| PREDICTED: uncharacterized protein LOC103498149 [Cucumis melo]
Length=311

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 48/71 (68%), Gaps = 2/71 (3%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMI--RSFASHHIQCVPHLKRLQSTLQPNTE  676
            MPLPPWRS AYLQAKW+S  QR  +P+    +  +     H QC+ HLKRLQS LQ  TE
Sbjct  223  MPLPPWRSLAYLQAKWQSPCQRMLHPEEQQQLGAKDMLMSHKQCIGHLKRLQSVLQSETE  282

Query  675  VERILRPVNSD  643
             +R LRPVNSD
Sbjct  283  TDRFLRPVNSD  293



>ref|XP_007009334.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY18144.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=253

 Score = 84.7 bits (208),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MP PPWRS AYLQAKW+S YQR+F P   ++  + +S H QC  HLK LQ++LQ   E E
Sbjct  167  MPFPPWRSLAYLQAKWQSPYQRQFTPYEHDINGNVSSDHKQCNGHLKGLQASLQSELEAE  226

Query  669  RILRPVNSD  643
            R+L+P+N D
Sbjct  227  RLLKPINID  235



>ref|XP_004307513.1| PREDICTED: uncharacterized protein LOC101311801 [Fragaria vesca 
subsp. vesca]
Length=303

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYLQAKW+S YQR FN D  N    F+  H QC  HLK LQS LQ   E +
Sbjct  218  MPLPPWRSLAYLQAKWQSPYQRHFNLDEQNGNGVFSFDHKQCSGHLKMLQSLLQSEIEAD  277

Query  669  RILRPVNSD  643
            R+L+P ++D
Sbjct  278  RLLKPKSND  286



>ref|XP_007009333.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY18143.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=316

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MP PPWRS AYLQAKW+S YQR+F P   ++  + +S H QC  HLK LQ++LQ   E E
Sbjct  230  MPFPPWRSLAYLQAKWQSPYQRQFTPYEHDINGNVSSDHKQCNGHLKGLQASLQSELEAE  289

Query  669  RILRPVNSD  643
            R+L+P+N D
Sbjct  290  RLLKPINID  298



>ref|XP_009357728.1| PREDICTED: uncharacterized protein LOC103948423 [Pyrus x bretschneideri]
Length=304

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYLQAKW+S YQR+FN +  N+  S+   H +C  HLK LQS LQ   E E
Sbjct  218  MPLPPWRSLAYLQAKWQSPYQRQFNLEEQNVNGSYNFDHKKCSAHLKMLQSLLQSEIEAE  277

Query  669  RILRPVNSD  643
            R+ RP+++D
Sbjct  278  RLSRPLDND  286



>ref|XP_004142760.2| PREDICTED: uncharacterized protein LOC101214727 [Cucumis sativus]
 gb|KGN51315.1| hypothetical protein Csa_5G517130 [Cucumis sativus]
Length=311

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMI--RSFASHHIQCVPHLKRLQSTLQPNTE  676
            MPLPPWRS AYLQAKW+S  QR  +P+    +  R     H QC+ HLKRLQS LQ   E
Sbjct  223  MPLPPWRSLAYLQAKWQSPCQRMLHPEEQQQLGSRDMLMSHKQCIGHLKRLQSVLQSEIE  282

Query  675  VERILRPVNSD  643
             +R LRPVN D
Sbjct  283  TDRFLRPVNGD  293



>ref|XP_011027197.1| PREDICTED: uncharacterized protein LOC105127551 [Populus euphratica]
Length=306

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYLQAKW S YQR+F+P   N     +S H QC  HLK L S+LQ   E E
Sbjct  220  MPLPPWRSLAYLQAKWHSPYQRQFDPGEQNFSSGDSSDHKQCSGHLKSLPSSLQFEMEGE  279

Query  669  RILRPVNSD  643
            R ++P+ SD
Sbjct  280  RFVKPIKSD  288



>emb|CDP00094.1| unnamed protein product [Coffea canephora]
Length=271

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 48/69 (70%), Gaps = 4/69 (6%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MP PPWRS  YLQAKW+S YQRKF+P+ PN     +  H QC  HL+RLQS L    E+E
Sbjct  189  MPFPPWRSLPYLQAKWQSPYQRKFSPEEPNAYGGSSMEHKQCGGHLRRLQSEL----EIE  244

Query  669  RILRPVNSD  643
            R+L+PV S+
Sbjct  245  RLLKPVKSN  253



>gb|KHN47258.1| hypothetical protein glysoja_035049 [Glycine soja]
Length=271

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYLQAKW+S Y+R  + +  N+  S    H QC  HLKRLQS LQ   E++
Sbjct  185  MPLPPWRSLAYLQAKWQSPYERYTHSEGNNISDSDCFDHKQCCGHLKRLQSCLQSGIEID  244

Query  669  RILRPVNSD  643
            R+L+P NS+
Sbjct  245  RLLKPRNSE  253



>ref|XP_003518643.1| PREDICTED: uncharacterized protein LOC100780208 [Glycine max]
Length=308

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYLQAKW+S Y+R  + +  N+  S    H QC  HLKRLQS LQ   E++
Sbjct  222  MPLPPWRSLAYLQAKWQSPYERYTHSEGNNISDSDCFDHKQCCGHLKRLQSCLQSGIEID  281

Query  669  RILRPVNSD  643
            R+L+P NS+
Sbjct  282  RLLKPRNSE  290



>gb|ACU19182.1| unknown [Glycine max]
Length=308

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYLQAKW+S Y+R  + +  N+  S    H QC  HLKRLQS LQ   E++
Sbjct  222  MPLPPWRSLAYLQAKWQSPYERYTHSEGNNISDSDCFDHKQCCGHLKRLQSCLQSGIEID  281

Query  669  RILRPVNSD  643
            R+L+P NS+
Sbjct  282  RLLKPRNSE  290



>ref|XP_010030963.1| PREDICTED: uncharacterized protein LOC104420886 [Eucalyptus grandis]
 gb|KCW50203.1| hypothetical protein EUGRSUZ_J00012 [Eucalyptus grandis]
Length=313

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRSF YLQAKW S YQR+ + +  + +R  +S H QC  HLKRLQS L+   E +
Sbjct  222  MPLPPWRSFKYLQAKWYSPYQRQPDAEKQSGVRRSSSEHEQCSGHLKRLQSALRSEMEAD  281

Query  669  RILRPVNSD  643
            ++L+P N D
Sbjct  282  QLLKPKNGD  290



>gb|KCW50202.1| hypothetical protein EUGRSUZ_J00012 [Eucalyptus grandis]
Length=314

 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRSF YLQAKW S YQR+ + +  + +R  +S H QC  HLKRLQS L+   E +
Sbjct  223  MPLPPWRSFKYLQAKWYSPYQRQPDAEKQSGVRRSSSEHEQCSGHLKRLQSALRSEMEAD  282

Query  669  RILRPVNSD  643
            ++L+P N D
Sbjct  283  QLLKPKNGD  291



>ref|XP_008810607.1| PREDICTED: uncharacterized protein LOC103721987 [Phoenix dactylifera]
 ref|XP_008810609.1| PREDICTED: uncharacterized protein LOC103721987 [Phoenix dactylifera]
 ref|XP_008810610.1| PREDICTED: uncharacterized protein LOC103721987 [Phoenix dactylifera]
 ref|XP_008810611.1| PREDICTED: uncharacterized protein LOC103721987 [Phoenix dactylifera]
Length=360

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS +YLQAKW S Y+RK N D  N + S +  H QC+ HLKRL+++LQ   E E
Sbjct  276  MPLPPWRSLSYLQAKWYSKYERKHNYDEQNYLGS-SYGHSQCIGHLKRLKTSLQSEIETE  334

Query  669  RILRPVNSD  643
            R+ +P+ +D
Sbjct  335  RLFKPIIND  343



>gb|KHG30352.1| putative yyaP [Gossypium arboreum]
Length=310

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MP PPWRS AYLQAKW S YQR+F P   ++    +S H QC  HL+RLQ +LQ   E E
Sbjct  224  MPFPPWRSLAYLQAKWYSPYQRQFAPLEHDISSDSSSCHKQCKGHLRRLQPSLQSELEAE  283

Query  669  RILRPVNSD  643
            R+L+P+N D
Sbjct  284  RLLKPINID  292



>gb|KJB73924.1| hypothetical protein B456_011G261400 [Gossypium raimondii]
Length=310

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 48/69 (70%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MP PPWRS AYLQAKW S YQR+F P   ++  + +S H QC  HL+RLQ +LQ   E E
Sbjct  224  MPFPPWRSLAYLQAKWYSPYQRQFAPLEHDISGNSSSCHKQCKGHLRRLQPSLQSELEAE  283

Query  669  RILRPVNSD  643
            R+L+P+N D
Sbjct  284  RLLKPINID  292



>gb|EYU33214.1| hypothetical protein MIMGU_mgv1a010457mg [Erythranthe guttata]
 gb|EYU33215.1| hypothetical protein MIMGU_mgv1a010457mg [Erythranthe guttata]
Length=311

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNP--DNPNMIRSFASHHIQCVPHLKRLQSTLQPNTE  676
            MPLPPWRSFAYLQAKW+S YQRKF P   N N   +    H  C  HL+RL S+L    E
Sbjct  227  MPLPPWRSFAYLQAKWQSPYQRKFYPYEKNSNRNTTIPLEHKNCAGHLRRLHSSLLSEIE  286

Query  675  VERILRPVN  649
            +ER LRP N
Sbjct  287  IERTLRPFN  295



>ref|XP_010690601.1| PREDICTED: uncharacterized protein LOC104904106 [Beta vulgaris 
subsp. vulgaris]
Length=310

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYLQAKW S YQR+  P+  N+  S  + H QC  HL++LQS+LQ     E
Sbjct  224  MPLPPWRSLAYLQAKWLSPYQRRIIPEEQNINSSSVTGHKQCNDHLRQLQSSLQSEIGTE  283

Query  669  RILRPVNSD  643
            R+L+P+  D
Sbjct  284  RLLKPIKID  292



>ref|XP_002315221.2| hypothetical protein POPTR_0010s21120g [Populus trichocarpa]
 gb|EEF01392.2| hypothetical protein POPTR_0010s21120g [Populus trichocarpa]
Length=306

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYLQAKW S YQR+F+P         +S H QC  HLK L S+LQ   E E
Sbjct  220  MPLPPWRSLAYLQAKWHSPYQRQFDPGEQTFSSIDSSDHKQCSGHLKSLPSSLQFEMEGE  279

Query  669  RILRPVNSD  643
            R ++P+ SD
Sbjct  280  RFVKPIKSD  288



>ref|XP_009399868.1| PREDICTED: uncharacterized protein LOC103984152 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=322

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 50/69 (72%), Gaps = 1/69 (1%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYLQAKW S Y+RK N D  +  ++ +S H QCV HL+RL+++L+   E E
Sbjct  238  MPLPPWRSLAYLQAKWCSKYERKHNVDKKHQ-QNCSSDHRQCVGHLQRLKASLELEIESE  296

Query  669  RILRPVNSD  643
            R+L+P  +D
Sbjct  297  RLLKPATND  305



>ref|XP_009399867.1| PREDICTED: uncharacterized protein LOC103984152 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=355

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 50/69 (72%), Gaps = 1/69 (1%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYLQAKW S Y+RK N D  +  ++ +S H QCV HL+RL+++L+   E E
Sbjct  271  MPLPPWRSLAYLQAKWCSKYERKHNVDKKHQ-QNCSSDHRQCVGHLQRLKASLELEIESE  329

Query  669  RILRPVNSD  643
            R+L+P  +D
Sbjct  330  RLLKPATND  338



>ref|XP_003552704.1| PREDICTED: uncharacterized protein LOC100794240 [Glycine max]
Length=308

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYLQAKW+S Y+R  + +   +  S    H QC  HLKRLQS LQ   E+E
Sbjct  222  MPLPPWRSLAYLQAKWQSPYERYTHSEGNIVSSSDCFDHKQCCGHLKRLQSCLQSGIEIE  281

Query  669  RILRPVN  649
            R+L+P N
Sbjct  282  RMLKPRN  288



>ref|XP_007139207.1| hypothetical protein PHAVU_008G010300g [Phaseolus vulgaris]
 gb|ESW11201.1| hypothetical protein PHAVU_008G010300g [Phaseolus vulgaris]
Length=311

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYLQAKW+S  +R  + +  N+       H QC  HLKRL+S LQ   E+E
Sbjct  225  MPLPPWRSLAYLQAKWQSPCERYMHSEGSNIGHGNCFDHKQCRGHLKRLKSCLQSGMEIE  284

Query  669  RILRPVNSD  643
            R+L+P N +
Sbjct  285  RMLKPRNGE  293



>ref|XP_008372765.1| PREDICTED: uncharacterized protein LOC103436122 [Malus domestica]
Length=169

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 34/61 (56%), Positives = 42/61 (69%), Gaps = 0/61 (0%)
 Frame = -2

Query  846  PLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVER  667
            PLPPWRS AYLQAKW+S YQR+FN +  N+  S+   H +C  HLK LQS LQ   E +R
Sbjct  109  PLPPWRSLAYLQAKWQSPYQRQFNLEEQNVNGSYNFDHKKCSAHLKMLQSLLQSEIEADR  168

Query  666  I  664
            +
Sbjct  169  L  169



>ref|XP_010937620.1| PREDICTED: uncharacterized protein LOC105056936 [Elaeis guineensis]
Length=360

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS +YLQAKW+S Y+R+ N    N + S   H  QC+ HLKRL+++LQ   E E
Sbjct  276  MPLPPWRSLSYLQAKWDSKYEREHNFYEQNHLGSSYGHR-QCIGHLKRLKASLQAEIETE  334

Query  669  RILRPV  652
            R+ +P+
Sbjct  335  RLFKPI  340



>ref|XP_007009339.1| Uncharacterized protein TCM_042766 [Theobroma cacao]
 gb|EOY18149.1| Uncharacterized protein TCM_042766 [Theobroma cacao]
Length=158

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MP PPWRS AYLQAKW+S YQR+  P+  ++  + +S + QC  HL+ L S+ Q   E E
Sbjct  74   MPFPPWRSLAYLQAKWQSPYQRQSTPNEHDLEDNVSSDNKQCNGHLRGLHSSPQSELEAE  133

Query  669  RILRPVNSD  643
            R+L+P+N D
Sbjct  134  RLLKPMNID  142



>ref|XP_009419933.1| PREDICTED: uncharacterized protein LOC103999799 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=346

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYLQAKW S Y+R+ N    N      S H QC+ HL+RL+++L+   E E
Sbjct  262  MPLPPWRSLAYLQAKWYSKYEREHNVHTRNK-HIVGSDHRQCIGHLQRLKASLKLEIESE  320

Query  669  RILRPVNSD  643
            R+L+P+ +D
Sbjct  321  RLLKPITND  329



>ref|XP_009419931.1| PREDICTED: uncharacterized protein LOC103999799 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=348

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 47/69 (68%), Gaps = 1/69 (1%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYLQAKW S Y+R+ N    N      S H QC+ HL+RL+++L+   E E
Sbjct  264  MPLPPWRSLAYLQAKWYSKYEREHNVHTRNK-HIVGSDHRQCIGHLQRLKASLKLEIESE  322

Query  669  RILRPVNSD  643
            R+L+P+ +D
Sbjct  323  RLLKPITND  331



>ref|XP_006846187.1| PREDICTED: uncharacterized protein LOC18436099 [Amborella trichopoda]
 gb|ERN07862.1| hypothetical protein AMTR_s00012p00212610 [Amborella trichopoda]
Length=308

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYLQAKW S Y+RK +    N        H QC+   +RL+  LQ   E E
Sbjct  224  MPLPPWRSLAYLQAKWHSSYERKLDFMERNN-HDLCQDHKQCIGQFRRLKVALQCEIEAE  282

Query  669  RILRPVNSD  643
            R+L+P+ +D
Sbjct  283  RLLKPIMND  291



>ref|XP_003565173.1| PREDICTED: uncharacterized protein LOC100838977 [Brachypodium 
distachyon]
Length=344

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS +YLQAKW S Y+RK+     N  +  A  H  CV HLKRL+S+LQ   +  
Sbjct  259  MPLPPWRSLSYLQAKWHSKYERKYLHSEQN-FQGTAPDHALCVGHLKRLKSSLQSELDTG  317

Query  669  RIL-RPVNSD  643
            R+L  P+ +D
Sbjct  318  RLLMMPIKTD  327



>ref|XP_003624426.1| hypothetical protein MTR_7g083080 [Medicago truncatula]
 gb|AES80644.1| plant-specific domain TIGR01615 family protein [Medicago truncatula]
Length=326

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 44/71 (62%), Gaps = 6/71 (8%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQR----KFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPN  682
            MPLPPWRS AYLQAKW S Y+R      N D  N  + F   H QC  HLK+LQS LQ  
Sbjct  238  MPLPPWRSLAYLQAKWLSPYERITHSDSNIDFGNDDKCF--DHKQCHGHLKKLQSCLQTG  295

Query  681  TEVERILRPVN  649
             EVER+L+  N
Sbjct  296  MEVERMLKARN  306



>gb|EAZ15005.1| hypothetical protein OsJ_04943 [Oryza sativa Japonica Group]
Length=273

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 44/70 (63%), Gaps = 2/70 (3%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS  YLQAKW S Y+R  +        S AS H  C+ HLKRL+S+LQ   + E
Sbjct  187  MPLPPWRSLPYLQAKWHSKYER-IDLHIEQDFHSTASDHALCIGHLKRLKSSLQSELDTE  245

Query  669  RIL-RPVNSD  643
            R+L  P+ +D
Sbjct  246  RLLMMPIKTD  255



>ref|XP_004971435.1| PREDICTED: uncharacterized protein LOC101770186 [Setaria italica]
Length=339

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 45/70 (64%), Gaps = 2/70 (3%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS  YLQ+KW+S Y+RK +        S AS H  C+ HLKRL+++LQ   E  
Sbjct  252  MPLPPWRSLPYLQSKWQSKYERK-DLITEQGFHSTASDHALCIGHLKRLKTSLQSELETG  310

Query  669  RIL-RPVNSD  643
            R+L  P+ +D
Sbjct  311  RLLMMPIKAD  320



>ref|NP_001045549.1| Os01g0973600 [Oryza sativa Japonica Group]
 dbj|BAD87423.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD87833.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF07463.1| Os01g0973600 [Oryza sativa Japonica Group]
Length=337

 Score = 68.6 bits (166),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 44/70 (63%), Gaps = 2/70 (3%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS  YLQAKW S Y+R  +        S AS H  C+ HLKRL+S+LQ   + E
Sbjct  251  MPLPPWRSLPYLQAKWHSKYER-IDLHIEQDFHSTASDHALCIGHLKRLKSSLQSELDTE  309

Query  669  RIL-RPVNSD  643
            R+L  P+ +D
Sbjct  310  RLLMMPIKTD  319



>ref|XP_010554604.1| PREDICTED: uncharacterized protein LOC104824273 isoform X2 [Tarenaya 
hassleriana]
Length=316

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 41/71 (58%), Gaps = 5/71 (7%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNP---DNPNMIRSFASHHIQCVPHLKRLQSTLQPNT  679
            MPLPPWRS  YLQ+KW S Y+R   P   D P M       H QC  +LKRLQ  LQ   
Sbjct  225  MPLPPWRSLHYLQSKWHSPYKRHLGPIDLDGPEMFSE--GLHKQCAENLKRLQLALQSER  282

Query  678  EVERILRPVNS  646
            E ER+ +P+ S
Sbjct  283  EGERLAKPIMS  293



>gb|EAY77418.1| hypothetical protein OsI_05409 [Oryza sativa Indica Group]
Length=337

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 44/70 (63%), Gaps = 2/70 (3%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS  YLQAKW S Y+R  +        S AS H  C+ HLKRL+S+LQ   + E
Sbjct  251  MPLPPWRSLPYLQAKWHSKYER-IDLHIEQDFHSTASDHALCIGHLKRLKSSLQSELDTE  309

Query  669  RIL-RPVNSD  643
            R+L  P+ +D
Sbjct  310  RLLMMPIKND  319



>ref|XP_010554603.1| PREDICTED: uncharacterized protein LOC104824273 isoform X1 [Tarenaya 
hassleriana]
Length=328

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 41/71 (58%), Gaps = 5/71 (7%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNP---DNPNMIRSFASHHIQCVPHLKRLQSTLQPNT  679
            MPLPPWRS  YLQ+KW S Y+R   P   D P M       H QC  +LKRLQ  LQ   
Sbjct  237  MPLPPWRSLHYLQSKWHSPYKRHLGPIDLDGPEMFSE--GLHKQCAENLKRLQLALQSER  294

Query  678  EVERILRPVNS  646
            E ER+ +P+ S
Sbjct  295  EGERLAKPIMS  305



>ref|NP_001147221.1| plant-specific domain TIGR01615 family protein [Zea mays]
 gb|ACF83884.1| unknown [Zea mays]
 gb|ACG26169.1| plant-specific domain TIGR01615 family protein [Zea mays]
 tpg|DAA55663.1| TPA: Plant-specific domain TIGR01615 family [Zea mays]
Length=344

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 41/63 (65%), Gaps = 1/63 (2%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS  YLQAKW+S Y+RK +       +S +S H  C+ HLKRL+++LQ   E  
Sbjct  257  MPLPPWRSLPYLQAKWQSKYERK-DSITEGGFQSTSSDHALCIGHLKRLKTSLQLELETA  315

Query  669  RIL  661
             +L
Sbjct  316  GLL  318



>ref|XP_006645399.1| PREDICTED: uncharacterized protein LOC102705965 [Oryza brachyantha]
Length=336

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 41/63 (65%), Gaps = 1/63 (2%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS  YL+AKW S Y+R  +      + S +S H  C+ HLKRL+++LQ   + E
Sbjct  251  MPLPPWRSLPYLEAKWHSKYER-IDLHIGQDLHSTSSDHALCIGHLKRLKASLQSELDTE  309

Query  669  RIL  661
            R+L
Sbjct  310  RLL  312



>dbj|BAK00401.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=349

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 44/69 (64%), Gaps = 2/69 (3%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRK-FNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEV  673
            MPLPPWRS +YLQ KW S Y+R+  + +  +  +  +  H+ C  HLKRL+S+L+   E 
Sbjct  259  MPLPPWRSLSYLQMKWHSKYERRGLHSEQQDFFQGASPSHVLCFGHLKRLKSSLRLELET  318

Query  672  -ERILRPVN  649
              R++ PVN
Sbjct  319  ARRLMMPVN  327



>ref|XP_004492986.1| PREDICTED: uncharacterized protein LOC101498821 [Cicer arietinum]
Length=326

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 40/68 (59%), Gaps = 1/68 (1%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPD-NPNMIRSFASHHIQCVPHLKRLQSTLQPNTEV  673
            MP PPWRS  YL AKW S ++R  + D N +        H QC  HLK+LQ+ LQ   EV
Sbjct  239  MPFPPWRSLTYLHAKWLSPFERITHSDGNISTENGDDFDHKQCRGHLKKLQTCLQSAMEV  298

Query  672  ERILRPVN  649
            ER+L+  N
Sbjct  299  ERMLKARN  306



>gb|KFK36851.1| hypothetical protein AALP_AA4G180000 [Arabis alpina]
Length=303

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 38/65 (58%), Gaps = 1/65 (2%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFA-SHHIQCVPHLKRLQSTLQPNTEV  673
            MPLPPWRS  YLQ+KW S Y+R   P N      F+   H QC  +LKRLQ  LQ   E 
Sbjct  217  MPLPPWRSLNYLQSKWHSAYKRHLVPINHEGPGMFSPGLHKQCAENLKRLQFALQAEQEA  276

Query  672  ERILR  658
            ER ++
Sbjct  277  ERSVK  281



>emb|CDM87136.1| unnamed protein product [Triticum aestivum]
Length=349

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 37/63 (59%), Gaps = 0/63 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS +YLQ KW S Y+RK         +  +  H  C  HLKRL+S+L+   E  
Sbjct  261  MPLPPWRSLSYLQMKWHSKYERKGLHSEQQEFQGASPSHALCFGHLKRLKSSLRLELETG  320

Query  669  RIL  661
            R+L
Sbjct  321  RLL  323



>ref|XP_006411191.1| hypothetical protein EUTSA_v10017011mg [Eutrema salsugineum]
 gb|ESQ52644.1| hypothetical protein EUTSA_v10017011mg [Eutrema salsugineum]
Length=296

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 38/65 (58%), Gaps = 1/65 (2%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFA-SHHIQCVPHLKRLQSTLQPNTEV  673
            MPLPPWRS  YLQ+KW S ++R   P +   +  F+   H QC  +LKRLQ  L    E 
Sbjct  219  MPLPPWRSLNYLQSKWHSPHKRHLGPISQEGLGMFSPGLHRQCAENLKRLQFALHAEQEA  278

Query  672  ERILR  658
            ER +R
Sbjct  279  ERFMR  283



>emb|CDY07644.1| BnaA03g18670D [Brassica napus]
Length=301

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 38/69 (55%), Gaps = 1/69 (1%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFA-SHHIQCVPHLKRLQSTLQPNTEV  673
            MPLPPWRS  YLQ+KW S Y+R   P N      F+   H QC  +LKRLQ  L    E 
Sbjct  223  MPLPPWRSLNYLQSKWLSPYKRHLGPINQEGPGMFSPGLHRQCAENLKRLQFALHAEQEA  282

Query  672  ERILRPVNS  646
            ER ++   S
Sbjct  283  ERFVKKKKS  291



>emb|CDY24955.1| BnaC03g22170D [Brassica napus]
Length=302

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 37/65 (57%), Gaps = 1/65 (2%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFA-SHHIQCVPHLKRLQSTLQPNTEV  673
            MPLPPWRS  YLQ+KW S Y+R   P N      F+   H QC  +LKRLQ  L    E 
Sbjct  223  MPLPPWRSLNYLQSKWLSPYKRHLGPINQEGPGMFSPGLHKQCAENLKRLQFALHAEQEA  282

Query  672  ERILR  658
            ER ++
Sbjct  283  ERFVK  287



>ref|XP_009133373.1| PREDICTED: uncharacterized protein LOC103857873 [Brassica rapa]
Length=302

 Score = 59.3 bits (142),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 37/65 (57%), Gaps = 1/65 (2%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFA-SHHIQCVPHLKRLQSTLQPNTEV  673
            MPLPPWRS  YLQ+KW S Y+R   P N      F+   H QC  +LKRLQ  L    E 
Sbjct  223  MPLPPWRSLNYLQSKWLSPYKRHLGPINQEGPGMFSPGLHRQCAENLKRLQFALHTEQEA  282

Query  672  ERILR  658
            ER ++
Sbjct  283  ERFVK  287



>ref|XP_010534499.1| PREDICTED: uncharacterized protein LOC104810030 [Tarenaya hassleriana]
Length=310

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 39/70 (56%), Gaps = 6/70 (9%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNP----DNPNMIRSFASHHIQCVPHLKRLQSTLQPN  682
            MPLPPWRS  YLQ+KW S ++R   P    D P M       H QC  +LKR+Q  L+  
Sbjct  222  MPLPPWRSLRYLQSKWHSPHKRHLGPPIHMDGPEMFSE--GFHRQCAENLKRVQLVLRAE  279

Query  681  TEVERILRPV  652
             E ER ++ +
Sbjct  280  KEGERCVKGM  289



>ref|XP_010505645.1| PREDICTED: uncharacterized protein LOC104782419 [Camelina sativa]
Length=304

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 38/67 (57%), Gaps = 5/67 (7%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNP---DNPNMIRSFASHHIQCVPHLKRLQSTLQPNT  679
            MPLPPWRS  YL++KW S ++R   P     P M       H QC  +LKRLQ TLQ   
Sbjct  218  MPLPPWRSLNYLRSKWHSPHKRHLGPIDQQGPGMF--LPGMHRQCAENLKRLQFTLQVEQ  275

Query  678  EVERILR  658
            E ER ++
Sbjct  276  ESERFMK  282



>gb|EMS45386.1| hypothetical protein TRIUR3_11720 [Triticum urartu]
Length=286

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS +YLQ KW S Y+RK         +  +     C  HLKRL+S+L+   E  
Sbjct  198  MPLPPWRSLSYLQMKWHSKYERKGLQSEQQEFQGASPSRTLCFGHLKRLKSSLRLELETG  257

Query  669  RIL  661
            R+L
Sbjct  258  RLL  260



>gb|EMT10549.1| hypothetical protein F775_07892 [Aegilops tauschii]
Length=281

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 36/63 (57%), Gaps = 0/63 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS +YLQ KW S Y+RK         +  +     C  HLKRL+S+L+   E  
Sbjct  193  MPLPPWRSLSYLQMKWHSKYERKGLHSEQQEFQGASPSRALCFGHLKRLKSSLRLELETG  252

Query  669  RIL  661
            R+L
Sbjct  253  RLL  255



>ref|XP_006294666.1| hypothetical protein CARUB_v10023703mg [Capsella rubella]
 gb|EOA27564.1| hypothetical protein CARUB_v10023703mg [Capsella rubella]
Length=306

 Score = 57.8 bits (138),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 37/67 (55%), Gaps = 5/67 (7%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNP---DNPNMIRSFASHHIQCVPHLKRLQSTLQPNT  679
            MPLPPWRS  YL++KW S ++R   P     P M       H QC  +LKRLQ  LQ   
Sbjct  220  MPLPPWRSLNYLRSKWHSPHKRHLGPIDQQGPGMF--LPGMHGQCAENLKRLQFALQVEQ  277

Query  678  EVERILR  658
            E ER ++
Sbjct  278  ESERFMK  284



>ref|NP_181495.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAK17153.1|AF325085_1 unknown protein [Arabidopsis thaliana]
 gb|AAB97120.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14920.1| unknown protein [Arabidopsis thaliana]
 gb|ABD59043.1| At2g39650 [Arabidopsis thaliana]
 gb|AEC09702.1| uncharacterized protein AT2G39650 [Arabidopsis thaliana]
Length=291

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 38/65 (58%), Gaps = 1/65 (2%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFA-SHHIQCVPHLKRLQSTLQPNTEV  673
            MPLPPWRS  YL++KW S ++R   P +      F+   H QC  +LKRLQ  LQ   E 
Sbjct  218  MPLPPWRSLNYLRSKWHSPHKRHLGPIDQQGPGMFSPGLHGQCAENLKRLQFALQVEQEA  277

Query  672  ERILR  658
            ER ++
Sbjct  278  ERFMK  282



>ref|XP_010508996.1| PREDICTED: uncharacterized protein LOC104785472 [Camelina sativa]
Length=303

 Score = 57.0 bits (136),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 37/67 (55%), Gaps = 5/67 (7%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNP---DNPNMIRSFASHHIQCVPHLKRLQSTLQPNT  679
            MPLPPWRS  YL++KW S ++R   P     P M       H QC  +LKRLQ  LQ   
Sbjct  217  MPLPPWRSLNYLRSKWHSPHKRHLGPIDQQGPGMF--LPGMHRQCAENLKRLQFALQVEQ  274

Query  678  EVERILR  658
            E ER ++
Sbjct  275  ESERFMK  281



>ref|XP_010517315.1| PREDICTED: uncharacterized protein LOC104792788 [Camelina sativa]
Length=303

 Score = 56.6 bits (135),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 37/67 (55%), Gaps = 5/67 (7%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNP---DNPNMIRSFASHHIQCVPHLKRLQSTLQPNT  679
            MPLPPWRS  YL++KW S ++R   P     P M       H QC  +LKRLQ  LQ   
Sbjct  217  MPLPPWRSLNYLRSKWHSPHKRHLGPIDQQGPGMF--LPGMHRQCAENLKRLQFALQVEQ  274

Query  678  EVERILR  658
            E ER ++
Sbjct  275  ESERYMK  281



>ref|XP_002881668.1| hypothetical protein ARALYDRAFT_903214 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57927.1| hypothetical protein ARALYDRAFT_903214 [Arabidopsis lyrata subsp. 
lyrata]
Length=305

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 38/65 (58%), Gaps = 1/65 (2%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFA-SHHIQCVPHLKRLQSTLQPNTEV  673
            MPLPPWRS  YL++KW S ++R   P +      F+   H QC  +LKRLQ  LQ   E 
Sbjct  219  MPLPPWRSLNYLRSKWHSPHKRHLGPIDHQGPGMFSPGLHGQCAENLKRLQFALQVEQES  278

Query  672  ERILR  658
            ER ++
Sbjct  279  ERFMK  283



>ref|XP_009783658.1| PREDICTED: uncharacterized protein LOC104232213 [Nicotiana sylvestris]
Length=321

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 39/67 (58%), Gaps = 0/67 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYL++KWES  QR  N    + I    S H  C   L R++S+++  ++ +
Sbjct  235  MPLPPWRSLAYLESKWESSSQRVSNFQVQSNIGHTKSSHQHCTELLWRIKSSIESESKAK  294

Query  669  RILRPVN  649
              L P N
Sbjct  295  GFLVPKN  301



>ref|XP_009622353.1| PREDICTED: uncharacterized protein LOC104113771 [Nicotiana tomentosiformis]
Length=330

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 35/65 (54%), Gaps = 0/65 (0%)
 Frame = -2

Query  849  MPLPPWRSFAYLQAKWESIYQRKFNPDNPNMIRSFASHHIQCVPHLKRLQSTLQPNTEVE  670
            MPLPPWRS AYL+AKWES  QR  N    + I    S H  C   L R++S++      +
Sbjct  244  MPLPPWRSLAYLEAKWESSSQRVANFQVQSSIGPSNSSHQHCTELLWRIKSSIGSEINAK  303

Query  669  RILRP  655
              L P
Sbjct  304  SFLVP  308



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1894952386554