BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13853

Length=1287
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001234183.1|  plastid lipid associated protein CHRC              459   5e-157   Solanum lycopersicum
ref|NP_001275061.1|  light-induced protein, chloroplastic               455   2e-155   Solanum tuberosum [potatoes]
sp|O99019.1|LIPC_SOLDE  RecName: Full=Light-induced protein, chlo...    454   6e-155   Solanum demissum
ref|XP_006449818.1|  hypothetical protein CICLE_v10015934mg             445   1e-151   Citrus clementina [clementine]
gb|KDO78378.1|  hypothetical protein CISIN_1g020639mg                   445   1e-151   Citrus sinensis [apfelsine]
ref|XP_011086212.1|  PREDICTED: light-induced protein, chloroplas...    444   2e-151   Sesamum indicum [beniseed]
ref|XP_006467367.1|  PREDICTED: plastid-lipid-associated protein,...    445   2e-150   
gb|EYU33869.1|  hypothetical protein MIMGU_mgv1a010099mg                436   5e-148   Erythranthe guttata [common monkey flower]
ref|XP_009628206.1|  PREDICTED: light-induced protein, chloroplastic    436   6e-148   Nicotiana tomentosiformis
ref|XP_009795634.1|  PREDICTED: light-induced protein, chloroplastic    434   5e-147   Nicotiana sylvestris
gb|AIX87511.1|  fibrillin                                               430   1e-145   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_009788638.1|  PREDICTED: light-induced protein, chloroplas...    430   1e-145   Nicotiana sylvestris
ref|XP_002524410.1|  Plastid-lipid-associated protein, chloroplas...    429   2e-145   Ricinus communis
gb|AIX87535.1|  fibrillin                                               429   3e-145   Lycium ruthenicum
ref|XP_007026203.1|  Plastid-lipid associated protein PAP / fibri...    431   2e-144   
emb|CAN69132.1|  hypothetical protein VITISV_012048                     425   2e-144   Vitis vinifera
emb|CAA50750.1|  fibrillin                                              426   3e-144   Capsicum annuum
gb|KJB57828.1|  hypothetical protein B456_009G182500                    426   6e-144   Gossypium raimondii
gb|KHG02015.1|  Plastid-lipid-associated, chloroplastic                 425   9e-144   Gossypium arboreum [tree cotton]
gb|AIX02791.1|  fibrillin 1 protein                                     425   1e-143   Capsicum annuum
gb|AIX02792.1|  fibrillin 1 protein                                     425   1e-143   Capsicum annuum
ref|XP_006383843.1|  chromoplast-specific carotenoid-associated p...    421   4e-142   Populus trichocarpa [western balsam poplar]
ref|XP_011047005.1|  PREDICTED: plastid-lipid-associated protein,...    421   4e-142   Populus euphratica
ref|XP_012091280.1|  PREDICTED: plastid-lipid-associated protein,...    420   5e-142   Jatropha curcas
gb|ABK96652.1|  unknown                                                 420   1e-141   Populus trichocarpa x Populus deltoides
ref|XP_007211630.1|  hypothetical protein PRUPE_ppa005787mg             417   1e-138   
emb|CAA75657.1|  Plastid-lipid-Associated Protein                       407   1e-137   Nicotiana tabacum [American tobacco]
gb|ABA43902.1|  fibrillin                                               409   1e-137   Coffea canephora [robusta coffee]
emb|CDP04455.1|  unnamed protein product                                409   2e-137   Coffea canephora [robusta coffee]
dbj|BAF95867.1|  putative plastid lipid-associated protein              405   3e-137   Vitis hybrid cultivar
ref|XP_008224724.1|  PREDICTED: plastid-lipid-associated protein,...    407   7e-137   Prunus mume [ume]
ref|XP_008384113.1|  PREDICTED: plastid-lipid-associated protein,...    407   1e-136   
ref|XP_007147677.1|  hypothetical protein PHAVU_006G145100g             405   3e-136   Phaseolus vulgaris [French bean]
ref|XP_008440050.1|  PREDICTED: chromoplast-specific carotenoid-a...    406   3e-136   Cucumis melo [Oriental melon]
ref|XP_004293330.1|  PREDICTED: plastid-lipid-associated protein,...    405   4e-136   Fragaria vesca subsp. vesca
ref|XP_004486195.1|  PREDICTED: plastid-lipid-associated protein,...    405   5e-136   Cicer arietinum [garbanzo]
ref|XP_004134784.1|  PREDICTED: chromoplast-specific carotenoid-a...    404   3e-135   Cucumis sativus [cucumbers]
ref|XP_010057882.1|  PREDICTED: plastid-lipid-associated protein,...    403   7e-135   Eucalyptus grandis [rose gum]
ref|XP_010099142.1|  Plastid-lipid-associated protein                   402   8e-135   Morus notabilis
ref|XP_003546169.1|  PREDICTED: plastid-lipid-associated protein,...    400   2e-134   Glycine max [soybeans]
gb|AAK57562.1|  plastid-lipid associated protein PAP2                   398   3e-133   Brassica rapa subsp. oleifera [biennial turnip rape]
sp|Q94KU6.1|PAP2_BRACM  RecName: Full=Plastid lipid-associated pr...    397   8e-133   Brassica rapa
ref|XP_009357505.1|  PREDICTED: plastid-lipid-associated protein,...    396   2e-132   Pyrus x bretschneideri [bai li]
ref|XP_010434068.1|  PREDICTED: probable plastid-lipid-associated...    396   2e-132   Camelina sativa [gold-of-pleasure]
emb|CDX79139.1|  BnaA01g12060D                                          396   3e-132   
ref|XP_009135738.1|  PREDICTED: plastid lipid-associated protein ...    395   4e-132   Brassica rapa
ref|XP_003534708.1|  PREDICTED: plastid-lipid-associated protein,...    392   6e-131   Glycine max [soybeans]
emb|CDX82925.1|  BnaC01g13750D                                          392   1e-130   
ref|XP_010252567.1|  PREDICTED: plastid-lipid-associated protein,...    392   2e-130   Nelumbo nucifera [Indian lotus]
ref|NP_192311.1|  fibrillin                                             390   3e-130   Arabidopsis thaliana [mouse-ear cress]
gb|KHN40849.1|  Plastid-lipid-associated protein, chloroplastic         390   5e-130   Glycine soja [wild soybean]
ref|NP_193955.1|  plastid-lipid associated protein PAP / fibrilli...    389   7e-130   Arabidopsis thaliana [mouse-ear cress]
gb|AAL67120.1|  AT4g22240/T10I14_70                                     387   8e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010422246.1|  PREDICTED: probable plastid-lipid-associated...    387   8e-129   Camelina sativa [gold-of-pleasure]
ref|XP_010686767.1|  PREDICTED: plastid-lipid-associated protein,...    386   9e-129   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006284145.1|  hypothetical protein CARUB_v10005278mg             386   1e-128   Capsella rubella
gb|AAM67287.1|  fibrillin precursor-like protein                        386   1e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006288225.1|  hypothetical protein CARUB_v10001463mg             386   2e-128   Capsella rubella
ref|XP_006396722.1|  hypothetical protein EUTSA_v10028808mg             386   2e-128   Eutrema salsugineum [saltwater cress]
ref|XP_010448920.1|  PREDICTED: probable plastid-lipid-associated...    384   6e-128   
ref|XP_010496158.1|  PREDICTED: probable plastid-lipid-associated...    385   6e-128   Camelina sativa [gold-of-pleasure]
ref|XP_006413678.1|  hypothetical protein EUTSA_v10025758mg             382   6e-127   Eutrema salsugineum [saltwater cress]
gb|KFK30956.1|  hypothetical protein AALP_AA6G049300                    380   6e-126   Arabis alpina [alpine rockcress]
ref|XP_010433071.1|  PREDICTED: probable plastid-lipid-associated...    379   9e-126   Camelina sativa [gold-of-pleasure]
ref|XP_002867781.1|  hypothetical protein ARALYDRAFT_914391             377   3e-125   Arabidopsis lyrata subsp. lyrata
ref|XP_010529464.1|  PREDICTED: probable plastid-lipid-associated...    377   6e-125   Tarenaya hassleriana [spider flower]
ref|XP_002872677.1|  plastid lipid-associated protein 1, chloropl...    377   1e-124   Arabidopsis lyrata subsp. lyrata
ref|XP_009392110.1|  PREDICTED: chromoplast-specific carotenoid-a...    375   4e-124   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY16684.1|  BnaA09g20620D                                          374   8e-124   Brassica napus [oilseed rape]
ref|XP_009114588.1|  PREDICTED: probable plastid-lipid-associated...    373   3e-123   Brassica rapa
sp|B4F6G1.1|CHRC2_ONCHC  RecName: Full=Chromoplast-specific carot...    371   1e-122   Oncidium hybrid cultivar
gb|EYU27736.1|  hypothetical protein MIMGU_mgv1a010083mg                370   2e-122   Erythranthe guttata [common monkey flower]
gb|AGN30962.1|  chromoplast-specific carotenoid-associated protein      370   4e-122   Narcissus tazetta subsp. chinensis
sp|B2LU34.1|CHRC1_ONCHC  RecName: Full=Chromoplast-specific carot...    368   2e-121   Oncidium hybrid cultivar
gb|EYU27735.1|  hypothetical protein MIMGU_mgv1a010083mg                365   2e-120   Erythranthe guttata [common monkey flower]
gb|KJB34758.1|  hypothetical protein B456_006G082400                    366   3e-120   Gossypium raimondii
ref|XP_010943242.1|  PREDICTED: probable plastid-lipid-associated...    365   6e-120   
gb|ABR17743.1|  unknown                                                 364   1e-119   Picea sitchensis
gb|ABK26110.1|  unknown                                                 364   1e-119   Picea sitchensis
ref|XP_009408003.1|  PREDICTED: probable plastid-lipid-associated...    361   6e-119   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003594155.1|  Plastid-lipid-associated protein                   360   2e-118   Medicago truncatula
ref|XP_010538742.1|  PREDICTED: plastid lipid-associated protein ...    358   1e-117   Tarenaya hassleriana [spider flower]
emb|CDX90850.1|  BnaA03g25300D                                          357   3e-117   
gb|EPS66635.1|  hypothetical protein M569_08140                         352   3e-116   Genlisea aurea
ref|XP_009134286.1|  PREDICTED: plastid lipid-associated protein ...    355   3e-116   Brassica rapa
gb|AAD03693.1|  fibrillin                                               351   4e-116   Brassica napus [oilseed rape]
emb|CDY21291.1|  BnaC03g29750D                                          354   5e-116   Brassica napus [oilseed rape]
ref|XP_008803509.1|  PREDICTED: probable plastid-lipid-associated...    351   1e-115   Phoenix dactylifera
gb|AAK57561.1|  plastid-lipid associated protein PAP1                   353   2e-115   Brassica rapa subsp. oleifera [biennial turnip rape]
gb|KHG06297.1|  Plastid-lipid-associated, chloroplastic                 352   1e-114   Gossypium arboreum [tree cotton]
ref|XP_004956481.1|  PREDICTED: probable plastid-lipid-associated...    350   2e-114   Setaria italica
ref|XP_003575588.1|  PREDICTED: probable plastid-lipid-associated...    350   2e-114   Brachypodium distachyon [annual false brome]
ref|XP_002983947.1|  hypothetical protein SELMODRAFT_156313             350   4e-114   Selaginella moellendorffii
sp|Q6K439.1|PAP2_ORYSJ  RecName: Full=Probable plastid-lipid-asso...    349   6e-114   Oryza sativa Japonica Group [Japonica rice]
gb|EEC84129.1|  hypothetical protein OsI_30469                          348   7e-114   Oryza sativa Indica Group [Indian rice]
dbj|BAJ98727.1|  predicted protein                                      347   2e-113   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEE69226.1|  hypothetical protein OsJ_28458                          347   3e-113   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002960725.1|  hypothetical protein SELMODRAFT_163532             347   5e-113   Selaginella moellendorffii
ref|XP_006661039.1|  PREDICTED: probable plastid-lipid-associated...    343   1e-112   Oryza brachyantha
ref|XP_002447942.1|  hypothetical protein SORBIDRAFT_06g018550          346   1e-112   Sorghum bicolor [broomcorn]
gb|AAO72593.1|  fibrillin-like protein                                  343   7e-112   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006849074.1|  PREDICTED: probable plastid-lipid-associated...    342   2e-111   Amborella trichopoda
ref|NP_001150448.1|  LOC100284078                                       341   7e-111   Zea mays [maize]
gb|AFW58454.1|  plastid-lipid-associated protein 2                      338   7e-110   
ref|XP_010928413.1|  PREDICTED: probable plastid-lipid-associated...    338   8e-110   Elaeis guineensis
ref|NP_001150453.1|  LOC100284083                                       337   2e-109   
ref|XP_008349368.1|  PREDICTED: plastid-lipid-associated protein,...    330   2e-108   
ref|XP_003594154.1|  Plastid-lipid-associated protein                   329   2e-106   Medicago truncatula
gb|ACJ85346.1|  unknown                                                 327   2e-105   Medicago truncatula
gb|AFK48303.1|  unknown                                                 327   2e-105   Medicago truncatula
gb|ACJ84978.1|  unknown                                                 326   4e-105   Medicago truncatula
ref|NP_001062631.2|  Os09g0133600                                       321   2e-104   
ref|XP_006844495.2|  PREDICTED: plastid-lipid-associated protein,...    316   3e-101   
ref|XP_009398685.1|  PREDICTED: probable plastid-lipid-associated...    309   1e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009783682.1|  PREDICTED: light-induced protein, chloroplas...    294   1e-94    Nicotiana sylvestris
gb|KDO78379.1|  hypothetical protein CISIN_1g020639mg                   296   2e-94    Citrus sinensis [apfelsine]
ref|XP_001766233.1|  predicted protein                                  297   7e-94    
ref|XP_008780182.1|  PREDICTED: probable plastid-lipid-associated...    278   6e-87    Phoenix dactylifera
ref|XP_010270045.1|  PREDICTED: plastid-lipid-associated protein,...    280   1e-86    Nelumbo nucifera [Indian lotus]
gb|ACG36654.1|  plastid-lipid-associated protein 2                      267   8e-83    Zea mays [maize]
emb|CDY71809.1|  BnaCnng74600D                                          264   1e-82    Brassica napus [oilseed rape]
gb|ABR17395.1|  unknown                                                 271   4e-82    Picea sitchensis
ref|XP_006854055.1|  PREDICTED: plastid lipid-associated protein ...    265   4e-79    Amborella trichopoda
gb|AAP74338.1|  fibrillin-like protein                                  253   1e-78    Elaeis guineensis
ref|XP_008799426.1|  PREDICTED: light-induced protein, chloroplas...    253   2e-78    
ref|XP_001756848.1|  predicted protein                                  255   2e-78    
emb|CBI33829.3|  unnamed protein product                                249   8e-76    Vitis vinifera
ref|XP_002276479.1|  PREDICTED: plastoglobulin-1, chloroplastic         250   8e-75    Vitis vinifera
ref|XP_010276838.1|  PREDICTED: probable plastid-lipid-associated...    251   2e-74    Nelumbo nucifera [Indian lotus]
ref|XP_010245209.1|  PREDICTED: plastid lipid-associated protein ...    249   2e-74    Nelumbo nucifera [Indian lotus]
ref|XP_012081063.1|  PREDICTED: plastid lipid-associated protein ...    247   2e-73    Jatropha curcas
ref|XP_009608239.1|  PREDICTED: plastoglobulin-1, chloroplastic i...    244   4e-73    Nicotiana tomentosiformis
ref|XP_011018504.1|  PREDICTED: plastid lipid-associated protein ...    244   8e-73    Populus euphratica
ref|XP_011082345.1|  PREDICTED: plastoglobulin-1, chloroplastic         244   1e-72    Sesamum indicum [beniseed]
ref|XP_002297709.2|  hypothetical protein POPTR_0001s02040g             243   1e-72    
ref|XP_010919972.1|  PREDICTED: probable plastid-lipid-associated...    244   5e-72    Elaeis guineensis
ref|XP_004300209.1|  PREDICTED: plastoglobulin-1, chloroplastic         239   4e-71    Fragaria vesca subsp. vesca
ref|XP_009766235.1|  PREDICTED: plastoglobulin-1, chloroplastic         239   5e-71    Nicotiana sylvestris
gb|EMS56479.1|  putative plastid-lipid-associated protein 2, chlo...    234   8e-71    Triticum urartu
ref|XP_002304354.1|  hypothetical protein POPTR_0003s09460g             239   1e-70    
ref|XP_008800089.1|  PREDICTED: probable plastid-lipid-associated...    240   1e-70    Phoenix dactylifera
gb|EMT11511.1|  Putative plastid-lipid-associated protein 2, chlo...    232   2e-70    
ref|XP_010053632.1|  PREDICTED: plastoglobulin-1, chloroplastic         237   4e-70    Eucalyptus grandis [rose gum]
gb|ABC96720.1|  plastid fibrillin 2                                     233   4e-70    Coffea canephora [robusta coffee]
ref|XP_004245973.1|  PREDICTED: plastoglobulin-1, chloroplastic         236   8e-70    Solanum lycopersicum
emb|CDP18539.1|  unnamed protein product                                237   9e-70    Coffea canephora [robusta coffee]
ref|XP_010096934.1|  putative plastid-lipid-associated protein 3        236   2e-69    Morus notabilis
ref|XP_009608213.1|  PREDICTED: plastoglobulin-1, chloroplastic i...    235   2e-69    Nicotiana tomentosiformis
ref|XP_011028127.1|  PREDICTED: plastid lipid-associated protein ...    234   6e-69    Populus euphratica
ref|XP_006352897.1|  PREDICTED: plastoglobulin-1, chloroplastic-like    234   3e-68    Solanum tuberosum [potatoes]
ref|XP_006662632.1|  PREDICTED: probable plastid-lipid-associated...    231   4e-68    
ref|XP_007209304.1|  hypothetical protein PRUPE_ppa007851mg             231   9e-68    Prunus persica
ref|XP_008238187.1|  PREDICTED: plastoglobulin-1, chloroplastic         231   1e-67    Prunus mume [ume]
ref|XP_009619935.1|  PREDICTED: plastoglobulin-1, chloroplastic-like    233   2e-67    Nicotiana tomentosiformis
ref|XP_010509611.1|  PREDICTED: probable plastid-lipid-associated...    229   5e-67    Camelina sativa [gold-of-pleasure]
ref|XP_010516724.1|  PREDICTED: probable plastid-lipid-associated...    229   6e-67    Camelina sativa [gold-of-pleasure]
ref|XP_002518975.1|  Plastid lipid-associated protein 3, chloropl...    229   7e-67    Ricinus communis
ref|XP_010518909.1|  PREDICTED: plastid lipid-associated protein ...    229   8e-67    Tarenaya hassleriana [spider flower]
gb|KHG16773.1|  Plastid lipid-associated 3, chloroplastic               228   1e-66    Gossypium arboreum [tree cotton]
gb|EMS55390.1|  putative plastid-lipid-associated protein 3, chlo...    227   1e-66    Triticum urartu
ref|XP_004983554.1|  PREDICTED: probable plastid-lipid-associated...    228   3e-66    Setaria italica
gb|KIZ02337.1|  hypothetical protein MNEG_5623                          223   5e-66    Monoraphidium neglectum
ref|XP_002467442.1|  hypothetical protein SORBIDRAFT_01g028150          227   5e-66    Sorghum bicolor [broomcorn]
ref|XP_006294405.1|  hypothetical protein CARUB_v10023422mg             227   7e-66    Capsella rubella
gb|KJB37720.1|  hypothetical protein B456_006G217700                    226   8e-66    Gossypium raimondii
ref|XP_002881399.1|  hypothetical protein ARALYDRAFT_902655             226   9e-66    Arabidopsis lyrata subsp. lyrata
gb|KJB37719.1|  hypothetical protein B456_006G217700                    226   1e-65    Gossypium raimondii
ref|NP_181092.1|  putative plastid-lipid-associated protein 3           226   2e-65    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010505057.1|  PREDICTED: probable plastid-lipid-associated...    225   2e-65    Camelina sativa [gold-of-pleasure]
dbj|BAJ85307.1|  predicted protein                                      225   2e-65    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006410707.1|  hypothetical protein EUTSA_v10016800mg             225   3e-65    Eutrema salsugineum [saltwater cress]
dbj|BAJ98223.1|  predicted protein                                      225   3e-65    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT01216.1|  Putative plastid-lipid-associated protein 3, chlo...    223   1e-64    
gb|AAK57563.1|  plastid-lipid associated protein PAP3                   223   1e-64    Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_009403116.1|  PREDICTED: LOW QUALITY PROTEIN: probable pla...    225   1e-64    
sp|Q94KU5.1|PAP3_BRACM  RecName: Full=Plastid lipid-associated pr...    223   1e-64    Brassica rapa
ref|XP_009143664.1|  PREDICTED: plastid lipid-associated protein ...    223   1e-64    Brassica rapa
ref|XP_006432747.1|  hypothetical protein CICLE_v10002003mg             223   1e-64    Citrus clementina [clementine]
ref|XP_004512496.1|  PREDICTED: plastoglobulin-1, chloroplastic-like    223   1e-64    Cicer arietinum [garbanzo]
emb|CDY31692.1|  BnaA05g08550D                                          223   2e-64    Brassica napus [oilseed rape]
ref|XP_010235051.1|  PREDICTED: probable plastid-lipid-associated...    222   2e-64    Brachypodium distachyon [annual false brome]
ref|XP_010677363.1|  PREDICTED: plastid lipid-associated protein ...    223   3e-64    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008676981.1|  PREDICTED: fibrillin1 isoform X1                   222   5e-64    Zea mays [maize]
gb|AAK68845.1|  putative fibrillin                                      222   5e-64    Arabidopsis thaliana [mouse-ear cress]
gb|KFK36419.1|  hypothetical protein AALP_AA4G121600                    221   6e-64    Arabis alpina [alpine rockcress]
emb|CDX84202.1|  BnaC04g09640D                                          221   9e-64    
ref|XP_009373486.1|  PREDICTED: plastoglobulin-1, chloroplastic         220   1e-63    Pyrus x bretschneideri [bai li]
gb|ACG41445.1|  plastid-lipid associated protein 3                      221   1e-63    Zea mays [maize]
ref|NP_001149315.1|  fibrillin1                                         221   1e-63    Zea mays [maize]
ref|XP_006368003.1|  PREDICTED: probable plastid-lipid-associated...    222   2e-63    Solanum tuberosum [potatoes]
ref|XP_007158264.1|  hypothetical protein PHAVU_002G137800g             220   2e-63    Phaseolus vulgaris [French bean]
ref|XP_008448650.1|  PREDICTED: plastoglobulin-1, chloroplastic         220   2e-63    Cucumis melo [Oriental melon]
ref|XP_007040679.1|  Plastid-lipid associated protein PAP / fibri...    218   9e-63    
gb|ERN06170.1|  hypothetical protein AMTR_s00016p00122150               211   9e-63    Amborella trichopoda
ref|XP_003516983.1|  PREDICTED: plastoglobulin-1, chloroplastic-like    218   1e-62    Glycine max [soybeans]
ref|XP_005645631.1|  hypothetical protein COCSUDRAFT_17945              215   2e-62    Coccomyxa subellipsoidea C-169
ref|XP_002505473.1|  predicted protein                                  213   3e-62    Micromonas commoda
emb|CAA75658.1|  Plastid-lipid-Associated Protein                       209   3e-62    Solanum lycopersicum
ref|XP_009349223.1|  PREDICTED: plastoglobulin-1, chloroplastic-like    216   4e-62    Pyrus x bretschneideri [bai li]
ref|XP_004244405.1|  PREDICTED: plastoglobulin-1, chloroplastic         218   4e-62    Solanum lycopersicum
sp|Q7XBW5.1|PAP3_ORYSJ  RecName: Full=Probable plastid-lipid-asso...    216   5e-62    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004148751.1|  PREDICTED: plastoglobulin-1, chloroplastic         216   5e-62    Cucumis sativus [cucumbers]
gb|EEE51456.1|  hypothetical protein OsJ_32570                          216   7e-62    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008373508.1|  PREDICTED: plastoglobulin-1, chloroplastic         213   4e-61    Malus domestica [apple tree]
gb|ADK79127.1|  astaxanthin vesicles associated protein                 208   9e-60    Haematococcus lacustris
gb|AFW58455.1|  hypothetical protein ZEAMMB73_538731                    201   5e-58    
sp|Q9ZP40.1|PG1_PEA  RecName: Full=Plastoglobulin-1, chloroplasti...    204   1e-57    Pisum sativum [garden pea]
ref|XP_001760672.1|  predicted protein                                  198   2e-56    
ref|NP_001065482.2|  Os10g0575700                                       199   5e-55    
ref|XP_005846413.1|  hypothetical protein CHLNCDRAFT_11571              192   1e-54    Chlorella variabilis
ref|XP_003612834.1|  Plastoglobulin-1                                   193   2e-53    Medicago truncatula
gb|ACJ84215.1|  unknown                                                 191   2e-52    Medicago truncatula
gb|AFK33388.1|  unknown                                                 189   7e-52    Medicago truncatula
ref|XP_008802537.1|  PREDICTED: plastid-lipid-associated protein,...    182   2e-51    Phoenix dactylifera
ref|XP_009804524.1|  PREDICTED: light-induced protein, chloroplas...    177   5e-50    Nicotiana sylvestris
gb|EPS69991.1|  hypothetical protein M569_04771                         176   3e-47    Genlisea aurea
ref|XP_006367875.1|  PREDICTED: plastoglobulin-1, chloroplastic-like    164   3e-44    
ref|XP_009789727.1|  PREDICTED: plastoglobulin-1, chloroplastic-like    163   3e-44    Nicotiana sylvestris
gb|EYU19055.1|  hypothetical protein MIMGU_mgv1a026687mg                159   9e-43    Erythranthe guttata [common monkey flower]
gb|KDO78380.1|  hypothetical protein CISIN_1g020639mg                   158   4e-42    Citrus sinensis [apfelsine]
ref|XP_001692028.1|  plastid lipid associated protein                   159   4e-41    Chlamydomonas reinhardtii
gb|AFA36496.1|  fibrillin-like protein                                  146   1e-38    Lolium perenne [perennial ryegrass]
ref|XP_003592199.1|  Plastid-lipid-associated protein                   147   5e-38    
ref|XP_001698968.1|  plastid lipid associated protein                   150   9e-38    Chlamydomonas reinhardtii
ref|XP_001698965.1|  plastid lipid associated protein                   152   1e-37    Chlamydomonas reinhardtii
ref|XP_010279319.1|  PREDICTED: plastid-lipid-associated protein,...    142   2e-36    Nelumbo nucifera [Indian lotus]
ref|XP_008800090.1|  PREDICTED: probable plastid-lipid-associated...    145   7e-36    Phoenix dactylifera
ref|XP_003059745.1|  predicted protein                                  141   3e-35    Micromonas pusilla CCMP1545
ref|XP_011018505.1|  PREDICTED: probable plastid-lipid-associated...    142   1e-34    Populus euphratica
ref|XP_006588307.1|  PREDICTED: plastoglobulin-1, chloroplastic-like    140   2e-34    
ref|XP_002945995.1|  hypothetical protein VOLCADRAFT_46047              137   9e-34    Volvox carteri f. nagariensis
ref|XP_002945997.1|  hypothetical protein VOLCADRAFT_46017              137   1e-33    Volvox carteri f. nagariensis
gb|KJB37718.1|  hypothetical protein B456_006G217700                    135   9e-33    Gossypium raimondii
ref|XP_006432746.1|  hypothetical protein CICLE_v10002003mg             132   1e-31    
ref|XP_007040682.1|  Plastid-lipid associated protein PAP / fibri...    132   3e-31    
ref|XP_007040681.1|  Plastid-lipid associated protein PAP / fibri...    128   2e-30    
ref|XP_007158263.1|  hypothetical protein PHAVU_002G137800g             128   3e-30    Phaseolus vulgaris [French bean]
gb|ACN41157.1|  unknown                                                 121   5e-29    Picea sitchensis
ref|WP_007353810.1|  MULTISPECIES: fibrillin                            121   1e-28    Kamptonema
ref|WP_016862318.1|  fibrillin                                          120   3e-28    Fischerella muscicola
ref|WP_039742995.1|  fibrillin                                          119   9e-28    
ref|WP_017310080.1|  fibrillin                                          118   2e-27    Fischerella sp. PCC 9339
ref|WP_044450060.1|  fibrillin                                          118   2e-27    Mastigocladus laminosus
ref|WP_041226434.1|  fibrillin                                          117   2e-27    Crinalium epipsammum
gb|AFZ12211.1|  PAP fibrillin family protein                            117   2e-27    Crinalium epipsammum PCC 9333
ref|WP_009545266.1|  MULTISPECIES: fibrillin                            117   4e-27    Cyanothece
ref|WP_006527167.1|  fibrillin                                          117   6e-27    Gloeocapsa sp. PCC 73106
gb|ACB52918.1|  fibrillin                                               117   6e-27    Cyanothece sp. ATCC 51142
ref|WP_008274287.1|  fibrillin                                          116   7e-27    Cyanothece sp. CCY0110
ref|WP_026733113.1|  fibrillin                                          116   7e-27    Fischerella sp. PCC 9605
ref|WP_006194699.1|  fibrillin                                          116   9e-27    Nodularia spumigena
gb|AAD38023.1|AF148219_1  fibrillin                                     115   2e-26    Nostoc sp. PCC 8009
ref|WP_026720334.1|  fibrillin                                          114   4e-26    Fischerella sp. PCC 9431
ref|WP_017717779.1|  fibrillin                                          113   7e-26    Oscillatoria sp. PCC 10802
ref|WP_019490506.1|  fibrillin                                          113   9e-26    Calothrix sp. PCC 7103
ref|WP_015142149.1|  PAP fibrillin                                      113   1e-25    Pleurocapsa minor
ref|WP_016878430.1|  fibrillin                                          113   1e-25    Chlorogloeopsis fritschii
ref|WP_045873360.1|  fibrillin                                          113   1e-25    Nostocales
ref|XP_002950467.1|  hypothetical protein VOLCADRAFT_104724             115   1e-25    Volvox carteri f. nagariensis
ref|WP_012410287.1|  fibrillin                                          113   1e-25    Nostoc punctiforme
ref|WP_017745894.1|  fibrillin                                          112   2e-25    Scytonema hofmannii
ref|WP_012597880.1|  fibrillin                                          112   2e-25    Cyanothece sp. PCC 7424
gb|KIJ80924.1|  fibrillin                                               112   2e-25    Scytonema tolypothrichoides VB-61278
ref|WP_029635318.1|  fibrillin [                                        112   2e-25    [Scytonema hofmanni] UTEX B 1581
ref|WP_009455625.1|  MULTISPECIES: fibrillin                            112   2e-25    Fischerella thermalis
ref|WP_016867324.1|  fibrillin                                          112   3e-25    Fischerella
emb|CDX94540.1|  BnaC09g22960D                                          110   3e-25    
ref|WP_017287997.1|  hypothetical protein                               111   3e-25    Leptolyngbya boryana
ref|WP_017653873.1|  fibrillin                                          111   5e-25    Fortiea contorta
ref|WP_045360233.1|  fibrillin                                          111   5e-25    Microcystis aeruginosa
ref|WP_012595043.1|  fibrillin                                          111   5e-25    Cyanothece sp. PCC 8801
ref|WP_015186507.1|  PAP fibrillin family protein                       110   6e-25    Gloeocapsa sp. PCC 7428
ref|WP_036002351.1|  fibrillin                                          110   1e-24    [Leptolyngbya] sp. JSC-1
ref|WP_015783811.1|  fibrillin                                          110   1e-24    Cyanothece sp. PCC 8802
ref|WP_039716372.1|  fibrillin                                          110   1e-24    
ref|WP_008188169.1|  fibrillin                                          110   1e-24    Moorea producens
gb|KIE13446.1|  fibrillin                                               110   1e-24    Tolypothrix bouteillei VB521301
ref|WP_008199162.1|  fibrillin                                          109   2e-24    Microcystis
ref|WP_015140456.1|  PAP fibrillin                                      109   2e-24    Nostoc sp. PCC 7524
ref|WP_041036447.1|  fibrillin                                          109   2e-24    
ref|WP_013323346.1|  fibrillin                                          109   2e-24    
ref|WP_015156100.1|  PAP fibrillin family protein                       109   3e-24    
ref|WP_002736482.1|  fibrillin                                          109   3e-24    
ref|WP_011613884.1|  fibrillin                                          109   3e-24    
ref|WP_009630980.1|  PAP_fibrillin                                      108   3e-24    
ref|WP_002797657.1|  fibrillin                                          108   3e-24    
ref|WP_044106796.1|  fibrillin                                          108   4e-24    
ref|WP_015111813.1|  PAP fibrillin family protein                       108   4e-24    
ref|WP_015128015.1|  PAP fibrillin family protein                       108   4e-24    
ref|WP_006625760.1|  MULTISPECIES: fibrillin                            108   5e-24    
ref|WP_015201000.1|  PAP fibrillin family protein                       108   6e-24    
emb|CCE16425.1|  fibrillin                                              108   6e-24    
ref|WP_002747500.1|  fibrillin                                          108   6e-24    
ref|WP_015213736.1|  PAP fibrillin family protein                       107   9e-24    
ref|WP_009768204.1|  fibrillin                                          107   9e-24    
ref|WP_016950092.1|  fibrillin                                          107   1e-23    
ref|WP_006617519.1|  fibrillin                                          107   1e-23    
ref|WP_027400976.1|  fibrillin                                          107   1e-23    
ref|WP_017315378.1|  fibrillin                                          107   1e-23    
ref|WP_039204978.1|  fibrillin                                          107   2e-23    
ref|WP_007306077.1|  fibrillin                                          107   2e-23    
ref|WP_015175821.1|  PAP fibrillin family protein                       106   2e-23    
ref|WP_017296325.1|  hypothetical protein                               107   2e-23    
ref|WP_015192734.1|  PAP fibrillin family protein                       106   2e-23    
ref|WP_035155753.1|  fibrillin                                          106   3e-23    
ref|WP_006631292.1|  fibrillin                                          106   3e-23    
ref|WP_019506432.1|  fibrillin                                          106   3e-23    
ref|WP_017322020.1|  fibrillin                                          106   3e-23    
ref|WP_002759778.1|  fibrillin                                          106   3e-23    
ref|WP_006509831.1|  PAP_fibrillin                                      106   3e-23    
ref|WP_007311273.1|  fibrillin                                          105   4e-23    
ref|WP_002784746.1|  Fibrillin                                          105   4e-23    
ref|WP_017305990.1|  hypothetical protein                               105   5e-23    
ref|WP_015231060.1|  PAP fibrillin                                      105   6e-23    
ref|WP_015210228.1|  PAP_fibrillin                                      105   6e-23    
ref|WP_027254936.1|  fibrillin                                          105   6e-23    
ref|WP_026786145.1|  MULTISPECIES: fibrillin                            104   1e-22    
ref|WP_011318109.1|  fibrillin                                          104   1e-22    
ref|WP_002788271.1|  fibrillin                                          104   1e-22    
ref|WP_015081106.1|  PAP fibrillin family protein                       104   1e-22    
ref|WP_042155767.1|  fibrillin                                          104   1e-22    
ref|WP_010998456.1|  fibrillin                                          103   2e-22    
ref|WP_045054020.1|  fibrillin                                          103   3e-22    
ref|WP_002765829.1|  fibrillin                                          102   6e-22    
ref|WP_019499433.1|  hypothetical protein                               102   7e-22    
dbj|BAA17246.1|  fibrillin                                              102   7e-22    
ref|WP_015135028.1|  fibrillin family protein                           102   8e-22    
ref|WP_008311462.1|  fibrillin                                          102   9e-22    
ref|WP_041425924.1|  fibrillin                                          102   1e-21    
tpg|DAA37511.1|  TPA: hypothetical protein ZEAMMB73_707606              102   1e-21    
emb|CCQ62956.1|  fibrillin                                              101   1e-21    
ref|WP_028946696.1|  fibrillin                                          101   1e-21    
gb|EEC67495.1|  hypothetical protein OsI_34766                          102   1e-21    
ref|WP_024546401.1|  fibrillin                                          101   1e-21    
ref|WP_015171061.1|  fibrillin                                          101   1e-21    
ref|WP_015226493.1|  fibrillin                                          101   2e-21    
ref|WP_006102803.1|  fibrillin                                          101   2e-21    
ref|WP_018396788.1|  hypothetical protein                               100   2e-21    
ref|WP_015180510.1|  PAP fibrillin                                      100   3e-21    
ref|WP_013190181.1|  fibrillin                                          100   4e-21    
ref|WP_012307392.1|  MULTISPECIES: fibrillin                            100   4e-21    
ref|WP_041922863.1|  fibrillin                                          100   5e-21    
gb|AFZ54525.1|  PAP fibrillin family protein                            100   6e-21    
ref|WP_015223589.1|  fibrillin                                        99.8    6e-21    
ref|WP_036534133.1|  fibrillin                                        99.8    8e-21    
gb|EKV03940.1|  PAP_fibrillin                                         99.4    8e-21    
ref|WP_036021731.1|  fibrillin                                        99.4    9e-21    
ref|WP_037223622.1|  fibrillin                                        99.4    9e-21    
ref|WP_015146841.1|  PAP fibrillin                                    99.4    9e-21    
gb|ERN41472.1|  PAP fibrillin                                         99.0    1e-20    
ref|WP_040655771.1|  fibrillin                                        98.6    2e-20    
ref|WP_012629263.1|  fibrillin                                        98.6    2e-20    
ref|WP_017711245.1|  hypothetical protein                             98.2    3e-20    
gb|EAW35713.1|  fibrillin                                             98.6    3e-20    
ref|WP_015124585.1|  PAP fibrillin                                    98.2    3e-20    
gb|AHB88680.1|  plastoglobulin-like protein Pgl1                      97.1    5e-20    
ref|WP_035991998.1|  fibrillin                                        97.1    6e-20    
dbj|BAQ66424.1|  fibrillin                                            97.1    7e-20    
ref|WP_023074381.1|  fibrillin                                        97.1    7e-20    
ref|WP_011056274.1|  fibrillin                                        96.7    7e-20    
ref|WP_036485633.1|  fibrillin                                        95.9    2e-19    
ref|WP_027846033.1|  fibrillin                                        95.5    2e-19    
ref|WP_040936721.1|  fibrillin                                        95.1    3e-19    
ref|WP_041429685.1|  fibrillin                                        94.7    3e-19    
ref|WP_015117639.1|  PAP fibrillin                                    94.7    4e-19    
ref|WP_009628669.1|  PAP fibrillin family protein                     94.4    7e-19    
ref|WP_039896592.1|  fibrillin                                        94.0    7e-19    
ref|WP_040932316.1|  fibrillin                                        94.0    9e-19    
ref|WP_017297518.1|  hypothetical protein                             93.6    1e-18    
ref|WP_015158219.1|  PAP_fibrillin                                    93.2    2e-18    
ref|WP_015167859.1|  PAP fibrillin                                    92.4    3e-18    
ref|WP_012165136.1|  fibrillin                                        92.0    4e-18    
ref|WP_010478039.1|  fibrillin                                        91.7    5e-18    
ref|WP_017658618.1|  fibrillin                                        90.9    9e-18    
ref|WP_028089769.1|  fibrillin                                        90.9    1e-17    
ref|WP_039726535.1|  MULTISPECIES: fibrillin                          90.9    1e-17    
ref|WP_023069009.1|  PAP_fibrillin family protein                     90.1    2e-17    
ref|WP_028082646.1|  fibrillin                                        88.6    7e-17    
ref|WP_011243663.1|  MULTISPECIES: fibrillin                          88.2    1e-16    
gb|AFG70455.1|  hypothetical protein 0_2632_01                        84.3    2e-16    
emb|CDP12788.1|  unnamed protein product                              87.8    4e-16    
gb|AEW07488.1|  hypothetical protein 0_2632_01                        83.2    5e-16    
gb|AFG70460.1|  hypothetical protein 0_2632_01                        82.0    1e-15    
gb|AFG70450.1|  hypothetical protein 0_2632_01                        82.0    1e-15    
ref|WP_015164068.1|  PAP fibrillin family protein                     85.1    1e-15    
ref|XP_009795802.1|  PREDICTED: probable plastid-lipid-associated...  85.9    2e-15    
ref|XP_009589333.1|  PREDICTED: probable plastid-lipid-associated...  85.9    2e-15    
gb|EYU43479.1|  hypothetical protein MIMGU_mgv1a011894mg              83.2    2e-14    
dbj|BAQ60042.1|  fibrillin                                            82.0    2e-14    
gb|ABD39693.1|  fibrillin 5                                           82.4    2e-14    
ref|XP_002317175.1|  chromoplast-specific carotenoid-associated p...  79.3    2e-14    
gb|AET04657.2|  plastid lipid-associated protein                      82.0    4e-14    
gb|ABR17093.1|  unknown                                               81.6    5e-14    
ref|XP_007159807.1|  hypothetical protein PHAVU_002G269000g           81.6    5e-14    
ref|WP_011433917.1|  PAP fibrillin                                    78.2    3e-13    
gb|AFK43713.1|  unknown                                               79.0    3e-13    
ref|XP_005708690.1|  hypothetical protein Gasu_05840                  79.7    4e-13    
ref|XP_006351023.1|  PREDICTED: probable plastid-lipid-associated...  78.2    6e-13    
ref|XP_004503974.1|  PREDICTED: probable plastid-lipid-associated...  77.8    7e-13    
ref|XP_003525106.1|  PREDICTED: probable plastid-lipid-associated...  77.0    2e-12    
ref|WP_006456855.1|  fibrillin                                        75.9    2e-12    
ref|XP_003062638.1|  predicted protein                                79.0    3e-12    
gb|KJB14939.1|  hypothetical protein B456_002G151300                  76.6    3e-12    
ref|XP_003630181.1|  Fibrillin                                        76.3    3e-12    
ref|XP_004249867.1|  PREDICTED: probable plastid-lipid-associated...  75.5    5e-12    
gb|EYU19056.1|  hypothetical protein MIMGU_mgv1a014970mg              73.9    6e-12    
ref|XP_007211809.1|  hypothetical protein PRUPE_ppa009938mg           75.5    7e-12    
ref|XP_008232975.1|  PREDICTED: probable plastid-lipid-associated...  75.1    7e-12    
ref|XP_001765309.1|  predicted protein                                73.9    8e-12    
ref|XP_007048240.1|  Plastid-lipid associated protein PAP / fibri...  75.1    1e-11    
ref|XP_002276832.1|  PREDICTED: probable plastid-lipid-associated...  74.7    1e-11    
gb|KHN29149.1|  Putative plastid-lipid-associated protein 7, chlo...  74.3    1e-11    
ref|XP_002522199.1|  structural molecule, putative                    74.3    1e-11    
emb|CBI37604.3|  unnamed protein product                              74.3    1e-11    
ref|XP_003532856.1|  PREDICTED: probable plastid-lipid-associated...  74.3    2e-11    
ref|XP_010554165.1|  PREDICTED: probable plastid-lipid-associated...  73.2    3e-11    
ref|NP_001152472.1|  structural molecule                              72.4    6e-11    
ref|XP_010680277.1|  PREDICTED: probable plastid-lipid-associated...  72.4    6e-11    
ref|XP_008668183.1|  PREDICTED: structural molecule isoform X2        72.4    6e-11    
ref|XP_002503779.1|  predicted protein                                74.3    8e-11    
ref|XP_008338731.1|  PREDICTED: probable plastid-lipid-associated...  71.2    1e-10    
ref|NP_001052788.1|  Os04g0422000                                     71.6    1e-10    
ref|XP_009334002.1|  PREDICTED: probable plastid-lipid-associated...  71.2    1e-10    
ref|XP_010912413.1|  PREDICTED: probable plastid-lipid-associated...  71.2    1e-10    
ref|WP_015206264.1|  PAP_fibrillin                                    70.5    2e-10    
ref|XP_004975609.1|  PREDICTED: probable plastid-lipid-associated...  71.2    2e-10    
ref|XP_006653391.1|  PREDICTED: probable plastid-lipid-associated...  70.5    2e-10    
ref|XP_009350993.1|  PREDICTED: probable plastid-lipid-associated...  70.9    2e-10    
ref|XP_010098895.1|  putative plastid-lipid-associated protein 7      70.5    2e-10    
ref|XP_001692022.1|  plastid lipid associated protein                 72.0    2e-10    
emb|CAH66928.1|  H0525E10.12                                          70.9    2e-10    
ref|XP_003081796.1|  unnamed protein product                          72.8    3e-10    
emb|CEF99501.1|  Plastid lipid-associated protein/fibrillin conse...  72.8    3e-10    
ref|XP_010027705.1|  PREDICTED: probable plastid-lipid-associated...  70.1    4e-10    
ref|XP_009417714.1|  PREDICTED: probable plastid-lipid-associated...  69.7    5e-10    
ref|XP_009790013.1|  PREDICTED: plastid lipid-associated protein ...  69.7    5e-10    
gb|KCW54281.1|  hypothetical protein EUGRSUZ_I00244                   70.1    5e-10    
ref|XP_010027706.1|  PREDICTED: probable plastid-lipid-associated...  68.9    5e-10    
ref|XP_010027704.1|  PREDICTED: probable plastid-lipid-associated...  70.5    7e-10    
ref|XP_010260935.1|  PREDICTED: probable plastid-lipid-associated...  69.3    7e-10    
ref|XP_009795803.1|  PREDICTED: probable plastid-lipid-associated...  68.2    9e-10    
dbj|BAJ88333.1|  predicted protein                                    68.6    1e-09    
ref|XP_009795804.1|  PREDICTED: probable plastid-lipid-associated...  68.2    1e-09    
ref|WP_010871790.1|  hypothetical protein                             67.0    2e-09    
ref|XP_004306596.1|  PREDICTED: probable plastid-lipid-associated...  67.8    2e-09    
ref|XP_002528606.1|  structural molecule, putative                    67.4    3e-09    
ref|XP_010912414.1|  PREDICTED: probable plastid-lipid-associated...  67.4    3e-09    
ref|XP_008668182.1|  PREDICTED: structural molecule isoform X1        67.0    4e-09    
ref|XP_002446468.1|  hypothetical protein SORBIDRAFT_06g016450        67.0    4e-09    
ref|XP_002300202.2|  hypothetical protein POPTR_0001s31680g           67.0    4e-09    
ref|XP_009589334.1|  PREDICTED: probable plastid-lipid-associated...  66.2    4e-09    
ref|XP_006427886.1|  hypothetical protein CICLE_v10026263mg           67.0    5e-09    
ref|XP_005847116.1|  hypothetical protein CHLNCDRAFT_134838           65.5    6e-09    
gb|KDO53355.1|  hypothetical protein CISIN_1g044591mg                 66.2    6e-09    
gb|AES63306.2|  plastid lipid-associated protein                      65.9    7e-09    
ref|XP_005539136.1|  plastid-lipid-associated protein PAP             67.0    7e-09    
ref|XP_011099801.1|  PREDICTED: probable plastid-lipid-associated...  66.2    7e-09    
gb|EJK57992.1|  hypothetical protein THAOC_21919                      65.5    8e-09    
ref|XP_001690132.1|  plastid lipid associated protein                 66.2    8e-09    
ref|XP_008784151.1|  PREDICTED: probable plastid-lipid-associated...  66.6    1e-08    
ref|XP_012071360.1|  PREDICTED: probable plastid-lipid-associated...  65.5    1e-08    
ref|XP_005854131.1|  pap fibrillin family protein                     66.2    1e-08    
ref|WP_028946443.1|  fimbrial protein                                 64.7    1e-08    
gb|KJB67237.1|  hypothetical protein B456_010G181700                  67.0    1e-08    
gb|KCW57059.1|  hypothetical protein EUGRSUZ_I02716                   65.5    2e-08    
ref|WP_026719769.1|  fibrillin                                        64.3    2e-08    
gb|KJB67236.1|  hypothetical protein B456_010G181700                  67.0    2e-08    
ref|XP_010554166.1|  PREDICTED: probable plastid-lipid-associated...  64.7    2e-08    
ref|XP_003581227.1|  PREDICTED: probable plastid-lipid-associated...  65.1    2e-08    
ref|XP_006399465.1|  hypothetical protein EUTSA_v10014407mg           65.1    2e-08    
ref|XP_002963739.1|  hypothetical protein SELMODRAFT_80175            63.5    2e-08    
ref|XP_005713282.1|  unnamed protein product                          65.1    2e-08    
ref|WP_011431174.1|  PAP/fibrillin family protein                     63.5    3e-08    
gb|KHG22065.1|  putative plastid-lipid-associated 4, chloroplasti...  64.3    3e-08    
gb|KJB16034.1|  hypothetical protein B456_002G209300                  63.9    3e-08    
ref|XP_010556359.1|  PREDICTED: probable plastid-lipid-associated...  63.9    3e-08    
ref|XP_003593055.1|  hypothetical protein MTR_2g007300                65.5    3e-08    
gb|EKF04089.1|  PAP/fibrillin family protein                          63.2    4e-08    
emb|CDX81141.1|  BnaC03g03950D                                        63.9    5e-08    
ref|XP_010491625.1|  PREDICTED: probable plastid-lipid-associated...  63.9    5e-08    
ref|WP_045869494.1|  fimbrial protein                                 63.2    5e-08    
ref|WP_039738237.1|  fibrillin                                        62.8    5e-08    
ref|XP_006580323.1|  PREDICTED: probable plastid-lipid-associated...  63.9    5e-08    
ref|XP_001781134.1|  predicted protein                                63.9    6e-08    
gb|KCW54282.1|  hypothetical protein EUGRSUZ_I00244                   62.8    6e-08    
ref|WP_008225055.1|  fibrillin                                        62.8    6e-08    
ref|XP_007041525.1|  Plastid-lipid associated protein PAP / fibri...  63.2    7e-08    
gb|KFK25274.1|  hypothetical protein AALP_AA8G090800                  63.2    8e-08    
emb|CBJ29036.1|  PAP fibrillin                                        63.5    8e-08    
ref|XP_006351024.1|  PREDICTED: probable plastid-lipid-associated...  62.8    8e-08    
ref|XP_005707169.1|  hypothetical protein Gasu_21080                  63.9    8e-08    
ref|XP_002873425.1|  structural molecule                              63.2    9e-08    
ref|XP_001692023.1|  fibrillin                                        62.0    1e-07    
ref|XP_010680278.1|  PREDICTED: probable plastid-lipid-associated...  62.4    1e-07    
ref|XP_011005194.1|  PREDICTED: probable plastid-lipid-associated...  62.4    1e-07    
ref|XP_010422936.1|  PREDICTED: probable plastid-lipid-associated...  62.4    1e-07    
ref|WP_027843196.1|  fimbrial protein                                 61.2    2e-07    
ref|WP_015203613.1|  PAP fibrillin                                    61.2    2e-07    
gb|EJK68912.1|  hypothetical protein THAOC_09876                      62.4    2e-07    
ref|NP_001031862.1|  putative plastid-lipid-associated protein 7      62.0    2e-07    



>ref|NP_001234183.1| plastid lipid associated protein CHRC [Solanum lycopersicum]
 gb|ABC42191.1| plastid lipid associated protein CHRC [Solanum lycopersicum]
Length=326

 Score =   459 bits (1181),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 239/329 (73%), Positives = 270/329 (82%), Gaps = 7/329 (2%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MASISS  Q  C+ + +    S  T K S  P++ST F SK    R+   +    P  KF
Sbjct  1     MASISSLNQIPCRTLQITSQYSKPTSKISTLPISSTNFPSKTELHRAISVKEFTYPKPKF  60

Query  1057  VVRAVS---DDEWGEEKKEPLSAAPAGVAVVEDEPAAL-TETDVLKKQLVDSFYGTNRGL  890
               +A +   +DEWG E ++    +P GVAVV++EP    +E ++LKKQL DSFYGTNRGL
Sbjct  61    TAQATNYDKEDEWGPEVEK---ISPGGVAVVDEEPPKEPSEIELLKKQLADSFYGTNRGL  117

Query  889   SASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVR  710
             SASSETRAE+VELITQLE+KNP PAPTEALTLLNGKW+LAYTSF GLFPLLSRG L LVR
Sbjct  118   SASSETRAEIVELITQLESKNPNPAPTEALTLLNGKWILAYTSFSGLFPLLSRGNLLLVR  177

Query  709   VEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTD  530
             VEEI QTIDSESFTVQNSVVF+GPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTD
Sbjct  178   VEEISQTIDSESFTVQNSVVFAGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTD  237

Query  529   SIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTT  350
             SIVLPENVEFLGQKIDL+PFKGLITS+QDTASSV KSISSQPP+KF ++N+NA+SWLLTT
Sbjct  238   SIVLPENVEFLGQKIDLSPFKGLITSVQDTASSVAKSISSQPPIKFPISNNNAQSWLLTT  297

Query  349   YLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             YLD ELRISRG+AGS+FVLIKE SPLLKP
Sbjct  298   YLDDELRISRGDAGSVFVLIKEGSPLLKP  326



>ref|NP_001275061.1| light-induced protein, chloroplastic [Solanum tuberosum]
 sp|P80471.2|LIPC_SOLTU RecName: Full=Light-induced protein, chloroplastic; AltName: 
Full=Drought-induced stress protein CDSP-34; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA75558.1| chloroplast drought-induced stress protein, 34 kD) [Solanum tuberosum]
Length=326

 Score =   455 bits (1171),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 242/329 (74%), Positives = 266/329 (81%), Gaps = 7/329 (2%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MASISS  Q  CK + +    S  T K S  P++ST F SK    RS   +   NP  KF
Sbjct  1     MASISSLNQIPCKTLQITSQYSKPTSKISTLPISSTNFPSKTELHRSISVKEFTNPKPKF  60

Query  1057  VVRAVS---DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETD-VLKKQLVDSFYGTNRGL  890
               +A +   +DEWG E ++     P GVAVVE+EP        +LKKQL DS YGTNRGL
Sbjct  61    TAQATNYDKEDEWGPEVEQ---IRPGGVAVVEEEPPKEPSEIELLKKQLADSLYGTNRGL  117

Query  889   SASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVR  710
             SASSETRAE+VELITQLE+KNP PAPTEALTLLNGKW+LAYTSF GLFPLLSRG LPLVR
Sbjct  118   SASSETRAEIVELITQLESKNPNPAPTEALTLLNGKWILAYTSFSGLFPLLSRGNLPLVR  177

Query  709   VEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTD  530
             VEEI QTIDSESFTVQNSVVF+GPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTD
Sbjct  178   VEEISQTIDSESFTVQNSVVFAGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTD  237

Query  529   SIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTT  350
             SIVLPENVEFLGQKIDL+PFKGLITS+QDTASSV KSISSQPP+KF + N+NA+SWLLTT
Sbjct  238   SIVLPENVEFLGQKIDLSPFKGLITSVQDTASSVAKSISSQPPIKFPITNNNAQSWLLTT  297

Query  349   YLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             YLD ELRISRG+AGS+FVLIKE SPLLKP
Sbjct  298   YLDDELRISRGDAGSVFVLIKEGSPLLKP  326



>sp|O99019.1|LIPC_SOLDE RecName: Full=Light-induced protein, chloroplastic; AltName: 
Full=C40.4; Flags: Precursor [Solanum demissum]
 emb|CAA10372.1| fibrillin [Solanum demissum]
Length=326

 Score =   454 bits (1167),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 241/329 (73%), Positives = 266/329 (81%), Gaps = 7/329 (2%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MASISS  Q  CK + +    S  T K S  P++ST F SK    RS   +   NP  KF
Sbjct  1     MASISSLNQIPCKTLQITSQYSKPTSKISTLPISSTNFLSKTEQHRSISVKEFTNPKPKF  60

Query  1057  VVRAVS---DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETD-VLKKQLVDSFYGTNRGL  890
               +A +   +DEWG E ++     P GVAVVE+EP        +LKKQL DS YGTNRGL
Sbjct  61    TAQATNYDKEDEWGPEVEQ---IRPGGVAVVEEEPPKEPSEIELLKKQLADSLYGTNRGL  117

Query  889   SASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVR  710
             SASSETRAE+VELITQLE+KNP PAPTEALTLLNGKW+LAYTSF GLFPLLSRG LPLVR
Sbjct  118   SASSETRAEIVELITQLESKNPNPAPTEALTLLNGKWILAYTSFSGLFPLLSRGNLPLVR  177

Query  709   VEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTD  530
             VEEI QTIDSESFTVQNSVVF+GPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTD
Sbjct  178   VEEISQTIDSESFTVQNSVVFAGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTD  237

Query  529   SIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTT  350
             SIVLPENVEFLGQKID++PFKGLITS+QDTASSVVKSISSQPP+KF + N+NA+SWLLTT
Sbjct  238   SIVLPENVEFLGQKIDVSPFKGLITSVQDTASSVVKSISSQPPIKFPITNNNAQSWLLTT  297

Query  349   YLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             YLD ELRI RG+AGS+FVLIKE SPLLKP
Sbjct  298   YLDDELRIPRGDAGSVFVLIKEGSPLLKP  326



>ref|XP_006449818.1| hypothetical protein CICLE_v10015934mg [Citrus clementina]
 sp|Q9ZWQ8.1|PAP_CITUN RecName: Full=Plastid-lipid-associated protein, chloroplastic; 
AltName: Full=CitPAP; Flags: Precursor [Citrus unshiu]
 dbj|BAA34702.1| homolog to plastid-lipid-associated protein [Citrus unshiu]
 gb|ESR63058.1| hypothetical protein CICLE_v10015934mg [Citrus clementina]
Length=323

 Score =   445 bits (1145),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 226/326 (69%), Positives = 262/326 (80%), Gaps = 4/326 (1%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MASIS   QF CK +    P +  T KPS+ P+NS   +  +A       +G        
Sbjct  1     MASISQTNQFPCKTLSQNPPHNQFTSKPSILPLNSVRISRSLAKKSFLSIQGFTRARPLV  60

Query  1057  VVRAVSDDEWGEEKKEPLSAAPAGVAVVEDE-PAALTETDVLKKQLVDSFYGTNRGLSAS  881
             + RA  DDEWG EK++    A   +AV E+E P  +TE D LKK LVDSFYGT+RGL+A+
Sbjct  61    LTRAADDDEWGPEKEKEGGGA---LAVAEEESPKEVTEIDNLKKALVDSFYGTDRGLNAT  117

Query  880   SETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEE  701
             SETRAE+VELITQLEAKNPTPAPTEALTLLN KW+L YTSF GLFPLLSRGTLPL RVEE
Sbjct  118   SETRAEIVELITQLEAKNPTPAPTEALTLLNAKWILVYTSFSGLFPLLSRGTLPLARVEE  177

Query  700   ICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIV  521
             I QTIDSE+FTVQNS+ F+GPLATTSISTNAKFEVRSPKRVQIKFEEG+IGTPQ+TDS+V
Sbjct  178   ISQTIDSENFTVQNSIQFAGPLATTSISTNAKFEVRSPKRVQIKFEEGVIGTPQVTDSLV  237

Query  520   LPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLD  341
             LPENVEFLGQKIDL+PFKG+++S+QDTASSV K+ISSQPPLKFS++NSNA+SWLLTTYLD
Sbjct  238   LPENVEFLGQKIDLSPFKGILSSVQDTASSVAKTISSQPPLKFSISNSNAQSWLLTTYLD  297

Query  340   SELRISRGEAGSIFVLIKEDSPLLKP  263
              +LRISR +AGS+FV IKE SPLL P
Sbjct  298   EDLRISRADAGSVFVFIKEGSPLLMP  323



>gb|KDO78378.1| hypothetical protein CISIN_1g020639mg [Citrus sinensis]
Length=323

 Score =   445 bits (1144),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 226/326 (69%), Positives = 262/326 (80%), Gaps = 4/326 (1%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MASIS   QF CK +    P +  T KPS+ P+NS   +  +A       +G        
Sbjct  1     MASISQTNQFPCKTLSQNPPHNQFTSKPSILPLNSVRISRSLAKKSFLSIQGFTRARPLV  60

Query  1057  VVRAVSDDEWGEEKKEPLSAAPAGVAVVEDE-PAALTETDVLKKQLVDSFYGTNRGLSAS  881
             + RA  DDEWG EK++    A   +AV E+E P  +TE D LKK LVDSFYGT+RGL+A+
Sbjct  61    LTRAADDDEWGPEKEKEEGGA---LAVAEEESPKEVTEIDNLKKALVDSFYGTDRGLNAT  117

Query  880   SETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEE  701
             SETRAE+VELITQLEAKNPTPAPTEALTLLN KW+L YTSF GLFPLLSRGTLPL RVEE
Sbjct  118   SETRAEIVELITQLEAKNPTPAPTEALTLLNAKWILVYTSFSGLFPLLSRGTLPLARVEE  177

Query  700   ICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIV  521
             I QTIDSE+FTVQNS+ F+GPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ+TDS+V
Sbjct  178   ISQTIDSENFTVQNSIRFAGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQVTDSLV  237

Query  520   LPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLD  341
             +PENVEFLGQKIDL+PFKG+++S+QDTASSV K+ISSQPPLKFS++NSNA+SWLLTTYLD
Sbjct  238   IPENVEFLGQKIDLSPFKGILSSVQDTASSVAKTISSQPPLKFSISNSNAQSWLLTTYLD  297

Query  340   SELRISRGEAGSIFVLIKEDSPLLKP  263
              +LRISR +AGS+FV IKE SPLL P
Sbjct  298   EDLRISRADAGSVFVFIKEGSPLLMP  323



>ref|XP_011086212.1| PREDICTED: light-induced protein, chloroplastic-like [Sesamum 
indicum]
Length=312

 Score =   444 bits (1143),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 237/324 (73%), Positives = 265/324 (82%), Gaps = 15/324 (5%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MASISS  QF  K        S S    ++ PVN   F +        P R  A   +KF
Sbjct  1     MASISSINQFSRKIFRGSSLNSKSKLNAALSPVNRINFPA-------VPLRKSAKLKQKF  53

Query  1057  VVRAVSDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASS  878
              V AVS+DEWG +  EP   AP GVAV++++P   +E D+LKKQLVDSFYGTNRGL ASS
Sbjct  54    TVGAVSEDEWGPDN-EP---APPGVAVIDEKP---SEIDILKKQLVDSFYGTNRGLGASS  106

Query  877   ETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRG-TLPLVRVEE  701
             +TRAE+VELITQLEAKNPTPAPTEALTLLNGKW+LAYT+F GLFPL SRG +LPL ++EE
Sbjct  107   DTRAEIVELITQLEAKNPTPAPTEALTLLNGKWILAYTTFSGLFPLFSRGASLPLAKLEE  166

Query  700   ICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIV  521
             I QTIDSE+FTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEG+IGTPQLTDSIV
Sbjct  167   ISQTIDSENFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGVIGTPQLTDSIV  226

Query  520   LPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLD  341
             LPENVEFLGQKIDLTPFKGL+TS+QDTASSV K+ISS+PPLKFS++NSNAESWLLTTYLD
Sbjct  227   LPENVEFLGQKIDLTPFKGLLTSVQDTASSVAKTISSRPPLKFSISNSNAESWLLTTYLD  286

Query  340   SELRISRGEAGSIFVLIKEDSPLL  269
              ELRISRG+ GSIFVLIKE SPLL
Sbjct  287   DELRISRGDGGSIFVLIKEGSPLL  310



>ref|XP_006467367.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Citrus sinensis]
Length=392

 Score =   445 bits (1144),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 226/326 (69%), Positives = 262/326 (80%), Gaps = 4/326 (1%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MASIS   QF CK +    P +  T KPS+ P+NS   +  +A       +G        
Sbjct  70    MASISQTNQFPCKTLSQNPPHNQFTSKPSILPLNSVRISRSLAKKSFLSIQGFTRARPLV  129

Query  1057  VVRAVSDDEWGEEKKEPLSAAPAGVAVVEDE-PAALTETDVLKKQLVDSFYGTNRGLSAS  881
             + RA  DDEWG EK++    A   +AV E+E P  +TE D LKK LVDSFYGT+RGL+A+
Sbjct  130   LTRAADDDEWGPEKEKEEGGA---LAVAEEESPKEVTEIDNLKKALVDSFYGTDRGLNAT  186

Query  880   SETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEE  701
             SETRAE+VELITQLEAKNPTPAPTEALTLLN KW+L YTSF GLFPLLSRGTLPL RVEE
Sbjct  187   SETRAEIVELITQLEAKNPTPAPTEALTLLNAKWILVYTSFSGLFPLLSRGTLPLARVEE  246

Query  700   ICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIV  521
             I QTIDSE+FTVQNS+ F+GPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ+TDS+V
Sbjct  247   ISQTIDSENFTVQNSIRFAGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQVTDSLV  306

Query  520   LPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLD  341
             +PENVEFLGQKIDL+PFKG+++S+QDTASSV K+ISSQPPLKFS++NSNA+SWLLTTYLD
Sbjct  307   IPENVEFLGQKIDLSPFKGILSSVQDTASSVAKTISSQPPLKFSISNSNAQSWLLTTYLD  366

Query  340   SELRISRGEAGSIFVLIKEDSPLLKP  263
              +LRISR +AGS+FV IKE SPLL P
Sbjct  367   EDLRISRADAGSVFVFIKEGSPLLMP  392



>gb|EYU33869.1| hypothetical protein MIMGU_mgv1a010099mg [Erythranthe guttata]
Length=322

 Score =   436 bits (1121),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 234/328 (71%), Positives = 260/328 (79%), Gaps = 21/328 (6%)
 Frame = -3

Query  1240  KMASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANP---  1070
             KMASI+S ++  C  +      S S P          I AS       FP    AN    
Sbjct  10    KMASIASISKLPCNSLKNSSQNSKSAP----------IVASCSVNRVKFPALSTANSAKV  59

Query  1069  NRKFVVRAVSDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGL  890
              R F VR VSDDEWG +  EP SA   GVAV+E++P   +E DVLKKQLVDSFYGTNRGL
Sbjct  60    KRDFSVRLVSDDEWGPDS-EPSSA---GVAVLEEKP---SEIDVLKKQLVDSFYGTNRGL  112

Query  889   SASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRG-TLPLV  713
             SASSETRAEVVELITQLEAKNPTPAPTEAL LLNGKW+LAYT+F GLFPLLSRG T PLV
Sbjct  113   SASSETRAEVVELITQLEAKNPTPAPTEALPLLNGKWILAYTTFAGLFPLLSRGATFPLV  172

Query  712   RVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLT  533
             ++EEI QTID+++FTVQNSV+FSGPLATT+I+TNAKFEVRSPKRVQIKFE G+IGTPQLT
Sbjct  173   KLEEISQTIDADNFTVQNSVLFSGPLATTAITTNAKFEVRSPKRVQIKFEGGVIGTPQLT  232

Query  532   DSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLT  353
             DSIVLPENVEFLGQ IDL+PFKGL  S+QDTASSV K+ISSQPPLKFS++N NAESWLLT
Sbjct  233   DSIVLPENVEFLGQNIDLSPFKGLFASVQDTASSVAKTISSQPPLKFSISNKNAESWLLT  292

Query  352   TYLDSELRISRGEAGSIFVLIKEDSPLL  269
             TYLD ELRISRG+ GSIFVLIKE SPLL
Sbjct  293   TYLDDELRISRGDGGSIFVLIKEGSPLL  320



>ref|XP_009628206.1| PREDICTED: light-induced protein, chloroplastic [Nicotiana tomentosiformis]
Length=322

 Score =   436 bits (1120),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 232/329 (71%), Positives = 264/329 (80%), Gaps = 11/329 (3%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MASISS  Q  CK + +    S ST K S  P+ ST F S   +++ F      NP  KF
Sbjct  1     MASISSLNQIPCKTLQITSQYSKSTSKISTLPLTSTNFPS--ISVKEF-----TNPKPKF  53

Query  1057  VVRAVS---DDEWGEEKKE-PLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGL  890
               +A +   +DEWG E ++   S     VA  E      +E ++LKKQLVDSFYGTNRGL
Sbjct  54    TAQAKNYDKEDEWGPEVEQIKPSGGGVSVAEEEPPKEEPSEIELLKKQLVDSFYGTNRGL  113

Query  889   SASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVR  710
             SASSETRAE+VELIT+LE+KNPTPAPTEAL LLNGKW+LAYTSF GLFPLLSRGTLPLVR
Sbjct  114   SASSETRAEIVELITKLESKNPTPAPTEALPLLNGKWILAYTSFSGLFPLLSRGTLPLVR  173

Query  709   VEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTD  530
             VEEI QTIDSE+FTVQNSVVF+GPLATTSI+TNAKFEVRSPKRVQIKF+EGIIGTPQLTD
Sbjct  174   VEEISQTIDSEAFTVQNSVVFAGPLATTSITTNAKFEVRSPKRVQIKFDEGIIGTPQLTD  233

Query  529   SIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTT  350
             SI LPEN+EFLGQKIDL+PFKGL+ S+QDTASSV KSISSQPP+KF ++NSNA+SWLLTT
Sbjct  234   SIELPENIEFLGQKIDLSPFKGLVNSVQDTASSVAKSISSQPPIKFPISNSNAQSWLLTT  293

Query  349   YLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             YLD ELRISRG+ GS+FVLIKE SPLLKP
Sbjct  294   YLDHELRISRGDGGSVFVLIKEGSPLLKP  322



>ref|XP_009795634.1| PREDICTED: light-induced protein, chloroplastic [Nicotiana sylvestris]
Length=321

 Score =   434 bits (1115),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 234/329 (71%), Positives = 263/329 (80%), Gaps = 12/329 (4%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MASISS  Q  CK + +    S  T K S FP+ ST F S   +++ F      NP  KF
Sbjct  1     MASISSLNQIPCKTLQITSQYSKPTSKISTFPITSTNFPS--ISVKEF-----TNPKPKF  53

Query  1057  VVRAVS---DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETD-VLKKQLVDSFYGTNRGL  890
               +A +   DDEWG E  E +  +  GVAV E+EP        +LKKQLVDSFYGTNRGL
Sbjct  54    TAQAKNYDKDDEWGPEV-EQIKPSGGGVAVAEEEPPKEPSEIELLKKQLVDSFYGTNRGL  112

Query  889   SASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVR  710
             SASSETRAE+VELIT+LE+ NPTPAPTEAL LLNGKW+LAYTSF GLFPLLSRGTLPLVR
Sbjct  113   SASSETRAEIVELITKLESMNPTPAPTEALPLLNGKWILAYTSFSGLFPLLSRGTLPLVR  172

Query  709   VEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTD  530
             +EEI QTIDSE+F VQN VVF+GPLATTSI+TNAKFEVRSPKRVQIKF+EGIIGTPQLTD
Sbjct  173   IEEISQTIDSETFAVQNCVVFAGPLATTSITTNAKFEVRSPKRVQIKFDEGIIGTPQLTD  232

Query  529   SIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTT  350
             SI LPENVEFLGQKIDL+PFKGLI S+QDTASSV KSISSQPP+KF ++NSNA+SWLLTT
Sbjct  233   SIELPENVEFLGQKIDLSPFKGLINSVQDTASSVAKSISSQPPIKFPISNSNAQSWLLTT  292

Query  349   YLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             YLD ELRISRG+ GS+FVLIKE SPLLKP
Sbjct  293   YLDDELRISRGDGGSVFVLIKEGSPLLKP  321



>gb|AIX87511.1| fibrillin [Lycium barbarum]
Length=321

 Score =   430 bits (1105),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 228/331 (69%), Positives = 260/331 (79%), Gaps = 16/331 (5%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MASISS  Q  CK + + C  S  T K S FP       SK    +    +   NP  +F
Sbjct  1     MASISSLNQLPCKTLQITCKYSKPTSKISTFP-------SKTEVHKPISIKQSTNPKPRF  53

Query  1057  VVRAV---SDDEWGEEKKEPLSAAPAGVAVVEDEPAAL---TETDVLKKQLVDSFYGTNR  896
              V+A     DDEWG E ++     P+GVAV E+EP      +E D+LKK+L D+FYGTNR
Sbjct  54    TVQATKYDQDDEWGPEVEQ---IKPSGVAVAEEEPPKPKEPSEIDLLKKELTDAFYGTNR  110

Query  895   GLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPL  716
             GLSASSETRAE+VELITQLE+KNPTPAPTEALTLLNG+W+LAYTSF GLFPLLSRG LPL
Sbjct  111   GLSASSETRAEIVELITQLESKNPTPAPTEALTLLNGRWILAYTSFSGLFPLLSRGNLPL  170

Query  715   VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  536
             +RVEEI QTIDSE+F VQNSVVF+GPL TT ISTNAKFEVRSPKRVQIKF+EGII TPQL
Sbjct  171   LRVEEISQTIDSENFAVQNSVVFAGPLTTTEISTNAKFEVRSPKRVQIKFDEGIIRTPQL  230

Query  535   TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  356
             TDSI  PENVEFLGQKIDL+PFKGLITS+QDTASSV KSIS+QPP+KF ++  +A+SWLL
Sbjct  231   TDSIEFPENVEFLGQKIDLSPFKGLITSVQDTASSVAKSISNQPPIKFPISTDSAQSWLL  290

Query  355   TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             TTYLD ELRISRG+AGS+FVLIKE SPLLKP
Sbjct  291   TTYLDDELRISRGDAGSVFVLIKEGSPLLKP  321



>ref|XP_009788638.1| PREDICTED: light-induced protein, chloroplastic-like [Nicotiana 
sylvestris]
Length=321

 Score =   430 bits (1105),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 233/329 (71%), Positives = 262/329 (80%), Gaps = 12/329 (4%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MASISS  Q  CK + +    S  T K S FP+ ST F S   +++ F      NP  KF
Sbjct  1     MASISSLNQIPCKTLQITSQYSKPTSKISTFPITSTNFPS--ISVKEF-----TNPKPKF  53

Query  1057  VVRAVS---DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETD-VLKKQLVDSFYGTNRGL  890
               +A +   DDEWG E  E +  +  GVAV E+EP        +LKKQLVDSFYGTNRGL
Sbjct  54    TAQAKNYDKDDEWGPEV-EQIKPSGGGVAVAEEEPPKEPSEIELLKKQLVDSFYGTNRGL  112

Query  889   SASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVR  710
             SASSETRAE+VELIT+LE+ NPTPAPTEAL LLNGKW+LAYTSF GLFPLLSRGTLPLVR
Sbjct  113   SASSETRAEIVELITKLESMNPTPAPTEALPLLNGKWILAYTSFSGLFPLLSRGTLPLVR  172

Query  709   VEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTD  530
             VEEI QTIDS +F VQN VVF+GPLATTSI+TNAKFEV+SPKRVQIKF+EGIIGTPQLTD
Sbjct  173   VEEISQTIDSGTFAVQNCVVFAGPLATTSITTNAKFEVKSPKRVQIKFDEGIIGTPQLTD  232

Query  529   SIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTT  350
             SI LPENVEFLGQKIDL+PFKGLI S+QDTASSV KSISSQPP+KF ++NSNA+SWLLTT
Sbjct  233   SIELPENVEFLGQKIDLSPFKGLINSVQDTASSVAKSISSQPPIKFPISNSNAQSWLLTT  292

Query  349   YLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             YLD ELRISRG+ GS+FVLIKE SPLLKP
Sbjct  293   YLDDELRISRGDGGSVFVLIKEGSPLLKP  321



>ref|XP_002524410.1| Plastid-lipid-associated protein, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF38021.1| Plastid-lipid-associated protein, chloroplast precursor, putative 
[Ricinus communis]
Length=321

 Score =   429 bits (1104),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 229/330 (69%), Positives = 261/330 (79%), Gaps = 11/330 (3%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRK-  1061
             MASIS   QF CK +      S  T +PSVF + +T          S     L+   R  
Sbjct  1     MASISQLNQFPCKTLSTPPCNSKFTSRPSVFSIKTTT---------SICRPTLSTGTRPV  51

Query  1060  FVVRAV-SDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSA  884
             F +RAV ++DEWG + ++   A     +  + +P  +TE D LKKQLVDSFYGT+RGL A
Sbjct  52    FSIRAVDAEDEWGPDYEDSAVAVAEEESEEKLKPTEVTEIDSLKKQLVDSFYGTDRGLKA  111

Query  883   SSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVE  704
             +SETRAE+VELITQLE+KNPT APTEALTLLNGKW+LAYTSF GLFPLLSRGTLPLV+VE
Sbjct  112   TSETRAEIVELITQLESKNPTAAPTEALTLLNGKWILAYTSFSGLFPLLSRGTLPLVKVE  171

Query  703   EICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSI  524
             EI QTIDSE+FTVQNSV FSGPLATTSISTNAKFEVRSPKRVQIKF+EGIIGTPQLTDSI
Sbjct  172   EISQTIDSENFTVQNSVQFSGPLATTSISTNAKFEVRSPKRVQIKFDEGIIGTPQLTDSI  231

Query  523   VLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYL  344
             VLPENVEFLGQKIDLTPFKG+ITS+QDTASSV K+ISSQPPLK  ++N+NA+SWLLTTYL
Sbjct  232   VLPENVEFLGQKIDLTPFKGIITSVQDTASSVAKTISSQPPLKIPISNNNAQSWLLTTYL  291

Query  343   DSELRISRGEAGSIFVLIKEDSPLLKP*TN  254
             D +LRISR +AGSIFVLIKE SPLL   TN
Sbjct  292   DEDLRISRADAGSIFVLIKEGSPLLTSLTN  321



>gb|AIX87535.1| fibrillin [Lycium ruthenicum]
Length=321

 Score =   429 bits (1103),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 225/331 (68%), Positives = 257/331 (78%), Gaps = 16/331 (5%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MASISS  Q  CK + +    S  T K S FP       SK    +    +   NP  +F
Sbjct  1     MASISSLNQLPCKTLQITSKYSKPTSKISTFP-------SKTELHKPISIKQSTNPKPRF  53

Query  1057  VVRAVS---DDEWGEEKKEPLSAAPAGVAVVEDEP---AALTETDVLKKQLVDSFYGTNR  896
               +  +   +DEWG    EP    P+GVAV E+EP      +E D+LKK+L D+FYGTNR
Sbjct  54    TAQGTNYDKEDEWG---PEPEQIKPSGVAVAEEEPPKPKESSEIDLLKKKLTDAFYGTNR  110

Query  895   GLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPL  716
             GLSASSETRAE+VELITQLE+KNPTPAPTEALTLLNG+W+LAYTSF GLFPLLSRG LPL
Sbjct  111   GLSASSETRAEIVELITQLESKNPTPAPTEALTLLNGRWILAYTSFSGLFPLLSRGNLPL  170

Query  715   VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  536
             +RVEEI QTIDSE+F VQNSVVF+GPL TT ISTNAK EVRSPKRVQIKF+EGII TPQL
Sbjct  171   LRVEEISQTIDSENFAVQNSVVFAGPLTTTEISTNAKLEVRSPKRVQIKFDEGIIRTPQL  230

Query  535   TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  356
             TDSI LPENVEFLGQKIDL+PFKGLITS+QDTASSV KSIS+QPP+KF ++  +A+SWLL
Sbjct  231   TDSIELPENVEFLGQKIDLSPFKGLITSVQDTASSVAKSISNQPPIKFPISTDSAQSWLL  290

Query  355   TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             TTYLD ELRISRG+AGS+FVLIKE SPLLKP
Sbjct  291   TTYLDDELRISRGDAGSVFVLIKEGSPLLKP  321



>ref|XP_007026203.1| Plastid-lipid associated protein PAP / fibrillin family protein 
[Theobroma cacao]
 gb|EOY28825.1| Plastid-lipid associated protein PAP / fibrillin family protein 
[Theobroma cacao]
Length=427

 Score =   431 bits (1108),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 234/356 (66%), Positives = 269/356 (76%), Gaps = 38/356 (11%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSS-TPKPSVFPVNST------IFASKVAALRSFPNRGL  1079
             MA++S   QF CK   +  PRS +   KPS+ P NST      I  S+   L++   R +
Sbjct  79    MATVSQLNQFPCK-TFLSTPRSRNLASKPSILPQNSTKPTQNLIKKSQFFTLKAVRERPV  137

Query  1078  ANPNRKFVVRAVSDDEWGEEK------KEPLSAAPAGVAVVEDEPAALTETDVLKKQLVD  917
                   F VRAV DDE+G +K      ++P++ +PA     E++P  ++E D LKK LVD
Sbjct  138   ------FQVRAVYDDEYGPDKAEEEEEEQPVTESPAVAVAEEEKPKEVSEVDSLKKALVD  191

Query  916   SFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLA-----------  770
             SFYGTNRGL A+SETRAE+VELITQLEAKNPTPAPTEALTLLNGKW+LA           
Sbjct  192   SFYGTNRGLKATSETRAEIVELITQLEAKNPTPAPTEALTLLNGKWILAVKLPVSSLLVF  251

Query  769   -------YTSFIGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTN  611
                    YTSF GLFPLLSRG LPLV+VEEI QTID+ESFTVQNSV FSGPLA+ +ISTN
Sbjct  252   CLDVAIKYTSFPGLFPLLSRGQLPLVKVEEISQTIDAESFTVQNSVQFSGPLASNTISTN  311

Query  610   AKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASS  431
             AKFEVRSPKRVQIKF+EGIIGTPQLTDSIVLPENVEFLGQ+ DLTP KGL+TS+QDTASS
Sbjct  312   AKFEVRSPKRVQIKFQEGIIGTPQLTDSIVLPENVEFLGQRFDLTPVKGLLTSVQDTASS  371

Query  430   VVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             V K+ISSQPPLKFSL+NSNAESWLLTTYLD ELRISRG+AGS+FVLIKE S LL P
Sbjct  372   VAKTISSQPPLKFSLSNSNAESWLLTTYLDEELRISRGDAGSVFVLIKEGSALLTP  427



>emb|CAN69132.1| hypothetical protein VITISV_012048 [Vitis vinifera]
Length=281

 Score =   425 bits (1093),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 222/275 (81%), Positives = 237/275 (86%), Gaps = 4/275 (1%)
 Frame = -3

Query  1084  GLANPNRKFV-VRAVSDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFY  908
             G  N  R  V VR   DDEWG EK EP     + VAVVE+E +   E   LKK LVDSFY
Sbjct  10    GEVNRGRPVVLVRTALDDEWGPEKXEP-EGEGSTVAVVEEEKSK--EITSLKKALVDSFY  66

Query  907   GTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRG  728
             GT+RGL A+SETRAE+VELITQLEAKNPTPAPTEALTLLNGKW+LAYTSF GLFPLLSRG
Sbjct  67    GTDRGLKATSETRAEIVELITQLEAKNPTPAPTEALTLLNGKWILAYTSFAGLFPLLSRG  126

Query  727   TLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIG  548
             TLPLV+VEEI QTIDSE+FTVQNSV FSGPLATTSISTNAKFEVRSPKRVQIKF+EGIIG
Sbjct  127   TLPLVKVEEISQTIDSENFTVQNSVQFSGPLATTSISTNAKFEVRSPKRVQIKFQEGIIG  186

Query  547   TPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAE  368
             TPQLTDSI LPENVEFLGQ IDLTPFKGLITS+QDTASSV K+ISSQPPLKFS+ NSNAE
Sbjct  187   TPQLTDSIELPENVEFLGQNIDLTPFKGLITSVQDTASSVAKTISSQPPLKFSIPNSNAE  246

Query  367   SWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             SWLLTTYLD +LRISRG+AGSIFVLIKE S LL P
Sbjct  247   SWLLTTYLDEDLRISRGDAGSIFVLIKEGSSLLVP  281



>emb|CAA50750.1| fibrillin [Capsicum annuum]
 emb|CAA65784.1| plastoglobules associated protein [Capsicum annuum]
 emb|CAA66160.1| plastoglobules associated protein [Capsicum annuum]
 emb|CAA10373.1| plastid-lipid-associated protein [Capsicum annuum]
 gb|AIX02794.1| fibrillin 1 protein [Capsicum annuum]
Length=322

 Score =   426 bits (1096),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 231/329 (70%), Positives = 261/329 (79%), Gaps = 11/329 (3%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MASISS  Q  CK + +    +S   K S  P+ S  F SK    RS   +   NP  KF
Sbjct  1     MASISSLNQIPCKTLQI----TSQYSKISSLPLTSPNFPSKTELHRSISIKEFTNPKPKF  56

Query  1057  VVRAVS---DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDV-LKKQLVDSFYGTNRGL  890
               +A +   +DEWG E ++     P GVAVVE+EP         LKKQL DSFYGTNRGL
Sbjct  57    TAQATNYDKEDEWGPELEQ---INPGGVAVVEEEPPKEPSEMEKLKKQLTDSFYGTNRGL  113

Query  889   SASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVR  710
             SASSETRAE+VELITQLE+KNPTPAPTEAL+LLNGKW+LAYTSF GLFPLL+RG L  VR
Sbjct  114   SASSETRAEIVELITQLESKNPTPAPTEALSLLNGKWILAYTSFSGLFPLLARGNLLPVR  173

Query  709   VEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTD  530
             VEEI QTID+E+ TVQNSVVF+GPL+TTSISTNAKFEVRSPKR+QI FEEGIIGTPQLTD
Sbjct  174   VEEISQTIDAETLTVQNSVVFAGPLSTTSISTNAKFEVRSPKRLQINFEEGIIGTPQLTD  233

Query  529   SIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTT  350
             SI LPENVEFLGQKIDL+PFKGLITS+QDTA+SV KSISSQPP+KF ++NS A+SWLLTT
Sbjct  234   SIELPENVEFLGQKIDLSPFKGLITSVQDTATSVAKSISSQPPIKFPISNSYAQSWLLTT  293

Query  349   YLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             YLD+ELRISRG+AGSIFVLIKE SPLLKP
Sbjct  294   YLDAELRISRGDAGSIFVLIKEGSPLLKP  322



>gb|KJB57828.1| hypothetical protein B456_009G182500 [Gossypium raimondii]
Length=326

 Score =   426 bits (1095),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 226/326 (69%), Positives = 258/326 (79%), Gaps = 4/326 (1%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSS-TPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRK  1061
             MA++S    F CK   +I P++S+ T K  V P+NST           F  +    P   
Sbjct  1     MATVSQLNNFPCKTF-LITPQNSNFTSKLPVLPLNSTKPTQNSIKKSQFLTQKSVQPRPV  59

Query  1060  FVVRAV-SDDEWGEEKKEPLSAAPAGVAVVEDE-PAALTETDVLKKQLVDSFYGTNRGLS  887
             F VRA  +DDEWG +K+EP+     GVAV E++ P    E + LKK LVDSFYGT+RGL 
Sbjct  60    FQVRASDADDEWGPDKEEPVVIESPGVAVAEEKKPDDAGEIESLKKALVDSFYGTDRGLK  119

Query  886   ASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRV  707
             ASSETRAE+VELITQLEAKNPTPAPTEAL LLNGKW+L YTSF GLFPLLSRG  PLV+V
Sbjct  120   ASSETRAEIVELITQLEAKNPTPAPTEALPLLNGKWILKYTSFPGLFPLLSRGQFPLVKV  179

Query  706   EEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDS  527
             EEI QTID+ES TVQNSV F+GPLA++SIST+AKFEVRSPKRVQIKF+EGIIGTPQLTDS
Sbjct  180   EEISQTIDAESLTVQNSVQFAGPLASSSISTSAKFEVRSPKRVQIKFQEGIIGTPQLTDS  239

Query  526   IVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTY  347
             IVLPENVEFLGQKIDLTP KGL+TS+QDTASSV K+ISSQPPLK  L+NSNAESWLLTTY
Sbjct  240   IVLPENVEFLGQKIDLTPIKGLLTSVQDTASSVAKTISSQPPLKIPLSNSNAESWLLTTY  299

Query  346   LDSELRISRGEAGSIFVLIKEDSPLL  269
             LD ELRISRG+AGS+FVL+KE S LL
Sbjct  300   LDDELRISRGDAGSVFVLVKEGSALL  325



>gb|KHG02015.1| Plastid-lipid-associated, chloroplastic [Gossypium arboreum]
Length=326

 Score =   425 bits (1093),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 225/326 (69%), Positives = 258/326 (79%), Gaps = 4/326 (1%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSS-TPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRK  1061
             MA++S    F CK   +I P++S+ T K  V P+NST           F  +    P   
Sbjct  1     MATVSQLNNFPCKTF-LITPQNSNFTSKLPVLPLNSTKPTQNSIKKSQFLTQKSVQPRPV  59

Query  1060  FVVRAV-SDDEWGEEKKEPLSAAPAGVAVVEDE-PAALTETDVLKKQLVDSFYGTNRGLS  887
             F +RA  +DDEWG +K+EP+     GVAV E++ P    E + LKK LVDSFYGT+RGL 
Sbjct  60    FQIRASDADDEWGPDKEEPVVIESPGVAVAEEKKPDDAGEIESLKKALVDSFYGTDRGLK  119

Query  886   ASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRV  707
             ASSETRAE+VELITQLEAKNPTPAPTEAL LLNGKW+L YTSF GLFPLLSRG  PLV+V
Sbjct  120   ASSETRAEIVELITQLEAKNPTPAPTEALPLLNGKWILKYTSFPGLFPLLSRGQFPLVKV  179

Query  706   EEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDS  527
             EEI QTID+ES TVQNSV F+GPLA++SIST+AKFEVRSPKRVQIKF+EGIIGTPQLTDS
Sbjct  180   EEISQTIDAESLTVQNSVQFAGPLASSSISTSAKFEVRSPKRVQIKFQEGIIGTPQLTDS  239

Query  526   IVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTY  347
             IVLPENVEFLGQKIDLTP KGL+TS+QDTASSV K+ISSQPPLK  L+NSNAESWLLTTY
Sbjct  240   IVLPENVEFLGQKIDLTPIKGLLTSVQDTASSVAKTISSQPPLKIPLSNSNAESWLLTTY  299

Query  346   LDSELRISRGEAGSIFVLIKEDSPLL  269
             LD ELRISRG+AGS+FVL+KE S LL
Sbjct  300   LDDELRISRGDAGSVFVLVKEGSALL  325



>gb|AIX02791.1| fibrillin 1 protein [Capsicum annuum]
Length=322

 Score =   425 bits (1093),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 230/329 (70%), Positives = 260/329 (79%), Gaps = 11/329 (3%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MASISS  Q  CK + +    +S   K S  P+ S  F SK    RS   +   NP  KF
Sbjct  1     MASISSLNQIPCKTLQI----TSQYSKISSLPLTSPNFPSKTELHRSISIKEFTNPKPKF  56

Query  1057  VVRAVS---DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDV-LKKQLVDSFYGTNRGL  890
               +A +   +DEWG E ++     P GVAVVE+EP         LKKQL DSFYGTNRGL
Sbjct  57    TAQATNYDKEDEWGPELEQ---INPGGVAVVEEEPPKEPSEMEKLKKQLTDSFYGTNRGL  113

Query  889   SASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVR  710
             SASSETRAE+VELITQLE+KNPTPAPTEAL+LLNGKW+LAYTSF GLFPLL+RG L  VR
Sbjct  114   SASSETRAEIVELITQLESKNPTPAPTEALSLLNGKWILAYTSFSGLFPLLARGNLLPVR  173

Query  709   VEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTD  530
             VEEI QTID+E+ TVQNS VF+GPL+TTSISTNAKFEVRSPKR+QI FEEGIIGTPQLTD
Sbjct  174   VEEISQTIDAETLTVQNSAVFAGPLSTTSISTNAKFEVRSPKRLQINFEEGIIGTPQLTD  233

Query  529   SIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTT  350
             SI LPENVEFLGQKIDL+PFKGLITS+QDTA+SV KSISSQPP+KF ++NS A+SWLLTT
Sbjct  234   SIELPENVEFLGQKIDLSPFKGLITSVQDTATSVAKSISSQPPIKFPISNSYAQSWLLTT  293

Query  349   YLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             YLD+ELRISRG+AGSIFVLIKE SPLLKP
Sbjct  294   YLDAELRISRGDAGSIFVLIKEGSPLLKP  322



>gb|AIX02792.1| fibrillin 1 protein [Capsicum annuum]
 gb|AIX02793.1| fibrillin 1 protein [Capsicum annuum]
Length=322

 Score =   425 bits (1092),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 230/329 (70%), Positives = 260/329 (79%), Gaps = 11/329 (3%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MASISS  Q  CK + +    +S   K S  P+ S  F SK    RS   +   NP  KF
Sbjct  1     MASISSLNQIPCKTLQI----TSQYSKISSLPLTSPNFPSKTELHRSISIKEFTNPKPKF  56

Query  1057  VVRAVS---DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDV-LKKQLVDSFYGTNRGL  890
               +A +   +DEWG E ++     P GVAVVE+EP         LKKQL DSFYGTNRGL
Sbjct  57    TAQATNYDKEDEWGPELEQ---INPGGVAVVEEEPPKEPSEMEKLKKQLTDSFYGTNRGL  113

Query  889   SASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVR  710
             SASSETRAE+VELITQLE+KNPTPAPTEAL+LLNGKW+LAYTSF GLFPLL+RG L  VR
Sbjct  114   SASSETRAEIVELITQLESKNPTPAPTEALSLLNGKWILAYTSFSGLFPLLARGNLLPVR  173

Query  709   VEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTD  530
             VEEI QTID+E+ TVQNSVVF+GPL+TTSISTNAKFEVRSPKR+QI FEEGIIG PQLTD
Sbjct  174   VEEISQTIDAETLTVQNSVVFAGPLSTTSISTNAKFEVRSPKRLQINFEEGIIGAPQLTD  233

Query  529   SIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTT  350
             SI LPENVEFLGQKIDL+PFKGLITS+QDTA+SV KSISSQPP+KF ++NS A+SWLLTT
Sbjct  234   SIELPENVEFLGQKIDLSPFKGLITSVQDTATSVAKSISSQPPIKFPISNSYAQSWLLTT  293

Query  349   YLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             YLD+ELRISRG+AGSIFVLIKE SPLLKP
Sbjct  294   YLDAELRISRGDAGSIFVLIKEGSPLLKP  322



>ref|XP_006383843.1| chromoplast-specific carotenoid-associated protein CHRC [Populus 
trichocarpa]
 gb|ERP61640.1| chromoplast-specific carotenoid-associated protein CHRC [Populus 
trichocarpa]
Length=329

 Score =   421 bits (1083),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 226/337 (67%), Positives = 260/337 (77%), Gaps = 20/337 (6%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSS--STPKPSVFPVNS---------TIFASKVAALRSFP  1091
             MA+IS   QF CK +    P  S  ++ +PS+ P+NS         +I   ++   R  P
Sbjct  1     MAAISQLNQFPCKTLSSKTPLFSHFTSSRPSIIPLNSIKNNPTTNNSILKPRILVTREQP  60

Query  1090  NRGLANPNRKFVVRAVSDDEWGEEKKEPLSAAPAGVAVVEDEPAAL-TETDVLKKQLVDS  914
              +        F+V+AV +DE   E + P    P  +A   +E      E D LK QLVD+
Sbjct  61    TKK----RNLFLVKAVDEDEGSPENEGP----PVALAEKGEEELKELAEVDRLKGQLVDT  112

Query  913   FYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLS  734
             FYGT+RGL+A+SETRAEVVELITQLEA+NP PAPTEALTLLNGKW+LAYTSF GLFPLLS
Sbjct  113   FYGTDRGLNATSETRAEVVELITQLEARNPNPAPTEALTLLNGKWILAYTSFAGLFPLLS  172

Query  733   RGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI  554
             RGTLPLV+VEEI QTIDSE+ TVQNSV FSGPLATTSISTNAKFEVRSPKRVQIKFEEGI
Sbjct  173   RGTLPLVKVEEISQTIDSENLTVQNSVQFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI  232

Query  553   IGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSN  374
             IGTP+LTDSI LPENVEFLGQKIDLTPF+G+I+S+QDTASSV K+ISSQPPLKFS+ N N
Sbjct  233   IGTPKLTDSIELPENVEFLGQKIDLTPFRGIISSVQDTASSVAKTISSQPPLKFSIPNRN  292

Query  373   AESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             AESWLLTTYLD +LRISRG+AGSIFVLIKE SPLL P
Sbjct  293   AESWLLTTYLDDDLRISRGDAGSIFVLIKEGSPLLTP  329



>ref|XP_011047005.1| PREDICTED: plastid-lipid-associated protein, chloroplastic [Populus 
euphratica]
Length=329

 Score =   421 bits (1082),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 224/337 (66%), Positives = 261/337 (77%), Gaps = 20/337 (6%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSS--STPKPSVFPVNS---------TIFASKVAALRSFP  1091
             MA+IS   QF CK +    P  S  ++ +PS+ P+NS         +I   ++   R  P
Sbjct  1     MAAISQLNQFPCKTLSSKTPLFSHFTSSRPSIIPLNSIKNNPTTNNSILKPRILVTREQP  60

Query  1090  NRGLANPNRKFVVRAVSDDEWGEEKKEPLSAAPAGVAVVEDEPAAL-TETDVLKKQLVDS  914
              +         +V+AV +DE   E + P    P  +A   +E      E D LK QLVD+
Sbjct  61    TKK----RNLLLVKAVDEDEGSPEDEGP----PVALAEKGEEELKELAEVDRLKGQLVDT  112

Query  913   FYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLS  734
             FYGT+RGL+A+SETRAEVVELITQLEA+NP PAPTEALTLLNGKW+LAYTSF GLFPLLS
Sbjct  113   FYGTDRGLNATSETRAEVVELITQLEARNPNPAPTEALTLLNGKWILAYTSFAGLFPLLS  172

Query  733   RGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI  554
             RGTLPLV+VEEI QTIDSE+ TVQNSV+FSGPLATTSISTNAKFEVRSPKRVQIKFEEGI
Sbjct  173   RGTLPLVKVEEISQTIDSENLTVQNSVLFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI  232

Query  553   IGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSN  374
             IGTP+LTDSI LPENVEFLGQKIDLTPF+G+I+S+QDTASSV K+ISSQPPLKFS++N N
Sbjct  233   IGTPKLTDSIELPENVEFLGQKIDLTPFRGIISSVQDTASSVAKTISSQPPLKFSISNRN  292

Query  373   AESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             AESWLLTTYLD +LRISRG+AGS+FVLIKE SPLL P
Sbjct  293   AESWLLTTYLDDDLRISRGDAGSVFVLIKEGSPLLTP  329



>ref|XP_012091280.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Jatropha curcas]
 gb|KDP20693.1| hypothetical protein JCGZ_21164 [Jatropha curcas]
Length=311

 Score =   420 bits (1080),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 224/323 (69%), Positives = 252/323 (78%), Gaps = 16/323 (5%)
 Frame = -3

Query  1231  SISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKFVV  1052
             +IS    F CK +    P S    +PSV P  S   A+ ++         L  P   F+V
Sbjct  5     TISQLNHFPCKTLSKTPPNSQFNSRPSVLPFPSIKLANSIS------KSTLGRP--AFLV  56

Query  1051  RAVSDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSET  872
             RAV DD          SA+ A      + P   +E D LKKQLVDSFYGT+RGL+ASSET
Sbjct  57    RAVDDDG--------ESASEAVAVAEVEAPKEPSEVDALKKQLVDSFYGTDRGLTASSET  108

Query  871   RAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQ  692
             RAE+VELITQLEAKNPT APTEALTLLNGKW+LAYTSF GLFPLLSRG LPLV+VEEI Q
Sbjct  109   RAEIVELITQLEAKNPTAAPTEALTLLNGKWILAYTSFSGLFPLLSRGRLPLVKVEEISQ  168

Query  691   TIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPE  512
             TIDSE+FTVQNSV FSGPLATTSISTNAKFEVRSPKRVQIKFEEG+IGTPQLTDSIV+PE
Sbjct  169   TIDSENFTVQNSVQFSGPLATTSISTNAKFEVRSPKRVQIKFEEGVIGTPQLTDSIVIPE  228

Query  511   NVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSEL  332
             NVEFLGQKIDLTP KG++TS+QDTASSV K+ISSQPPLKF ++N+NAESWLLTTYLD +L
Sbjct  229   NVEFLGQKIDLTPLKGILTSVQDTASSVAKTISSQPPLKFPISNTNAESWLLTTYLDEDL  288

Query  331   RISRGEAGSIFVLIKEDSPLLKP  263
             RISRG+ GS+FVLIKE SPLLKP
Sbjct  289   RISRGDGGSVFVLIKEGSPLLKP  311



>gb|ABK96652.1| unknown [Populus trichocarpa x Populus deltoides]
Length=329

 Score =   420 bits (1080),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 227/337 (67%), Positives = 259/337 (77%), Gaps = 20/337 (6%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSS--STPKPSVFPVNS---------TIFASKVAALRSFP  1091
             MA+IS   QF CK +    P  S  ++ +PS  P+NS         +I   ++   R  P
Sbjct  1     MAAISQLNQFPCKTLYSKTPLFSHFTSSRPSTIPLNSIKNNPTTNNSILKQRILVTREQP  60

Query  1090  NRGLANPNRKFVVRAVSDDEWGEEKKEPLSAAPAGVAVVEDEPAAL-TETDVLKKQLVDS  914
                 A     F+V+AV +DE   E + P    P  +A   +E     TE D LK QLVD+
Sbjct  61    ----AKKRNLFLVKAVDEDEGSPENEGP----PVALAEKGEEELKELTEVDRLKGQLVDT  112

Query  913   FYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLS  734
             FYGT+RGL+A+SETRAEVVELITQLEA+NP PAPTEALTLLNGKW+LAYTSF GLFPLLS
Sbjct  113   FYGTDRGLNATSETRAEVVELITQLEARNPNPAPTEALTLLNGKWILAYTSFAGLFPLLS  172

Query  733   RGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI  554
             RGTLPLV+VEEI QTIDSE+ TVQNSV FSGPLATTSISTNAKFEVRSPKRVQIKFEEGI
Sbjct  173   RGTLPLVKVEEISQTIDSENLTVQNSVQFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI  232

Query  553   IGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSN  374
             IGTP+LTDSI LPE VEFLGQKIDLTPF+G+I+S+QDTASSV K+ISSQPPLKFS+ N N
Sbjct  233   IGTPKLTDSIELPEKVEFLGQKIDLTPFRGIISSVQDTASSVAKTISSQPPLKFSIPNRN  292

Query  373   AESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             AESWLLTTYLD +LRISRG+AGSIFVLIKE SPLL P
Sbjct  293   AESWLLTTYLDDDLRISRGDAGSIFVLIKEGSPLLTP  329



>ref|XP_007211630.1| hypothetical protein PRUPE_ppa005787mg [Prunus persica]
 gb|EMJ12829.1| hypothetical protein PRUPE_ppa005787mg [Prunus persica]
Length=444

 Score =   417 bits (1071),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 222/331 (67%), Positives = 253/331 (76%), Gaps = 10/331 (3%)
 Frame = -3

Query  1240  KMASISSFTQFHCKPVGM--ICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPN  1067
             KMA  S   QF CK + +     R +S P   +F  NS + A+K      F         
Sbjct  119   KMAFASQLNQFPCKTLSLNPAHHRLASKPFSLLFAPNSNVLAAKFNNQLKFSTHEFVGTR  178

Query  1066  RKFVVRAVSDDEWGEEKKEPLSAAPAGVAVVEDEPAA---LTETDVLKKQLVDSFYGTNR  896
                 +R V +DEWG EK+       + VAV ED+  A     ET  LKK LVDSFYGT+R
Sbjct  179   PATRLRVVDEDEWGPEKE-----TESAVAVAEDDKPAEPESAETSRLKKALVDSFYGTDR  233

Query  895   GLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPL  716
             GLSA+SETRAE+VELITQLEA+NPTPAPTEAL LLNGKW+LAYTSF GLFPLLSRGTLPL
Sbjct  234   GLSATSETRAEIVELITQLEAQNPTPAPTEALPLLNGKWILAYTSFAGLFPLLSRGTLPL  293

Query  715   VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  536
             V+VEE+ QTIDSE+FTVQNSV F+GPLATTS STNA FEVRSPKRVQIKFEEG+IGTPQL
Sbjct  294   VKVEEVSQTIDSENFTVQNSVQFAGPLATTSFSTNATFEVRSPKRVQIKFEEGVIGTPQL  353

Query  535   TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  356
             TDS+V+PENVEFLGQK+DLT FK L+TS+QDTASSVVK+ISSQPP KFS++NS AESWLL
Sbjct  354   TDSLVIPENVEFLGQKLDLTVFKSLLTSVQDTASSVVKTISSQPPFKFSISNSKAESWLL  413

Query  355   TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             TTYLD ELRISRG+ GS+FVLIKE S LL P
Sbjct  414   TTYLDPELRISRGDNGSVFVLIKEGSSLLSP  444



>emb|CAA75657.1| Plastid-lipid-Associated Protein [Nicotiana tabacum]
Length=270

 Score =   407 bits (1047),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 206/260 (79%), Positives = 231/260 (89%), Gaps = 1/260 (0%)
 Frame = -3

Query  1039  DDEWGEEKKE-PLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAE  863
             +DEWG E ++   S     VA  E      +E ++LKKQLVDSFYGTNRGLSASSETRAE
Sbjct  11    EDEWGPEVEQIKPSGGGVSVAEEEPPKEEPSEIELLKKQLVDSFYGTNRGLSASSETRAE  70

Query  862   VVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTID  683
             +VELIT+LE+KNPTPAPTEAL LLNGKW+LAYTSF GLFPLLSRGTLPLVRVEEI QTID
Sbjct  71    IVELITKLESKNPTPAPTEALPLLNGKWILAYTSFSGLFPLLSRGTLPLVRVEEISQTID  130

Query  682   SESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVE  503
             SE+FTVQNSVVF+GPLATTSI+TNAKFEVRSPKRVQIKF+EG+IGTPQLTDSI LPEN+E
Sbjct  131   SEAFTVQNSVVFAGPLATTSITTNAKFEVRSPKRVQIKFDEGVIGTPQLTDSIELPENIE  190

Query  502   FLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRIS  323
             FLGQKIDL+PFKGL+ S+QDTASSV KSISSQPP+KF ++NSNA+SWLLTTYLD ELRIS
Sbjct  191   FLGQKIDLSPFKGLVNSVQDTASSVAKSISSQPPIKFPISNSNAQSWLLTTYLDHELRIS  250

Query  322   RGEAGSIFVLIKEDSPLLKP  263
             RG+ GS+FVLIKE SPLLKP
Sbjct  251   RGDGGSVFVLIKEGSPLLKP  270



>gb|ABA43902.1| fibrillin [Coffea canephora]
Length=320

 Score =   409 bits (1052),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 225/326 (69%), Positives = 252/326 (77%), Gaps = 7/326 (2%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MASI+SF QF                K S   VN T F  K     S   +  +     F
Sbjct  1     MASITSFNQFSYTVKSKTFQHPQFGTKVSNSAVNFTDFGLKKPLQSSISIKESSKKRPGF  60

Query  1057  VVRAVSDDEWGEEKKEPLSAAPAGVAVVEDEPAALTET-DVLKKQLVDSFYGTNRGLSAS  881
             VV   + D++G E++       AGVAV E+ P       D+LKK+LVDSFYGT+RGL+AS
Sbjct  61    VVLVAAGDDYGPEEE------AAGVAVAEEPPPKEPREIDILKKRLVDSFYGTDRGLNAS  114

Query  880   SETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEE  701
             SETRAEVVELITQLEAKNPTPAPTEALTLLNGKW+LAYTSFIGLFPLLSRGTLPLV+VEE
Sbjct  115   SETRAEVVELITQLEAKNPTPAPTEALTLLNGKWILAYTSFIGLFPLLSRGTLPLVKVEE  174

Query  700   ICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIV  521
             I QTIDSE+F+V+N V F+GPLATTSI+TNAKFEVRSPKRVQIKFEEG+IGTPQLTDSI 
Sbjct  175   ISQTIDSEAFSVENVVQFAGPLATTSITTNAKFEVRSPKRVQIKFEEGVIGTPQLTDSIE  234

Query  520   LPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLD  341
             LPE+VE LGQKIDL P KGL+TS+QDTASSV KSISS+PPLKFSL+N NAESWLLTTYLD
Sbjct  235   LPESVELLGQKIDLNPVKGLLTSVQDTASSVAKSISSRPPLKFSLSNRNAESWLLTTYLD  294

Query  340   SELRISRGEAGSIFVLIKEDSPLLKP  263
              ELRISRG+ GSIFVLIKE  PLLKP
Sbjct  295   DELRISRGDGGSIFVLIKEGCPLLKP  320



>emb|CDP04455.1| unnamed protein product [Coffea canephora]
Length=320

 Score =   409 bits (1051),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 228/340 (67%), Positives = 259/340 (76%), Gaps = 35/340 (10%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVA-ALRSFPNRGLANPNRK  1061
             MASI+SF QF            S T K   F      F +KV+ +  +F + GL  P + 
Sbjct  1     MASITSFNQF------------SYTIKSKTF--QHPQFGTKVSNSAVNFTDCGLKKPLQS  46

Query  1060  -------------FVVRAVSDDEWGEEKKEPLSAAPAGVAVVEDEPAALTET-DVLKKQL  923
                          FVV   + D++G E++       AGVAV E+ P       D+LKK+L
Sbjct  47    SISIKESSKKRPGFVVLVATGDDYGPEEE------AAGVAVAEEPPPKEPREIDILKKRL  100

Query  922   VDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFP  743
             VDSFYGT+RGL+ASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKW+LAYTSFIGLFP
Sbjct  101   VDSFYGTDRGLNASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWILAYTSFIGLFP  160

Query  742   LLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFE  563
             LLSRGTLPLV+VEEI QTIDSE+F+V+N V F+GPLATTSI+TNAKFEVRSPKRVQIKFE
Sbjct  161   LLSRGTLPLVKVEEISQTIDSEAFSVENVVQFAGPLATTSITTNAKFEVRSPKRVQIKFE  220

Query  562   EGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLA  383
             EG+IGTPQLTDSI LPE+VE LGQKIDL P KGL+TS+QDTASSV KSISS+PPLKFSL+
Sbjct  221   EGVIGTPQLTDSIELPESVELLGQKIDLNPVKGLLTSVQDTASSVAKSISSRPPLKFSLS  280

Query  382   NSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             N NAESWLLTTYLD ELRISRG+ GSIFVLIKE  PLLKP
Sbjct  281   NRNAESWLLTTYLDDELRISRGDGGSIFVLIKEGCPLLKP  320



>dbj|BAF95867.1| putative plastid lipid-associated protein [Vitis hybrid cultivar]
Length=238

 Score =   405 bits (1041),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 206/240 (86%), Positives = 220/240 (92%), Gaps = 2/240 (1%)
 Frame = -3

Query  982  AVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEA  803
            AVVE+E +   E   LKK LVDSFYGT+RGL A+SETRAE+VELITQLEAKNPTPAPTEA
Sbjct  1    AVVEEEKSK--EITSLKKALVDSFYGTDRGLKATSETRAEIVELITQLEAKNPTPAPTEA  58

Query  802  LTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTS  623
            LTLLNGKW+LAYTSF GLFPLLSRGTLPLV+VEEI QTIDSE+FTVQNSV FSGPLATTS
Sbjct  59   LTLLNGKWILAYTSFAGLFPLLSRGTLPLVKVEEISQTIDSENFTVQNSVQFSGPLATTS  118

Query  622  ISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQD  443
            ISTNAKFEVRSPKRVQIKF+EGIIGTPQLTDSI LPENVEFLGQ IDLTPFKGLITS+QD
Sbjct  119  ISTNAKFEVRSPKRVQIKFQEGIIGTPQLTDSIELPENVEFLGQNIDLTPFKGLITSVQD  178

Query  442  TASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
            TASSV K+ISSQPPLKFS+ NSNAESWLLTTYLD +LRISRG+AGSIFVLIKE S LL P
Sbjct  179  TASSVAKTISSQPPLKFSIPNSNAESWLLTTYLDEDLRISRGDAGSIFVLIKEGSSLLVP  238



>ref|XP_008224724.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Prunus mume]
Length=324

 Score =   407 bits (1047),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 220/333 (66%), Positives = 252/333 (76%), Gaps = 17/333 (5%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGM--ICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNR  1064
             MA  S   QF CK + +     R +S P   +F  NS + A+K      F          
Sbjct  1     MAFASQLNQFPCKMLSLNPAHHRLASKPFSLLFAPNSIVLAAKFNNQLKFSTHEFVGTRP  60

Query  1063  KFVVRAVSDDEWGEEKKEPLSAAPAGVAVVED------EPAALTETDVLKKQLVDSFYGT  902
                +R V +DEWG EK+       + VAV ED      EPA   ET  LKK LVDSFYGT
Sbjct  61    ATRLRVVDEDEWGPEKE-----TESAVAVAEDDKPAEPEPA---ETSRLKKALVDSFYGT  112

Query  901   NRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTL  722
             +RGLSA+SETRAE+VELITQLEA+NPTPAPTEAL LLNGKW+LAYTSF GLFPLLSRGT 
Sbjct  113   DRGLSATSETRAEIVELITQLEAQNPTPAPTEALPLLNGKWILAYTSFAGLFPLLSRGT-  171

Query  721   PLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTP  542
             PLV+VEE+ QTIDS++FTVQNSV F+GPLATTSI+TNA FEVRSPKRVQIKFEEG+IGTP
Sbjct  172   PLVKVEEVSQTIDSQNFTVQNSVQFAGPLATTSITTNATFEVRSPKRVQIKFEEGVIGTP  231

Query  541   QLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESW  362
             QLTDS+V+PENVEFLGQK+DLT FK L+TS+QDTASSV K+ISSQPP KFS++NS AESW
Sbjct  232   QLTDSLVIPENVEFLGQKLDLTVFKSLLTSVQDTASSVAKTISSQPPFKFSISNSKAESW  291

Query  361   LLTTYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             LLTTYLD ELRISRG+ GS+FVLIKE S LL P
Sbjct  292   LLTTYLDPELRISRGDNGSVFVLIKEGSSLLTP  324



>ref|XP_008384113.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Malus domestica]
 ref|XP_008358758.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Malus domestica]
Length=320

 Score =   407 bits (1046),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 206/266 (77%), Positives = 232/266 (87%), Gaps = 8/266 (3%)
 Frame = -3

Query  1054  VRAVSDDEWGEEKKEPLSAAPAGVAV----VEDEPAALTETDVLKKQLVDSFYGTNRGLS  887
             +R+ +DDEWG E+ E  S     VAV     E EPA +++   LKK LVDSFYGTNRGLS
Sbjct  57    IRSANDDEWGNER-EVESGGDVAVAVEEKPAEPEPAEISQ---LKKALVDSFYGTNRGLS  112

Query  886   ASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRV  707
             A+SETRAE+VELITQLEAKNPTPAPTEAL LLNGKW+LAYTSF GLFPLLSRGTLPLV+V
Sbjct  113   ATSETRAEIVELITQLEAKNPTPAPTEALPLLNGKWILAYTSFAGLFPLLSRGTLPLVKV  172

Query  706   EEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDS  527
             EEI QTIDSE+FTVQNSV F+GPLATTSISTNA FEVRSPKRVQIKFEEG+IGTPQLTDS
Sbjct  173   EEISQTIDSENFTVQNSVQFAGPLATTSISTNATFEVRSPKRVQIKFEEGVIGTPQLTDS  232

Query  526   IVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTY  347
             +V+PENV+FLGQKI+L PFKGL+ S+QDTASSVVK+ISSQPP KFS+ +SNA+SWLLTTY
Sbjct  233   LVIPENVDFLGQKIELAPFKGLLNSVQDTASSVVKTISSQPPFKFSIPSSNAQSWLLTTY  292

Query  346   LDSELRISRGEAGSIFVLIKEDSPLL  269
             LD ELRISRG+ GS+FVLIK  SPLL
Sbjct  293   LDGELRISRGDNGSVFVLIKAGSPLL  318



>ref|XP_007147677.1| hypothetical protein PHAVU_006G145100g [Phaseolus vulgaris]
 gb|ESW19671.1| hypothetical protein PHAVU_006G145100g [Phaseolus vulgaris]
Length=310

 Score =   405 bits (1042),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 220/324 (68%), Positives = 252/324 (78%), Gaps = 17/324 (5%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MAS+S   +  C P  ++   +S +P     P +  I+   V      P          +
Sbjct  1     MASLSHLNKVLCVP--LLNSSASVSP-----PRSLGIWTKPVGR----PRMAAEFATSAW  49

Query  1057  VVRAV-SDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSAS  881
              VRAV SDDEWG EK+E       GVAV  +E  A  ET+ LKK LV SFYGTNRGL A+
Sbjct  50    RVRAVTSDDEWGTEKEEVYGG---GVAV--EEKVAEPETERLKKALVGSFYGTNRGLKAT  104

Query  880   SETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEE  701
             SETRAE+VELITQLEAKNPTPAPT+ALTLLNGKW+LAYTSF GLFPLLS GTLPLV+VEE
Sbjct  105   SETRAEIVELITQLEAKNPTPAPTDALTLLNGKWILAYTSFAGLFPLLSSGTLPLVKVEE  164

Query  700   ICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIV  521
             I QTIDSE+FTVQNSV F+GPLA+TSI TNAKF+VRSPKRVQIKFEEGIIGTPQLTDS+ 
Sbjct  165   ISQTIDSENFTVQNSVQFAGPLASTSIITNAKFDVRSPKRVQIKFEEGIIGTPQLTDSLE  224

Query  520   LPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLD  341
             +PENVEFLGQKIDLTPFKG+ TS+QDTASSVVK+ISS+PPLK  ++NSNA+SWLLTTYLD
Sbjct  225   IPENVEFLGQKIDLTPFKGIFTSIQDTASSVVKTISSRPPLKIPISNSNAQSWLLTTYLD  284

Query  340   SELRISRGEAGSIFVLIKEDSPLL  269
              ELRISRG+ GS+FVLIKE S LL
Sbjct  285   QELRISRGDGGSVFVLIKEGSSLL  308



>ref|XP_008440050.1| PREDICTED: chromoplast-specific carotenoid-associated protein, 
chromoplast [Cucumis melo]
Length=323

 Score =   406 bits (1043),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 215/328 (66%), Positives = 257/328 (78%), Gaps = 8/328 (2%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MA +S F Q  CK + +  P+   T KPS+FP+ S    ++ AA +S     L +    F
Sbjct  1     MAFVSQFNQLPCKTLALNPPQPQLTSKPSIFPIASIGAGARAAAGKS-----LISVRPSF  55

Query  1057  VVRAV-SDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDV--LKKQLVDSFYGTNRGLS  887
              VRAV +DDEWGEEK+E      A     E+E   +  +++  LKK LVDSFYGT+RGL 
Sbjct  56    KVRAVLNDDEWGEEKEEKYGDGSAVAVAEEEEEKPMEPSEIYKLKKALVDSFYGTDRGLR  115

Query  886   ASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRV  707
              S +TRAE+VELITQLE+KNPTPAPTEALTLLNGKW+L YTSF GLFPLLSR TLPLV+V
Sbjct  116   VSRDTRAEIVELITQLESKNPTPAPTEALTLLNGKWILQYTSFSGLFPLLSRNTLPLVKV  175

Query  706   EEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDS  527
             EEI QTIDSE+ TVQNSV FSGPLATTSI+TNAKFEVRSP RV IKFEEG+IGTPQLTDS
Sbjct  176   EEISQTIDSENLTVQNSVQFSGPLATTSITTNAKFEVRSPLRVHIKFEEGVIGTPQLTDS  235

Query  526   IVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTY  347
             IV+P+NV+FLGQKIDL+PF G+I+S+QDTAS+V K+ISSQPPLKFS++N+  ESWLLTTY
Sbjct  236   IVIPDNVDFLGQKIDLSPFNGIISSIQDTASNVAKTISSQPPLKFSISNTKVESWLLTTY  295

Query  346   LDSELRISRGEAGSIFVLIKEDSPLLKP  263
             LD +LRISRG+ GS+FVL+KE S LL P
Sbjct  296   LDEDLRISRGDGGSVFVLLKEGSALLSP  323



>ref|XP_004293330.1| PREDICTED: plastid-lipid-associated protein, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=322

 Score =   405 bits (1042),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 217/327 (66%), Positives = 256/327 (78%), Gaps = 7/327 (2%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MA +S    F CK + +  P+   T KPS+   NS   A+    L +  +   A P  + 
Sbjct  1     MAFVSQLNHFPCKTLSLTPPQPRLTSKPSILAPNSISLATHKLKLSNPESPPAARPATR-  59

Query  1057  VVRAVSDDEWGEEKKEPLSAAPAGVAVVE--DEPAALTETDVLKKQLVDSFYGTNRGLSA  884
              VRA+ DD   E  +E    A   VAV E  DEP  +++   LKK LVDSFYGT+RGLSA
Sbjct  60    -VRALDDDSAPENSEESSDVAAGAVAVAEKPDEPEEISK---LKKALVDSFYGTDRGLSA  115

Query  883   SSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVE  704
             +SETRAE+VELITQLEA+NPTPAPT+AL LLNGKW+LAYTSF GLFP+LSRGTLPLV+V 
Sbjct  116   TSETRAEIVELITQLEAQNPTPAPTDALPLLNGKWILAYTSFAGLFPILSRGTLPLVKVA  175

Query  703   EICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSI  524
             EI QTIDS++FTV+NSV FSGPLATTS STNA F+VRSPKRVQ+KFEEG+IGTPQLTDS+
Sbjct  176   EISQTIDSDNFTVENSVRFSGPLATTSFSTNATFDVRSPKRVQLKFEEGVIGTPQLTDSL  235

Query  523   VLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYL  344
             V+PE+VEFLGQKIDL PFKGL+TS+QDTASSV KSISSQPP+KFS+++SNAESWLLTTYL
Sbjct  236   VIPEDVEFLGQKIDLAPFKGLLTSVQDTASSVAKSISSQPPIKFSISSSNAESWLLTTYL  295

Query  343   DSELRISRGEAGSIFVLIKEDSPLLKP  263
             D ELRISRG+ GS+FVLIKE S LL P
Sbjct  296   DQELRISRGDNGSVFVLIKEGSSLLTP  322



>ref|XP_004486195.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Cicer arietinum]
 ref|XP_004517240.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Cicer arietinum]
Length=320

 Score =   405 bits (1041),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 208/279 (75%), Positives = 239/279 (86%), Gaps = 9/279 (3%)
 Frame = -3

Query  1078  ANPNRKFV-VRAV-SDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYG  905
             A+ +R+ V V AV SDDEWG ++  P     AGVAV  +E    TETD LKK LVDSFYG
Sbjct  48    ADVSRRVVYVHAVTSDDEWGPDRDVPY----AGVAVAVEEKPVETETDKLKKALVDSFYG  103

Query  904   TNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGT  725
             T+RGL ASSETRAE+VELI+QLEAKNPTPAPT+ALTLLNGKW+L YTSF GLFPLLS GT
Sbjct  104   TDRGLKASSETRAEIVELISQLEAKNPTPAPTDALTLLNGKWILVYTSFAGLFPLLSSGT  163

Query  724   LPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGT  545
             LPLV+VEEI QTIDSE+FTVQNSV F+GPL TTSISTNAKFEVRSPKRVQIKF+EGIIGT
Sbjct  164   LPLVKVEEISQTIDSEAFTVQNSVRFAGPLTTTSISTNAKFEVRSPKRVQIKFDEGIIGT  223

Query  544   PQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAES  365
             PQLTDS+ +PENVEFLGQ+IDLTPFKG++TS+Q+TASSVV++IS+QPPLKF ++N+ A+S
Sbjct  224   PQLTDSLEIPENVEFLGQRIDLTPFKGILTSVQNTASSVVRTISNQPPLKFPISNNKAQS  283

Query  364   WLLTTYLDSELRISRGEAGSIFVLIKEDSPLLKP*TNSR  248
             WLLTTYLD ELRISRG+ G +FVLIKE S LL   TN R
Sbjct  284   WLLTTYLDEELRISRGDGGGVFVLIKEGSSLL---TNQR  319



>ref|XP_004134784.1| PREDICTED: chromoplast-specific carotenoid-associated protein, 
chromoplast [Cucumis sativus]
 sp|Q96398.1|CHRC_CUCSA RecName: Full=Chromoplast-specific carotenoid-associated protein, 
chromoplast; Flags: Precursor [Cucumis sativus]
 emb|CAA64846.1| chromoplast-specific carotenoid-associated protein, CHRC [Cucumis 
sativus]
 gb|AAD05165.1| chromoplast-specific carotenoid-associated protein CHRC [Cucumis 
sativus]
 gb|KGN49072.1| hypothetical protein Csa_6G512870 [Cucumis sativus]
Length=322

 Score =   404 bits (1037),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 215/327 (66%), Positives = 252/327 (77%), Gaps = 11/327 (3%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MA +S F Q  CK + +  P+   T KPSVFP+     AS  A  R+   + L +    F
Sbjct  1     MAFVSQFNQLPCKTLALNPPQPQLTSKPSVFPI-----ASIGATARAAAGKSLISVRPAF  55

Query  1057  VVRAV-SDDEWGEEKKEPLSAAPAGVAVVEDEPAAL---TETDVLKKQLVDSFYGTNRGL  890
              VRAV +DDEWGE+K E      + VAV E E       +E   LKK LVDSFYGT+RGL
Sbjct  56    KVRAVLNDDEWGEDKDEKY-GDDSSVAVAEKEEEKPLEPSEIYKLKKALVDSFYGTDRGL  114

Query  889   SASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVR  710
               S +TRAE+VELITQLE+KNPTPAPTEALTLLNGKW+LAYT+F GLFPLLSR  LPLV+
Sbjct  115   RVSRDTRAEIVELITQLESKNPTPAPTEALTLLNGKWILAYTTFAGLFPLLSRN-LPLVK  173

Query  709   VEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTD  530
             VEEI QTIDSE+ TVQNSV FSGPLATTSI+TNAKFEVRSP RV IKFEEG+IGTPQLTD
Sbjct  174   VEEISQTIDSENLTVQNSVQFSGPLATTSITTNAKFEVRSPLRVHIKFEEGVIGTPQLTD  233

Query  529   SIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTT  350
             SIV+P+NV+FLGQKID TPF G+I+SLQDTAS+V K+ISSQPP+KFS++N+  ESWLLTT
Sbjct  234   SIVIPDNVDFLGQKIDFTPFNGIISSLQDTASNVAKTISSQPPIKFSISNTRVESWLLTT  293

Query  349   YLDSELRISRGEAGSIFVLIKEDSPLL  269
             YLD +LRISRG+ GS+FVL+KE S  L
Sbjct  294   YLDEDLRISRGDGGSVFVLLKEGSSFL  320



>ref|XP_010057882.1| PREDICTED: plastid-lipid-associated protein, chloroplastic [Eucalyptus 
grandis]
 gb|KCW75228.1| hypothetical protein EUGRSUZ_E03981 [Eucalyptus grandis]
Length=336

 Score =   403 bits (1035),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 222/335 (66%), Positives = 253/335 (76%), Gaps = 13/335 (4%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAA---LRSFPNRGLANPN  1067
             M+++S    F C  +     +   +PKPSV  V +   AS++A    +R   N G     
Sbjct  1     MSTVSQLIHFPCVSLSSSPTQHRFSPKPSVLAVANPGIASRIACGSRIR-HGNPGRRVRP  59

Query  1066  RKFVVRAVSDDEWGEEK--KEPLSAAPAG-------VAVVEDEPAALTETDVLKKQLVDS  914
                V  A   DE   EK  +EP+S    G            + P  + E   LKK+LVDS
Sbjct  60    VFRVRAAEDGDEGVPEKGEEEPVSGTSGGGAAVAVAEPEEPEPPKEVPEIAALKKELVDS  119

Query  913   FYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLS  734
             FYGT+RGL A+SETRAE+VELITQLEAKNPTPAPTEALTLLNGKW+LAYTSF  LFPLL+
Sbjct  120   FYGTDRGLRATSETRAEIVELITQLEAKNPTPAPTEALTLLNGKWILAYTSFAQLFPLLA  179

Query  733   RGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI  554
             RGTLPLV+VEEI QTIDSE+FTVQNSV+FSGPLATTS STNAKFEVRSPKRVQIKFEEGI
Sbjct  180   RGTLPLVKVEEISQTIDSENFTVQNSVLFSGPLATTSFSTNAKFEVRSPKRVQIKFEEGI  239

Query  553   IGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSN  374
             IGTPQLTDSIVLPENVEFLGQ+IDL PFKGLI S+QDTA SV K+ISSQPP+KFSL+N+N
Sbjct  240   IGTPQLTDSIVLPENVEFLGQRIDLAPFKGLINSVQDTAYSVAKTISSQPPIKFSLSNNN  299

Query  373   AESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
             A+SWLLTTYLD ELRISRG+AGSIFVLIKE S LL
Sbjct  300   AQSWLLTTYLDEELRISRGDAGSIFVLIKEGSSLL  334



>ref|XP_010099142.1| Plastid-lipid-associated protein [Morus notabilis]
 gb|EXB77014.1| Plastid-lipid-associated protein [Morus notabilis]
Length=324

 Score =   402 bits (1034),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 219/327 (67%), Positives = 246/327 (75%), Gaps = 5/327 (2%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MA      QF CK   ++ PR  S    +  P NS    S+         R L+      
Sbjct  1     MACACQLNQFPCKSFSVVPPRHQSK---ASLPPNSIGVPSRFTDGPKLSTRDLSRARPVS  57

Query  1057  VVRAVSDDEWGEE--KKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSA  884
              VR  +DDEWG E       SA        E++P    E   LKK LV+SFYGT+RGL A
Sbjct  58    RVRVANDDEWGPEPVTSGEDSAVAVAEEKEEEKPVEAAEIARLKKALVESFYGTDRGLKA  117

Query  883   SSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVE  704
             SSETRAE+VELITQLEA+NPTPAPTEAL+LLNGKW+LAYTSF GL  LLSRGTLPLV+VE
Sbjct  118   SSETRAEIVELITQLEAQNPTPAPTEALSLLNGKWILAYTSFPGLLTLLSRGTLPLVKVE  177

Query  703   EICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSI  524
             EI QTIDSE+FTVQNSV F+GPLATTSI+TNAKFEVRSPKRVQIKFE GIIGTPQLTDSI
Sbjct  178   EISQTIDSENFTVQNSVQFAGPLATTSITTNAKFEVRSPKRVQIKFEAGIIGTPQLTDSI  237

Query  523   VLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYL  344
             V+PENVEFLGQKIDLTPFKGLITS+QDTASSVVK+ISSQPPLK  ++N+NA+SWLLTTYL
Sbjct  238   VVPENVEFLGQKIDLTPFKGLITSVQDTASSVVKTISSQPPLKIPISNNNAQSWLLTTYL  297

Query  343   DSELRISRGEAGSIFVLIKEDSPLLKP  263
             D ELRISRG+ GS+FVLIKE S LL P
Sbjct  298   DGELRISRGDGGSVFVLIKEGSSLLTP  324



>ref|XP_003546169.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Glycine max]
 gb|KHN32987.1| Plastid-lipid-associated protein, chloroplastic [Glycine soja]
Length=306

 Score =   400 bits (1029),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 206/272 (76%), Positives = 232/272 (85%), Gaps = 4/272 (1%)
 Frame = -3

Query  1081  LANPNRKFVVRAV-SDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYG  905
             +  P     VRAV SDDEWG EK+E   A   GVAV E    + TET+ LKK LVDSFYG
Sbjct  36    VGRPRLLVRVRAVTSDDEWGPEKEE---AYGGGVAVEEKPTKSETETEKLKKALVDSFYG  92

Query  904   TNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGT  725
             T+RGL A+SETRAE+VELITQLEAKNP P PT+ALTLLNGKW+LAYTSF GLFPLLS GT
Sbjct  93    TDRGLKATSETRAEIVELITQLEAKNPNPVPTDALTLLNGKWILAYTSFAGLFPLLSSGT  152

Query  724   LPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGT  545
             LPLV+VEEI Q IDS +FTVQNSV F+GPLATTSISTNAKF+VRSPKRVQIKFEEGIIGT
Sbjct  153   LPLVKVEEISQIIDSLNFTVQNSVQFAGPLATTSISTNAKFDVRSPKRVQIKFEEGIIGT  212

Query  544   PQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAES  365
             PQLTDS+ +PENVEFLGQKIDLT FKG++TS+QDTA+SVVK+ISS+PPLK  ++NSNA+S
Sbjct  213   PQLTDSLEIPENVEFLGQKIDLTLFKGILTSVQDTATSVVKTISSRPPLKIPISNSNAQS  272

Query  364   WLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
             WLLTTYLD ELRISRG+ GS+FVLIKE S LL
Sbjct  273   WLLTTYLDEELRISRGDGGSVFVLIKEGSSLL  304



>gb|AAK57562.1| plastid-lipid associated protein PAP2 [Brassica rapa subsp. oleifera]
Length=319

 Score =   398 bits (1023),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 208/327 (64%), Positives = 257/327 (79%), Gaps = 10/327 (3%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MA++ SF QF CK   + CP +S   KP   P +S +  S +    SF     A     F
Sbjct  1     MATVHSFNQFPCK-TRVQCPSNS---KPLSKPPSSLVPMSALTRRPSFSPGEFAVSRSDF  56

Query  1057  VVRAVSDDEWGEEKKEPLSAAPAGVAVVEDEPA--ALTETDVLKKQLVDSFYGTNRGLSA  884
              VR +      E++ +P ++   G A++  E A  ++ ET+VLK+ LVDS YGT+RGLSA
Sbjct  57    RVRVID----AEDELDPETSEGGGSALLMAEEAIESVEETEVLKRSLVDSLYGTDRGLSA  112

Query  883   SSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVE  704
             SSETRAE+ +LITQLE+KNPTPAPT+AL LLNGKW+LAYTSF+GLFPLLSRG +PLV+V+
Sbjct  113   SSETRAEIGDLITQLESKNPTPAPTDALFLLNGKWILAYTSFVGLFPLLSRGIVPLVKVD  172

Query  703   EICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSI  524
             EI QTIDS++FTV+NSV+F+GPLATTSISTNAKFE+RSPKRVQIKFEEG+IGTPQLTDSI
Sbjct  173   EISQTIDSDNFTVENSVLFAGPLATTSISTNAKFEIRSPKRVQIKFEEGVIGTPQLTDSI  232

Query  523   VLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYL  344
              +PE VEFLGQKIDLTP +GL+TS+QDTA+SV ++ISSQPPLKFSL   +A+SWLLTTYL
Sbjct  233   EIPEYVEFLGQKIDLTPIRGLLTSVQDTATSVARTISSQPPLKFSLPGDSAQSWLLTTYL  292

Query  343   DSELRISRGEAGSIFVLIKEDSPLLKP  263
             D ++RISRG+ GS+FVLIKE SPLL P
Sbjct  293   DKDIRISRGDGGSVFVLIKEGSPLLNP  319



>sp|Q94KU6.1|PAP2_BRACM RecName: Full=Plastid lipid-associated protein 2, chloroplastic; 
Flags: Precursor [Brassica rapa]
 gb|AAK57565.1|AF290567_1 plastid-lipid associated protein PAP2 [Brassica rapa subsp. oleifera]
Length=319

 Score =   397 bits (1020),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 207/327 (63%), Positives = 256/327 (78%), Gaps = 10/327 (3%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MA++  F QF CK       +SS+  KP   P +S +  S +    SFP    A     F
Sbjct  1     MATVQFFNQFPCK----TRVQSSANSKPLSKPPSSLVPMSALTRRPSFPPGEFAVSRSDF  56

Query  1057  VVRAVSDDEWGEEKKEPLSAAPAGVAVVEDEPA--ALTETDVLKKQLVDSFYGTNRGLSA  884
              VR +      E++ +P ++   G A++  E A  ++ ET+VLK+ LVDS YGT+RGLSA
Sbjct  57    RVRVID----AEDELDPETSEGGGSALLMAEEAIESVEETEVLKRSLVDSLYGTDRGLSA  112

Query  883   SSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVE  704
             SSETRAE+ +LITQLE+KNPTPAPT+AL LLNGKW+LAYTSF+GLFPLLSRG +PLV+V+
Sbjct  113   SSETRAEIGDLITQLESKNPTPAPTDALFLLNGKWILAYTSFVGLFPLLSRGIVPLVKVD  172

Query  703   EICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSI  524
             EI QTIDS++FTV+NSV+F+GPLATTSISTNAKFE+RSPKRVQIKFEEG+IGTPQLTDSI
Sbjct  173   EISQTIDSDNFTVENSVLFAGPLATTSISTNAKFEIRSPKRVQIKFEEGVIGTPQLTDSI  232

Query  523   VLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYL  344
              +PE VEFLGQKIDLTP +GL+TS+QDTA+SV ++ISSQPPLKFSL   +A+SWLLTTYL
Sbjct  233   EIPEYVEFLGQKIDLTPIRGLLTSVQDTATSVARTISSQPPLKFSLPGDSAQSWLLTTYL  292

Query  343   DSELRISRGEAGSIFVLIKEDSPLLKP  263
             D ++RISRG+ GS+FVLIKE SPLL P
Sbjct  293   DKDIRISRGDGGSVFVLIKEGSPLLNP  319



>ref|XP_009357505.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Pyrus x bretschneideri]
Length=315

 Score =   396 bits (1018),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 205/268 (76%), Positives = 232/268 (87%), Gaps = 13/268 (5%)
 Frame = -3

Query  1054  VRAVSDDEWGEEKKEPLSAAPAGVAV----VEDEPAALTETDVLKKQLVDSFYGTNRGLS  887
             VR+ +DDE     +E  S+    VAV     E EPA ++    LKK LVDSFYGT+RGLS
Sbjct  57    VRSANDDE-----REVESSGDVNVAVEEKPAEPEPAEISR---LKKALVDSFYGTDRGLS  108

Query  886   ASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRV  707
             A+SETRAE+VELITQLEAKNPTPAPTEAL LLNGKW+LAYTSF GLFPLLSRGTLPLV+V
Sbjct  109   ATSETRAEIVELITQLEAKNPTPAPTEALPLLNGKWILAYTSFAGLFPLLSRGTLPLVKV  168

Query  706   EEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDS  527
             EEI QTIDS++FTVQNSV F+GPLATTSISTNAKFEVRSPKRVQIKFEEG+IGTPQLTDS
Sbjct  169   EEISQTIDSDNFTVQNSVQFAGPLATTSISTNAKFEVRSPKRVQIKFEEGVIGTPQLTDS  228

Query  526   IVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTY  347
             +V+PENVEFLGQKI+L PFKGL+ S+QDTASSVVK+ISS+PP KFS++ SNA+SWLLTTY
Sbjct  229   LVIPENVEFLGQKIELAPFKGLLNSVQDTASSVVKTISSRPPFKFSIS-SNAQSWLLTTY  287

Query  346   LDSELRISRGEAGSIFVLIKEDSPLLKP  263
             LD ELRISRG+ GS+FVLIKE SPLL P
Sbjct  288   LDGELRISRGDNGSVFVLIKEGSPLLTP  315



>ref|XP_010434068.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic 
[Camelina sativa]
Length=319

 Score =   396 bits (1018),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 209/327 (64%), Positives = 247/327 (76%), Gaps = 10/327 (3%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPK-PSVFPVNSTIFASKVAALRSFPNRGLANPNRK  1061
             MA+I  F QF CK        S S  K P   P++S I     +        G+A     
Sbjct  1     MAAIQLFNQFPCKARVTTSSNSKSLSKIPITVPMSSIIHRPVFST-----GGGIAVSRGD  55

Query  1060  FVVRAV-SDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSA  884
             F VRA  ++DEWG E  E  SAA   ++V ++   A+ ET+ LK+ L DSFYG +RGL+ 
Sbjct  56    FRVRATDAEDEWGTEAGERGSAA---LSVADEAIEAVEETERLKRSLADSFYGIDRGLNT  112

Query  883   SSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVE  704
             SSETRAE+ +LITQLE+KNPTPAPTEAL LLNGKW+LAYTSF+ LFPLLSRG LPLV+V+
Sbjct  113   SSETRAEIGDLITQLESKNPTPAPTEALFLLNGKWILAYTSFVNLFPLLSRGILPLVKVD  172

Query  703   EICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSI  524
             EI QTIDS++FTVQNSV F+GPL T SISTNAKFE+RSPKRVQIKFE+G+IGTPQLTDSI
Sbjct  173   EISQTIDSDNFTVQNSVRFAGPLGTNSISTNAKFEIRSPKRVQIKFEQGVIGTPQLTDSI  232

Query  523   VLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYL  344
              +P+NVE LGQKIDL P +GL+TS+QDTASSV +SISSQPPLKFSL    AESWLLTTYL
Sbjct  233   EIPDNVEVLGQKIDLNPIRGLLTSVQDTASSVARSISSQPPLKFSLPGDKAESWLLTTYL  292

Query  343   DSELRISRGEAGSIFVLIKEDSPLLKP  263
             D ++RISRG+ GSIFVLIKE SPLL P
Sbjct  293   DKDIRISRGDGGSIFVLIKEGSPLLNP  319



>emb|CDX79139.1| BnaA01g12060D [Brassica napus]
Length=319

 Score =   396 bits (1017),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 206/327 (63%), Positives = 256/327 (78%), Gaps = 10/327 (3%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MA++  F QF C+       +SS+  KP   P +S +  S +    SFP    A     F
Sbjct  1     MATVQFFNQFPCQ----TRVQSSANSKPLSKPPSSLVPMSALTRRPSFPPGEFAVSRSDF  56

Query  1057  VVRAVSDDEWGEEKKEPLSAAPAGVAVVEDEPA--ALTETDVLKKQLVDSFYGTNRGLSA  884
              VR +      E++ +P ++   G A++  E A  ++ ET+VLK+ LVDS YGT+RGLSA
Sbjct  57    RVRVID----AEDELDPETSEGGGSALLMAEEAIESVEETEVLKRSLVDSLYGTDRGLSA  112

Query  883   SSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVE  704
             SSETRAE+ +LITQLE+KNPTPAPT+AL LLNGKW+LAYTSF+GLFPLLSRG +PLV+V+
Sbjct  113   SSETRAEIGDLITQLESKNPTPAPTDALFLLNGKWILAYTSFVGLFPLLSRGIVPLVKVD  172

Query  703   EICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSI  524
             EI QTIDS++FTV+NSV+F+GPLATTSISTNAKFE+RSPKRVQIKFEEG+IGTPQLTDSI
Sbjct  173   EISQTIDSDNFTVENSVLFAGPLATTSISTNAKFEIRSPKRVQIKFEEGVIGTPQLTDSI  232

Query  523   VLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYL  344
              +PE VEFLGQKIDLTP +GL+TS+QDTA+SV ++ISSQPPLKFSL   +A+SWLLTTYL
Sbjct  233   EIPEYVEFLGQKIDLTPIRGLLTSVQDTATSVARTISSQPPLKFSLPGDSAQSWLLTTYL  292

Query  343   DSELRISRGEAGSIFVLIKEDSPLLKP  263
             D ++RISRG+ GS+FVLIKE SPLL P
Sbjct  293   DKDIRISRGDGGSVFVLIKEGSPLLNP  319



>ref|XP_009135738.1| PREDICTED: plastid lipid-associated protein 2, chloroplastic 
[Brassica rapa]
Length=319

 Score =   395 bits (1016),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 207/327 (63%), Positives = 256/327 (78%), Gaps = 10/327 (3%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MA++  F QF CK   + CP +S   KP   P +S +  S +    SF     A     F
Sbjct  1     MATVQFFNQFPCK-TRVQCPSNS---KPLSKPPSSLVPMSALTRRPSFSPGEFAVSRSDF  56

Query  1057  VVRAVSDDEWGEEKKEPLSAAPAGVAVVEDEPA--ALTETDVLKKQLVDSFYGTNRGLSA  884
              VR +      E++ +P ++   G A++  E A  ++ ET+VLK+ LVDS YGT+RGLSA
Sbjct  57    RVRVID----AEDELDPETSEGGGSALLMAEEAIESVEETEVLKRSLVDSLYGTDRGLSA  112

Query  883   SSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVE  704
             SSETRAE+ +LITQLE+KNPTPAPT+AL LLNGKW+LAYTSF+GLFPLLSRG +PLV+V+
Sbjct  113   SSETRAEIGDLITQLESKNPTPAPTDALFLLNGKWILAYTSFVGLFPLLSRGIVPLVKVD  172

Query  703   EICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSI  524
             EI QTIDS++FTV+NSV+F+GPLATTSISTNAKFE+RSPKRVQIKFEEG+IGTPQLTDSI
Sbjct  173   EISQTIDSDNFTVENSVLFAGPLATTSISTNAKFEIRSPKRVQIKFEEGVIGTPQLTDSI  232

Query  523   VLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYL  344
              +PE VEFLGQKIDLTP +GL+TS+QDTA+SV ++ISSQPPLKFSL   +A+SWLLTTYL
Sbjct  233   EIPEYVEFLGQKIDLTPIRGLLTSVQDTATSVARTISSQPPLKFSLPGDSAQSWLLTTYL  292

Query  343   DSELRISRGEAGSIFVLIKEDSPLLKP  263
             D ++RISRG+ GS+FVLIKE SPLL P
Sbjct  293   DKDIRISRGDGGSVFVLIKEGSPLLNP  319



>ref|XP_003534708.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Glycine max]
Length=312

 Score =   392 bits (1007),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 206/263 (78%), Positives = 230/263 (87%), Gaps = 5/263 (2%)
 Frame = -3

Query  1054  VRAV-SDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASS  878
             VRAV SDDEWG EK+E   A   GVAV E      TET+ LKK LVDSFYGT+ GL A+S
Sbjct  52    VRAVTSDDEWGPEKEE--EAYGGGVAVEEK--PTETETEKLKKALVDSFYGTDLGLKATS  107

Query  877   ETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEI  698
             ETRAE+VELITQLEAKNP PAPT+ALTLLNGKW+LAYTSF GLFPLLS GTLPLV+VEEI
Sbjct  108   ETRAEIVELITQLEAKNPNPAPTDALTLLNGKWILAYTSFAGLFPLLSSGTLPLVKVEEI  167

Query  697   CQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVL  518
              QTID+ +FTVQNSV F+GPLATTSISTNAKF+VRSPKRVQIKFEEGIIGTPQLTDS+ +
Sbjct  168   SQTIDTLNFTVQNSVQFAGPLATTSISTNAKFDVRSPKRVQIKFEEGIIGTPQLTDSLEI  227

Query  517   PENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDS  338
             PENVE LGQKIDLTPFKG++TS+QDTASSVVK+ISS+PPLK  ++NSNA+SWLLTTYLD 
Sbjct  228   PENVELLGQKIDLTPFKGILTSVQDTASSVVKTISSRPPLKIPISNSNAQSWLLTTYLDE  287

Query  337   ELRISRGEAGSIFVLIKEDSPLL  269
             ELRISRG+ GS+FVLIKE S LL
Sbjct  288   ELRISRGDGGSVFVLIKEGSSLL  310



>emb|CDX82925.1| BnaC01g13750D [Brassica napus]
Length=317

 Score =   392 bits (1006),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 207/332 (62%), Positives = 253/332 (76%), Gaps = 24/332 (7%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKP-SVFPVNSTIFASKVAALRSFPNRGLANPNR-  1064
             MA++  F QF CK        S    KP S+ P ++            F  R L +P   
Sbjct  1     MATVQFFNQFPCKTRVQSSANSKPLSKPPSLVPTSA------------FTRRPLFSPGEF  48

Query  1063  -----KFVVRAV-SDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGT  902
                   F VR + ++DE+  E+ E  SA    + + E+   ++ ET+VLK+ LVDS YGT
Sbjct  49    AVSRADFRVRVIDAEDEFDSERSEGGSA----LLMAEEAIESVEETEVLKRSLVDSLYGT  104

Query  901   NRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTL  722
             +RGLSASSETRAE+ +LITQLE+KNPTPAPT+AL LLNGKW+LAYTSF+GLFPLLSRG +
Sbjct  105   DRGLSASSETRAEIGDLITQLESKNPTPAPTDALFLLNGKWILAYTSFVGLFPLLSRGIV  164

Query  721   PLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTP  542
             PLV+V+EI QTIDSE+FTV+NSV+F+GPLATTSISTNAKFE+RSPKRVQIKFEEG+IGTP
Sbjct  165   PLVKVDEISQTIDSENFTVENSVLFAGPLATTSISTNAKFEIRSPKRVQIKFEEGVIGTP  224

Query  541   QLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESW  362
             QLTDSI +PE VEFLGQKIDLTP +GL+TS+QDTA+SV ++ISSQPPLKFSL   NA+SW
Sbjct  225   QLTDSIEIPEYVEFLGQKIDLTPIRGLLTSVQDTATSVARTISSQPPLKFSLPGDNAQSW  284

Query  361   LLTTYLDSELRISRGEAGSIFVLIKEDSPLLK  266
             LLTTYLD ++RISRG+ GS+FVLIKE SPLL 
Sbjct  285   LLTTYLDKDIRISRGDGGSVFVLIKEGSPLLN  316



>ref|XP_010252567.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Nelumbo nucifera]
Length=332

 Score =   392 bits (1006),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 210/330 (64%), Positives = 253/330 (77%), Gaps = 8/330 (2%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRS-FPNRGLANPNRK  1061
             MA + SF    C+   +   +       SV P+NS    SK  + RS F  RG ++  R 
Sbjct  1     MAGVCSFNLLPCQNPSLTRSQRLLGSNNSVSPLNSIGVISKNLSERSVFSLRGRSHRVRP  60

Query  1060  FV-VRAVSDDEWG---EEKKEPLSAAPAGVAVVEDEPAALTETDV--LKKQLVDSFYGTN  899
              + VR V DDEWG   EE+++P+    A    V D+    +++++  LKK L+DS YGT+
Sbjct  61    VLRVREV-DDEWGPDKEEEEKPVGEGVAAATAVADKSEDPSDSEIYNLKKALIDSLYGTD  119

Query  898   RGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLP  719
             RGL ASSETRAE+VELITQLEAKNPT APTEALTLLNGKW+LAYTSF+GLF L SRGTLP
Sbjct  120   RGLRASSETRAEIVELITQLEAKNPTAAPTEALTLLNGKWILAYTSFVGLFLLFSRGTLP  179

Query  718   LVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  539
             LV+VEEI Q+IDS +FTV+N V F+GPLATT++STNAKFE+RSPKRVQIKFEEGIIGTPQ
Sbjct  180   LVKVEEISQSIDSSNFTVENVVQFAGPLATTTLSTNAKFEIRSPKRVQIKFEEGIIGTPQ  239

Query  538   LTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWL  359
             LTDSI +PE  EFLGQ IDLTP KGLI+S+Q+TASSVVKSISS+PPLK  ++N+NAESWL
Sbjct  240   LTDSIEIPEKAEFLGQTIDLTPLKGLISSVQNTASSVVKSISSRPPLKIPISNTNAESWL  299

Query  358   LTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
             LTTYLD ELRISRG+ GS+FVL+KE S LL
Sbjct  300   LTTYLDDELRISRGDGGSVFVLVKEGSSLL  329



>ref|NP_192311.1| fibrillin [Arabidopsis thaliana]
 sp|O81439.1|PAP1_ARATH RecName: Full=Probable plastid-lipid-associated protein 1, chloroplastic; 
Short=AtPap1; AltName: Full=Fibrillin-1a; AltName: 
Full=Plastoglobulin 35; Short=AtPGL35; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC28198.1| contains similarity to fibrillins [Arabidopsis thaliana]
 emb|CAB77870.1| putative fibrillin [Arabidopsis thaliana]
 gb|AAM53324.1| putative fibrillin [Arabidopsis thaliana]
 gb|AAM62561.1| putative fibrillin [Arabidopsis thaliana]
 gb|AAN15467.1| putative fibrillin [Arabidopsis thaliana]
 gb|AEE82363.1| fibrillin [Arabidopsis thaliana]
Length=318

 Score =   390 bits (1003),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 202/330 (61%), Positives = 250/330 (76%), Gaps = 17/330 (5%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPK----PSVFPVNSTIFASKVAALRSFPNRGLANP  1070
             MA++  FTQF CK    + P SS+T      P + P+NS    S++      P+      
Sbjct  1     MATVPLFTQFPCK---TLNPSSSNTKHQSKSPILLPINSINRRSEIGVSVHRPD------  51

Query  1069  NRKFVVRAVS-DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRG  893
                F +RA   DDEWG++  E + A+ + V+V +    ++ ET+ LK+ L DS YGT+RG
Sbjct  52    ---FKIRATDIDDEWGQDGVERVFASSSTVSVADKAIESVEETERLKRSLADSLYGTDRG  108

Query  892   LSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLV  713
             LS SS+TRAE+ ELITQLE+KNPTPAP EAL LLNGKW+LAYTSF+GLFPLLSR   PLV
Sbjct  109   LSVSSDTRAEISELITQLESKNPTPAPNEALFLLNGKWILAYTSFVGLFPLLSRRIEPLV  168

Query  712   RVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLT  533
             +V+EI QTIDS+SFTVQNSV F+GP +TTS STNAKFE+RSPKRVQIKFE+G+IGTPQLT
Sbjct  169   KVDEISQTIDSDSFTVQNSVRFAGPFSTTSFSTNAKFEIRSPKRVQIKFEQGVIGTPQLT  228

Query  532   DSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLT  353
             DSI +PE+VE LGQKIDL P KGL+TS+QDTASSV ++IS+QPPLKFSL + N +SWLLT
Sbjct  229   DSIEIPESVEVLGQKIDLNPIKGLLTSVQDTASSVARTISNQPPLKFSLPSDNTQSWLLT  288

Query  352   TYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             TYLD +LRISRG+ GS++VLIKE S LL P
Sbjct  289   TYLDKDLRISRGDGGSVYVLIKEGSSLLNP  318



>gb|KHN40849.1| Plastid-lipid-associated protein, chloroplastic [Glycine soja]
Length=314

 Score =   390 bits (1001),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 206/263 (78%), Positives = 230/263 (87%), Gaps = 3/263 (1%)
 Frame = -3

Query  1054  VRAV-SDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASS  878
             VRAV SDDEWG EK+E   A   GVAV E      TET+ LKK LVDSFYGT+ GL A+S
Sbjct  52    VRAVTSDDEWGPEKEE--EAYGGGVAVEEKPTETETETEKLKKALVDSFYGTDLGLKATS  109

Query  877   ETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEI  698
             ETRAE+VELITQLEAKNP PAPT+ALTLLNGKW+LAYTSF GLFPLLS GTLPLV+VEEI
Sbjct  110   ETRAEIVELITQLEAKNPNPAPTDALTLLNGKWILAYTSFAGLFPLLSSGTLPLVKVEEI  169

Query  697   CQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVL  518
              QTID+ +FTVQNSV F+GPLATTSISTNAKF+VRSPKRVQIKFEEGIIGTPQLTDS+ +
Sbjct  170   SQTIDTLNFTVQNSVQFAGPLATTSISTNAKFDVRSPKRVQIKFEEGIIGTPQLTDSLEI  229

Query  517   PENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDS  338
             PENVE LGQKIDLTPFKG++TS+QDTASSVVK+ISS+PPLK  ++NSNA+SWLLTTYLD 
Sbjct  230   PENVELLGQKIDLTPFKGILTSVQDTASSVVKTISSRPPLKIPISNSNAQSWLLTTYLDE  289

Query  337   ELRISRGEAGSIFVLIKEDSPLL  269
             ELRISRG+ GS+FVLIKE S LL
Sbjct  290   ELRISRGDGGSVFVLIKEGSSLL  312



>ref|NP_193955.1| plastid-lipid associated protein PAP / fibrillin family protein 
[Arabidopsis thaliana]
 sp|O49629.1|PAP2_ARATH RecName: Full=Probable plastid-lipid-associated protein 2, chloroplastic; 
Short=AtPap2; AltName: Full=Fibrillin-1b; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAA16774.1| fibrillin precursor-like protein [Arabidopsis thaliana]
 emb|CAB79179.1| fibrillin precursor-like protein [Arabidopsis thaliana]
 gb|AAW28556.1| At4g22240 [Arabidopsis thaliana]
 gb|AAW38981.1| At4g22240 [Arabidopsis thaliana]
 gb|AEE84581.1| plastid-lipid associated protein PAP / fibrillin family protein 
[Arabidopsis thaliana]
Length=310

 Score =   389 bits (1000),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 207/327 (63%), Positives = 246/327 (75%), Gaps = 19/327 (6%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPS-VFPVNSTIFASKVAALRSFPNRGLA-NPNR  1064
             MA++   TQF C+    I P S S  KP  + PV S I    ++        G+A +P R
Sbjct  1     MATVQLSTQFSCQTRVSISPNSKSISKPPFLVPVTSIIHRPMIST------GGIAVSPRR  54

Query  1063  KFVVRAVSDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSA  884
              F VRA    E G       SA  A    +ED    + ET+ LK+ LVDS YGT+RGLSA
Sbjct  55    VFKVRATDTGEIG-------SALLAAEEAIED----VEETERLKRSLVDSLYGTDRGLSA  103

Query  883   SSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVE  704
             SSETRAE+ +LITQLE+KNPTPAPTEAL LLNGKW+LAYTSF+ LFPLLSRG +PL++V+
Sbjct  104   SSETRAEIGDLITQLESKNPTPAPTEALFLLNGKWILAYTSFVNLFPLLSRGIVPLIKVD  163

Query  703   EICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSI  524
             EI QTIDS++FTVQNSV F+GPL T SISTNAKFE+RSPKRVQIKFE+G+IGTPQLTDSI
Sbjct  164   EISQTIDSDNFTVQNSVRFAGPLGTNSISTNAKFEIRSPKRVQIKFEQGVIGTPQLTDSI  223

Query  523   VLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYL  344
              +PE VE LGQKIDL P +GL+TS+QDTASSV ++ISSQPPLKFSL   NA+SWLLTTYL
Sbjct  224   EIPEYVEVLGQKIDLNPIRGLLTSVQDTASSVARTISSQPPLKFSLPADNAQSWLLTTYL  283

Query  343   DSELRISRGEAGSIFVLIKEDSPLLKP  263
             D ++RISRG+ GS+FVLIKE SPLL P
Sbjct  284   DKDIRISRGDGGSVFVLIKEGSPLLNP  310



>gb|AAL67120.1| AT4g22240/T10I14_70 [Arabidopsis thaliana]
Length=310

 Score =   387 bits (993),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 206/327 (63%), Positives = 245/327 (75%), Gaps = 19/327 (6%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPS-VFPVNSTIFASKVAALRSFPNRGLA-NPNR  1064
             MA++   TQF C+    I P S S  KP  + PV S I    ++        G+A +P R
Sbjct  1     MATVQLSTQFSCQTRVSISPNSKSISKPPFLVPVTSIIHRLMIST------GGIAVSPRR  54

Query  1063  KFVVRAVSDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSA  884
              F VRA    E G       SA  A    +ED    + ET+ LK+ LVDS YGT+RGLSA
Sbjct  55    VFKVRATDTGEIG-------SALLAAEEAIED----VEETERLKRSLVDSLYGTDRGLSA  103

Query  883   SSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVE  704
             SSETRAE+ +LITQLE+KNPTPAPTEAL LLNGKW+LAYTSF+ LFPLLSRG +PL++V+
Sbjct  104   SSETRAEIGDLITQLESKNPTPAPTEALFLLNGKWILAYTSFVNLFPLLSRGIVPLIKVD  163

Query  703   EICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSI  524
             EI QTIDS++FTVQNSV F+GPL T SISTNAKFE+RSPKRVQIKFE+G+IGTPQLTDSI
Sbjct  164   EISQTIDSDNFTVQNSVRFAGPLGTNSISTNAKFEIRSPKRVQIKFEQGVIGTPQLTDSI  223

Query  523   VLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYL  344
              +PE VE LGQKIDL P +GL+TS+QDTASSV ++ISSQPPLKF L   NA+SWLLTTYL
Sbjct  224   EIPEYVEVLGQKIDLNPIRGLLTSVQDTASSVARTISSQPPLKFFLPADNAQSWLLTTYL  283

Query  343   DSELRISRGEAGSIFVLIKEDSPLLKP  263
             D ++RISRG+ GS+FVLIKE SPLL P
Sbjct  284   DKDIRISRGDGGSVFVLIKEGSPLLNP  310



>ref|XP_010422246.1| PREDICTED: probable plastid-lipid-associated protein 1, chloroplastic 
[Camelina sativa]
Length=320

 Score =   387 bits (993),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 206/332 (62%), Positives = 255/332 (77%), Gaps = 19/332 (6%)
 Frame = -3

Query  1237  MASISS-FTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNR---GLANP  1070
             MA++ S FTQF CK    + P S +    S  PV          ++ SF  R   G++  
Sbjct  1     MATVPSLFTQFPCK---TLVPNSPNAKPHSKSPVQ--------VSVHSFNRRSELGISVH  49

Query  1069  NRKFVVRAVS-DDEWGEEKKEPLSAAPAGVAVVEDEPA--ALTETDVLKKQLVDSFYGTN  899
              R F VRA   DDEWG+E  E + A+ + VA  E + A  ++ ET+ LK+ L DS YGT+
Sbjct  50    RRGFKVRATDFDDEWGQEGVERVMAS-SSVAEKEADEAIESVEETEKLKRSLADSLYGTD  108

Query  898   RGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLP  719
             RGLSASS+TRAE+ ELITQ+E+KNPTPAPT+AL LLNGKW+LAYTSF+G+FPLLSR   P
Sbjct  109   RGLSASSDTRAEISELITQIESKNPTPAPTDALFLLNGKWILAYTSFVGMFPLLSRRIEP  168

Query  718   LVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  539
             LV+V+EI QTIDS++FTVQNSV+F+GP +TTS+STNAKFE+RSPKRVQIKFE+G+IGTPQ
Sbjct  169   LVKVDEISQTIDSDTFTVQNSVLFAGPFSTTSVSTNAKFEIRSPKRVQIKFEQGVIGTPQ  228

Query  538   LTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWL  359
             LTDSI +PE VE LGQKIDL+P KGL+TS+QDTASSV ++ISSQPPLKFSL++   +SWL
Sbjct  229   LTDSIEIPEFVEVLGQKIDLSPIKGLLTSVQDTASSVARTISSQPPLKFSLSSDKTQSWL  288

Query  358   LTTYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             LTTYLD +LRISRG+ GS+FVLIKE S LL P
Sbjct  289   LTTYLDKDLRISRGDGGSLFVLIKEGSSLLNP  320



>ref|XP_010686767.1| PREDICTED: plastid-lipid-associated protein, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=310

 Score =   386 bits (992),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 210/330 (64%), Positives = 241/330 (73%), Gaps = 25/330 (8%)
 Frame = -3

Query  1237  MASISSFTQF----HCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANP  1070
             M+ IS F       H  P  +  P+S      +VFP                   G+   
Sbjct  1     MSIISQFCHLPIKSHKLPSQLFTPKSPVVSPSTVFPT------------------GVKRE  42

Query  1069  NRKFVVRAVS-DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRG  893
                  V+A S DDEWG+EK     +A   VA  E     + E + LKKQLV+SFYGT+RG
Sbjct  43    ITTLKVKASSLDDEWGQEKSTSYGSAAVAVAEEEST-VEMEEMNKLKKQLVNSFYGTDRG  101

Query  892   LSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLV  713
             L ASSETRAE+VE ITQLEAKNPTPAPT+AL+LLNGKW+LAYTSF GLFPLLS+G LPLV
Sbjct  102   LKASSETRAEIVEFITQLEAKNPTPAPTDALSLLNGKWILAYTSFSGLFPLLSQGRLPLV  161

Query  712   RVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLT  533
             +VEEI QTIDSE FTVQNSV FSGP +TTS+STNAKFEVRSPKRVQIKF EG++GTPQ+T
Sbjct  162   KVEEISQTIDSEQFTVQNSVQFSGPFSTTSVSTNAKFEVRSPKRVQIKFMEGVVGTPQIT  221

Query  532   DSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLT  353
             DS+VLPENVEFLGQKIDLTP KGL  S+QDTASSV K+ISSQPPLKF++A  N ESWLLT
Sbjct  222   DSLVLPENVEFLGQKIDLTPLKGLFDSVQDTASSVAKTISSQPPLKFNIAR-NPESWLLT  280

Query  352   TYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             TYLD ELRISRG+ GS+FV IKE+S LL P
Sbjct  281   TYLDEELRISRGDGGSVFVFIKEESLLLPP  310



>ref|XP_006284145.1| hypothetical protein CARUB_v10005278mg [Capsella rubella]
 gb|EOA17043.1| hypothetical protein CARUB_v10005278mg [Capsella rubella]
Length=317

 Score =   386 bits (992),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 204/326 (63%), Positives = 247/326 (76%), Gaps = 10/326 (3%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MA+I  F QF CK       +S S  KP +    S+I    V     F   G+A     F
Sbjct  1     MAAIQLFNQFPCKTRVSTSSKSKSISKPLITVPMSSIIHRPV-----FSTGGIAVSRSDF  55

Query  1057  VVRAV-SDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSAS  881
              VRA  +DDEWG E +    A  + ++V ++   ++ ET+ LK+ L DS YG +RGL+AS
Sbjct  56    RVRATDADDEWGTEPE----ARGSALSVADEAIESVEETERLKRSLADSLYGIDRGLNAS  111

Query  880   SETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEE  701
             SETRAE+ +LITQLE+KNPTPAPT+AL LLNGKW+LAYTSF+ LFPLLSRG LPLV+V+E
Sbjct  112   SETRAEIGDLITQLESKNPTPAPTDALFLLNGKWILAYTSFVNLFPLLSRGILPLVKVDE  171

Query  700   ICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIV  521
             I QTIDS++FTVQNSV F+GPL T SISTNAKFE+RSPKRVQIKFE+G+IGTPQLTDSI 
Sbjct  172   ISQTIDSDNFTVQNSVRFAGPLGTNSISTNAKFEIRSPKRVQIKFEQGVIGTPQLTDSIE  231

Query  520   LPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLD  341
             +PE VE LGQKIDL P +GL+TS+QDTASSV ++ISSQPPLKFSL   NA+SWLLTTYLD
Sbjct  232   IPEYVEVLGQKIDLNPIRGLLTSVQDTASSVARTISSQPPLKFSLPGDNAQSWLLTTYLD  291

Query  340   SELRISRGEAGSIFVLIKEDSPLLKP  263
              ++RISRG+ GS+FVLIKE SPLL P
Sbjct  292   KDIRISRGDGGSVFVLIKEGSPLLNP  317



>gb|AAM67287.1| fibrillin precursor-like protein [Arabidopsis thaliana]
Length=310

 Score =   386 bits (991),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 206/327 (63%), Positives = 245/327 (75%), Gaps = 19/327 (6%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPS-VFPVNSTIFASKVAALRSFPNRGLA-NPNR  1064
             MA++   TQF C+    I P S S  KP  + PV S I    ++        G+A +P R
Sbjct  1     MATVQLSTQFRCQTRVSISPNSKSISKPPFLVPVTSIIHRPMIST------GGIAVSPRR  54

Query  1063  KFVVRAVSDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSA  884
              F VRA    E G       SA  A    +ED    + ET+ LK+ LVDS YGT+RGLSA
Sbjct  55    VFKVRATDTGEIG-------SALLAAEEAIED----VEETERLKRSLVDSLYGTDRGLSA  103

Query  883   SSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVE  704
             SSETRAE+ +LITQLE+KNPTPAPTEAL LLNGKW+LA TSF+ LFPLLSRG +PL++V+
Sbjct  104   SSETRAEIGDLITQLESKNPTPAPTEALFLLNGKWILACTSFVNLFPLLSRGIVPLIKVD  163

Query  703   EICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSI  524
             EI QTIDS++FTVQNSV F+GPL T SISTNAKFE+RSPKRVQIKFE+G+IGTPQLTDSI
Sbjct  164   EISQTIDSDNFTVQNSVRFAGPLGTNSISTNAKFEIRSPKRVQIKFEQGVIGTPQLTDSI  223

Query  523   VLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYL  344
              +PE VE LGQKIDL P +GL+TS+QDTASSV ++ISSQPPLKFSL   NA+SWLLTTYL
Sbjct  224   EIPEYVEVLGQKIDLNPIRGLLTSVQDTASSVARTISSQPPLKFSLPADNAQSWLLTTYL  283

Query  343   DSELRISRGEAGSIFVLIKEDSPLLKP  263
             D ++RISRG+ GS+FVLIKE SPLL P
Sbjct  284   DKDIRISRGDGGSVFVLIKEGSPLLNP  310



>ref|XP_006288225.1| hypothetical protein CARUB_v10001463mg [Capsella rubella]
 gb|EOA21123.1| hypothetical protein CARUB_v10001463mg [Capsella rubella]
Length=322

 Score =   386 bits (992),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 204/330 (62%), Positives = 248/330 (75%), Gaps = 13/330 (4%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MA++  F+QF CK    + P SS+    S  P+        V ++      G++     F
Sbjct  1     MATVPLFSQFSCK---TLIPSSSNAKPQSKAPIQV-----PVHSINRRSELGISVHRPDF  52

Query  1057  VVRAVS-DDEWGEEKKEPLSAAPAGVAVVEDEP----AALTETDVLKKQLVDSFYGTNRG  893
              VRA   DDEWG++  E + A+ + V+V E E      ++ ET+ LK+ LVDS YGT+RG
Sbjct  53    KVRATDIDDEWGQDGVERVIASSSPVSVAEKEADDAIESVEETERLKRSLVDSLYGTDRG  112

Query  892   LSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLV  713
             L+ASS+TRAE+ ELITQLE+KNPTPAP EAL LLNGKW+LAYTSF+GLFPLLSR   PLV
Sbjct  113   LNASSDTRAEISELITQLESKNPTPAPNEALFLLNGKWILAYTSFVGLFPLLSRRIEPLV  172

Query  712   RVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLT  533
             +V+EI QTIDS+SF VQNSV F+GP +TTS STNAKFEVRSPKRVQIKFE+G+IGTPQLT
Sbjct  173   KVDEISQTIDSDSFAVQNSVRFAGPFSTTSFSTNAKFEVRSPKRVQIKFEQGVIGTPQLT  232

Query  532   DSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLT  353
             DSI +PE VE LGQKIDL P KGL+TS+QDTASSV ++ISSQPPLKFSL + N +SWLLT
Sbjct  233   DSIEIPEFVEVLGQKIDLNPIKGLLTSVQDTASSVARTISSQPPLKFSLPSDNTQSWLLT  292

Query  352   TYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             TYLD +LRISRG+ GS+FVLIKE S LL P
Sbjct  293   TYLDKDLRISRGDGGSVFVLIKEGSSLLNP  322



>ref|XP_006396722.1| hypothetical protein EUTSA_v10028808mg [Eutrema salsugineum]
 gb|ESQ38175.1| hypothetical protein EUTSA_v10028808mg [Eutrema salsugineum]
Length=318

 Score =   386 bits (991),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 205/327 (63%), Positives = 243/327 (74%), Gaps = 11/327 (3%)
 Frame = -3

Query  1237  MASISSFTQFHCKP-VGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRK  1061
             MA++  F+QF CK  +       S +  P + P+NS    S+V         G+A     
Sbjct  1     MATVPLFSQFPCKTLIPSSSSSKSQSKSPILVPINSINRRSEV---------GIAVHRPD  51

Query  1060  FVVRAVS-DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSA  884
             F VRA   DDEWG +  E  S         E+   ++ ET+ LK+ LVDS YGT+RGLSA
Sbjct  52    FKVRATDVDDEWGTDAAERGSNVSVAEKSAEEAIESVEETERLKRLLVDSLYGTDRGLSA  111

Query  883   SSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVE  704
             SSETRAE+ E ITQLE+KNP PAP EAL LLNGKW+LAYTSF+GLFPLLSR   PLV+V+
Sbjct  112   SSETRAEISEFITQLESKNPNPAPNEALFLLNGKWILAYTSFVGLFPLLSRRISPLVKVD  171

Query  703   EICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSI  524
             EI QTIDS+SFTVQNSV F+GPLATTSISTNAKFE+RSPKRVQIKFE+G+IGTPQLTDSI
Sbjct  172   EISQTIDSDSFTVQNSVRFAGPLATTSISTNAKFEIRSPKRVQIKFEQGVIGTPQLTDSI  231

Query  523   VLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYL  344
              +PE VE LGQKIDL P +GL+TS+QDTASSV ++ISSQPPLKFSL   NA+SWLLTTYL
Sbjct  232   EIPEFVEVLGQKIDLNPIRGLLTSVQDTASSVARTISSQPPLKFSLPGDNAQSWLLTTYL  291

Query  343   DSELRISRGEAGSIFVLIKEDSPLLKP  263
             D +LRISRG+ GS+FVL+KE S LL P
Sbjct  292   DKDLRISRGDGGSVFVLVKEGSSLLSP  318



>ref|XP_010448920.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic 
[Camelina sativa]
 ref|XP_010448921.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic 
[Camelina sativa]
Length=310

 Score =   384 bits (987),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 203/325 (62%), Positives = 236/325 (73%), Gaps = 15/325 (5%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MA+I  F QF CK          S  KP +     TI  S +         G+A     F
Sbjct  1     MAAIQVFNQFPCKARVKTSSNFKSISKPLI-----TIPMSSIVHRPVLSTGGIAVSRADF  55

Query  1057  VVRAVSDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASS  878
              VRA    E GE     L+ A   +  VE       ET+ LK+ L DSFYG +RGL+ SS
Sbjct  56    RVRAT---EAGERGSAALTVADEAIEAVE-------ETERLKRSLADSFYGIDRGLNTSS  105

Query  877   ETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEI  698
             ETRAE+ +LITQLE+KNPTPAPT+AL LLNGKW+LAYTSF+ LFPLLSRG LPLV+V+EI
Sbjct  106   ETRAEIGDLITQLESKNPTPAPTDALFLLNGKWILAYTSFVNLFPLLSRGILPLVKVDEI  165

Query  697   CQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVL  518
              QTIDS++FTVQNSV F+GPL T SISTNAKFE+RSPKRVQIKFE+G+IGTPQLTDSI +
Sbjct  166   SQTIDSDNFTVQNSVRFAGPLGTNSISTNAKFEIRSPKRVQIKFEQGVIGTPQLTDSIEI  225

Query  517   PENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDS  338
             PENVE LGQKIDL P +GL+TS+QDTASSV +SISSQPPLKFSL    AESWLLTTYLD 
Sbjct  226   PENVEVLGQKIDLNPIRGLLTSVQDTASSVARSISSQPPLKFSLPGDKAESWLLTTYLDK  285

Query  337   ELRISRGEAGSIFVLIKEDSPLLKP  263
             ++RISRG+ GS+FVLIKE SPLL P
Sbjct  286   DIRISRGDGGSVFVLIKEGSPLLNP  310



>ref|XP_010496158.1| PREDICTED: probable plastid-lipid-associated protein 1, chloroplastic 
[Camelina sativa]
Length=321

 Score =   385 bits (988),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 206/332 (62%), Positives = 254/332 (77%), Gaps = 18/332 (5%)
 Frame = -3

Query  1237  MASISS-FTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNR---GLANP  1070
             MA++ S FTQF CK   +  P S +    S  PV          ++ SF  R   G++  
Sbjct  1     MATVPSLFTQFPCKKTQV--PNSPNAKPHSKSPVQ--------VSVHSFNRRSELGISVH  50

Query  1069  NRKFVVRAVS-DDEWGEEKKEPLSAAPAGVAVVEDEPA--ALTETDVLKKQLVDSFYGTN  899
              R F VRA   DDEWG+E  E + A+ + VA  E + A  ++ ET+ LK+ L DS YGT+
Sbjct  51    RRGFKVRATDFDDEWGQEGVERVMAS-SSVAEKEADEAIESVEETEKLKRSLADSLYGTD  109

Query  898   RGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLP  719
             RGL ASS+TRAE+ ELITQLE+KNPTPAPT+AL LLNGKW+LAYTSF+G+FPLLSR   P
Sbjct  110   RGLCASSDTRAEISELITQLESKNPTPAPTDALFLLNGKWILAYTSFVGMFPLLSRRIEP  169

Query  718   LVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  539
             LV+V+EI QTIDS++FTVQNSV+F+GP +TTS+STNAKFE+RSPKRVQIKFE+G+IGTPQ
Sbjct  170   LVKVDEISQTIDSDTFTVQNSVLFAGPFSTTSVSTNAKFEIRSPKRVQIKFEQGVIGTPQ  229

Query  538   LTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWL  359
             LTDSI +PE VE LGQKIDL+P KGL+TS+QDTASSV ++ISSQPPLKFSL++   +SWL
Sbjct  230   LTDSIEIPEFVEVLGQKIDLSPIKGLLTSVQDTASSVARTISSQPPLKFSLSSDKTQSWL  289

Query  358   LTTYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             LTTYLD +LRISRG+ GS+FVLIKE S LL P
Sbjct  290   LTTYLDKDLRISRGDGGSLFVLIKEGSSLLNP  321



>ref|XP_006413678.1| hypothetical protein EUTSA_v10025758mg [Eutrema salsugineum]
 dbj|BAJ33603.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ55131.1| hypothetical protein EUTSA_v10025758mg [Eutrema salsugineum]
Length=317

 Score =   382 bits (981),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 210/326 (64%), Positives = 249/326 (76%), Gaps = 10/326 (3%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MA++  F+Q  CK        S S  KP +    S+I    V +   F     A     F
Sbjct  1     MATVQLFSQSPCKTRVSSSANSKSLSKPPILVPASSITRRPVLSTGRF-----AVSRADF  55

Query  1057  VVRAV-SDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSAS  881
              VR   ++DEWG E  E  SA    ++V E+   A+ ET+VLK+ L DS YGT+RGLSAS
Sbjct  56    RVRVTDAEDEWGPETGERGSA----LSVAEEAIEAVEETEVLKRTLADSLYGTDRGLSAS  111

Query  880   SETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEE  701
             SETRAE+ +LITQLE+KNPTPAPTEAL LLNGKW+LAYTSF+GLFPLLSRG +PLV+V+E
Sbjct  112   SETRAEIGDLITQLESKNPTPAPTEALFLLNGKWILAYTSFVGLFPLLSRGIVPLVKVDE  171

Query  700   ICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIV  521
             I QTIDSE+FTVQNSV F+GPLATTSISTNAKFE+RSPKRVQIKFE+G+IGTPQLTDSI 
Sbjct  172   ISQTIDSENFTVQNSVRFAGPLATTSISTNAKFEIRSPKRVQIKFEQGVIGTPQLTDSIE  231

Query  520   LPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLD  341
             +PE VE LGQKIDL P +GL+TS+QDTASSV ++ISSQPPLKFSL   NA+SWLLTTYLD
Sbjct  232   IPEYVEVLGQKIDLNPIRGLLTSVQDTASSVARTISSQPPLKFSLPGDNAQSWLLTTYLD  291

Query  340   SELRISRGEAGSIFVLIKEDSPLLKP  263
              ++RISRG+ GS+FVLIKE SPLL P
Sbjct  292   KDIRISRGDGGSVFVLIKEGSPLLNP  317



>gb|KFK30956.1| hypothetical protein AALP_AA6G049300 [Arabis alpina]
Length=320

 Score =   380 bits (975),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 205/331 (62%), Positives = 245/331 (74%), Gaps = 17/331 (5%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MA++  F+QF CK +       S++  P + P N     S++         G+A     F
Sbjct  1     MATVPLFSQFPCKTLAPSPNSKSNSKSPIILPTNPINRRSEI---------GIAVHRPDF  51

Query  1057  VVRAV-SDDEWGEEKKEPLSAAPAGVAVVEDEPA-----ALTETDVLKKQLVDSFYGTNR  896
              VRA+ +DDEWG +  E  S    G   V ++ A     ++ ET+ LK+ LVDS YGT+R
Sbjct  52    RVRAIDADDEWGSDAVE--SRGGGGSVSVAEKAAEEAIGSVEETERLKRLLVDSLYGTDR  109

Query  895   GLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPL  716
             GL+ASSETR E+ ELITQLE+ NPTPAP EAL LLNGKW+LAYTSF+GLFPLLSR   PL
Sbjct  110   GLTASSETRGEIGELITQLESMNPTPAPNEALFLLNGKWILAYTSFVGLFPLLSRRIEPL  169

Query  715   VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  536
             V+V+EI QTIDS+SFTVQNSV F+GPLATTS STNAKFE+RSPKRVQIKFE+G+IGTPQL
Sbjct  170   VKVDEISQTIDSDSFTVQNSVRFAGPLATTSFSTNAKFEIRSPKRVQIKFEQGVIGTPQL  229

Query  535   TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  356
             TDSI +PE VE LGQKIDL P KGL+TS+QDTASSV K+ISSQPPLKFSL     +SWLL
Sbjct  230   TDSIEIPEFVEVLGQKIDLNPIKGLLTSVQDTASSVAKTISSQPPLKFSLPGDRTQSWLL  289

Query  355   TTYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             TTYLD +LRISRG+AGS+FVLIKE S LL P
Sbjct  290   TTYLDKDLRISRGDAGSVFVLIKEGSSLLNP  320



>ref|XP_010433071.1| PREDICTED: probable plastid-lipid-associated protein 1, chloroplastic 
[Camelina sativa]
Length=320

 Score =   379 bits (973),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 199/329 (60%), Positives = 253/329 (77%), Gaps = 13/329 (4%)
 Frame = -3

Query  1237  MASISS-FTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRK  1061
             MA++ S FTQ  CK    + P SS+  + S  P+       ++ ++      G++     
Sbjct  1     MATVPSLFTQLPCK---TLVPNSSNAKRHSKSPIQV-----QIPSINRRSKLGVSVHRPD  52

Query  1060  FVVRAVS-DDEWGEEKKEPLSAAPAGVAVVEDEPA--ALTETDVLKKQLVDSFYGTNRGL  890
             F VRA   DD+WG++  E + A+ + VA  E + A  ++ ET+ LK+ L DS YGT+RGL
Sbjct  53    FKVRATDFDDKWGQDGVERVMAS-SSVAEKEADEAIESVEETEKLKRSLADSLYGTDRGL  111

Query  889   SASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVR  710
             SASS+TRAE+ ELITQLE+KNPTPAPT+AL LLNGKW+LAYTSF+G+FPLLSR   PLV+
Sbjct  112   SASSDTRAEISELITQLESKNPTPAPTDALFLLNGKWILAYTSFVGMFPLLSRRIEPLVK  171

Query  709   VEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTD  530
             V+EI QTIDS++FTVQNSV+F+GP +TTS+STNAKFE+RSPKRVQI FE+G+IGTPQLTD
Sbjct  172   VDEISQTIDSDTFTVQNSVLFAGPFSTTSVSTNAKFEIRSPKRVQIMFEQGVIGTPQLTD  231

Query  529   SIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTT  350
             SI +PE VE LGQKIDL+P KGL+TS+QDTASSV ++ISSQPPLKFSL++   +SWLLTT
Sbjct  232   SIEIPEFVEVLGQKIDLSPIKGLLTSVQDTASSVARTISSQPPLKFSLSSDKTQSWLLTT  291

Query  349   YLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             YLD +LRISRG+ GS+FVLIKE S LL P
Sbjct  292   YLDKDLRISRGDGGSLFVLIKEGSSLLNP  320



>ref|XP_002867781.1| hypothetical protein ARALYDRAFT_914391 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44040.1| hypothetical protein ARALYDRAFT_914391 [Arabidopsis lyrata subsp. 
lyrata]
Length=310

 Score =   377 bits (969),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 204/325 (63%), Positives = 240/325 (74%), Gaps = 15/325 (5%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MA++  FTQF CK    I   S S  KP +    S+I    V     F  R +      F
Sbjct  1     MATVQLFTQFPCKTRVSITRNSKSFSKPPILVPMSSIIHRPV-----FSTRRIGVSRADF  55

Query  1057  VVRAVSDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASS  878
              VRA   D  GE          + +   E+   A+ ET+ LK+ L DS YGT+RGLSASS
Sbjct  56    RVRAT--DAAGERG--------SALLAAEEAIEAVEETERLKRSLADSLYGTDRGLSASS  105

Query  877   ETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEI  698
             ETRAE+ +LITQLE+KNPTPAPTEAL LLNGKW+LAYTSF+ LFPLLSRG +PLV+V+EI
Sbjct  106   ETRAEIGDLITQLESKNPTPAPTEALFLLNGKWILAYTSFVNLFPLLSRGIVPLVKVDEI  165

Query  697   CQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVL  518
              QTIDSE+FTVQNSV F+GPL T SISTNAKFE+RSPKRVQIKFE+G+IGTPQLTDSI +
Sbjct  166   SQTIDSENFTVQNSVRFAGPLGTNSISTNAKFEIRSPKRVQIKFEQGVIGTPQLTDSIEI  225

Query  517   PENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDS  338
             PE VE LGQKIDL P +GL+TS+QDTASSV ++ISSQPPLKFSL   NA+SWLLTTYLD 
Sbjct  226   PEYVEVLGQKIDLNPIRGLLTSVQDTASSVARTISSQPPLKFSLPGDNAQSWLLTTYLDK  285

Query  337   ELRISRGEAGSIFVLIKEDSPLLKP  263
             ++RISRG+ GS+FVLIKE SPLL P
Sbjct  286   DIRISRGDGGSVFVLIKEGSPLLNP  310



>ref|XP_010529464.1| PREDICTED: probable plastid-lipid-associated protein 1, chloroplastic 
[Tarenaya hassleriana]
Length=323

 Score =   377 bits (968),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 205/325 (63%), Positives = 251/325 (77%), Gaps = 6/325 (2%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MAS+S  +QF CK        S S  KP++    ++I  +++ A+ +    G+A     F
Sbjct  1     MASVSLSSQFPCKTRPPTSRNSKSQKKPAILMRMTSI--NRMPAVLAG---GIAVSRPDF  55

Query  1057  VVRAVS-DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSAS  881
              VR+   +DEWG E  E  S        +E+   A+ ET+ LK+ L +S YGT+RGL AS
Sbjct  56    RVRSSEVEDEWGSEPSENRSPVSVVEREIEEAIEAVEETERLKRALAESLYGTDRGLRAS  115

Query  880   SETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEE  701
             SETRAE+ ELITQLEAKNPTPAPT+AL LLNGKW+LAYTSF+GLFPLLSRG +P+V+V+E
Sbjct  116   SETRAEIGELITQLEAKNPTPAPTDALFLLNGKWILAYTSFVGLFPLLSRGIVPVVKVDE  175

Query  700   ICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIV  521
             I QTIDSESFTVQNSV F+GPLATTSISTNAKFEVRSP+RVQIKFE+GIIGTPQLTDSI 
Sbjct  176   ISQTIDSESFTVQNSVRFAGPLATTSISTNAKFEVRSPRRVQIKFEQGIIGTPQLTDSIE  235

Query  520   LPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLD  341
             +PENVE LGQKIDL P +GL+TSLQDTA+SV ++ISS+PPLKFSL + NA+SWLLTT+LD
Sbjct  236   IPENVEVLGQKIDLNPIRGLLTSLQDTATSVARTISSRPPLKFSLPSDNAQSWLLTTFLD  295

Query  340   SELRISRGEAGSIFVLIKEDSPLLK  266
              +LRISRG+ GS+FVL KE S LL+
Sbjct  296   KDLRISRGDGGSVFVLFKEGSSLLE  320



>ref|XP_002872677.1| plastid lipid-associated protein 1, chloroplast precursor [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH48936.1| plastid lipid-associated protein 1, chloroplast precursor [Arabidopsis 
lyrata subsp. lyrata]
Length=322

 Score =   377 bits (967),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 200/334 (60%), Positives = 245/334 (73%), Gaps = 21/334 (6%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPK----PSVFPVNSTIFASKVAALRSFPNRGLANP  1070
             MA++  F+QF CK    + P SS+T      P + P+NS    S++         G++  
Sbjct  1     MATVPLFSQFPCK---TLVPSSSNTKSQSKSPILLPINSVNRRSEI---------GISVH  48

Query  1069  NRKFVVRAVS-DDEWGEEKKE----PLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYG  905
                F +RA   +DEWG+E  E      S       V +    +  ET+ LK+ L DS YG
Sbjct  49    RPDFKIRATDINDEWGQEGVERVLSSSSPVSVAEKVADGAIESAEETERLKRSLADSLYG  108

Query  904   TNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGT  725
             T+RGLSASS+TRAE+ ELITQLE+KNPTPAP EAL LLNGKW+LAYTSF+GLFPLLSR  
Sbjct  109   TDRGLSASSDTRAEISELITQLESKNPTPAPNEALFLLNGKWILAYTSFVGLFPLLSRRI  168

Query  724   LPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGT  545
              PLV+V+EI QTIDS+SFTVQNSV F+GP +TTS STNAKFE+RSPKRVQIKFE+G+IGT
Sbjct  169   EPLVKVDEISQTIDSDSFTVQNSVRFAGPFSTTSFSTNAKFEIRSPKRVQIKFEQGVIGT  228

Query  544   PQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAES  365
             PQL DSI +PE+VE LGQKIDL P KG++TS+QDTASSV ++IS+QPPLKFSL + N +S
Sbjct  229   PQLMDSIEIPESVEILGQKIDLNPIKGILTSVQDTASSVARTISNQPPLKFSLPSDNTQS  288

Query  364   WLLTTYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             WLLTTYLD +LRISRG+ GS+FVLIKE S LL P
Sbjct  289   WLLTTYLDKDLRISRGDGGSVFVLIKEGSSLLNP  322



>ref|XP_009392110.1| PREDICTED: chromoplast-specific carotenoid-associated protein 
C1, chromoplast-like [Musa acuminata subsp. malaccensis]
Length=320

 Score =   375 bits (962),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 191/261 (73%), Positives = 220/261 (84%), Gaps = 6/261 (2%)
 Frame = -3

Query  1045  VSDDEWGEEKK-EPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETR  869
             V DDEWG+E   EP S    GVAVVE     L+E   LK++L+D   GT+RGL ASSETR
Sbjct  63    VDDDEWGKEGNGEPES----GVAVVEPPVEELSEAGELKRKLMDLLSGTDRGLKASSETR  118

Query  868   AEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLP-LVRVEEICQ  692
             AE+VELITQLEAKNPTPAPT+AL LLNGKW+LAYTSF  LFPLL  G LP LV+V+EICQ
Sbjct  119   AEIVELITQLEAKNPTPAPTDALPLLNGKWILAYTSFSQLFPLLGSGRLPQLVKVDEICQ  178

Query  691   TIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPE  512
             TIDSESFTVQNSV F+GPLATTS++TNAKFEVRSPKRVQIKFEEGIIGTPQLTD IV+P+
Sbjct  179   TIDSESFTVQNSVKFAGPLATTSVTTNAKFEVRSPKRVQIKFEEGIIGTPQLTDDIVVPD  238

Query  511   NVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSEL  332
              VEFLGQ +DL+PFKG+I+S+Q+ ASSVV++IS QPPLK  + N+NA+SWLLTTYLD EL
Sbjct  239   KVEFLGQNVDLSPFKGVISSIQNAASSVVRTISGQPPLKIPINNTNAQSWLLTTYLDEEL  298

Query  331   RISRGEAGSIFVLIKEDSPLL  269
             RISR + GS+FVLIKE SPLL
Sbjct  299   RISRSDGGSVFVLIKEGSPLL  319



>emb|CDY16684.1| BnaA09g20620D [Brassica napus]
Length=318

 Score =   374 bits (960),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 202/325 (62%), Positives = 241/325 (74%), Gaps = 7/325 (2%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MA++  FTQF CK    I P SS++   S  P   T+ +      R+     +  P+ K 
Sbjct  1     MATVPLFTQFPCK---TIVPTSSNSKLQSKSP---TLVSVNPINRRTEVRTAVHRPDFKV  54

Query  1057  VVRAVSDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASS  878
              V  V +DEWG +  E  S         E+   ++ ET+ LK+ L DS YGT+RGLSASS
Sbjct  55    RVSDV-NDEWGPDSSERGSNVSVAEKEAEEAIESVEETERLKRSLADSLYGTDRGLSASS  113

Query  877   ETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEI  698
             ETRAE+ ELITQLE+KNP PAP EAL LL+GKW+LAYTSF+GLFPLLSR   PLV+V+EI
Sbjct  114   ETRAEISELITQLESKNPNPAPNEALFLLSGKWILAYTSFVGLFPLLSRRISPLVKVDEI  173

Query  697   CQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVL  518
              QTIDS+SFTVQNSV F+GPLATTS STNAKFEV+SPKRVQIKFE+G+IGTPQLTDSI +
Sbjct  174   SQTIDSDSFTVQNSVRFAGPLATTSFSTNAKFEVQSPKRVQIKFEQGVIGTPQLTDSIEI  233

Query  517   PENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDS  338
             PE+VE LGQKIDL P +GL+TS+QDTASSV ++ISSQPPLKFSL    A+SWLLTTYLD 
Sbjct  234   PESVEVLGQKIDLNPIRGLLTSVQDTASSVARTISSQPPLKFSLPADRAQSWLLTTYLDK  293

Query  337   ELRISRGEAGSIFVLIKEDSPLLKP  263
             +LRISRG+ GSIFVL KE S LL P
Sbjct  294   DLRISRGDGGSIFVLFKEGSSLLNP  318



>ref|XP_009114588.1| PREDICTED: probable plastid-lipid-associated protein 1, chloroplastic 
[Brassica rapa]
Length=318

 Score =   373 bits (957),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 202/326 (62%), Positives = 244/326 (75%), Gaps = 9/326 (3%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MA++  FTQF CK    I P SS++   S  P  + +F + +   RS     +  P  +F
Sbjct  1     MATVPLFTQFPCK---TIVPTSSNSKLQSKSP--TLMFVNPINR-RSEARTAVHRP--EF  52

Query  1057  VVRAVS-DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSAS  881
              VRA   +DEWG +  E  S         E+   ++ ET+ LK+ L DS YGT+RGLSAS
Sbjct  53    KVRATDVNDEWGPDASERGSNVSVAEKEAEEAIESVEETERLKRSLADSLYGTDRGLSAS  112

Query  880   SETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEE  701
             SETRAE+ ELITQLE+KNP PAP EAL LL+GKW+LAYTSF+GLFPLLSR   PLV+V+E
Sbjct  113   SETRAEISELITQLESKNPNPAPNEALFLLSGKWILAYTSFVGLFPLLSRRISPLVKVDE  172

Query  700   ICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIV  521
             I QTIDS+SFTVQNSV F+GPLATTS STNAKFEV+SPKRVQIKFE+G+IGTPQLTDSI 
Sbjct  173   ISQTIDSDSFTVQNSVRFAGPLATTSFSTNAKFEVQSPKRVQIKFEQGVIGTPQLTDSIE  232

Query  520   LPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLD  341
             +PE+VE LGQKIDL P +GL+TS+QDTASSV ++IS++PPLKFSL    A+SWLLTTYLD
Sbjct  233   IPESVEVLGQKIDLNPIRGLLTSVQDTASSVARTISNRPPLKFSLPADRAQSWLLTTYLD  292

Query  340   SELRISRGEAGSIFVLIKEDSPLLKP  263
              +LRISRG+ GSIFVL KE S LL P
Sbjct  293   KDLRISRGDGGSIFVLFKEGSSLLNP  318



>sp|B4F6G1.1|CHRC2_ONCHC RecName: Full=Chromoplast-specific carotenoid-associated protein 
C2, chromoplast; Short=OgCHRC2; AltName: Full=Chromoplast 
specific carotenoid associated protein C2; AltName: Full=Fibrillin-like 
protein 2; Flags: Precursor [Oncidium hybrid cultivar]
 gb|AAY24688.1| fibrillin-like protein [Oncidium hybrid cultivar]
Length=319

 Score =   371 bits (952),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 192/281 (68%), Positives = 228/281 (81%), Gaps = 14/281 (5%)
 Frame = -3

Query  1102  RSFPNRGLANPNRKFVVRAVSDDEWGEEKKEPLSAAPAGVAVVEDEP--AALTETDVLKK  929
             R+FP+         F V+A+++DEW  EKK  L      VA+ EDE   A L  +D LKK
Sbjct  49    RTFPS---------FRVQAIAEDEWESEKKT-LKGVVGSVALAEDEKTGADLVVSD-LKK  97

Query  928   QLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGL  749
             +L+D  +GT+RGL A+SETRAEV ELITQLEAKNP PAPTEAL+LLNGKW+LAYTSF+GL
Sbjct  98    KLIDQLFGTDRGLKATSETRAEVNELITQLEAKNPNPAPTEALSLLNGKWILAYTSFVGL  157

Query  748   FPLLSRGTLP-LVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQI  572
             FPLL   +L  L++V+EI QTIDSE FTVQNSV F GP ++TS++TNAKFEVRSPKRVQI
Sbjct  158   FPLLGAESLQQLLKVDEISQTIDSEGFTVQNSVRFVGPFSSTSVTTNAKFEVRSPKRVQI  217

Query  571   KFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKF  392
             KFEEGIIGTPQLTDSIV+P+ VEF GQ IDL+PFKG+I+SLQDTASSV K+ISSQPP+KF
Sbjct  218   KFEEGIIGTPQLTDSIVIPDKVEFFGQNIDLSPFKGVISSLQDTASSVAKTISSQPPIKF  277

Query  391   SLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
              ++NSNA+SWLLTTYLD ELRISR + GS+FVLI E SPLL
Sbjct  278   PISNSNAQSWLLTTYLDDELRISRADGGSVFVLILESSPLL  318



>gb|EYU27736.1| hypothetical protein MIMGU_mgv1a010083mg [Erythranthe guttata]
Length=319

 Score =   370 bits (951),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 209/332 (63%), Positives = 244/332 (73%), Gaps = 20/332 (6%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSS-TPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRK  1061
             MASI S +QF CK +     R S  +P+ +V  VN   F +   ++R    R      + 
Sbjct  1     MASIPSISQFPCKSLQTGSHRHSKLSPRNAVNLVNGINFPA--ISVR----RSAEAAKQV  54

Query  1060  FVVRAVS-DDEWGEEKKEPLSAAPAGVAVVEDEP----AALTETDVLKKQLVDSFYGTNR  896
             F  RA   +DE+ E          AGVAV+ + P      LTE DVLKKQL+DS YGT R
Sbjct  55    FTARAAGGEDEFCEPDL-------AGVAVLIEPPPPPAKKLTEIDVLKKQLLDSLYGTTR  107

Query  895   GLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPL-LSRGTLP  719
             GL ASSETRAE++ELITQLE KNPTPAPTEALTLLNGKW+L YTS + LF L  + G LP
Sbjct  108   GLFASSETRAEILELITQLECKNPTPAPTEALTLLNGKWILVYTSHVNLFSLSTTVGALP  167

Query  718   LVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  539
             LV+VEEI QTIDSESFTVQ+SV+FSGPL+TT+ISTN+KFEVR+PKRVQIK EEGIIGTPQ
Sbjct  168   LVKVEEISQTIDSESFTVQSSVLFSGPLSTTAISTNSKFEVRTPKRVQIKIEEGIIGTPQ  227

Query  538   LTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWL  359
             L  S+VLPENVE  GQ IDLTPFK L TS+Q+TASSV  +ISSQPPLKFS+++ +AESWL
Sbjct  228   LIYSVVLPENVELFGQNIDLTPFKELFTSVQETASSVATTISSQPPLKFSISHKDAESWL  287

Query  358   LTTYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             LTTYLD ELRISR + G IFVLIKE SPLL P
Sbjct  288   LTTYLDEELRISREDGGGIFVLIKEGSPLLTP  319



>gb|AGN30962.1| chromoplast-specific carotenoid-associated protein [Narcissus 
tazetta var. chinensis]
Length=316

 Score =   370 bits (949),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 199/321 (62%), Positives = 241/321 (75%), Gaps = 20/321 (6%)
 Frame = -3

Query  1189  MICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANP------------NRKFVVRA  1046
             M C  S +       PV+ST+ + +  +L + PN   ++P             + F+ RA
Sbjct  1     MACSSSFNPLALKTLPVHSTVKSHRNPSLPT-PNLNFSSPLPKTLTLTIKTQQKSFLARA  59

Query  1045  VSDD-EWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETR  869
              +DD EWG+E+ +      +G   V +E     E + LKK+L +  YGT+RGL ASSETR
Sbjct  60    TTDDDEWGKERGDE-----SGGLAVAEEEQGGGEIEELKKRLKELLYGTDRGLKASSETR  114

Query  868   AEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLP-LVRVEEICQ  692
             AE+VELITQLEAKNPTPAPTEALTLLNGKW+LAYTSF  LFPLL  G LP LV+V+EI Q
Sbjct  115   AEIVELITQLEAKNPTPAPTEALTLLNGKWILAYTSFSQLFPLLGSGRLPELVKVDEISQ  174

Query  691   TIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPE  512
             TIDSE+FTVQNSV F+GPLATTS++TNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIV+PE
Sbjct  175   TIDSEAFTVQNSVKFAGPLATTSVTTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVIPE  234

Query  511   NVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSEL  332
              VEF GQKIDL+P +G+ITS++D+ SSVVK+IS +PPLK  +AN  A+SWLLTTYLD EL
Sbjct  235   KVEFFGQKIDLSPLRGVITSIEDSYSSVVKTISGRPPLKIPIANDKAQSWLLTTYLDGEL  294

Query  331   RISRGEAGSIFVLIKEDSPLL  269
             RISR + GS+FVLIKE SPLL
Sbjct  295   RISRADGGSVFVLIKEGSPLL  315



>sp|B2LU34.1|CHRC1_ONCHC RecName: Full=Chromoplast-specific carotenoid-associated protein 
C1, chromoplast; Short=OgCHRC1; AltName: Full=Fibrillin-like 
protein 1; AltName: Full=Plastid lipid-associated protein 
CHRC1; Flags: Precursor [Oncidium hybrid cultivar]
 gb|ACC59805.1| chromoplast specific carotenoid associated protein [Oncidium 
hybrid cultivar]
Length=319

 Score =   368 bits (945),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 188/267 (70%), Positives = 222/267 (83%), Gaps = 5/267 (2%)
 Frame = -3

Query  1060  FVVRAVSDDEWGEEKKEPLSAAPAGVAVVEDEP--AALTETDVLKKQLVDSFYGTNRGLS  887
             F V+A+++DEW  EKK  L      VA+ EDE   A L  +D LKK+L+D  +GT+RGL 
Sbjct  54    FRVQAIAEDEWESEKKA-LKGVVGSVALAEDETTGADLVVSD-LKKKLIDQLFGTDRGLK  111

Query  886   ASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLP-LVR  710
             A+SETRAEV ELITQLEAKNP PAPTEAL+LLNG+W+LAYTSF GLFPLL   +L  L++
Sbjct  112   ATSETRAEVNELITQLEAKNPNPAPTEALSLLNGRWILAYTSFAGLFPLLGAESLQQLLK  171

Query  709   VEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTD  530
             V+EI QTIDSE FTVQNSV F GP ++TS++TNAKFEVRSPKRVQIKFEEGIIGTPQLTD
Sbjct  172   VDEISQTIDSEGFTVQNSVRFVGPFSSTSVTTNAKFEVRSPKRVQIKFEEGIIGTPQLTD  231

Query  529   SIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTT  350
             SIV+P+  EF GQ IDL+PFKG+I+SLQDTASSV K+ISSQPP+KF ++NSNA+SWLLTT
Sbjct  232   SIVIPDKFEFFGQNIDLSPFKGVISSLQDTASSVAKTISSQPPIKFPISNSNAQSWLLTT  291

Query  349   YLDSELRISRGEAGSIFVLIKEDSPLL  269
             YLD ELRISR + GS+FVLIKE SPLL
Sbjct  292   YLDDELRISRADGGSVFVLIKEGSPLL  318



>gb|EYU27735.1| hypothetical protein MIMGU_mgv1a010083mg [Erythranthe guttata]
Length=323

 Score =   365 bits (938),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 209/336 (62%), Positives = 245/336 (73%), Gaps = 24/336 (7%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSS-TPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRK  1061
             MASI S +QF CK +     R S  +P+ +V  VN   F +   ++R    R      + 
Sbjct  1     MASIPSISQFPCKSLQTGSHRHSKLSPRNAVNLVNGINFPA--ISVR----RSAEAAKQV  54

Query  1060  FVVRAVS-DDEWGEEKKEPLSAAPAGVAVVEDEP----AALTETDVLKKQLVDSFYGTNR  896
             F  RA   +DE+ E          AGVAV+ + P      LTE DVLKKQL+DS YGT R
Sbjct  55    FTARAAGGEDEFCEPDL-------AGVAVLIEPPPPPAKKLTEIDVLKKQLLDSLYGTTR  107

Query  895   GLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVL----AYTSFIGLFPL-LSR  731
             GL ASSETRAE++ELITQLE KNPTPAPTEALTLLNGKW+L    +YTS + LF L  + 
Sbjct  108   GLFASSETRAEILELITQLECKNPTPAPTEALTLLNGKWILVENCSYTSHVNLFSLSTTV  167

Query  730   GTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGII  551
             G LPLV+VEEI QTIDSESFTVQ+SV+FSGPL+TT+ISTN+KFEVR+PKRVQIK EEGII
Sbjct  168   GALPLVKVEEISQTIDSESFTVQSSVLFSGPLSTTAISTNSKFEVRTPKRVQIKIEEGII  227

Query  550   GTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNA  371
             GTPQL  S+VLPENVE  GQ IDLTPFK L TS+Q+TASSV  +ISSQPPLKFS+++ +A
Sbjct  228   GTPQLIYSVVLPENVELFGQNIDLTPFKELFTSVQETASSVATTISSQPPLKFSISHKDA  287

Query  370   ESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             ESWLLTTYLD ELRISR + G IFVLIKE SPLL P
Sbjct  288   ESWLLTTYLDEELRISREDGGGIFVLIKEGSPLLTP  323



>gb|KJB34758.1| hypothetical protein B456_006G082400 [Gossypium raimondii]
Length=338

 Score =   366 bits (939),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 208/335 (62%), Positives = 241/335 (72%), Gaps = 13/335 (4%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MA+I     F CK          ST KPS+  +NS       + +  F  R        F
Sbjct  1     MATIFQLNNFPCKTFLTTPKHLQSTSKPSILLLNSIKRTQNSSRVSHFLTRKSIRSRPGF  60

Query  1057  VVRAVSDDEWGEEKKEPLSAAP----AGVAVVEDEPAA--------LTETDVLKKQLVDS  914
              + A  DDE   +KKE +   P     GV V E E  A        + E + LKK LVDS
Sbjct  61    QIFAADDDEGSPDKKEEVMEDPETESGGVIVAEAEAEAEEEKPKEEVGEIESLKKALVDS  120

Query  913   FYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLS  734
             FYGT+RG  ASSETRAE+VELIT LEAKNPTPAPT++L LLNGKW+LAYTSF GLFPLLS
Sbjct  121   FYGTDRGWKASSETRAEIVELITLLEAKNPTPAPTDSLPLLNGKWILAYTSFTGLFPLLS  180

Query  733   RGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI  554
             RG L LV+VEEI QTID+ES TVQNSV FSGPLA++SIS +AKFEVRSP+RVQIKF+EGI
Sbjct  181   RGQLRLVKVEEISQTIDAESLTVQNSVQFSGPLASSSISASAKFEVRSPRRVQIKFQEGI  240

Query  553   IGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSN  374
             IGTPQLTDSIVLPENVEF+GQ IDL P KGL+ S+QDTAS+V K+ISS+PPLKFSL+NSN
Sbjct  241   IGTPQLTDSIVLPENVEFMGQNIDLAPIKGLLNSVQDTASTVAKTISSRPPLKFSLSNSN  300

Query  373   AESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
             +ESWLLTTYLD +LRISR + GS+FVLIKE S  L
Sbjct  301   SESWLLTTYLDEDLRISR-DGGSVFVLIKEGSSFL  334



>ref|XP_010943242.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic 
[Elaeis guineensis]
Length=351

 Score =   365 bits (938),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 196/269 (73%), Positives = 224/269 (83%), Gaps = 8/269 (3%)
 Frame = -3

Query  1060  FVVRAVSDDEWGEEKKEPLSAAPAGVAVVEDE----PAALTETDVLKKQLVDSFYGTNRG  893
             F +RA++DDE G E++     A  GVAV E E    P+ + E   LK++L+D   GT+RG
Sbjct  85    FRLRAMADDEEGSEERGEEEEAARGVAVAEAEGKVEPSEVAE---LKRKLMDLLRGTDRG  141

Query  892   LSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLP-L  716
             L ASSETRAE+VELITQLEAKNPTPAPTEALTLLNGKW+LAYTSF  LFPLL  G LP L
Sbjct  142   LKASSETRAEIVELITQLEAKNPTPAPTEALTLLNGKWILAYTSFSQLFPLLGSGRLPEL  201

Query  715   VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  536
             V+VEEI QTIDSE+FTVQNSV F+GPLATTS++TNAKFEVRSPKRVQIKFEEGIIGTPQL
Sbjct  202   VKVEEISQTIDSENFTVQNSVQFAGPLATTSVTTNAKFEVRSPKRVQIKFEEGIIGTPQL  261

Query  535   TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  356
             TDSIV+PE VEFLGQ IDL+PFKG+ITS+QD ASSV ++IS QPPLK  + N+NA+SWLL
Sbjct  262   TDSIVVPEKVEFLGQNIDLSPFKGVITSVQDAASSVARTISGQPPLKIPINNNNAQSWLL  321

Query  355   TTYLDSELRISRGEAGSIFVLIKEDSPLL  269
             TTYLD ELRISRG+ GSIFVLIKE S LL
Sbjct  322   TTYLDEELRISRGDGGSIFVLIKEGSSLL  350



>gb|ABR17743.1| unknown [Picea sitchensis]
 gb|ADE77567.1| unknown [Picea sitchensis]
Length=331

 Score =   364 bits (934),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 197/334 (59%), Positives = 242/334 (72%), Gaps = 13/334 (4%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFAS-----KVAALRSFP---NRG  1082
             MA+ISSF+  H      +   +S + KP+   +++  FA+      V  L S P      
Sbjct  1     MAAISSFSAHHYANSPAVAQLTSGS-KPAASAISAVGFAASKPSNHVITLSSRPLSIFHA  59

Query  1081  LANPNRKFVVRAV-SDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYG  905
               +    F V A+ ++DEW   K    + +     VVE+EP+ + +   LK+ LVDSFYG
Sbjct  60    WGSRRTNFKVFAIDAEDEWSGGKNGEEAPSTVTATVVEEEPSEMKD---LKRALVDSFYG  116

Query  904   TNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGT  725
             T+RGL ASSETRAE+VELITQLEAKNPTPAPTEAL LLNGKW+L YTSF  LFPLL+ GT
Sbjct  117   TDRGLRASSETRAEIVELITQLEAKNPTPAPTEALNLLNGKWILVYTSFSELFPLLATGT  176

Query  724   LPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGT  545
             LPLV+V+EI Q  DS + TV+NSV F+GPLATTS STNA FEVRSPKRVQIKFEEG+I T
Sbjct  177   LPLVKVQEISQKFDSGTLTVENSVQFAGPLATTSFSTNASFEVRSPKRVQIKFEEGVIST  236

Query  544   PQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAES  365
             PQLTD+I +PE+VE LG+KIDL PFKGLI+S+Q+ ASSVVKSIS +PP+KF +    A+S
Sbjct  237   PQLTDAIEIPESVEVLGKKIDLAPFKGLISSVQNAASSVVKSISERPPIKFPIRTERAQS  296

Query  364   WLLTTYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             WLLTTYLD +LRISRG+  S+FVLIKE SPLL P
Sbjct  297   WLLTTYLDEDLRISRGDGSSVFVLIKEGSPLLPP  330



>gb|ABK26110.1| unknown [Picea sitchensis]
 gb|ABR17902.1| unknown [Picea sitchensis]
Length=331

 Score =   364 bits (934),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 197/334 (59%), Positives = 242/334 (72%), Gaps = 13/334 (4%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFAS-----KVAALRSFP---NRG  1082
             MA+ISSF+  H      +   +S + KP+   +++  FA+      V  L S P      
Sbjct  1     MAAISSFSAHHYANSPAVAQLTSGS-KPAASAISAVGFAASKPSNHVITLSSRPLSIFHA  59

Query  1081  LANPNRKFVVRAV-SDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYG  905
               +    F V A+ ++DEW   K    + +     VVE+EP+ + +   LK+ LVDSFYG
Sbjct  60    WGSRRTNFRVFAIDAEDEWSGGKNGEEAPSTVTATVVEEEPSEMKD---LKRALVDSFYG  116

Query  904   TNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGT  725
             T+RGL ASSETRAE+VELITQLEAKNPTPAPTEAL LLNGKW+L YTSF  LFPLL+ GT
Sbjct  117   TDRGLRASSETRAEIVELITQLEAKNPTPAPTEALNLLNGKWILVYTSFSELFPLLATGT  176

Query  724   LPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGT  545
             LPLV+V+EI Q  DS + TV+NSV F+GPLATTS STNA FEVRSPKRVQIKFEEG+I T
Sbjct  177   LPLVKVQEISQKFDSGTLTVENSVQFAGPLATTSFSTNASFEVRSPKRVQIKFEEGVIST  236

Query  544   PQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAES  365
             PQLTD+I +PE+VE LG+KIDL PFKGLI+S+Q+ ASSVVKSIS +PP+KF +    A+S
Sbjct  237   PQLTDAIEIPESVEVLGKKIDLAPFKGLISSVQNAASSVVKSISERPPIKFPIRTERAQS  296

Query  364   WLLTTYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             WLLTTYLD +LRISRG+  S+FVLIKE SPLL P
Sbjct  297   WLLTTYLDEDLRISRGDGSSVFVLIKEGSPLLPP  330



>ref|XP_009408003.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=305

 Score =   361 bits (927),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 186/265 (70%), Positives = 216/265 (82%), Gaps = 13/265 (5%)
 Frame = -3

Query  1060  FVVRA-VSDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSA  884
             F  RA V DDE GEE          GVAV +  P A++E   LKK+L+D  YGT+RGL A
Sbjct  52    FRTRAMVDDDELGEE---------GGVAVAQ--PPAVSEAGELKKKLIDLLYGTDRGLKA  100

Query  883   SSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLP-LVRV  707
             SSETRAE++E+ITQLEAKNPTPAPT+AL LLNGKW+LAYTSF GLFPLLS G LP LV+V
Sbjct  101   SSETRAEILEVITQLEAKNPTPAPTDALALLNGKWILAYTSFSGLFPLLSSGRLPELVKV  160

Query  706   EEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDS  527
             +EI QTIDSESFTVQNSV FSGPLATTS++TNAKFEVRSPKRVQIKFEEGIIGTPQLTD 
Sbjct  161   DEISQTIDSESFTVQNSVKFSGPLATTSVTTNAKFEVRSPKRVQIKFEEGIIGTPQLTDD  220

Query  526   IVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTY  347
             IV+P+ VEFLGQ IDL+PF G+I+S+Q+ A+SV ++IS QP LK  + N+N +SWLLTTY
Sbjct  221   IVIPDKVEFLGQNIDLSPFNGVISSIQNAAASVARTISGQPLLKIPINNTNVQSWLLTTY  280

Query  346   LDSELRISRGEAGSIFVLIKEDSPL  272
             LD ELRISRG+AGS+FVL KE   L
Sbjct  281   LDEELRISRGDAGSVFVLTKEGCSL  305



>ref|XP_003594155.1| Plastid-lipid-associated protein [Medicago truncatula]
 gb|ABD32657.1| PAP fibrillin [Medicago truncatula]
 gb|AES64406.1| plastid lipid-associated protein [Medicago truncatula]
Length=317

 Score =   360 bits (924),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 209/335 (62%), Positives = 245/335 (73%), Gaps = 32/335 (10%)
 Frame = -3

Query  1237  MASISSFTQF-HCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANP---  1070
             MAS+S+  Q  H   +    P +S    PS+ P   T+          F N+ +  P   
Sbjct  1     MASLSNLNQLLHTNTL----PVTSLNSTPSISPSTITV---------GFLNKHVRKPIVL  47

Query  1069  ----NRKFVVRAVS-DDEWGEEKKEPLSAAPAGVAVVE---DEPAALTETDVLKKQLVDS  914
                  R   V+A   DDEWG E         AGVAV E    E  +  ET+ LKK LV S
Sbjct  48    ADGLRRVVYVQANRIDDEWGPEPS-------AGVAVAEVQATEKVSDGETEKLKKALVGS  100

Query  913   FYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLS  734
             FYGT+RGL A+SETRAE+VELITQLEAKNPTPA T+AL+LLNGKW+LAYTSF GLFPLLS
Sbjct  101   FYGTDRGLKATSETRAEIVELITQLEAKNPTPASTDALSLLNGKWILAYTSFAGLFPLLS  160

Query  733   RGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI  554
              G LPL+ VEEI QTIDSES TVQNSV+F+GPL TTSISTNAKFEVRSP R+QIKFEEG+
Sbjct  161   SGLLPLLTVEEISQTIDSESLTVQNSVLFAGPLTTTSISTNAKFEVRSPNRLQIKFEEGV  220

Query  553   IGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSN  374
             IGTPQLTDS+ +PENVE LGQKIDL+PFKG+ TS+Q+TASSVV++IS+QPPLK  ++N N
Sbjct  221   IGTPQLTDSLEIPENVEVLGQKIDLSPFKGIFTSVQNTASSVVQTISNQPPLKIPISNDN  280

Query  373   AESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
             A+SWLLTTYLD ELRISRG+ GS+FVLIKE S LL
Sbjct  281   AQSWLLTTYLDEELRISRGDGGSVFVLIKEGSSLL  315



>ref|XP_010538742.1| PREDICTED: plastid lipid-associated protein 2, chloroplastic 
[Tarenaya hassleriana]
Length=323

 Score =   358 bits (920),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 199/336 (59%), Positives = 237/336 (71%), Gaps = 26/336 (8%)
 Frame = -3

Query  1237  MASISSFTQFHCK-PVGMICPRSSSTPKPSVFPVNS-----TIFASKVAALRSFPNRGLA  1076
             MAS+S F +F CK      C   S      + P++S     T FA  ++  R        
Sbjct  1     MASVSLFNKFPCKTQTPTSCNTKSQLKHAILVPMSSINRRPTGFAGGISVSRPV------  54

Query  1075  NPNRKFVVRAVS-----DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSF  911
                  F VRA       DDE  EE      A  A    VE     + E + LK+ LVDS 
Sbjct  55    -----FRVRASEVKDERDDEPAEEGSSVSVAESAAAKTVE----VVDEIEQLKRALVDSL  105

Query  910   YGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSR  731
              GT+RGLSASS+ RAE+ +LITQLEAKNPTPAPT+AL LLNGKW+LAYTSF  LFPLLSR
Sbjct  106   NGTDRGLSASSDKRAEIGDLITQLEAKNPTPAPTDALFLLNGKWILAYTSFSALFPLLSR  165

Query  730   GTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGII  551
             G +P+V+++EI Q IDS++FTVQNS+ F+ PLAT SISTN+KFEVRSP+RVQIKFEEGII
Sbjct  166   GYVPVVKLDEISQMIDSDNFTVQNSIRFASPLATASISTNSKFEVRSPRRVQIKFEEGII  225

Query  550   GTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNA  371
             GTPQLTDSI +PE V+ LGQKI+LTP KGL+TSLQ TASS+ K+ISSQPPLKFSL  SNA
Sbjct  226   GTPQLTDSIQIPEEVKVLGQKINLTPIKGLLTSLQGTASSMAKTISSQPPLKFSLPGSNA  285

Query  370   ESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             +SWLLTTYLD +LRISRG+ GS+FVL KE + LLKP
Sbjct  286   QSWLLTTYLDKDLRISRGDGGSVFVLFKEGNSLLKP  321



>emb|CDX90850.1| BnaA03g25300D [Brassica napus]
Length=316

 Score =   357 bits (916),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 198/323 (61%), Positives = 235/323 (73%), Gaps = 18/323 (6%)
 Frame = -3

Query  1219  FTQFHCK-PVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKFVVRAV  1043
             F+QF CK P+      S  +  P + P+N               +R LA     F VRA 
Sbjct  8     FSQFTCKTPITSSSTSSFQSKSPILLPINPI-------------SRRLAVHRHDFKVRAS  54

Query  1042  S-DDEWGEEKKEPLSAAPAGVA--VVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSET  872
               +DEWG + K       + VA  V E+   +  ET+ LK+ L  S YGT+RGLSASSET
Sbjct  55    DVNDEWGPDSKG-RGGLNSSVAEKVAEEAIESAEETERLKRVLAGSLYGTDRGLSASSET  113

Query  871   RAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQ  692
             RAE+ ELITQLE+KNP PAP EAL LLNGKW+L YTSF+GLFPLLSR   PLV+V+EI Q
Sbjct  114   RAEISELITQLESKNPNPAPNEALFLLNGKWILVYTSFVGLFPLLSRRISPLVKVDEISQ  173

Query  691   TIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPE  512
             TIDS+SFTV NSV F+GPLATTS+STNAKFEVRSPKRVQ+KFE+G+IGTPQLTDSI +PE
Sbjct  174   TIDSDSFTVHNSVRFAGPLATTSLSTNAKFEVRSPKRVQVKFEQGVIGTPQLTDSIEIPE  233

Query  511   NVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSEL  332
              VE LGQKIDL P +GL+TS+QDTASSV ++ISSQPPLKFSL    A+SWLLTTYLD +L
Sbjct  234   FVEVLGQKIDLNPIRGLLTSVQDTASSVARTISSQPPLKFSLPGEIAQSWLLTTYLDKDL  293

Query  331   RISRGEAGSIFVLIKEDSPLLKP  263
             RISRG+ GS+FVLI+E S LL P
Sbjct  294   RISRGDGGSVFVLIREGSSLLNP  316



>gb|EPS66635.1| hypothetical protein M569_08140, partial [Genlisea aurea]
Length=228

 Score =   352 bits (902),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 172/226 (76%), Positives = 205/226 (91%), Gaps = 2/226 (1%)
 Frame = -3

Query  955  LTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWV  776
            ++E D LKKQL+DSFYGTNRGLSASSETRAE+VELI+Q+EAKNPTPAPT+AL LLNGKW+
Sbjct  2    VSEIDALKKQLLDSFYGTNRGLSASSETRAEIVELISQIEAKNPTPAPTDALPLLNGKWI  61

Query  775  LAYTSFIGLFPLLSRG-TLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFE  599
            LAYT+F GLFPLLSR  +LPL ++EEI QT+DSE FTVQNS +FSGPLATTSISTN+ FE
Sbjct  62   LAYTTFSGLFPLLSRAASLPLAKLEEISQTVDSEKFTVQNSFLFSGPLATTSISTNSTFE  121

Query  598  VRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKS  419
            +RSPKRVQIKF  G+IGTPQ++DSI +PE+V+ LGQKIDLTPFKGL++S+QDTAS+V K+
Sbjct  122  IRSPKRVQIKFVGGVIGTPQVSDSIEIPESVDILGQKIDLTPFKGLLSSVQDTASTVAKT  181

Query  418  ISSQPPLKFSL-ANSNAESWLLTTYLDSELRISRGEAGSIFVLIKE  284
            ISSQPPL+FS+  NS  ESW+LTTYLD++LRISRG+ GSIFVLIKE
Sbjct  182  ISSQPPLEFSVPDNSYTESWILTTYLDNDLRISRGDGGSIFVLIKE  227



>ref|XP_009134286.1| PREDICTED: plastid lipid-associated protein 1, chloroplastic 
[Brassica rapa]
 sp|Q94FZ9.1|PAP1_BRACM RecName: Full=Plastid lipid-associated protein 1, chloroplastic; 
Flags: Precursor [Brassica rapa]
 gb|AAK57564.1| plastid-lipid associated protein PAP1 [Brassica rapa subsp. oleifera]
Length=327

 Score =   355 bits (911),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 199/333 (60%), Positives = 236/333 (71%), Gaps = 27/333 (8%)
 Frame = -3

Query  1219  FTQFHCK-PVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKFVVRAV  1043
             F+QF CK P+      S  +  P + P+N               NR +A     F VRA 
Sbjct  8     FSQFTCKTPITSSSTSSFQSKSPILLPINPI-------------NRRIAVHRHDFKVRAS  54

Query  1042  S-DDEWGEEKKE----------PLSAAPAGVA--VVEDEPAALTETDVLKKQLVDSFYGT  902
               +DEWG + K           P     + VA  V E+   +  ET+ LK+ L  S YGT
Sbjct  55    DVNDEWGPDSKGRGGDVDDEWGPEIGLNSSVAEKVAEEAIESAEETERLKRVLAGSLYGT  114

Query  901   NRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTL  722
             +RGLSASSETRAE+ ELITQLE+KNP PAP EAL LLNGKW+L YTSF+GLFPLLSR   
Sbjct  115   DRGLSASSETRAEISELITQLESKNPNPAPNEALFLLNGKWILVYTSFVGLFPLLSRRIS  174

Query  721   PLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTP  542
             PLV+V+EI QTIDS+SFTV NSV F+ PLATTS+STNAKFEVRSPKRVQ+KFE+G+IGTP
Sbjct  175   PLVKVDEISQTIDSDSFTVHNSVRFASPLATTSLSTNAKFEVRSPKRVQVKFEQGVIGTP  234

Query  541   QLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESW  362
             QLTDSI +PE VE LGQKIDL P KGL+TS+QDTASSV ++ISSQPPLKFSL   +A+SW
Sbjct  235   QLTDSIEIPEFVEVLGQKIDLNPIKGLLTSVQDTASSVARTISSQPPLKFSLPGDSAQSW  294

Query  361   LLTTYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             LLTTYLD +LRISRG+ GS+FVLI+E S LL P
Sbjct  295   LLTTYLDKDLRISRGDGGSVFVLIREGSSLLNP  327



>gb|AAD03693.1| fibrillin [Brassica napus]
Length=237

 Score =   351 bits (901),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 198/229 (86%), Gaps = 0/229 (0%)
 Frame = -3

Query  949  ETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLA  770
            ET+ LK+ L  S YGT+RGLSASSETRAE+ ELITQLE+KNP PAP EAL LLNGKW+L 
Sbjct  9    ETERLKRVLAGSLYGTDRGLSASSETRAEISELITQLESKNPNPAPNEALFLLNGKWILV  68

Query  769  YTSFIGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRS  590
            YTSF+GLFPLLSR   PLV+V+EI QTIDS+SFTV NSV F+GPLATTS+STNAKFEVRS
Sbjct  69   YTSFVGLFPLLSRRISPLVKVDEISQTIDSDSFTVHNSVRFAGPLATTSLSTNAKFEVRS  128

Query  589  PKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISS  410
            PKRVQ+KFE+G+IGTPQLTDSI +PE VE LGQKIDL P KGL+TS+QDTASSV ++ISS
Sbjct  129  PKRVQVKFEQGVIGTPQLTDSIEIPEFVEVLGQKIDLNPIKGLLTSVQDTASSVARTISS  188

Query  409  QPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
            QPPLKFSL    A+SWLLTTYLD +LRISRG+ GS+FVLI+E S LL P
Sbjct  189  QPPLKFSLPGEIAQSWLLTTYLDKDLRISRGDGGSVFVLIREGSSLLNP  237



>emb|CDY21291.1| BnaC03g29750D [Brassica napus]
Length=316

 Score =   354 bits (908),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 196/323 (61%), Positives = 238/323 (74%), Gaps = 18/323 (6%)
 Frame = -3

Query  1219  FTQFHCKPVGMICPRSSSTPK-PSVFPVNSTIFASKVAALRSFPNRGLANPNRKFVVRAV  1043
             F+QF CK +      S+   K P + P+N               NR +A     F +RA 
Sbjct  8     FSQFTCKTLVTSSTTSTFQSKSPILLPINPI-------------NRRIAVHRHDFKIRAS  54

Query  1042  S-DDEWGEEK--KEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSET  872
               +DEWG +   +  L+++ A   V E+   +  ET+ LK+ L  S YGT+RGLSASSET
Sbjct  55    DVNDEWGPDSMGRGRLNSSVAE-KVAEEAIESAEETERLKRVLAGSLYGTDRGLSASSET  113

Query  871   RAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQ  692
             RAE+ ELITQLE+KNP PAP EAL LLNGKW+L YTSF+GLFPLLSR   PLV+V+EI Q
Sbjct  114   RAEISELITQLESKNPNPAPNEALFLLNGKWILVYTSFVGLFPLLSRRISPLVKVDEISQ  173

Query  691   TIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPE  512
             TIDS+SFTV NSV F+GPLATTS+STNAKFEVRSPKRVQ+KFE+G+IGTPQLTDSI +PE
Sbjct  174   TIDSDSFTVHNSVRFAGPLATTSLSTNAKFEVRSPKRVQVKFEQGVIGTPQLTDSIEIPE  233

Query  511   NVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSEL  332
              VE LGQKIDL P +GL+TS+QDTASSV ++ISSQPPLKFSL   +A+SWLLTTYLD +L
Sbjct  234   FVEVLGQKIDLNPIRGLLTSVQDTASSVARTISSQPPLKFSLPGDSAQSWLLTTYLDKDL  293

Query  331   RISRGEAGSIFVLIKEDSPLLKP  263
             RISRG+ GS+FVLI+E S LL P
Sbjct  294   RISRGDGGSVFVLIREGSSLLNP  316



>ref|XP_008803509.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic 
[Phoenix dactylifera]
Length=256

 Score =   351 bits (901),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 177/240 (74%), Positives = 203/240 (85%), Gaps = 5/240 (2%)
 Frame = -3

Query  985  VAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTE  806
            VAV E+     +E   LK++L+D   GT+RGL ASSETRAE+VELITQLEAKNPTPAPTE
Sbjct  20   VAVAEEGKVEPSEVGELKRKLMDLLRGTDRGLEASSETRAEIVELITQLEAKNPTPAPTE  79

Query  805  ALTLLNGKWVLAYTSFIGLFPLLSRGTLP-LVRVEEICQTIDSESFTVQNSVVFSGPLAT  629
            ALTLLNGKW+L YTSF  LFPLL  G LP LV+VEEI QTIDSE+FTVQNSV F+GPLAT
Sbjct  80   ALTLLNGKWILTYTSFSQLFPLLGSGRLPELVKVEEISQTIDSENFTVQNSVQFAGPLAT  139

Query  628  TSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSL  449
            T    NAKFEVRSPKRVQIKFEEGIIGTPQLTDSIV+P+ VEFLGQ IDL+PFKG+ITS+
Sbjct  140  T----NAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVIPKKVEFLGQNIDLSPFKGVITSV  195

Query  448  QDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
            QD ASSV ++IS QPPLK  + N+NA+SWLLTTYLD ELR+SRG+ GS++VL+KE SPLL
Sbjct  196  QDAASSVARTISGQPPLKIPINNNNAQSWLLTTYLDEELRVSRGDGGSVYVLVKEGSPLL  255



>gb|AAK57561.1| plastid-lipid associated protein PAP1 [Brassica rapa subsp. oleifera]
Length=327

 Score =   353 bits (906),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 198/333 (59%), Positives = 235/333 (71%), Gaps = 27/333 (8%)
 Frame = -3

Query  1219  FTQFHCK-PVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKFVVRAV  1043
             F+QF CK P+      S  +  P + P+N               NR +A     F VRA 
Sbjct  8     FSQFTCKTPITSSSTSSFQSKSPILLPINPI-------------NRRIAVHRHDFKVRAS  54

Query  1042  S-DDEWGEEKKE----------PLSAAPAGVA--VVEDEPAALTETDVLKKQLVDSFYGT  902
               +DEWG + K           P     + VA  V E+   +  ET+ LK+ L  S YGT
Sbjct  55    DVNDEWGPDSKGRGGDVDDEWGPEIGLNSSVAEKVAEEAIESAEETERLKRVLAGSLYGT  114

Query  901   NRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTL  722
             +RGLSASSETRAE+ ELITQLE+KNP PAP EAL LLNGKW+L YTSF+GLFPLLSR   
Sbjct  115   DRGLSASSETRAEISELITQLESKNPNPAPNEALFLLNGKWILVYTSFVGLFPLLSRRIS  174

Query  721   PLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTP  542
             PLV+V+EI QTIDS+SFTV NSV F+ PLATTS+STNAKFEVRSPKRVQ+KFE+G+IGTP
Sbjct  175   PLVKVDEISQTIDSDSFTVHNSVRFASPLATTSLSTNAKFEVRSPKRVQVKFEQGVIGTP  234

Query  541   QLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESW  362
             QLTDSI +PE VE  GQKIDL P KGL+TS+QDTASSV ++ISSQPPLKFSL   +A+SW
Sbjct  235   QLTDSIEIPEFVEVFGQKIDLNPIKGLLTSVQDTASSVARTISSQPPLKFSLPGDSAQSW  294

Query  361   LLTTYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
             LLTTYLD +LRISRG+ GS+FVLI+E S LL P
Sbjct  295   LLTTYLDKDLRISRGDGGSVFVLIREGSSLLNP  327



>gb|KHG06297.1| Plastid-lipid-associated, chloroplastic [Gossypium arboreum]
Length=336

 Score =   352 bits (902),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 202/333 (61%), Positives = 237/333 (71%), Gaps = 11/333 (3%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MA+I     F  K          ST KPS+  +NS       +++  F  R        F
Sbjct  1     MATIFQLNNFPYKTFLTTPKHIQSTSKPSILLLNSIKRTQNSSSVSHFLTRKSIRSRPGF  60

Query  1057  VVRAVSDDEWGEEKKEPLSAAPAGVAVVEDEPAALTET----------DVLKKQLVDSFY  908
              V A  DDE   +K+E +   P   +       A  E           + LKK LVDSFY
Sbjct  61    QVFAADDDEGSPDKEEEVMEEPETESGGVVVAEAEAEEEKPKEEVGEIESLKKALVDSFY  120

Query  907   GTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRG  728
             GT+RG  ASSETRAE+VELIT LEAKNPTPAPT++L LLNGKW+LAYTSF GLFPLLSRG
Sbjct  121   GTDRGWKASSETRAEIVELITLLEAKNPTPAPTDSLPLLNGKWILAYTSFTGLFPLLSRG  180

Query  727   TLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIG  548
              L LV+VEEI QTID+E+ TVQNSV FSGPLA++SIS +AKFEVRSP+RVQIKF+EGIIG
Sbjct  181   QLRLVKVEEISQTIDAENLTVQNSVQFSGPLASSSISASAKFEVRSPRRVQIKFQEGIIG  240

Query  547   TPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAE  368
             TPQLTDSIVLPENVEF+GQKIDL P K L+ S+QDTAS+V K+ISS+PPLKFSL+NSN+E
Sbjct  241   TPQLTDSIVLPENVEFMGQKIDLAPIKSLLNSVQDTASTVAKTISSRPPLKFSLSNSNSE  300

Query  367   SWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
             SWLLTTYLD +LRISR + GS+FVLIKE S LL
Sbjct  301   SWLLTTYLDEDLRISR-DGGSVFVLIKEGSSLL  332



>ref|XP_004956481.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic-like 
[Setaria italica]
Length=318

 Score =   350 bits (899),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 180/260 (69%), Positives = 205/260 (79%), Gaps = 3/260 (1%)
 Frame = -3

Query  1042  SDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAE  863
             S+DEWG E +    +A  G AV E      +E   LK QL ++ YGT RGL ASSETRAE
Sbjct  61    SEDEWGPEPEG--GSAVTGTAVAEASDPEASEVAELKAQLKEALYGTERGLRASSETRAE  118

Query  862   VVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLP-LVRVEEICQTI  686
             VVELITQLEA+NPTPAPTEALTLLNGKW+LAYTSF  LFPLL  G LP LV+VEEI QTI
Sbjct  119   VVELITQLEARNPTPAPTEALTLLNGKWILAYTSFSQLFPLLGSGRLPELVKVEEISQTI  178

Query  685   DSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENV  506
             DSE+FTVQN + FSGPLATTS+STNAKFE+RSPKRVQIKF+EG+IGTPQLTDSIVLPE  
Sbjct  179   DSETFTVQNCIKFSGPLATTSVSTNAKFEIRSPKRVQIKFDEGVIGTPQLTDSIVLPEKF  238

Query  505   EFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRI  326
             E  GQ IDL+P KG+ +S+++ ASSV  +IS QPPLK  +  +NAESWLLTTYLD ELRI
Sbjct  239   ELFGQNIDLSPLKGIFSSIENAASSVANTISGQPPLKIPIRTNNAESWLLTTYLDEELRI  298

Query  325   SRGEAGSIFVLIKEDSPLLK  266
             SRG+  SIFVL KE S LL 
Sbjct  299   SRGDGSSIFVLFKEGSSLLN  318



>ref|XP_003575588.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic 
[Brachypodium distachyon]
Length=324

 Score =   350 bits (899),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 179/258 (69%), Positives = 205/258 (79%), Gaps = 4/258 (2%)
 Frame = -3

Query  1039  DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEV  860
             DDEWG E  E  S+A    AV ED P A +E   LK++L  + YGT RGL ASSETRAEV
Sbjct  69    DDEWGNEPGERGSSA---AAVAEDAPPAASELAALKEKLRAALYGTERGLRASSETRAEV  125

Query  859   VELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLP-LVRVEEICQTID  683
             VE+++QLEA+NPTPAPTEAL LLNGKW+LAYTSF  LFPLL  G LP LV V+EI QTID
Sbjct  126   VEILSQLEARNPTPAPTEALPLLNGKWILAYTSFSQLFPLLGSGRLPALVTVDEISQTID  185

Query  682   SESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVE  503
             SE+FTVQN + FSGPLATTS+STNA+FE+RSPKRVQIKF+EGIIGTPQLTDSIVLPE  E
Sbjct  186   SENFTVQNCIKFSGPLATTSVSTNARFEIRSPKRVQIKFDEGIIGTPQLTDSIVLPEKFE  245

Query  502   FLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRIS  323
             F GQ IDL+P  G+ TS+++ ASSV K+IS QPPLK  + + NA SWLLTTYLD ELRIS
Sbjct  246   FFGQNIDLSPLSGIFTSIENAASSVAKTISGQPPLKVPIRSDNARSWLLTTYLDDELRIS  305

Query  322   RGEAGSIFVLIKEDSPLL  269
             RG+  SIFVL KE S LL
Sbjct  306   RGDGSSIFVLFKEGSGLL  323



>ref|XP_002983947.1| hypothetical protein SELMODRAFT_156313 [Selaginella moellendorffii]
 gb|EFJ14959.1| hypothetical protein SELMODRAFT_156313 [Selaginella moellendorffii]
Length=326

 Score =   350 bits (897),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 191/327 (58%), Positives = 229/327 (70%), Gaps = 9/327 (3%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MA+ISS   F    V   CP  S     + F  +     S   A R      L   +R  
Sbjct  1     MAAISS-EAFPRLGVANACPSPSRERASAHFLHSGPSIRSIATATR----LSLGARHRLQ  55

Query  1057  VVRAVSDDEWGE---EKKEPLSAAPAGVA-VVEDEPAALTETDVLKKQLVDSFYGTNRGL  890
              + +  +DEWGE   EKK   S A  GV   V DE     +T+ LKK L+DS YGT RGL
Sbjct  56    ALASDGNDEWGEGAAEKKGAASKAGNGVGTAVADEKEKDGDTEGLKKALLDSLYGTERGL  115

Query  889   SASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVR  710
              ASSETRAEV ELITQLEAKNPTPAPTEAL +LNGKW+LAYTSF  LFPLL+ GTLPLV+
Sbjct  116   KASSETRAEVNELITQLEAKNPTPAPTEALAVLNGKWILAYTSFSELFPLLAAGTLPLVK  175

Query  709   VEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTD  530
             V EI QT+DS + TVQNSV F GPLATTS S +A FEVRSPKRVQIKFEEG+IGTPQLTD
Sbjct  176   VGEISQTVDSNALTVQNSVSFVGPLATTSFSASASFEVRSPKRVQIKFEEGVIGTPQLTD  235

Query  529   SIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTT  350
             S+ LP+ V+F+G+KIDLTP +  +  LQD A+SV +++S QPPLKFS+  + A+SWLLTT
Sbjct  236   SVELPDTVDFMGRKIDLTPAQNALRPLQDAANSVARTLSGQPPLKFSIPGNKAQSWLLTT  295

Query  349   YLDSELRISRGEAGSIFVLIKEDSPLL  269
             YLD +LRISRG+ G +F+L+KE SPL+
Sbjct  296   YLDEDLRISRGDGGGVFLLVKEGSPLI  322



>sp|Q6K439.1|PAP2_ORYSJ RecName: Full=Probable plastid-lipid-associated protein 2, chloroplastic; 
AltName: Full=Fibrillin-like protein 2; Flags: 
Precursor [Oryza sativa Japonica Group]
 dbj|BAD22310.1| putative chloroplast drought-induced stress protein, 34 kD [Oryza 
sativa Japonica Group]
 dbj|BAG94105.1| unnamed protein product [Oryza sativa Japonica Group]
Length=319

 Score =   349 bits (895),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 184/270 (68%), Positives = 210/270 (78%), Gaps = 4/270 (1%)
 Frame = -3

Query  1066  RKFVVRAVS---DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNR  896
             R+   RAV+   +DEWG+E       A A VA    +    +E   LK +L ++ YGT R
Sbjct  49    RRLTARAVAGDAEDEWGKEPAADQGGAAAAVAEAPADVPVTSEVAELKAKLKEALYGTER  108

Query  895   GLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLP-  719
             GL ASSETRAEVVELITQLEA+NPTPAPTEALTLLNGKW+LAYTSF  LFPLL  G+LP 
Sbjct  109   GLRASSETRAEVVELITQLEARNPTPAPTEALTLLNGKWILAYTSFSQLFPLLGSGSLPQ  168

Query  718   LVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  539
             LV+VEEI QTIDSE+FTVQN + FSGPLATTS+STNAKFEVRSPKRVQIKF+EGIIGTPQ
Sbjct  169   LVKVEEISQTIDSENFTVQNCIKFSGPLATTSVSTNAKFEVRSPKRVQIKFDEGIIGTPQ  228

Query  538   LTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWL  359
             LTDSIVLPE  E  GQ IDLTP KG+ +S+++ ASSV ++IS QPPLK  +   NAESWL
Sbjct  229   LTDSIVLPEKFELFGQNIDLTPLKGIFSSIENAASSVARTISGQPPLKIPIRTDNAESWL  288

Query  358   LTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
             LTTYLD ELRISRG+  SIFVL KE S LL
Sbjct  289   LTTYLDDELRISRGDGSSIFVLFKEGSTLL  318



>gb|EEC84129.1| hypothetical protein OsI_30469 [Oryza sativa Indica Group]
Length=319

 Score =   348 bits (894),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 184/270 (68%), Positives = 210/270 (78%), Gaps = 4/270 (1%)
 Frame = -3

Query  1066  RKFVVRAVS---DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNR  896
             R+   RAV+   +DEWG+E       A A VA    +    +E   LK +L ++ YGT R
Sbjct  49    RRLTARAVAGDAEDEWGKEPAADQGGAAAAVAEAPADVPVTSEVAELKAKLKEALYGTER  108

Query  895   GLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLP-  719
             GL ASSETRAEVVELITQLEA+NPTPAPTEALTLLNGKW+LAYTSF  LFPLL  G+LP 
Sbjct  109   GLRASSETRAEVVELITQLEARNPTPAPTEALTLLNGKWILAYTSFSQLFPLLGSGSLPQ  168

Query  718   LVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  539
             LV+VEEI QTIDSE+FTVQN + FSGPLATTS+STNAKFEVRSPKRVQIKF+EGIIGTPQ
Sbjct  169   LVKVEEISQTIDSENFTVQNCIKFSGPLATTSVSTNAKFEVRSPKRVQIKFDEGIIGTPQ  228

Query  538   LTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWL  359
             LTDSIVLPE  E  GQ IDLTP KG+ +S+++ ASSV ++IS QPPLK  +   NAESWL
Sbjct  229   LTDSIVLPEKFELFGQNIDLTPLKGIFSSIENAASSVARTISGQPPLKIPIRTDNAESWL  288

Query  358   LTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
             LTTYLD ELRISRG+  SIFVL KE S LL
Sbjct  289   LTTYLDDELRISRGDGSSIFVLFKEGSTLL  318



>dbj|BAJ98727.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87659.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88297.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97495.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=313

 Score =   347 bits (891),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 194/310 (63%), Positives = 223/310 (72%), Gaps = 18/310 (6%)
 Frame = -3

Query  1174  SSSTPKPSVFPVNSTIFASKVA-ALRSFPNRGLANPNRKFVVRAV---SDDEWGEEKKEP  1007
             S S P P V P  S+     ++ A R FP+  L    R    RAV   +DDEWG+E  E 
Sbjct  11    SLSVPSPQVPPGASSARGRLLSPAARRFPS--LRAARRVVTARAVPVDADDEWGKEPAE-  67

Query  1006  LSAAPAGVAVVEDEPAALTETD----VLKKQLVDSFYGTNRGLSASSETRAEVVELITQL  839
                   G AV E  P+   ET      LK++L  + YGT RGL ASSETRAEVVELITQL
Sbjct  68    -----GGTAVAE-APSEAAETAGELAALKQKLKAALYGTERGLRASSETRAEVVELITQL  121

Query  838   EAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTL-PLVRVEEICQTIDSESFTVQ  662
             EA+NPTPAPTEALTLLNGKW+LAYTSF  LFPLL  G L  LV+V+EI QTIDSE+F VQ
Sbjct  122   EARNPTPAPTEALTLLNGKWILAYTSFSQLFPLLGSGRLQALVKVDEISQTIDSENFAVQ  181

Query  661   NSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKID  482
             N + FSGPLA+TS+STNAKFE+RSPKRVQIKFEEGIIGTPQLTDSIVLPE  EF GQ ID
Sbjct  182   NCIKFSGPLASTSVSTNAKFEIRSPKRVQIKFEEGIIGTPQLTDSIVLPEKFEFFGQNID  241

Query  481   LTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSI  302
             L+P  G+ TS+++ ASSV K+IS QPPLK    + +A SWLLTTYLD+ELRISRG+  SI
Sbjct  242   LSPLSGIFTSIENAASSVAKTISGQPPLKIPFRSESAGSWLLTTYLDAELRISRGDGSSI  301

Query  301   FVLIKEDSPL  272
             FVL KE S L
Sbjct  302   FVLFKEGSSL  311



>gb|EEE69226.1| hypothetical protein OsJ_28458 [Oryza sativa Japonica Group]
Length=319

 Score =   347 bits (890),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 187/282 (66%), Positives = 213/282 (76%), Gaps = 6/282 (2%)
 Frame = -3

Query  1102  RSFPNRGLANPNRKFVVRAVS---DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLK  932
             R  P RG  +       RAV+   +DEWG+E       A A VA    +    +E   LK
Sbjct  39    RGSPTRGPRHGG--LTARAVAGDAEDEWGKEPAADQGGAAAAVAEAPADVPVTSEVAELK  96

Query  931   KQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIG  752
              +L ++ YGT RGL ASSETRAEVVELITQLEA+NPTPAPTEALTLLNGKW+LAYTSF  
Sbjct  97    AKLKEALYGTERGLRASSETRAEVVELITQLEARNPTPAPTEALTLLNGKWILAYTSFSQ  156

Query  751   LFPLLSRGTLP-LVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQ  575
             LFPLL  G+LP LV+VEEI QTIDSE+FTVQN + FSGPLATTS+STNAKFEVRSPKRVQ
Sbjct  157   LFPLLGSGSLPQLVKVEEISQTIDSENFTVQNCIKFSGPLATTSVSTNAKFEVRSPKRVQ  216

Query  574   IKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLK  395
             IKF+EGIIGTPQLTDSIVLPE  E  GQ IDLTP KG+ +S+++ ASSV ++IS QPPLK
Sbjct  217   IKFDEGIIGTPQLTDSIVLPEKFELFGQNIDLTPLKGIFSSIENAASSVARTISGQPPLK  276

Query  394   FSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
               +   NAESWLLTTYLD ELRISRG+  SIFVL KE S LL
Sbjct  277   IPIRTDNAESWLLTTYLDDELRISRGDGSSIFVLFKEGSTLL  318



>ref|XP_002960725.1| hypothetical protein SELMODRAFT_163532 [Selaginella moellendorffii]
 gb|EFJ38264.1| hypothetical protein SELMODRAFT_163532 [Selaginella moellendorffii]
Length=324

 Score =   347 bits (889),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 189/326 (58%), Positives = 228/326 (70%), Gaps = 9/326 (3%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MA+ISS   F    V   CP  S     + F  +     S   A R      L   +R  
Sbjct  1     MAAISS-EAFPRLGVANACPSPSRERASAHFLHSGPSIRSIATATR----LSLGARHRLQ  55

Query  1057  VVRAVSDDEWGE---EKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLS  887
              + +  +DEWGE   EKK   +    G AV  DE     +T+ LKK L+DS YGT RGL 
Sbjct  56    ALASDGNDEWGEGAAEKKASKAGNGVGTAV-SDEKEKDGDTEGLKKALLDSLYGTERGLK  114

Query  886   ASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRV  707
             ASSETRAEV ELITQLEAKNPTPAPTEAL +LNGKW+LAYTSF  LFPLL+ GTLPLV+V
Sbjct  115   ASSETRAEVNELITQLEAKNPTPAPTEALAVLNGKWILAYTSFSELFPLLAAGTLPLVKV  174

Query  706   EEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDS  527
              EI QT+DS + TVQNSV F GPLATTS S +A FEVRSPKRVQIKFEEG+IGTPQLTDS
Sbjct  175   GEISQTVDSNALTVQNSVSFVGPLATTSFSASASFEVRSPKRVQIKFEEGVIGTPQLTDS  234

Query  526   IVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTY  347
             + LP+ V+F+G+KIDLTP +  +  LQD A+SV +++S QPPLKFS+  + A+SWLLTTY
Sbjct  235   VELPDTVDFMGRKIDLTPAQDALRPLQDAANSVARTLSGQPPLKFSIPGNKAQSWLLTTY  294

Query  346   LDSELRISRGEAGSIFVLIKEDSPLL  269
             LD +LRISRG+ G +F+L+KE SPL+
Sbjct  295   LDEDLRISRGDGGGVFLLVKEGSPLI  320



>ref|XP_006661039.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic-like, 
partial [Oryza brachyantha]
Length=239

 Score =   343 bits (879),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 176/239 (74%), Positives = 196/239 (82%), Gaps = 2/239 (1%)
 Frame = -3

Query  982  AVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEA  803
            AV E  P A  E   LK +L D+ YGT RGL ASSETRAEVVELITQLEA+NPTPAPTEA
Sbjct  1    AVAEAPPVA-GEVAELKAKLKDALYGTERGLRASSETRAEVVELITQLEARNPTPAPTEA  59

Query  802  LTLLNGKWVLAYTSFIGLFPLLSRGTLP-LVRVEEICQTIDSESFTVQNSVVFSGPLATT  626
            LTLLNGKW+LAYTSF  LFPLL   +LP LV+VEEI QTIDSE+FTVQN + FSGPLATT
Sbjct  60   LTLLNGKWILAYTSFSQLFPLLGAASLPQLVKVEEISQTIDSENFTVQNCIKFSGPLATT  119

Query  625  SISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQ  446
            S+STNAKFEVRSPKRVQIKF+EGIIGTPQLTDSIVLPE  EF GQ IDLTP KG+ +S++
Sbjct  120  SVSTNAKFEVRSPKRVQIKFDEGIIGTPQLTDSIVLPEKFEFFGQNIDLTPLKGIFSSIE  179

Query  445  DTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
            + ASSV ++IS QPPLK  +   NAE+WLLTTYLD ELRISRG+  SIFVL KE S LL
Sbjct  180  NAASSVARTISGQPPLKIPIRTDNAEAWLLTTYLDDELRISRGDGSSIFVLFKEGSTLL  238



>ref|XP_002447942.1| hypothetical protein SORBIDRAFT_06g018550 [Sorghum bicolor]
 gb|EES12270.1| hypothetical protein SORBIDRAFT_06g018550 [Sorghum bicolor]
Length=330

 Score =   346 bits (887),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 179/261 (69%), Positives = 205/261 (79%), Gaps = 5/261 (2%)
 Frame = -3

Query  1039  DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDV--LKKQLVDSFYGTNRGLSASSETRA  866
             DDEWG E +    +A  G   V + P A    +V  LK QL D+ YGT RGL ASSE+RA
Sbjct  72    DDEWGPEPEG--GSAVTGATAVAEAPEAPEAREVAELKAQLKDALYGTERGLRASSESRA  129

Query  865   EVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLP-LVRVEEICQT  689
             +V+ELITQLE +NPTPAPTEALTLLNGKW+LAYTSF  LFPLL  G LP LV+VEEI QT
Sbjct  130   KVLELITQLETRNPTPAPTEALTLLNGKWILAYTSFSQLFPLLGFGNLPELVKVEEISQT  189

Query  688   IDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPEN  509
             IDSE+FTVQN + FSGPLATTS++TNAKFE+RSPKRVQIKFEEGI+GTPQLTDSIVLPE 
Sbjct  190   IDSENFTVQNCIKFSGPLATTSVATNAKFEIRSPKRVQIKFEEGIVGTPQLTDSIVLPEK  249

Query  508   VEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELR  329
              E  GQ IDL+P KG+ TS+++ ASSV K+IS QPPLK  +  +NAESWLLTTYLD ELR
Sbjct  250   FELFGQNIDLSPLKGIFTSIENAASSVAKTISDQPPLKIPIRTNNAESWLLTTYLDEELR  309

Query  328   ISRGEAGSIFVLIKEDSPLLK  266
             ISRG+  SIFVL KE S LL 
Sbjct  310   ISRGDGSSIFVLFKEGSTLLN  330



>gb|AAO72593.1| fibrillin-like protein [Oryza sativa Japonica Group]
Length=319

 Score =   343 bits (881),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 183/270 (68%), Positives = 209/270 (77%), Gaps = 4/270 (1%)
 Frame = -3

Query  1066  RKFVVRAVS---DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNR  896
             R+   RAV+   +DE G+E       A A VA    +    +E   LK +L ++ YGT R
Sbjct  49    RRLTARAVAGDAEDEXGKEPAADQGGAAAAVAEAPADVPVTSEVAELKAKLKEALYGTER  108

Query  895   GLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLP-  719
             GL ASSETRAEVVELITQLEA+NPTPAPTEALTLLNGKW+LAYTSF  LFPLL  G+LP 
Sbjct  109   GLRASSETRAEVVELITQLEARNPTPAPTEALTLLNGKWILAYTSFSQLFPLLGSGSLPQ  168

Query  718   LVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  539
             LV+VEEI QTIDSE+FTVQN + FSGPLATTS+STNAKFEVRSPKRVQIKF+EGIIGTPQ
Sbjct  169   LVKVEEISQTIDSENFTVQNCIKFSGPLATTSVSTNAKFEVRSPKRVQIKFDEGIIGTPQ  228

Query  538   LTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWL  359
             LTDSIVLPE  E  GQ IDLTP KG+ +S+++ ASSV ++IS QPPLK  +   NAESWL
Sbjct  229   LTDSIVLPEKFELFGQNIDLTPLKGIFSSIENAASSVARTISGQPPLKIPIRTDNAESWL  288

Query  358   LTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
             LTTYLD ELRISRG+  SIFVL KE S LL
Sbjct  289   LTTYLDDELRISRGDGSSIFVLFKEGSTLL  318



>ref|XP_006849074.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic 
[Amborella trichopoda]
 gb|ERN10655.1| hypothetical protein AMTR_s00028p00216930 [Amborella trichopoda]
Length=322

 Score =   342 bits (878),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/257 (65%), Positives = 204/257 (79%), Gaps = 8/257 (3%)
 Frame = -3

Query  1039  DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEV  860
             +++WGE           G AV E      TE   LKK+LV++FYGT RGL ASSETRAE+
Sbjct  70    EEKWGE--------GSGGTAVAEKAEQVTTEVQKLKKELVEAFYGTERGLKASSETRAEI  121

Query  859   VELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTIDS  680
             VELITQLEA NPTPAPTEAL LLNGKW+LAYT+F  +FPL + GTLPLV+V+EI QTIDS
Sbjct  122   VELITQLEALNPTPAPTEALPLLNGKWILAYTTFSEMFPLFAMGTLPLVKVQEISQTIDS  181

Query  679   ESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEF  500
             E+FTV+N+V+FSGPLATTS +TNAKF VRSPKRVQIKFEEG+IGTP+LTDSI +P+    
Sbjct  182   ENFTVENTVLFSGPLATTSFTTNAKFAVRSPKRVQIKFEEGVIGTPKLTDSIEIPDYAVV  241

Query  499   LGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISR  320
             +GQ IDL+PF+G+I ++QD A+SV +SIS +PP KF +    AESWLLTT+LD +LRISR
Sbjct  242   MGQTIDLSPFRGIINTIQDAAASVARSISGRPPFKFPITTDRAESWLLTTFLDEDLRISR  301

Query  319   GEAGSIFVLIKEDSPLL  269
             G+A S+FVLIKE S LL
Sbjct  302   GDASSVFVLIKEGSSLL  318



>ref|NP_001150448.1| LOC100284078 [Zea mays]
 gb|ACF84791.1| unknown [Zea mays]
 gb|ACG39141.1| plastid-lipid-associated protein 2 [Zea mays]
 tpg|DAA37512.1| TPA: plastid-lipid-associated protein 2 [Zea mays]
Length=318

 Score =   341 bits (874),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 177/258 (69%), Positives = 204/258 (79%), Gaps = 5/258 (2%)
 Frame = -3

Query  1039  DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEV  860
             +DEWG E +    +A  G AV E   A   E   LK QL D+ YGT RGL ASSE+RA+V
Sbjct  64    EDEWGPEPEG--GSAVTGAAVAEAPEA--REVAELKAQLKDALYGTERGLRASSESRAKV  119

Query  859   VELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLP-LVRVEEICQTID  683
             +ELITQLE +NPTPAPTEALTLLNGKW+LAYTSF  LFPLL  G LP LV+VEEI QTID
Sbjct  120   LELITQLETRNPTPAPTEALTLLNGKWILAYTSFSQLFPLLGFGNLPQLVKVEEISQTID  179

Query  682   SESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVE  503
             SE+FTVQN + FSGPLATTS++TNAKFE+RSPKRVQIKF+EGI+GTPQLTDSIVLPE  E
Sbjct  180   SENFTVQNCIKFSGPLATTSVATNAKFEIRSPKRVQIKFDEGIVGTPQLTDSIVLPEKFE  239

Query  502   FLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRIS  323
               GQ IDL+P KG+ +S+++ ASSV K+IS QPPLK  +  +NAESWLLTTYLD ELRIS
Sbjct  240   LFGQNIDLSPLKGIFSSIENAASSVAKTISEQPPLKIPIRTNNAESWLLTTYLDEELRIS  299

Query  322   RGEAGSIFVLIKEDSPLL  269
             RG+  SIFVL KE S LL
Sbjct  300   RGDGSSIFVLFKEGSTLL  317



>gb|AFW58454.1| plastid-lipid-associated protein 2 [Zea mays]
Length=314

 Score =   338 bits (867),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 175/258 (68%), Positives = 203/258 (79%), Gaps = 5/258 (2%)
 Frame = -3

Query  1039  DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEV  860
             +DEW  E +    +A  G AV E   A   E   LK QL D+ YGT RGL ASSE+RA+V
Sbjct  60    EDEWVPEPEG--GSAVTGTAVAEAPEAG--EVAELKAQLKDALYGTERGLRASSESRAKV  115

Query  859   VELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLP-LVRVEEICQTID  683
             +ELITQLE +NPTPAPTEALTLLNGKW+LAYTSF  LFPLL  G LP LV+VEEI QTID
Sbjct  116   LELITQLETRNPTPAPTEALTLLNGKWILAYTSFSQLFPLLEFGKLPALVKVEEISQTID  175

Query  682   SESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVE  503
             S++FTVQN + FSGPLATTS+STNAKFE+RSPKRVQIKF+EGI+GTPQLTDS+VLPE  E
Sbjct  176   SKNFTVQNCIKFSGPLATTSVSTNAKFEIRSPKRVQIKFDEGIVGTPQLTDSVVLPEKFE  235

Query  502   FLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRIS  323
               GQ IDL+P KG+ +S+++ ASSV K+IS QPPLK  +  +NAESWLLTTYLD E+RIS
Sbjct  236   VFGQNIDLSPLKGIFSSIENAASSVAKTISGQPPLKIPIRANNAESWLLTTYLDEEVRIS  295

Query  322   RGEAGSIFVLIKEDSPLL  269
             RGE G IFVL KE S LL
Sbjct  296   RGEGGGIFVLFKEGSTLL  313



>ref|XP_010928413.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic 
[Elaeis guineensis]
Length=328

 Score =   338 bits (868),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 168/224 (75%), Positives = 193/224 (86%), Gaps = 1/224 (0%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSF  758
            LK++L+D  YGT+RGL ASSETRAE+VE+I QLE +NPTPAPTEALTLLNGKW+LAYTSF
Sbjct  104  LKRKLMDLLYGTDRGLQASSETRAEIVEVINQLEVRNPTPAPTEALTLLNGKWILAYTSF  163

Query  757  IGLFPLLSRGTLP-LVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKR  581
              LFPLL    LP LV+VEEI QTIDSE+FTVQNSV F+ PLATTS++TNAKFEVRSPKR
Sbjct  164  SPLFPLLGSARLPELVKVEEISQTIDSENFTVQNSVQFAVPLATTSVTTNAKFEVRSPKR  223

Query  580  VQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPP  401
            VQIKFEEGIIGTPQLTDSIVLPE VEFLGQ IDL+PFK +ITS+Q+ ASSV ++IS +PP
Sbjct  224  VQIKFEEGIIGTPQLTDSIVLPEKVEFLGQNIDLSPFKSVITSVQNAASSVARTISERPP  283

Query  400  LKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
             K S+ N NA+SWLLTTYLD EL+ISR + G IF+LIKE S LL
Sbjct  284  WKISINNDNAQSWLLTTYLDEELKISRADGGGIFLLIKEGSSLL  327



>ref|NP_001150453.1| LOC100284083 [Zea mays]
 gb|ACG39157.1| plastid-lipid-associated protein 2 [Zea mays]
Length=314

 Score =   337 bits (865),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 174/258 (67%), Positives = 203/258 (79%), Gaps = 5/258 (2%)
 Frame = -3

Query  1039  DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEV  860
             +DEW  E +    +A  G AV E   A   E   LK QL D+ YGT RGL ASSE+RA+V
Sbjct  60    EDEWVPEPEG--GSAVTGTAVAEAPEAG--EVAELKAQLKDALYGTERGLRASSESRAKV  115

Query  859   VELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLP-LVRVEEICQTID  683
             +ELITQLE +NPTPAPTEALTLLNGKW+LAYTSF  LFPLL  G LP LV+VEEI QTID
Sbjct  116   LELITQLETRNPTPAPTEALTLLNGKWILAYTSFSQLFPLLEFGKLPALVKVEEISQTID  175

Query  682   SESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVE  503
             S++FTVQN + FSGPLATTS+STNAKFE+RSPKRVQIKF+EGI+GTPQLTDS+VLPE  E
Sbjct  176   SKNFTVQNCIKFSGPLATTSVSTNAKFEIRSPKRVQIKFDEGIVGTPQLTDSVVLPEKFE  235

Query  502   FLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRIS  323
               GQ IDL+P KG+ +S+++ ASSV K++S QPPLK  +  +NAESWLLTTYLD ELRIS
Sbjct  236   IFGQNIDLSPLKGIFSSIENAASSVAKTLSGQPPLKIPIRANNAESWLLTTYLDEELRIS  295

Query  322   RGEAGSIFVLIKEDSPLL  269
             RG+ G IFVL KE S LL
Sbjct  296   RGDGGGIFVLFKEGSTLL  313



>ref|XP_008349368.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Malus domestica]
Length=205

 Score =   330 bits (847),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -3

Query  844  QLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTIDSESFTV  665
            QLEAKNPTPAPTEAL LLNGKW+LAYTSF GLFPLLSRGTLPLV+VEEI QTIDSE+FTV
Sbjct  12   QLEAKNPTPAPTEALPLLNGKWILAYTSFAGLFPLLSRGTLPLVKVEEISQTIDSENFTV  71

Query  664  QNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKI  485
            QNSV F+GPLATTSISTNA FEVRSPKRVQIKFEEG+IGTPQLTDS+V+PENV+FLGQKI
Sbjct  72   QNSVQFAGPLATTSISTNATFEVRSPKRVQIKFEEGVIGTPQLTDSLVIPENVDFLGQKI  131

Query  484  DLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGS  305
            +L PFKGL+ S+QDTASSVVK+ISSQPP KFS+ +SNA+SWLLTTYLD ELRISRG+ GS
Sbjct  132  ELAPFKGLLNSVQDTASSVVKTISSQPPFKFSIPSSNAQSWLLTTYLDGELRISRGDNGS  191

Query  304  IFVLIKEDSPLL  269
            +FVLIK  SPLL
Sbjct  192  VFVLIKAGSPLL  203



>ref|XP_003594154.1| Plastid-lipid-associated protein [Medicago truncatula]
 gb|ABD32658.1| PAP fibrillin [Medicago truncatula]
 gb|AES64405.1| plastid lipid-associated protein [Medicago truncatula]
Length=316

 Score =   329 bits (844),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 195/329 (59%), Positives = 236/329 (72%), Gaps = 21/329 (6%)
 Frame = -3

Query  1237  MASISSFTQF-HCKPVGMICPRSSSTPKPSVFPVNSTI-FASKVAALRSFPNRGLANPNR  1064
             MAS+S+  Q  H   +    P +S    PS+ P   T    SK A        GL    R
Sbjct  1     MASLSNLNQLLHINTL----PVTSLNSTPSITPSTITFGLQSKNARKSILVADGL---RR  53

Query  1063  KFVVRAVS----DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNR  896
                VRA +    DDEWG E        P+    V +     +ET+ LKK LV SFYGT R
Sbjct  54    VVYVRATANDDDDDEWGSE--------PSADVAVAEVIVPESETEKLKKDLVGSFYGTAR  105

Query  895   GLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPL  716
             GL A+SETRAE+ ELI+QLEAKNPTPA T+AL+LL+GKW+LAYTS+ GLFPLLS G LPL
Sbjct  106   GLKAASETRAEIFELISQLEAKNPTPASTDALSLLDGKWILAYTSYAGLFPLLSSGLLPL  165

Query  715   VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  536
             + VEE+ QTIDSES +VQNSV+ +GPL TTSISTNAKFEVRSP R+QIKFEEG+IGTPQL
Sbjct  166   LEVEELSQTIDSESLSVQNSVLLAGPLTTTSISTNAKFEVRSPNRLQIKFEEGVIGTPQL  225

Query  535   TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  356
             TDS+ +PE VEFLGQ+IDL+ FK + TS+Q+TASSVV++IS QPPLK  ++NS A+SWLL
Sbjct  226   TDSLEIPETVEFLGQEIDLSSFKDIFTSIQNTASSVVQTISDQPPLKIPISNSYAQSWLL  285

Query  355   TTYLDSELRISRGEAGSIFVLIKEDSPLL  269
             TTYLD ELR++RG+ GS+FVLIKE S LL
Sbjct  286   TTYLDEELRVARGDGGSVFVLIKEGSSLL  314



>gb|ACJ85346.1| unknown [Medicago truncatula]
Length=315

 Score =   327 bits (838),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 194/328 (59%), Positives = 235/328 (72%), Gaps = 20/328 (6%)
 Frame = -3

Query  1237  MASISSFTQF-HCKPVGMICPRSSSTPKPSVFPVNSTI-FASKVAALRSFPNRGLANPNR  1064
             MAS+S+  Q  H   +    P +S    PS+ P   T    SK A        GL    R
Sbjct  1     MASLSNLNQLLHINTL----PVTSLNSTPSITPSTITFGLQSKNARKSILVADGL---RR  53

Query  1063  KFVVRAVS---DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRG  893
                VRA +   DDEWG E        P+    V +     +ET+ LKK LV SFYGT RG
Sbjct  54    VVYVRATANDDDDEWGSE--------PSADVAVAEVIVPESETEKLKKDLVGSFYGTARG  105

Query  892   LSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLV  713
             L A+SETRAE+ ELI+QLEAKNPTPA T+AL+LL+GKW+LAYTS+ GLFPLLS G LPL+
Sbjct  106   LKAASETRAEIFELISQLEAKNPTPASTDALSLLDGKWILAYTSYAGLFPLLSSGLLPLL  165

Query  712   RVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLT  533
              VEE+ QTIDSE  +VQNSV+ +GPL TTSISTNAKFEVRSP R+QIKFEEG+IGTPQLT
Sbjct  166   EVEELSQTIDSECLSVQNSVLLAGPLTTTSISTNAKFEVRSPNRLQIKFEEGVIGTPQLT  225

Query  532   DSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLT  353
             DS+ +PE VEFLGQ+IDL+ FK + TS+Q+TASSVV++IS QPPLK  ++NS A+SWLLT
Sbjct  226   DSLEIPETVEFLGQEIDLSSFKDIFTSIQNTASSVVQTISDQPPLKIPISNSYAQSWLLT  285

Query  352   TYLDSELRISRGEAGSIFVLIKEDSPLL  269
             TYLD ELR++RG+ GS+FVLIKE S LL
Sbjct  286   TYLDEELRVARGDGGSVFVLIKEGSSLL  313



>gb|AFK48303.1| unknown [Medicago truncatula]
Length=316

 Score =   327 bits (838),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 194/329 (59%), Positives = 235/329 (71%), Gaps = 21/329 (6%)
 Frame = -3

Query  1237  MASISSFTQF-HCKPVGMICPRSSSTPKPSVFPVNSTI-FASKVAALRSFPNRGLANPNR  1064
             MAS+S+  Q  H   +    P +S    PS+ P   T    SK A        GL    R
Sbjct  1     MASLSNLNQLLHINTL----PVTSLNSTPSITPSTITFGLQSKNARKSILVADGL---RR  53

Query  1063  KFVVRAVS----DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNR  896
                VRA +    DDEWG E        P+    V +     +ET+ LKK LV SFYGT R
Sbjct  54    VVYVRATANDDDDDEWGSE--------PSADVAVAEVIVPESETEKLKKDLVGSFYGTAR  105

Query  895   GLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPL  716
             GL A+SETRAE+ ELI+QLEAKNPTPA T+AL+LL+GKW+LAYTS+ GLFPLLS G LPL
Sbjct  106   GLKAASETRAEIFELISQLEAKNPTPASTDALSLLDGKWILAYTSYAGLFPLLSSGLLPL  165

Query  715   VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  536
             + VEE+ QTIDSES +VQNSV+ +GPL TTSISTNAKFEVRSP R+QIKFEEG+IGTPQL
Sbjct  166   LEVEELSQTIDSESLSVQNSVLLAGPLTTTSISTNAKFEVRSPNRLQIKFEEGVIGTPQL  225

Query  535   TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  356
             TDS+ +PE VEFLGQ+IDL+ FK + TS+Q+TASSVV++IS QPPLK  ++NS A+SWLL
Sbjct  226   TDSLEIPETVEFLGQEIDLSSFKDIFTSIQNTASSVVQTISDQPPLKIPISNSYAQSWLL  285

Query  355   TTYLDSELRISRGEAGSIFVLIKEDSPLL  269
             TTYLD ELR++RG+ G +FVLIKE S LL
Sbjct  286   TTYLDEELRVARGDGGGVFVLIKEGSSLL  314



>gb|ACJ84978.1| unknown [Medicago truncatula]
Length=316

 Score =   326 bits (836),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 194/329 (59%), Positives = 235/329 (71%), Gaps = 21/329 (6%)
 Frame = -3

Query  1237  MASISSFTQF-HCKPVGMICPRSSSTPKPSVFPVNSTI-FASKVAALRSFPNRGLANPNR  1064
             MAS+S+  Q  H   +    P +S    PS+ P   T    SK A        GL    R
Sbjct  1     MASLSNLNQLLHINTL----PVTSLNSTPSITPSTITFGLQSKNARKSILVADGL---RR  53

Query  1063  KFVVRAVS----DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNR  896
                VRA +    DDEWG E        P+    V +     +ET+ LKK LV SFYGT R
Sbjct  54    VVYVRATANDDDDDEWGSE--------PSADVAVAEVIVPESETEKLKKDLVGSFYGTAR  105

Query  895   GLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPL  716
             GL A+SETRAE+ ELI+QLEAKNPTPA T+AL+LL+GKW+LAYTS+ GLFPLLS G LPL
Sbjct  106   GLKAASETRAEIFELISQLEAKNPTPASTDALSLLDGKWILAYTSYAGLFPLLSSGLLPL  165

Query  715   VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  536
             + VEE+ QTIDSES +VQNSV+ +GPL TTSISTNAKFEVRSP R+QIKFEEG+IGTPQL
Sbjct  166   LEVEELSQTIDSESLSVQNSVLLAGPLTTTSISTNAKFEVRSPNRLQIKFEEGVIGTPQL  225

Query  535   TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  356
             TDS+ +PE VEFLGQ+IDL+ FK + TS+Q+TASSVV++IS QPPLK  ++NS A+SWLL
Sbjct  226   TDSLEIPETVEFLGQEIDLSSFKDIFTSIQNTASSVVQTISDQPPLKTPISNSYAQSWLL  285

Query  355   TTYLDSELRISRGEAGSIFVLIKEDSPLL  269
             TTYLD ELR++RG+ G +FVLIKE S LL
Sbjct  286   TTYLDEELRVARGDGGGVFVLIKEGSSLL  314



>ref|NP_001062631.2| Os09g0133600, partial [Oryza sativa Japonica Group]
 dbj|BAF24545.2| Os09g0133600, partial [Oryza sativa Japonica Group]
Length=241

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 179/209 (86%), Gaps = 1/209 (0%)
 Frame = -3

Query  892  LSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLP-L  716
            L ASSETRAEVVELITQLEA+NPTPAPTEALTLLNGKW+LAYTSF  LFPLL  G+LP L
Sbjct  32   LRASSETRAEVVELITQLEARNPTPAPTEALTLLNGKWILAYTSFSQLFPLLGSGSLPQL  91

Query  715  VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQL  536
            V+VEEI QTIDSE+FTVQN + FSGPLATTS+STNAKFEVRSPKRVQIKF+EGIIGTPQL
Sbjct  92   VKVEEISQTIDSENFTVQNCIKFSGPLATTSVSTNAKFEVRSPKRVQIKFDEGIIGTPQL  151

Query  535  TDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLL  356
            TDSIVLPE  E  GQ IDLTP KG+ +S+++ ASSV ++IS QPPLK  +   NAESWLL
Sbjct  152  TDSIVLPEKFELFGQNIDLTPLKGIFSSIENAASSVARTISGQPPLKIPIRTDNAESWLL  211

Query  355  TTYLDSELRISRGEAGSIFVLIKEDSPLL  269
            TTYLD ELRISRG+  SIFVL KE S LL
Sbjct  212  TTYLDDELRISRGDGSSIFVLFKEGSTLL  240



>ref|XP_006844495.2| PREDICTED: plastid-lipid-associated protein, chloroplastic [Amborella 
trichopoda]
Length=317

 Score =   316 bits (810),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 161/243 (66%), Positives = 192/243 (79%), Gaps = 5/243 (2%)
 Frame = -3

Query  991  AGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAP  812
             G+AV E     +TE + +KK LV++FYGTNRGL ASSETRAE+VELITQLEA NPTP P
Sbjct  78   GGLAVAE---LGMTEVEKVKKALVEAFYGTNRGLQASSETRAEIVELITQLEAMNPTPVP  134

Query  811  TEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLA  632
            T+AL LLNGKW+L YT    +F L + GTLP+++ EEI QTID+ESFTV+NSV+FSGPLA
Sbjct  135  TQALPLLNGKWILVYTCLSDIFSLYAMGTLPILKAEEISQTIDAESFTVENSVLFSGPLA  194

Query  631  TTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITS  452
            TTS +T+AKFEVRSPKRVQ  FEEG+ GTPQLTDSI +PENVE LGQ I+L+PF+  IT 
Sbjct  195  TTSFTTHAKFEVRSPKRVQ--FEEGVFGTPQLTDSIEIPENVEVLGQTIELSPFREFITP  252

Query  451  LQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPL  272
            LQD A+SV +SIS   P KF +    AESWLLTT+LD +L ISRG+A S+FVLIKE S L
Sbjct  253  LQDAATSVARSISGSTPFKFLITIDRAESWLLTTFLDEDLCISRGDASSVFVLIKEGSSL  312

Query  271  LKP  263
            L P
Sbjct  313  LPP  315



>ref|XP_009398685.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=312

 Score =   309 bits (792),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 169/260 (65%), Positives = 204/260 (78%), Gaps = 5/260 (2%)
 Frame = -3

Query  1051  RAVSDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSET  872
             RAV DD+  E+ +E       GVAV E   AA +E   LKK+L+D   GT+ GL  SSET
Sbjct  57    RAVVDDD--EQGEEGGEEPLGGVAVTELLVAA-SEVSDLKKKLMDLVSGTDWGLKTSSET  113

Query  871   RAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLP-LVRVEEIC  695
             RAE+VELI Q+EAKNPTPAPT+ALTLL+GKW+LAYTSF  LFPLL+ G LP LV+V+EI 
Sbjct  114   RAEIVELIGQIEAKNPTPAPTDALTLLDGKWILAYTSFSALFPLLASGRLPSLVKVDEIS  173

Query  694   QTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLP  515
             Q+ DSESFTVQNSV   GPLATTS++T+AKFEVRSPKRVQIKFEEGIIGTPQLTD+IV+P
Sbjct  174   QSFDSESFTVQNSVKLLGPLATTSVTTSAKFEVRSPKRVQIKFEEGIIGTPQLTDNIVIP  233

Query  514   ENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSE  335
             + VEFLGQ +DL+   G+  S+Q+ ASSVV++IS +PPLK  + N+  +SWLLTTYLD E
Sbjct  234   DKVEFLGQSLDLSLLDGVFKSIQNAASSVVRTISGRPPLKIPINNA-LQSWLLTTYLDEE  292

Query  334   LRISRGEAGSIFVLIKEDSP  275
             LRISR  AGS+FVL K + P
Sbjct  293   LRISRDYAGSVFVLTKANDP  312



>ref|XP_009783682.1| PREDICTED: light-induced protein, chloroplastic-like [Nicotiana 
sylvestris]
Length=181

 Score =   294 bits (753),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -3

Query  769  YTSFIGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRS  590
            YTSF GLFPLLSRGTLPLVRVEEI QTIDSE+F VQN VVF+GPLATTSI+TNAKFEV+S
Sbjct  13   YTSFSGLFPLLSRGTLPLVRVEEISQTIDSETFAVQNCVVFAGPLATTSITTNAKFEVKS  72

Query  589  PKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISS  410
            PKRVQIKF+EGIIGTPQLTDSI LPENVEFLGQKIDL+PFKGLI S+QDTASSV KSISS
Sbjct  73   PKRVQIKFDEGIIGTPQLTDSIELPENVEFLGQKIDLSPFKGLINSVQDTASSVAKSISS  132

Query  409  QPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
            QPP+KF ++NSNA+SWLLTTYLD ELRISRG+ GS+FVLIKE SPLLKP
Sbjct  133  QPPIKFPISNSNAQSWLLTTYLDDELRISRGDGGSVFVLIKEGSPLLKP  181



>gb|KDO78379.1| hypothetical protein CISIN_1g020639mg [Citrus sinensis]
Length=248

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 155/234 (66%), Positives = 176/234 (75%), Gaps = 4/234 (2%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MASIS   QF CK +    P +  T KPS+ P+NS   +  +A       +G        
Sbjct  1     MASISQTNQFPCKTLSQNPPHNQFTSKPSILPLNSVRISRSLAKKSFLSIQGFTRARPLV  60

Query  1057  VVRAVSDDEWGEEKKEPLSAAPAGVAVVEDE-PAALTETDVLKKQLVDSFYGTNRGLSAS  881
             + RA  DDEWG EK++    A   +AV E+E P  +TE D LKK LVDSFYGT+RGL+A+
Sbjct  61    LTRAADDDEWGPEKEKEEGGA---LAVAEEESPKEVTEIDNLKKALVDSFYGTDRGLNAT  117

Query  880   SETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEE  701
             SETRAE+VELITQLEAKNPTPAPTEALTLLN KW+L YTSF GLFPLLSRGTLPL RVEE
Sbjct  118   SETRAEIVELITQLEAKNPTPAPTEALTLLNAKWILVYTSFSGLFPLLSRGTLPLARVEE  177

Query  700   ICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  539
             I QTIDSE+FTVQNS+ F+GPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ
Sbjct  178   ISQTIDSENFTVQNSIRFAGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  231



>ref|XP_001766233.1| predicted protein [Physcomitrella patens]
 gb|EDQ68865.1| predicted protein [Physcomitrella patens]
Length=318

 Score =   297 bits (761),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/223 (63%), Positives = 179/223 (80%), Gaps = 0/223 (0%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSF  758
            LK+QL+D+ YGT RGL ASS+TRAEV+ELITQLEAKNPT APT ALTLLNGKWVLAYTSF
Sbjct  95   LKQQLIDTLYGTERGLRASSDTRAEVIELITQLEAKNPTEAPTAALTLLNGKWVLAYTSF  154

Query  757  IGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRV  578
              LFPLL+ G LPLV+V EI Q ID+++ T++N V F GP+  TS S +A FE+RSPKR+
Sbjct  155  SELFPLLAAGNLPLVKVGEITQIIDAQALTIENCVSFEGPVTATSFSASASFEIRSPKRI  214

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPL  398
            Q+KFEEG I  P++++S  +P +++ +GQKID +  KGL+  LQD A +V +++S QPPL
Sbjct  215  QVKFEEGSISAPKVSNSAEIPSSLDIMGQKIDFSAAKGLLKPLQDAAMTVARTLSGQPPL  274

Query  397  KFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
            KFS+ N  A+SWLLTTYLD +LRISRG+ GS+FVL++E S LL
Sbjct  275  KFSIPNDRAQSWLLTTYLDEDLRISRGDGGSVFVLLREGSTLL  317



>ref|XP_008780182.1| PREDICTED: probable plastid-lipid-associated protein 2, chloroplastic, 
partial [Phoenix dactylifera]
Length=281

 Score =   278 bits (711),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 139/185 (75%), Positives = 164/185 (89%), Gaps = 4/185 (2%)
 Frame = -3

Query  967  EPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLN  788
            EP+ + E   LK++L++  YGT+RGL+ASSETRAE++ELITQLE+KNPTPAPTEALTLLN
Sbjct  100  EPSEIGE---LKRKLMELLYGTDRGLNASSETRAEILELITQLESKNPTPAPTEALTLLN  156

Query  787  GKWVLAYTSFIGLFPLLSRGTLP-LVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTN  611
            GKW+LAYTSF  LFPLL  G LP +V+VEEI QTIDSE+FTVQNSV F+ PLATT ++TN
Sbjct  157  GKWILAYTSFSPLFPLLGSGRLPEVVKVEEISQTIDSENFTVQNSVQFAEPLATTCVTTN  216

Query  610  AKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASS  431
            AKFEVRSPKRVQIKFEEGIIGTPQ+TDSIV+PE VEFLGQ IDL+PFKG+ITS+QD ASS
Sbjct  217  AKFEVRSPKRVQIKFEEGIIGTPQITDSIVIPEKVEFLGQNIDLSPFKGVITSVQDAASS  276

Query  430  VVKSI  416
            V ++I
Sbjct  277  VARTI  281



>ref|XP_010270045.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Nelumbo nucifera]
Length=349

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 174/351 (50%), Positives = 218/351 (62%), Gaps = 32/351 (9%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMI-CPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRK  1061
             MA+ SS   F CK + +    R     K S  PVNS    S+    RS  +  +   NR 
Sbjct  1     MAAASSVNTFPCKTLSLTQSQRLLGFNKNSFSPVNSIGVTSRKPITRSTFSIAIGEHNRV  60

Query  1060  ---FVVRAVSDDEWGEEKKEPLSAAPAGVAVVE-DEPAALTETDVLKKQLVDSFYGTNRG  893
                  +RAV D     E  EP+      +A    D P   ++ D+LKK L DSF GT+RG
Sbjct  61    RPILRIRAVGDAVKRAED-EPIGEGVISMAAAAVDRPEKPSDIDMLKKLLFDSFIGTDRG  119

Query  892   LSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLV  713
             L ASSE RAE+ E+I+QLEA NPTPAPTEA TLLNGKW++AYTS  G     +RG LP+V
Sbjct  120   LRASSEARAEIDEVISQLEALNPTPAPTEAFTLLNGKWIVAYTSLAG---WCTRGKLPMV  176

Query  712   RVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGI-------  554
             +VEEI QTIDS SFT+ N V F  PL+TTS  TNAKFEVRSPKR+Q+ FEE I       
Sbjct  177   KVEEISQTIDSSSFTLNNEVQFICPLSTTSFRTNAKFEVRSPKRIQVWFEENITITSQTT  236

Query  553   -------------IGTPQLTDSIVLPENVEFLGQKID--LTPFKGLITSLQDTASSVVKS  419
                          I +PQLTD++ +PE VEF+ QK+   L P    I S+++TASSVV+ 
Sbjct  237   EPVGQTLRLRLCPIISPQLTDAVEIPETVEFVRQKLGFCLCPLNATIRSVKNTASSVVRI  296

Query  418   ISSQPPLKFSLANSNAE-SWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
             ISSQ  LK   +N+N++ SWLLTTYLD+ELRI+RG+ G++FVLIKE S LL
Sbjct  297   ISSQLLLKVLSSNTNSQSSWLLTTYLDNELRIARGDGGNVFVLIKEGSSLL  347



>gb|ACG36654.1| plastid-lipid-associated protein 2 [Zea mays]
Length=262

 Score =   267 bits (682),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 138/203 (68%), Positives = 161/203 (79%), Gaps = 5/203 (2%)
 Frame = -3

Query  1039  DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEV  860
             +DEWG E +    +A  G AV E   A   E   LK QL D+ YGT RGL ASSE+RA+V
Sbjct  64    EDEWGPEPEG--GSAVTGAAVAEAPEA--REVAELKAQLKDALYGTERGLRASSESRAKV  119

Query  859   VELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLP-LVRVEEICQTID  683
             +ELITQLE +NPTPAPTEALTLLNGKW+LAYTSF  LFPLL  G LP LV+VEEI QTID
Sbjct  120   LELITQLETRNPTPAPTEALTLLNGKWILAYTSFSQLFPLLGFGNLPQLVKVEEISQTID  179

Query  682   SESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVE  503
             SE+FTVQN + FSGPLATTS++TNAKFE+RSPKRVQIKF+EGI+GTPQLTDSIVLPE  E
Sbjct  180   SENFTVQNCIKFSGPLATTSVATNAKFEIRSPKRVQIKFDEGIVGTPQLTDSIVLPEKFE  239

Query  502   FLGQKIDLTPFKGLITSLQDTAS  434
               GQ IDL+P KG+ +S+++ AS
Sbjct  240   LFGQNIDLSPLKGIFSSIENAAS  262



>emb|CDY71809.1| BnaCnng74600D, partial [Brassica napus]
Length=188

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = -3

Query  772  AYTSFIGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVR  593
            +YTSF+GLFPLLSR   PLV+V+EI QTIDS+SFTVQNSV F+GPLATTS STNAKFEV+
Sbjct  19   SYTSFVGLFPLLSRRISPLVKVDEISQTIDSDSFTVQNSVRFAGPLATTSFSTNAKFEVQ  78

Query  592  SPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSIS  413
            SPKRVQIKFE+G+IGTPQLTDSI +PE+VE LGQKIDL P +GL+TS+QDTASSV ++IS
Sbjct  79   SPKRVQIKFEQGVIGTPQLTDSIEIPESVEVLGQKIDLNPIRGLLTSVQDTASSVARTIS  138

Query  412  SQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
            SQPPLKFSL    A+SWLLTTYLD +LRISRG+ GSIFVL KE S LL P
Sbjct  139  SQPPLKFSLPADRAQSWLLTTYLDKDLRISRGDGGSIFVLFKEGSSLLNP  188



>gb|ABR17395.1| unknown [Picea sitchensis]
Length=436

 Score =   271 bits (693),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 149/297 (50%), Positives = 194/297 (65%), Gaps = 26/297 (9%)
 Frame = -3

Query  1090  NRGLANPNRKFVVRAVSDDEWGE---------EKKEPLSAAPAGVAVVEDEPAALT----  950
             N G A+     +V A S DEWGE         + + P +  P+   + +DE  A +    
Sbjct  141   NVGGADSAGNGLVSATSVDEWGEKTVPDDESAQTRLPDTDPPS---LEDDERGAASDLSP  197

Query  949   -ETD---------VLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEAL  800
              E D          LK+ LVD FYGT  GL ASS+TRAE+ ELI+QLEA+NPTP PTEA 
Sbjct  198   KERDGSAEDSGLSELKQCLVDCFYGTEYGLRASSQTRAEIGELISQLEAQNPTPVPTEAP  257

Query  799   TLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSI  620
             +LL GKWVL YTSF  L PL++ GTLP V++ +I Q ID + FT++NS  +SGP AT S 
Sbjct  258   SLLQGKWVLVYTSFSELLPLIAAGTLPFVKLGKIFQEIDIDKFTIENSASYSGPFATFSF  317

Query  619   STNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDT  440
                A FEVRSPKR+++KFEEGII  P++T ++ +PE VE  GQKIDLT F+G +  LQ+ 
Sbjct  318   RALASFEVRSPKRIEVKFEEGIIPPPEITSTLDIPEKVEIFGQKIDLTSFQGSLRPLQEA  377

Query  439   ASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
             A+++ + IS QPPLK  +    A+SWLL TYLD +LRISRG+ G +FVL+KE S LL
Sbjct  378   ATNISRVISGQPPLKLPIRRDGAQSWLLITYLDKDLRISRGDGGGLFVLVKEGSSLL  434



>ref|XP_006854055.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic 
[Amborella trichopoda]
 gb|ERN15522.1| hypothetical protein AMTR_s00048p00085290 [Amborella trichopoda]
Length=479

 Score =   265 bits (676),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 129/240 (54%), Positives = 175/240 (73%), Gaps = 1/240 (0%)
 Frame = -3

Query  988  GVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPT  809
            G   V  + +   E + LK+ LVDSFYGT  GL A+SETRAE+VEL+ QLEA NPT APT
Sbjct  239  GYVEVSADKSRFDEIEGLKRCLVDSFYGTELGLRATSETRAEIVELVNQLEALNPTSAPT  298

Query  808  EALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLAT  629
            E+L+LL+G WVL YT+F  L PL++ GTLPL+ +E+ICQ I+++SFTVQNS+ +S PLAT
Sbjct  299  ESLSLLDGNWVLRYTAFSELLPLIAAGTLPLLELEKICQEINTKSFTVQNSITYSSPLAT  358

Query  628  TSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSL  449
             S S +A FEVRSP R+Q+KFEEG+   P++     LP  V+  GQ IDL+P   +++ L
Sbjct  359  FSFSASASFEVRSPSRIQVKFEEGVFNPPEIRTPADLPTKVDVFGQSIDLSPLSSVLSPL  418

Query  448  QDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
            ++  +++ ++IS QPPLK  +    +ESWLL +YLD +LRISRG+ G +FVL+KE SPLL
Sbjct  419  EEGFANISRAISGQPPLKLRIPGQGSESWLLISYLDKDLRISRGDGG-LFVLVKEGSPLL  477



>gb|AAP74338.1| fibrillin-like protein [Elaeis guineensis]
Length=172

 Score =   253 bits (646),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 145/170 (85%), Gaps = 1/170 (1%)
 Frame = -3

Query  784  KWVLAYTSFIGLFPLLSRGTLP-LVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNA  608
            KW+LAYTSF  LFPLL    LP LV+VEEI QTIDSE+FTVQNSV F+ PLATTS++TNA
Sbjct  1    KWILAYTSFSPLFPLLGSERLPELVKVEEISQTIDSENFTVQNSVQFAVPLATTSVTTNA  60

Query  607  KFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSV  428
            KFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPE VEFLGQ IDL+PFK +ITS+Q+ ASSV
Sbjct  61   KFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPEKVEFLGQNIDLSPFKSVITSVQNAASSV  120

Query  427  VKSISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDS  278
             ++IS +PP K S+ N NA+SWLLTTYLD EL+ISR + G IF+LIKE S
Sbjct  121  ARTISERPPWKISINNDNAQSWLLTTYLDEELKISRADGGGIFLLIKEGS  170



>ref|XP_008799426.1| PREDICTED: light-induced protein, chloroplastic-like, partial 
[Phoenix dactylifera]
Length=171

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 145/169 (86%), Gaps = 1/169 (1%)
 Frame = -3

Query  769  YTSFIGLFPLLSRGTLP-LVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVR  593
            YTSF  LFPLL  G LP +V+VEEI QTIDSE+FTVQNSV F+GPLATT ++TNAKFEVR
Sbjct  3    YTSFSPLFPLLGSGRLPEVVKVEEILQTIDSENFTVQNSVQFAGPLATTCVTTNAKFEVR  62

Query  592  SPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSIS  413
            SPKRVQIKFEEGIIGTPQ+TDSIV+PE VEFLGQ IDL+PFKG+ITS+QD ASSV ++IS
Sbjct  63   SPKRVQIKFEEGIIGTPQITDSIVIPEKVEFLGQNIDLSPFKGVITSVQDAASSVARTIS  122

Query  412  SQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLK  266
             +PP K  + N+NA+SWLLTTYLD ELRISR + GS+FVLIKE S LL 
Sbjct  123  ERPPWKIPINNNNAQSWLLTTYLDEELRISRADGGSVFVLIKEGSSLLN  171



>ref|XP_001756848.1| predicted protein [Physcomitrella patens]
 gb|EDQ78445.1| predicted protein, partial [Physcomitrella patens]
Length=242

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 179/242 (74%), Gaps = 10/242 (4%)
 Frame = -3

Query  976  VEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALT  797
            +ED+     E   LK+QL+D   G  RG+ ASS+TR EV ELI+Q E+KNPTPAPT++L+
Sbjct  4    IEDDGVDAKE---LKQQLIDFLDGKGRGIRASSDTRDEVTELISQFESKNPTPAPTDSLS  60

Query  796  LLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSIS  617
            LLNGKW+L YTS+  L+PLL+ G LPLV V E+ QTID+++ +V+NSV+F  P+ TTS  
Sbjct  61   LLNGKWILLYTSYSELYPLLAAGNLPLVEVAEVSQTIDAQALSVENSVLFESPV-TTSFG  119

Query  616  TNAKFEVRSPKRV------QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLIT  455
            T+  FE+RSPK +      Q+K EEGII +P++ DS  +P N++ +GQKIDL+   GL+ 
Sbjct  120  TSVFFEIRSPKLIVLLLWFQVKLEEGIISSPKVRDSAEIPSNLDIMGQKIDLSFAMGLLK  179

Query  454  SLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSP  275
             LQD A+++++++S QPPLKFS+ N  A+SWLLTT+L+ +LRISR + GS+FV ++E + 
Sbjct  180  PLQDVATTIIRNLSGQPPLKFSIQNDRAQSWLLTTFLEEDLRISRIDGGSMFVFLREGTT  239

Query  274  LL  269
            LL
Sbjct  240  LL  241



>emb|CBI33829.3| unnamed protein product [Vitis vinifera]
Length=273

 Score =   249 bits (636),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 125/257 (49%), Positives = 173/257 (67%), Gaps = 1/257 (0%)
 Frame = -3

Query  1039  DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEV  860
             +DEWG +     +   +G  +     A + E   LK+ LVD+ YGTN G  A++E RAEV
Sbjct  15    EDEWGGDGDAKDAYIKSGNGIATAAAAEVDEVGDLKRCLVDTVYGTNFGFEATAEVRAEV  74

Query  859   VELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTIDS  680
             VEL+ QLEA NPTPAPTEA  LL+G WVL YT+   L PLL+ G+ PL++V+ ICQ+I++
Sbjct  75    VELVNQLEAVNPTPAPTEAAELLDGNWVLLYTAASELLPLLAAGSTPLLKVKSICQSIET  134

Query  679   ESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEF  500
              S T+ NS   S P AT S S +A FEVRSP R+Q++F+EG +  P++  S+ LPENV+ 
Sbjct  135   SSRTIVNSTTLSSPFATFSFSASATFEVRSPSRIQVQFKEGTLQPPEIKSSLNLPENVDV  194

Query  499   LGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISR  320
              GQKI+L+  +  +  LQ+  +S+ ++IS QPPLK  +    + SWLL TYLD ++RISR
Sbjct  195   FGQKINLSAVQQYLNPLQEAVASISRAISGQPPLKVPIPGERSSSWLLITYLDKDIRISR  254

Query  319   GEAGSIFVLIKEDSPLL  269
             G+ G +FVL +E SPLL
Sbjct  255   GDGG-LFVLAREGSPLL  270



>ref|XP_002276479.1| PREDICTED: plastoglobulin-1, chloroplastic [Vitis vinifera]
Length=382

 Score =   250 bits (639),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 125/257 (49%), Positives = 173/257 (67%), Gaps = 1/257 (0%)
 Frame = -3

Query  1039  DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEV  860
             +DEWG +     +   +G  +     A + E   LK+ LVD+ YGTN G  A++E RAEV
Sbjct  124   EDEWGGDGDAKDAYIKSGNGIATAAAAEVDEVGDLKRCLVDTVYGTNFGFEATAEVRAEV  183

Query  859   VELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTIDS  680
             VEL+ QLEA NPTPAPTEA  LL+G WVL YT+   L PLL+ G+ PL++V+ ICQ+I++
Sbjct  184   VELVNQLEAVNPTPAPTEAAELLDGNWVLLYTAASELLPLLAAGSTPLLKVKSICQSIET  243

Query  679   ESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEF  500
              S T+ NS   S P AT S S +A FEVRSP R+Q++F+EG +  P++  S+ LPENV+ 
Sbjct  244   SSRTIVNSTTLSSPFATFSFSASATFEVRSPSRIQVQFKEGTLQPPEIKSSLNLPENVDV  303

Query  499   LGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISR  320
              GQKI+L+  +  +  LQ+  +S+ ++IS QPPLK  +    + SWLL TYLD ++RISR
Sbjct  304   FGQKINLSAVQQYLNPLQEAVASISRAISGQPPLKVPIPGERSSSWLLITYLDKDIRISR  363

Query  319   GEAGSIFVLIKEDSPLL  269
             G+ G +FVL +E SPLL
Sbjct  364   GDGG-LFVLAREGSPLL  379



>ref|XP_010276838.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic 
[Nelumbo nucifera]
Length=446

 Score =   251 bits (642),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/257 (49%), Positives = 170/257 (66%), Gaps = 7/257 (3%)
 Frame = -3

Query  1039  DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEV  860
             +DEWG         A          PA   + + LK+ LV++ YGT+ G  AS E R EV
Sbjct  195   EDEWGG------GEASTKYTSGRSNPAVYDKLEDLKRCLVETVYGTDFGFQASGEVREEV  248

Query  859   VELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTIDS  680
             +EL+ QLEA NPTPAP EA +LL+G WVL YT+F  L PLL+ G +PL+ ++ ICQ ID+
Sbjct  249   LELVNQLEASNPTPAPVEATSLLDGNWVLLYTAFSELLPLLAVGRIPLLEIKRICQKIDT  308

Query  679   ESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEF  500
             +S T++NS   S P AT S S +A FEVRSP R+Q++F+EG    P++  +  LPEN++ 
Sbjct  309   KSLTIENSTSLSSPFATFSFSASATFEVRSPSRIQVQFKEGAFQPPEIKSTFHLPENIDV  368

Query  499   LGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISR  320
              GQKIDL+P +  +  LQD  +SV ++IS QPPLK  +    ++SWL+TTYLD +LRISR
Sbjct  369   FGQKIDLSPVQRSLNPLQDAVASVSRAISGQPPLKLPIPGERSQSWLITTYLDEDLRISR  428

Query  319   GEAGSIFVLIKEDSPLL  269
             G+ G +F+L KE SPLL
Sbjct  429   GDGG-LFILAKEGSPLL  444



>ref|XP_010245209.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic-like 
[Nelumbo nucifera]
Length=376

 Score =   249 bits (635),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/257 (49%), Positives = 172/257 (67%), Gaps = 10/257 (4%)
 Frame = -3

Query  1039  DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEV  860
             +DEW E  KE  SA+  G A + D+   L      K+ LVD+ YGT+ G  AS+E RAEV
Sbjct  128   EDEW-EGNKE--SASGNGSAALYDKLGDL------KRSLVDTVYGTDFGFQASAEVRAEV  178

Query  859   VELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTIDS  680
             +EL+ QLE+ NPTPAP EA +LL+G W+L YT+F  L PLL+ GT PL +++ ICQ ID+
Sbjct  179   LELVNQLESSNPTPAPLEATSLLDGNWILLYTAFSELLPLLAAGTTPLFKIKRICQKIDT  238

Query  679   ESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEF  500
             +S  ++NS   S P AT S S +A FEVR P ++Q+KF EG    P++  ++ LPENVE 
Sbjct  239   KSLAIENSTALSSPFATFSFSASATFEVRGPSKMQVKFTEGAFQPPEIKSTVDLPENVEI  298

Query  499   LGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISR  320
              GQKIDL P +  +  LQD  +S+ ++IS QPPLK  +    ++SWL+ TYLD +LRISR
Sbjct  299   FGQKIDLAPIQQSLKPLQDAVASISRAISGQPPLKLPIPGERSQSWLIITYLDKDLRISR  358

Query  319   GEAGSIFVLIKEDSPLL  269
             G+ G +F+L KE S LL
Sbjct  359   GDGG-LFILAKEGSSLL  374



>ref|XP_012081063.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic 
[Jatropha curcas]
 gb|KDP30383.1| hypothetical protein JCGZ_17112 [Jatropha curcas]
Length=382

 Score =   247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 129/264 (49%), Positives = 170/264 (64%), Gaps = 11/264 (4%)
 Frame = -3

Query  1045  VSDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDV----LKKQLVDSFYGTNRGLSASS  878
             V DDEW EE       A AG          + E D     LK+ LVD+ YGTN G  AS 
Sbjct  125   VRDDEWEEEY------AAAGNGSTSQSTGVVVEKDDNVGDLKRILVDTVYGTNFGFQASP  178

Query  877   ETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEI  698
             E RAEV+EL+ QLEA NPT  P +A  +L+G WVL YT+F  L PLL+ G  PL++VE I
Sbjct  179   EIRAEVLELVNQLEAMNPTQTPVDAAEVLDGNWVLLYTAFSELLPLLALGATPLLKVERI  238

Query  697   CQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVL  518
              Q ID+ + ++ NS   S P AT S S +A FEVRSP R+Q++F+EG +  P++  SI L
Sbjct  239   SQAIDTSNLSIVNSTTLSSPFATFSFSASASFEVRSPSRIQVEFKEGTLQPPEIKSSIDL  298

Query  517   PENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDS  338
             PEN++  GQKI+L+P +  +  LQ+ A+++ ++IS QPPLK  +  S   SWLL TYLD 
Sbjct  299   PENLDIFGQKINLSPVQQSLNPLQEVAANIARTISGQPPLKIPIPGSRTRSWLLITYLDD  358

Query  337   ELRISRGEAGSIFVLIKEDSPLLK  266
             +LRISRG+ G +FVL+KE SPLL 
Sbjct  359   DLRISRGDGG-LFVLVKEGSPLLN  381



>ref|XP_009608239.1| PREDICTED: plastoglobulin-1, chloroplastic isoform X2 [Nicotiana 
tomentosiformis]
Length=341

 Score =   244 bits (624),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/257 (49%), Positives = 175/257 (68%), Gaps = 11/257 (4%)
 Frame = -3

Query  1039  DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEV  860
             +DEWG       + +PA V V   E   L E   LK+  VD+ YGT+ G  ASSE RAE 
Sbjct  95    EDEWGN------NGSPA-VDVSGGEDEKLLE---LKRCFVDTVYGTDFGFRASSEVRAEA  144

Query  859   VELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTIDS  680
             +EL++QLEA NPTPAPTE   LL+G W+L +T+F  L PLL+ G++PLV+VE+I Q ID+
Sbjct  145   LELVSQLEAANPTPAPTECPELLDGNWILVFTAFSELLPLLAAGSIPLVKVEKISQGIDT  204

Query  679   ESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEF  500
              +FT++NS   S P+AT S S  A FEVRSP R+Q++F+EG    P++  +I LPENV+ 
Sbjct  205   SNFTIENSTTLSSPVATLSFSATATFEVRSPSRIQVEFKEGNFKPPEIKSNIELPENVDV  264

Query  499   LGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISR  320
              GQKI L+P +  ++ L++  + + ++IS QPPLK  +     +SWLLTTYLD +LRIS+
Sbjct  265   FGQKISLSPVQQSLSPLENAVAGIARTISGQPPLKIPIPGERTKSWLLTTYLDKDLRISK  324

Query  319   GEAGSIFVLIKEDSPLL  269
             G+ G +FVL+KE S LL
Sbjct  325   GDGG-LFVLVKEGSSLL  340



>ref|XP_011018504.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic-like 
isoform X1 [Populus euphratica]
Length=369

 Score =   244 bits (624),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 128/263 (49%), Positives = 176/263 (67%), Gaps = 6/263 (2%)
 Frame = -3

Query  1045  VSDDEWGEE---KKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSE  875
             ++DDEWGE+        +AAP+  + V  E     E   LK+ LVD+ YGT  G  A+ E
Sbjct  109   INDDEWGEQFVASGNGTAAAPSTSSAVVVEKDRRIED--LKRCLVDTVYGTEFGFRATPE  166

Query  874   TRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEIC  695
              RAEV+EL+ QLEA NPT AP +A  +L+GKWVL YT+F  L PLL+ G  PL++V+ I 
Sbjct  167   IRAEVLELVNQLEAVNPTSAPVDATGVLDGKWVLVYTAFSELLPLLAAGATPLLKVKSIS  226

Query  694   QTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLP  515
             QTIDS + ++ N    S P AT S S +A F+VR+P R+Q++F+EG +  P++  +I LP
Sbjct  227   QTIDSSNLSIVNKTTLSSPFATFSFSASATFDVRTPSRIQVEFKEGTLQPPEINSNIGLP  286

Query  514   ENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSE  335
             ENVE  GQKI+L+P +  +  LQ+ A+++ ++IS QPPLK  +    A SWLL TYLD +
Sbjct  287   ENVELFGQKINLSPVQQSLNPLQEAAANIGRTISGQPPLKVPIPGQQASSWLLITYLDED  346

Query  334   LRISRGEAGSIFVLIKEDSPLLK  266
             LRISRG+ G +FVL KE SPLL+
Sbjct  347   LRISRGDGG-LFVLAKEGSPLLE  368



>ref|XP_011082345.1| PREDICTED: plastoglobulin-1, chloroplastic [Sesamum indicum]
Length=359

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/263 (48%), Positives = 176/263 (67%), Gaps = 9/263 (3%)
 Frame = -3

Query  1042  SDDEWGEEKKE-----PLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASS  878
             ++DEWG  + +     P++     V V ED    L E   LK+ LVD+ YG++ G  AS+
Sbjct  99    NEDEWGGSEVDLGNGSPVADVGVNVGVKEDGDGKLWE---LKRALVDTVYGSDLGFRASA  155

Query  877   ETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEI  698
             E RAE  EL++QLEA NPTPAPTE   LL+G WVL YT+F  L PLL+ G++PLV+VE+I
Sbjct  156   EVRAEAFELVSQLEAANPTPAPTENPELLDGNWVLVYTAFSELLPLLAVGSIPLVKVEKI  215

Query  697   CQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVL  518
              Q+ID+ S T++NS+  S P++T S S +A FEVRSP R+Q++F+EG    P++  SI L
Sbjct  216   GQSIDTSSLTIENSITLSSPVSTLSFSASASFEVRSPTRIQVEFKEGTFKPPEIKSSIDL  275

Query  517   PENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDS  338
             PE++   GQ I+L+  +  ++ LQ+    + ++IS QPPLK  +     +SWLL TYLD 
Sbjct  276   PESINVFGQNINLSSIQQSLSPLQNAVEGIARTISGQPPLKIPIPGERTKSWLLITYLDK  335

Query  337   ELRISRGEAGSIFVLIKEDSPLL  269
             +LRISRG+ G +FVL+KE S LL
Sbjct  336   DLRISRGDGG-LFVLVKEGSALL  357



>ref|XP_002297709.2| hypothetical protein POPTR_0001s02040g [Populus trichocarpa]
 gb|EEE82514.2| hypothetical protein POPTR_0001s02040g [Populus trichocarpa]
Length=349

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 129/277 (47%), Positives = 177/277 (64%), Gaps = 27/277 (10%)
 Frame = -3

Query  1096  FPNRGLANPNRKFVVRAVSDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVD  917
             +P    ++P R       +DDEWGE+ K+           +ED          LK+ LVD
Sbjct  99    YPKDADSDPTR-------NDDEWGEQFKD---------GRIED----------LKRCLVD  132

Query  916   SFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLL  737
             + YGT  G  A+ E RAEV+EL+ QLEA NPT AP +   +L+GKWVL YT+F  L PLL
Sbjct  133   TVYGTEFGFRATPEIRAEVLELVNQLEAVNPTSAPVDTTGVLDGKWVLVYTAFSELLPLL  192

Query  736   SRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEG  557
             + G  PL++V+ I QTIDS + ++ NS   S P AT S S +A FEVR+P R+Q++F+EG
Sbjct  193   AAGATPLLKVKSISQTIDSSNLSIVNSTTLSSPFATFSFSASATFEVRTPSRIQVEFKEG  252

Query  556   IIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANS  377
              +  P++  +I LPENVE  GQKI+L+P +  +  LQ+ A+++ ++IS QPPLK  +   
Sbjct  253   TLQPPEINSNIDLPENVELFGQKINLSPVQQSLNPLQEAAANIGRTISGQPPLKVPIPGK  312

Query  376   NAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLK  266
              A SWLL TYLD +LRISRG+ G +FVL KE SPLL+
Sbjct  313   QASSWLLITYLDEDLRISRGDGG-LFVLAKEGSPLLE  348



>ref|XP_010919972.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic 
[Elaeis guineensis]
Length=402

 Score =   244 bits (622),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 121/261 (46%), Positives = 175/261 (67%), Gaps = 9/261 (3%)
 Frame = -3

Query  1045  VSDDEWGEEKKEPLSAAPAGVAVVEDE--PAALTETDVLKKQLVDSFYGTNRGLSASSET  872
             + +DEWG+E+       P G+  +     P    +   LK+ LVDS YGT+ GL AS+E 
Sbjct  145   MDEDEWGKER------GPEGMGYISGNGTPVPPDKRGDLKRCLVDSLYGTDFGLRASAEV  198

Query  871   RAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQ  692
             RAE+VEL+ QLE +NPTPAPT++  LL+G W+L YT+F  L PLL+ GT PL+++++I Q
Sbjct  199   RAEIVELVNQLETENPTPAPTKSPELLDGNWILLYTAFSELLPLLAVGTTPLLKIKKISQ  258

Query  691   TIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPE  512
              IDS++ T+ N+   S P AT S S  A FEV +P R+Q++F+EG    P+++ ++ LPE
Sbjct  259   AIDSKNMTIVNATTLSSPFATFSFSATASFEVLNPSRIQVQFKEGTFQPPEISSTVDLPE  318

Query  511   NVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSEL  332
              V   GQ IDL P +  +  +Q+  +++ ++IS QPPLK  +  ++A+SWLLTTYLD + 
Sbjct  319   KVNIFGQSIDLKPVQQALNPIQEAIANITRAISGQPPLKVPVPGNSAQSWLLTTYLDQDF  378

Query  331   RISRGEAGSIFVLIKEDSPLL  269
             RISRG+ G +FVL KE SPLL
Sbjct  379   RISRGDGG-LFVLAKEGSPLL  398



>ref|XP_004300209.1| PREDICTED: plastoglobulin-1, chloroplastic [Fragaria vesca subsp. 
vesca]
Length=352

 Score =   239 bits (611),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 173/264 (66%), Gaps = 5/264 (2%)
 Frame = -3

Query  1045  VSDDEWG--EEKKEPLSAAPAGVAVVEDEPAALTETDV--LKKQLVDSFYGTNRGLSASS  878
             V++DEWG  +E  E  +  PA             ++ +  LK+ LVD+ YGT  G  A S
Sbjct  89    VNEDEWGGGDEYVEIGNGTPAKAEAESAVEVEEVDSKLTELKRCLVDTLYGTELGFRAGS  148

Query  877   ETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEI  698
             E RAEVVEL+ QLEA NPTPAPTE   LL+G WVL YT+   L PLL+ G+ P ++V++I
Sbjct  149   EVRAEVVELVNQLEAANPTPAPTENPGLLDGNWVLLYTASSELLPLLAAGSTPFLKVDKI  208

Query  697   CQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVL  518
              Q+ID+ S T+ NS+  SGP AT S S +A FEVRSP R+Q++F+EG    P +  SI L
Sbjct  209   NQSIDTSSLTILNSITLSGPFATFSFSASASFEVRSPSRIQVQFKEGTFQPPDIKSSIDL  268

Query  517   PENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDS  338
             P+ VE  GQ+I+L+P +  ++ LQ+ A+S+ ++IS Q  LK  +     +SWLLTTYLD 
Sbjct  269   PQEVEIFGQRINLSPVQQALSPLQEVAASISRTISGQQSLKVPIPGERTQSWLLTTYLDE  328

Query  337   ELRISRGEAGSIFVLIKEDSPLLK  266
             + RISRG+ G +FVL KE SPLL+
Sbjct  329   DFRISRGDGG-LFVLAKEGSPLLE  351



>ref|XP_009766235.1| PREDICTED: plastoglobulin-1, chloroplastic [Nicotiana sylvestris]
 ref|XP_009766236.1| PREDICTED: plastoglobulin-1, chloroplastic [Nicotiana sylvestris]
 ref|XP_009766237.1| PREDICTED: plastoglobulin-1, chloroplastic [Nicotiana sylvestris]
Length=342

 Score =   239 bits (610),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 127/257 (49%), Positives = 172/257 (67%), Gaps = 11/257 (4%)
 Frame = -3

Query  1039  DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEV  860
             +DEWG       + +PA V V   E   L E   LK+  VD+ YGT+ G  ASSE RAE 
Sbjct  96    EDEWGN------NGSPA-VDVSGGEDEKLLE---LKRCFVDTVYGTDFGFRASSEIRAEA  145

Query  859   VELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTIDS  680
             +EL++QLEA NPTPAPTE   LL+G W+L +T+F  L PLL+ G++PLV+VE+I Q ID+
Sbjct  146   LELVSQLEAANPTPAPTECPELLDGNWILVFTAFSELLPLLAAGSIPLVKVEKISQGIDT  205

Query  679   ESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEF  500
              +FT++NS   S  +AT S S  A FEVRSP R+Q++F+EG    P++  +I LPENV+ 
Sbjct  206   SNFTIENSTALSSLVATLSFSATATFEVRSPSRIQVEFKEGNFKPPEIKSNIELPENVDV  265

Query  499   LGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISR  320
              GQKI L+P +  +  L+   + + ++IS QPPLK  +     +SWLLTTYLD +LRIS+
Sbjct  266   FGQKISLSPMQQSLGPLEYAVAGIARTISGQPPLKIPIPGERTKSWLLTTYLDKDLRISK  325

Query  319   GEAGSIFVLIKEDSPLL  269
             G+ G IFVL+KE S LL
Sbjct  326   GDGG-IFVLVKEGSSLL  341



>gb|EMS56479.1| putative plastid-lipid-associated protein 2, chloroplastic [Triticum 
urartu]
Length=220

 Score =   234 bits (598),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 136/169 (80%), Gaps = 1/169 (1%)
 Frame = -3

Query  775  LAYTSFIGLFPLLSRGTL-PLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFE  599
            L YTSF  LFPLL  G L  LV+V+EI QTIDSE+F VQN + FSGPLA+TS+STNAKFE
Sbjct  50   LWYTSFSQLFPLLGSGRLQALVKVDEISQTIDSENFAVQNCIKFSGPLASTSVSTNAKFE  109

Query  598  VRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKS  419
            +RSPKRVQIKFEEGIIGTPQLTDSIVLPE  EF GQ IDL+P  G+ TS+++ ASSV K+
Sbjct  110  IRSPKRVQIKFEEGIIGTPQLTDSIVLPEKFEFFGQNIDLSPLSGIFTSIENAASSVAKT  169

Query  418  ISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPL  272
            IS QPPLK    + +A SWLLTTYLD+ELRISRG+  SIFVL KE S L
Sbjct  170  ISGQPPLKIPFRSESAGSWLLTTYLDAELRISRGDGSSIFVLFKEGSSL  218



>ref|XP_002304354.1| hypothetical protein POPTR_0003s09460g [Populus trichocarpa]
 gb|EEE79333.1| hypothetical protein POPTR_0003s09460g [Populus trichocarpa]
Length=373

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/265 (47%), Positives = 176/265 (66%), Gaps = 12/265 (5%)
 Frame = -3

Query  1042  SDDEWG------EEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSAS  881
             +DDEWG      E       ++ + V V +DE       + LK+ LVD+ YGT+ G  AS
Sbjct  114   NDDEWGGEFVAVENGNAAAPSSSSAVVVEKDE-----RVEELKRGLVDTVYGTDFGFRAS  168

Query  880   SETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEE  701
              E RAE +EL+ QLE  NPTPAP +A  +L+GKWVL YT+F  L PLL+ G  P ++V+ 
Sbjct  169   PEIRAEALELVNQLEVVNPTPAPVDATGVLDGKWVLVYTAFSELLPLLAAGATPFLKVKS  228

Query  700   ICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIV  521
             I QTID+ S ++ NS   SGP AT S S +A FE R+P R+Q++F+EG++  PQ+  S+ 
Sbjct  229   ISQTIDASSLSIVNSTTLSGPFATFSFSASATFEFRTPSRIQVEFKEGVLQPPQINSSVE  288

Query  520   LPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLD  341
             LPENV+  GQKI+L+P +  +  LQ+ A+++ ++IS QPPLK  +  + A +WLL TYLD
Sbjct  289   LPENVDLFGQKINLSPIQQSLGPLQEAAANIGRTISGQPPLKVPIPGNRASTWLLITYLD  348

Query  340   SELRISRGEAGSIFVLIKEDSPLLK  266
              +L+ISRG+ G +FVL KE SPLL+
Sbjct  349   EDLQISRGDGG-LFVLAKEGSPLLE  372



>ref|XP_008800089.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic 
isoform X1 [Phoenix dactylifera]
Length=402

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/259 (47%), Positives = 174/259 (67%), Gaps = 5/259 (2%)
 Frame = -3

Query  1045  VSDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRA  866
             + +DEWG   KEP S    G       P    +   LK+ LVD+ YGT+ GL AS+E RA
Sbjct  145   MDEDEWG---KEPGSGG-MGYISGNGSPVPSDKLGDLKRCLVDTLYGTDFGLRASAEVRA  200

Query  865   EVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTI  686
             E++EL+ QLEA+NPT APT +  LL+G W+L YT+F  L PLL+ G  PL+++++I Q I
Sbjct  201   EILELVNQLEAENPTRAPTTSPELLDGNWILLYTAFSELLPLLAVGATPLLKIKKISQAI  260

Query  685   DSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENV  506
             D+++ T+ N+ + S P AT S S +A FEVRSP R+Q++F+EG    P+++ ++ LPE V
Sbjct  261   DTKNMTIVNATMLSSPFATFSFSASASFEVRSPSRIQVQFKEGTFQPPEISSTVDLPEKV  320

Query  505   EFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRI  326
                GQ IDL P +  +  +Q+  +++ ++IS QPPLK  L  ++A+SWLLTTYLD + RI
Sbjct  321   NIFGQLIDLKPVQQTLNPVQENIANITRAISGQPPLKVPLPGNSAQSWLLTTYLDQDFRI  380

Query  325   SRGEAGSIFVLIKEDSPLL  269
             SRG+ G +FVL KE SPLL
Sbjct  381   SRGDGG-LFVLAKEGSPLL  398



>gb|EMT11511.1| Putative plastid-lipid-associated protein 2, chloroplastic [Aegilops 
tauschii]
Length=183

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 134/167 (80%), Gaps = 1/167 (1%)
 Frame = -3

Query  769  YTSFIGLFPLLSRGTL-PLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVR  593
            YTSF  LFPLL  G L  LV+V+EI QTIDSE+F VQN + FSGPLA+TS+STNAKFE+R
Sbjct  15   YTSFSQLFPLLGSGRLQALVKVDEISQTIDSENFAVQNCIKFSGPLASTSVSTNAKFEIR  74

Query  592  SPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSIS  413
            SPKRVQIKFEEGIIGTPQLTDSIVLPE  E  GQ IDL+P  G+ TS+++ ASSV K+IS
Sbjct  75   SPKRVQIKFEEGIIGTPQLTDSIVLPEKFELFGQNIDLSPLSGIFTSIENAASSVAKTIS  134

Query  412  SQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPL  272
             QPPLK    + +A SWLLTTYLD+ELRISRG+  SIFVL KE S L
Sbjct  135  GQPPLKIPFRSESAGSWLLTTYLDAELRISRGDGSSIFVLFKEGSAL  181



>ref|XP_010053632.1| PREDICTED: plastoglobulin-1, chloroplastic [Eucalyptus grandis]
 gb|KCW77976.1| hypothetical protein EUGRSUZ_D02221 [Eucalyptus grandis]
Length=360

 Score =   237 bits (605),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 122/264 (46%), Positives = 171/264 (65%), Gaps = 7/264 (3%)
 Frame = -3

Query  1039  DDEWGE----EKKEPLSAAPA--GVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASS  878
             DDEWG     E+   ++  P+  G A        + +   LK+ LVD+ YGT+ G  +  
Sbjct  98    DDEWGGAGGVEEVAGVNGTPSAQGEAAAAAVEEEVDKVGDLKRALVDTVYGTDFGFRSGQ  157

Query  877   ETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEI  698
             E RAEV+EL+ QLEA NPTPAP +A  LL+G WVL YT+   L PLL+ G+LPL++VE+I
Sbjct  158   EVRAEVLELVNQLEAANPTPAPVDAAGLLDGNWVLVYTASSELLPLLAAGSLPLLKVEKI  217

Query  697   CQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVL  518
              Q++D+ + T+ NS   S P AT S S +A FE+RSP R+Q++F+EG    P++  +I L
Sbjct  218   SQSVDTSNLTIVNSTTLSSPFATLSFSASAAFEIRSPSRIQVEFKEGTFQPPEIKPTIDL  277

Query  517   PENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDS  338
             PE+V   GQ I+L P +  I+ LQ+  +S+ ++IS QPPLK  +      SWLL TYLD 
Sbjct  278   PESVNLFGQNINLMPVQQSISPLQEAVASLSRAISGQPPLKLPIPGERTRSWLLITYLDK  337

Query  337   ELRISRGEAGSIFVLIKEDSPLLK  266
             ++RISRG+ G +FVL+KE SPLL 
Sbjct  338   DMRISRGDGG-LFVLVKEGSPLLN  360



>gb|ABC96720.1| plastid fibrillin 2 [Coffea canephora]
Length=229

 Score =   233 bits (594),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 120/223 (54%), Positives = 162/223 (73%), Gaps = 1/223 (0%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSF  758
            LK+ LVD+ YGT+ G  ASSE RAE +ELI QLEA NP PAPTE+  LL+G WVL +T+F
Sbjct  6    LKRALVDTVYGTDFGFRASSELRAEAIELIAQLEAANPNPAPTESPKLLDGNWVLLFTAF  65

Query  757  IGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRV  578
              L PLL+ G+LPLV+VE+I Q+++S S T+ NS   SGP+A+ S S +A FEVRSP R+
Sbjct  66   SELLPLLATGSLPLVKVEKISQSVNSSSLTIDNSTTISGPVASLSFSASAAFEVRSPSRI  125

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPL  398
            Q++F+EG +  P++  SI LPE+V+  GQKI+L+P +  +  LQ+  + + ++IS QPPL
Sbjct  126  QVQFKEGTLNPPEIKSSIDLPEDVDIFGQKINLSPVQQSLNPLQNAVAGIGRAISGQPPL  185

Query  397  KFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
            K  +    A+SWLL TYLD +LRISRG+ G +FVL KE S LL
Sbjct  186  KIPIPGERAKSWLLITYLDKDLRISRGDGG-LFVLAKEGSTLL  227



>ref|XP_004245973.1| PREDICTED: plastoglobulin-1, chloroplastic [Solanum lycopersicum]
Length=344

 Score =   236 bits (602),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 122/257 (47%), Positives = 172/257 (67%), Gaps = 12/257 (5%)
 Frame = -3

Query  1039  DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEV  860
             DDEWG       + +P GV V  +E   L E   LK+ LVD+ YGT+ G  ASSE RAE 
Sbjct  99    DDEWG-------NGSP-GVDVSGEEDEKLLE---LKRCLVDTVYGTDFGFRASSEIRAEA  147

Query  859   VELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTIDS  680
             +E + QLEA NP+PAPTE+  LL+G W+L +T+F  L PLL+ G +PL++VE+I Q +++
Sbjct  148   LEFVCQLEAANPSPAPTESPELLDGNWILVFTAFSELLPLLAVGNIPLLKVEKISQDVNT  207

Query  679   ESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEF  500
              S T++N+   S P+AT S S  A FEVRSP R+Q++F+EG    P++  +I LPE V+ 
Sbjct  208   NSSTIENATTLSSPVATLSFSATATFEVRSPSRIQVEFKEGNFKPPEIKSNINLPETVDL  267

Query  499   LGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISR  320
              GQKI L+P +  +  L++  + + ++IS QPPLK  +     +SWLLTTYLD ++RISR
Sbjct  268   FGQKISLSPVQQSLGPLENAVAGIARTISGQPPLKIPIPGGRTKSWLLTTYLDKDMRISR  327

Query  319   GEAGSIFVLIKEDSPLL  269
             G+ G +FVL+KE S LL
Sbjct  328   GDGG-LFVLVKEGSSLL  343



>emb|CDP18539.1| unnamed protein product [Coffea canephora]
Length=370

 Score =   237 bits (604),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 131/260 (50%), Positives = 177/260 (68%), Gaps = 7/260 (3%)
 Frame = -3

Query  1042  SDDEWGEE--KKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETR  869
             +DDEWG    K +       GV V + E   L +   LK+ LVD+ YGT+ G  ASSE R
Sbjct  114   ADDEWGGVGVKDDRYGNGSPGVEV-DGESQKLRD---LKRALVDTVYGTDFGFRASSELR  169

Query  868   AEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQT  689
             AE +ELI QLEA NP PAPTE+  LL+G WVL +T+F  L PLL+ G+LPLV+VE+I Q+
Sbjct  170   AEAIELIAQLEAANPNPAPTESPELLDGNWVLLFTAFSELLPLLATGSLPLVKVEKISQS  229

Query  688   IDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPEN  509
             ++S S T+ NS   SGP+A+ S S +A FEVRSP R+Q++F+EG +  P++  SI LPE+
Sbjct  230   VNSSSLTIDNSTTISGPVASLSFSASAAFEVRSPSRIQVQFKEGTLNPPEIKSSIDLPED  289

Query  508   VEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELR  329
             V+  GQKI+L+P +  +  LQ+  + + ++IS QPPLK  +    A+SWLL TYLD +LR
Sbjct  290   VDIFGQKINLSPVQQSLNPLQNAVAGIGRAISGQPPLKIPIPGERAKSWLLITYLDKDLR  349

Query  328   ISRGEAGSIFVLIKEDSPLL  269
             ISRG+ G +FVL KE S LL
Sbjct  350   ISRGDGG-LFVLAKEGSTLL  368



>ref|XP_010096934.1| putative plastid-lipid-associated protein 3 [Morus notabilis]
 gb|EXB66511.1| putative plastid-lipid-associated protein 3 [Morus notabilis]
Length=368

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/223 (51%), Positives = 155/223 (70%), Gaps = 1/223 (0%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSF  758
            LK+ LVDS YGT  G  A  E RAE++EL+ QLEA NPTPAPT+AL LL G WVL YT F
Sbjct  145  LKRCLVDSIYGTELGFRARLEERAEILELVNQLEALNPTPAPTQALELLGGNWVLLYTGF  204

Query  757  IGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRV  578
              L PLL+ G+ PL++V++ICQ+ID+ + T+ NS   S P++T S S  A FEVRSP R+
Sbjct  205  SELLPLLAAGSTPLLKVDKICQSIDTSNLTIVNSTTLSSPVSTFSFSATATFEVRSPFRI  264

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPL  398
            Q++F+EG    P++  S+ LP  V+  GQKI L+P +  +  +Q+ A+++ ++IS QPPL
Sbjct  265  QVQFKEGTFQAPEIKSSVDLPREVDIFGQKISLSPLQQTLNPIQEAAANISRAISGQPPL  324

Query  397  KFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
            +  +     +SWLL TYLD + RISRG+ G +FVL KE SPLL
Sbjct  325  RLPIPGERTQSWLLITYLDEDFRISRGDGG-LFVLAKEGSPLL  366



>ref|XP_009608213.1| PREDICTED: plastoglobulin-1, chloroplastic isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009608224.1| PREDICTED: plastoglobulin-1, chloroplastic isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009608233.1| PREDICTED: plastoglobulin-1, chloroplastic isoform X1 [Nicotiana 
tomentosiformis]
Length=354

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 127/270 (47%), Positives = 175/270 (65%), Gaps = 24/270 (9%)
 Frame = -3

Query  1039  DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEV  860
             +DEWG       + +PA V V   E   L E   LK+  VD+ YGT+ G  ASSE RAE 
Sbjct  95    EDEWGN------NGSPA-VDVSGGEDEKLLE---LKRCFVDTVYGTDFGFRASSEVRAEA  144

Query  859   VELITQLEAKNPTPAPTEALTLLNGKWVL-------------AYTSFIGLFPLLSRGTLP  719
             +EL++QLEA NPTPAPTE   LL+G W+L              +T+F  L PLL+ G++P
Sbjct  145   LELVSQLEAANPTPAPTECPELLDGNWILVGSIGNNLSTPWGGFTAFSELLPLLAAGSIP  204

Query  718   LVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQ  539
             LV+VE+I Q ID+ +FT++NS   S P+AT S S  A FEVRSP R+Q++F+EG    P+
Sbjct  205   LVKVEKISQGIDTSNFTIENSTTLSSPVATLSFSATATFEVRSPSRIQVEFKEGNFKPPE  264

Query  538   LTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWL  359
             +  +I LPENV+  GQKI L+P +  ++ L++  + + ++IS QPPLK  +     +SWL
Sbjct  265   IKSNIELPENVDVFGQKISLSPVQQSLSPLENAVAGIARTISGQPPLKIPIPGERTKSWL  324

Query  358   LTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
             LTTYLD +LRIS+G+ G +FVL+KE S LL
Sbjct  325   LTTYLDKDLRISKGDGG-LFVLVKEGSSLL  353



>ref|XP_011028127.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic 
[Populus euphratica]
Length=373

 Score =   234 bits (598),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 122/265 (46%), Positives = 175/265 (66%), Gaps = 12/265 (5%)
 Frame = -3

Query  1042  SDDEWG------EEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSAS  881
             +DDEWG      E       ++ + V V +DE       + LK+ LVD+ YGT+ G  AS
Sbjct  114   NDDEWGGEFVAVENGNAAAPSSSSAVVVEKDE-----RVEELKRSLVDTVYGTDFGFRAS  168

Query  880   SETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEE  701
              E RAE +EL+ QLE  NPTPAP +A  +L+GKWVL YT+F  L PLL+ G  PL++V+ 
Sbjct  169   PEIRAEALELVNQLEVVNPTPAPVDATGVLDGKWVLVYTAFSELLPLLAAGATPLLKVKS  228

Query  700   ICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIV  521
             I QTID+ S ++ NS   SGP AT S S +A FE R+P R++++F+EG++  PQ+  S+ 
Sbjct  229   ISQTIDASSLSIVNSTTLSGPFATFSFSASATFEFRTPSRIRVEFKEGVLQPPQINSSVE  288

Query  520   LPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLD  341
             LPEN +  GQKI+L+P +  +  LQ+ A+++ ++IS QPPLK  +  +   +WLL TYLD
Sbjct  289   LPENFDLFGQKINLSPIQQSLGPLQEAAANIGRTISGQPPLKVPIPGNRVSTWLLITYLD  348

Query  340   SELRISRGEAGSIFVLIKEDSPLLK  266
              +L+ISRG+ G +F+L KE SPLL+
Sbjct  349   EDLQISRGDGG-LFILAKEGSPLLE  372



>ref|XP_006352897.1| PREDICTED: plastoglobulin-1, chloroplastic-like [Solanum tuberosum]
Length=411

 Score =   234 bits (597),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/259 (48%), Positives = 175/259 (68%), Gaps = 16/259 (6%)
 Frame = -3

Query  1039  DDEWGEEKKEPLSAAPAGV--AVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRA  866
             +DEWG       + +P GV  +V EDE   L E   LK+ LVD+ YGT+ G  ASSE RA
Sbjct  166   EDEWG-------NGSP-GVDGSVGEDE--KLLE---LKRCLVDTVYGTDFGFRASSEIRA  212

Query  865   EVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTI  686
             E +E ++QLEA NPTPAPTE+  LL+G W+L +T+F  L PLL+ G +PL++VE+I Q +
Sbjct  213   EALEFVSQLEAANPTPAPTESPELLDGNWLLVFTAFSELLPLLAVGNIPLLKVEKISQDV  272

Query  685   DSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENV  506
             ++ S T++N+   S P+AT S S  A FEVRSP R+Q++F+EG    P++  +I LPE V
Sbjct  273   NTNSLTIENATTLSSPVATLSFSATATFEVRSPSRIQVEFKEGNFKPPEIKSNIDLPETV  332

Query  505   EFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRI  326
             +  GQKI L+P +  +  L++  + + ++IS QPPLK  +     +SWLLTTYLD ++RI
Sbjct  333   DLFGQKISLSPVQQSLGPLENAVAGIARTISGQPPLKIPIPGERTKSWLLTTYLDKDMRI  392

Query  325   SRGEAGSIFVLIKEDSPLL  269
             SRG+ G +FVL+KE S LL
Sbjct  393   SRGDGG-LFVLVKEGSSLL  410



>ref|XP_006662632.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic-like 
[Oryza brachyantha]
Length=330

 Score =   231 bits (589),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 156/224 (70%), Gaps = 2/224 (1%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSF  758
            LK+ LVD+ YG++ G  AS+E R EV+EL+TQLEA NPTPAP +A  LL+G W+L YT++
Sbjct  105  LKRCLVDTVYGSDLGFRASAEVRGEVLELVTQLEAANPTPAPVQATDLLDGNWILIYTAY  164

Query  757  IGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRV  578
              L P+L+ G  PL +V+EI Q +D++S T+ N+   S P A+ S S  A F+V+SP RV
Sbjct  165  SELLPILAVGAAPLFKVDEISQEVDTKSMTIVNASTISSPFASLSFSATASFDVQSPSRV  224

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPL  398
            Q++F+EG    P+++ S+ LP  V+  GQKI L P + ++  LQ   +S+  SIS QPPL
Sbjct  225  QVQFKEGSFQPPKISSSVDLPAEVDIFGQKISLGPVQQVLNPLQQAFASIAGSISGQPPL  284

Query  397  KFSL-ANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
            K  +  N+   SWLLTTYLD +LRISRG+ G +F+L+KE SPLL
Sbjct  285  KLQIPGNNRGRSWLLTTYLDKDLRISRGDGG-LFILVKEGSPLL  327



>ref|XP_007209304.1| hypothetical protein PRUPE_ppa007851mg [Prunus persica]
 gb|EMJ10503.1| hypothetical protein PRUPE_ppa007851mg [Prunus persica]
Length=353

 Score =   231 bits (589),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 123/261 (47%), Positives = 171/261 (66%), Gaps = 5/261 (2%)
 Frame = -3

Query  1042  SDDEWG---EEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSET  872
             ++DEWG   ++  E  + +PA  A  E E     +   LK+ L D+ YGT  G  A SE 
Sbjct  93    NEDEWGGGGDDVVEIGNGSPAK-AEAEIEEKVDGKFSELKRALADTVYGTEFGFRAGSEV  151

Query  871   RAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQ  692
             RAEV+EL+ QLEA NP PAPT    LL+G WVL YT+   L PLL+ G+ PL++V +I Q
Sbjct  152   RAEVLELVNQLEAVNPNPAPTANPGLLDGNWVLLYTASSELLPLLAAGSTPLLKVSKIGQ  211

Query  691   TIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPE  512
             +ID+ S T+ NS   SGP AT S S +A FEVRSP R+Q++F+EG +  P++  S+ LP+
Sbjct  212   SIDTSSLTIVNSTTLSGPFATFSFSASASFEVRSPSRIQVEFKEGSVLPPKIKSSVDLPQ  271

Query  511   NVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSEL  332
              V+  GQKI+L+P +  +  LQ+  +S+ ++IS QPP K S+     +SWLL TYLD +L
Sbjct  272   EVDIFGQKINLSPVQRTLNPLQEAVASISRAISGQPPFKVSIPGERTKSWLLITYLDEDL  331

Query  331   RISRGEAGSIFVLIKEDSPLL  269
             RISRG+ G +FVL +E SPL+
Sbjct  332   RISRGDGG-LFVLAREGSPLI  351



>ref|XP_008238187.1| PREDICTED: plastoglobulin-1, chloroplastic [Prunus mume]
Length=353

 Score =   231 bits (588),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/261 (47%), Positives = 171/261 (66%), Gaps = 5/261 (2%)
 Frame = -3

Query  1042  SDDEWG---EEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSET  872
             ++DEWG   ++  E  + +PA  A  E E     +   LK+ L D+ YGT  G  A SE 
Sbjct  93    NEDEWGGGGDDVVEIGNGSPAK-AEAEIEEKVDGKFSELKRALADTVYGTEFGFRAGSEV  151

Query  871   RAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQ  692
             RAEV+EL+ QLEA NP PAPT    LL+G WVL YT+   L PLL+ G+ PL++V +I Q
Sbjct  152   RAEVLELVNQLEAVNPNPAPTANPGLLDGNWVLLYTASSELLPLLAAGSTPLLKVSKIGQ  211

Query  691   TIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPE  512
             +ID+ S T+ NS   SGP AT S S +A FEVRSP R+Q++F+EG +  P++  S+ LP+
Sbjct  212   SIDTSSLTIVNSTTLSGPFATFSFSASASFEVRSPSRIQVEFKEGSVLPPKIKSSVDLPQ  271

Query  511   NVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSEL  332
              V+  GQKI+L+P +  +  LQ+  +S+ ++IS QPP K S+     +SWLL TYLD +L
Sbjct  272   EVDIFGQKINLSPVQRTLNPLQEAVASISRAISGQPPFKVSIPGERTKSWLLITYLDEDL  331

Query  331   RISRGEAGSIFVLIKEDSPLL  269
             RISRG+ G +FVL +E SPL+
Sbjct  332   RISRGDGG-LFVLAREGSPLI  351



>ref|XP_009619935.1| PREDICTED: plastoglobulin-1, chloroplastic-like [Nicotiana tomentosiformis]
Length=427

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/223 (50%), Positives = 160/223 (72%), Gaps = 1/223 (0%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSF  758
            LK+ L+D+ YGT  GL ASSE RAE +EL++QLEA NPTP+P E+  LL+G W+L +T+F
Sbjct  204  LKRCLMDTVYGTEFGLRASSEMRAEALELVSQLEAANPTPSPVESPELLDGNWILVFTAF  263

Query  757  IGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRV  578
              L PLL+ GT+P ++VE+I QTI + S T+++S   S P+AT+S S  A FEVRSP R+
Sbjct  264  SELLPLLAVGTIPFLKVEKISQTISTSSLTIESSTTLSSPVATSSFSATAAFEVRSPSRI  323

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPL  398
            Q++F+EG    P++   I LPENV+  GQKI L+P +  +  L++  +++ ++IS  PPL
Sbjct  324  QVQFKEGTFNPPEVKSKINLPENVDIFGQKISLSPVQQSLGPLENAVAAIARAISGLPPL  383

Query  397  KFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
            K  +     +SWL+TTYLD +LRISRG+ G +FVL+KE+S LL
Sbjct  384  KIPIPGERTKSWLITTYLDKDLRISRGDGG-LFVLVKEESSLL  425



>ref|XP_010509611.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic 
[Camelina sativa]
Length=375

 Score =   229 bits (585),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 123/260 (47%), Positives = 163/260 (63%), Gaps = 6/260 (2%)
 Frame = -3

Query  1045  VSDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRA  866
              ++DEW EE      A     + V D+      T  LK+ L D+ YGT  G  A SE RA
Sbjct  121   TNEDEWEEEIVGGAEADAGNGSAVSDD-----NTWELKRCLADTVYGTELGFRAGSEVRA  175

Query  865   EVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTI  686
             EV+EL+ QLEA NPTPAP E   LL+G WVL YT+F  L PLL+ G+ PL++V+ I Q+I
Sbjct  176   EVLELVNQLEALNPTPAPLENPELLDGNWVLLYTAFSELIPLLAAGSTPLLKVKSISQSI  235

Query  685   DSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENV  506
             DS + T+ NS   S P A  S S  A FEVRSP RV++ F+EG +  P++  S+ LPE+V
Sbjct  236   DSNNLTIDNSTTLSSPFADFSFSATASFEVRSPSRVEVSFKEGTLKPPEIKSSVDLPESV  295

Query  505   EFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRI  326
                GQ+I L   K  +  LQD A+++ +++S QPPLK     +   SWLLTTYLD +LRI
Sbjct  296   GVFGQQISLALLKQSLNPLQDVAANISRALSGQPPLKLPFPGNRGSSWLLTTYLDKDLRI  355

Query  325   SRGEAGSIFVLIKEDSPLLK  266
             SRG+ G +FVL +E S LL+
Sbjct  356   SRGDGG-LFVLAREGSSLLE  374



>ref|XP_010516724.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic 
[Camelina sativa]
Length=378

 Score =   229 bits (585),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 123/259 (47%), Positives = 164/259 (63%), Gaps = 6/259 (2%)
 Frame = -3

Query  1042  SDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAE  863
             ++DEW EE      A     + V D+      T  LK+ L D+ YGT  G  A SE RAE
Sbjct  125   NEDEWEEEIVGGAEADAGNGSAVSDD-----NTWELKRCLADTVYGTELGFRAGSEVRAE  179

Query  862   VVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTID  683
             V+EL+ QLEA NPTPAP E   LL+G W L YT+F  L PLL+ G+ PL++V+ I Q+ID
Sbjct  180   VLELVNQLEALNPTPAPLENPELLDGNWFLLYTAFSELIPLLAAGSTPLLKVKSISQSID  239

Query  682   SESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVE  503
             S + T+ NS   S P A  S S  A FEVRSP RV++ F+EG +  P++  S+ LPE+V 
Sbjct  240   SNNLTIDNSTTLSSPFADFSFSATASFEVRSPSRVEVSFKEGTLKPPEIKSSVDLPESVG  299

Query  502   FLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRIS  323
               GQ+I L   K  +  LQD A+++ +++S QPPLK  +  + A SWLLTTYLD +LRIS
Sbjct  300   VFGQQISLALLKQSLNPLQDVAANISRALSGQPPLKLPIPGNRASSWLLTTYLDKDLRIS  359

Query  322   RGEAGSIFVLIKEDSPLLK  266
             RG+ G +FVL +E S LL+
Sbjct  360   RGDGG-LFVLAREGSSLLE  377



>ref|XP_002518975.1| Plastid lipid-associated protein 3, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF43508.1| Plastid lipid-associated protein 3, chloroplast precursor, putative 
[Ricinus communis]
Length=367

 Score =   229 bits (584),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 115/254 (45%), Positives = 167/254 (66%), Gaps = 6/254 (2%)
 Frame = -3

Query  1030  WGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEVVEL  851
             WG E +   + +  G+ V +D+       + LK+ LVD+ YGT  G  AS E R EV+EL
Sbjct  119   WGAEYESGGNGSAGGLVVEKDD-----RIEDLKRCLVDTVYGTKFGFQASPEIRGEVLEL  173

Query  850   ITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTIDSESF  671
             + QLEA NPTPAP ++  +L+G W+L YT+F  L PLL+ G++PL++VE+I Q +D+ + 
Sbjct  174   VNQLEALNPTPAPVDSSQILDGTWILLYTAFSELLPLLAVGSVPLLKVEKISQEVDTSNL  233

Query  670   TVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQ  491
             ++ NS   S P AT S S +A FEVRS  R+Q++F EG +  P++   I LP NV+  GQ
Sbjct  234   SIVNSTTLSSPFATFSFSASASFEVRSSSRIQVEFREGSLQPPEINSKIDLPVNVDVFGQ  293

Query  490   KIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEA  311
              I+L+P +  +  LQ+  +++ ++IS QPPLK  +    + SWLL TYLD +LRISRG+ 
Sbjct  294   NINLSPLQQSLNPLQELVANISRTISGQPPLKVPIPGDRSRSWLLITYLDEDLRISRGDG  353

Query  310   GSIFVLIKEDSPLL  269
             G +FVL+KE SPLL
Sbjct  354   G-LFVLVKEGSPLL  366



>ref|XP_010518909.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic-like 
[Tarenaya hassleriana]
Length=371

 Score =   229 bits (584),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 119/258 (46%), Positives = 164/258 (64%), Gaps = 7/258 (3%)
 Frame = -3

Query  1039  DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEV  860
             +DEW EE+           + V D    L      K+ L D+ YGT  G  A SE R EV
Sbjct  120   EDEWEEERGGDGEVGNGNGSAVYDRAWEL------KRILADTVYGTELGFRAESEVRGEV  173

Query  859   VELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTIDS  680
             +EL+ QLEA NPTP P EA  LL+G WVL YT+F  L PLL+ G+ P ++V+ I Q+ID+
Sbjct  174   LELLNQLEALNPTPTPVEASDLLDGNWVLLYTAFSELLPLLAAGSTPFLKVKRITQSIDT  233

Query  679   ESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEF  500
             ++ +V+NS+  SGPLA  S S +A FEVRSP R+Q+ F+EG +  P++  S+ LPENVE 
Sbjct  234   KNLSVENSITLSGPLADFSFSASATFEVRSPSRIQVSFKEGTLRPPEIKSSLDLPENVEL  293

Query  499   LGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISR  320
              GQ+++L+  K  +  LQ+ A+++ ++IS Q PL      +   SWLL TYLD +LRISR
Sbjct  294   FGQQVNLSLLKQSLNPLQEIAANISRAISGQQPLSLPFPGNRGSSWLLITYLDKDLRISR  353

Query  319   GEAGSIFVLIKEDSPLLK  266
             G+ G IFVL +E S LL+
Sbjct  354   GDGG-IFVLAREGSSLLE  370



>gb|KHG16773.1| Plastid lipid-associated 3, chloroplastic [Gossypium arboreum]
Length=367

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 156/224 (70%), Gaps = 1/224 (0%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSF  758
            LK+ LVDS YGT  G  A  E RAE++EL+ QLEA NPT AP EA  LL+G W+L YT+F
Sbjct  144  LKRCLVDSVYGTELGFRAGQELRAEILELVNQLEAVNPTRAPIEATQLLDGNWILLYTAF  203

Query  757  IGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRV  578
              L PLL+ G  PL++V+ I Q+ID+ S ++ NS   SGP A  S S +A FEVRSP R+
Sbjct  204  SELLPLLAAGATPLLKVKSISQSIDTASQSIVNSTTLSGPFADLSFSASATFEVRSPSRI  263

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPL  398
            Q++F+EGI+  P++  S+ LP +++  GQ+I L+P +  +  LQD  +++ ++IS QPPL
Sbjct  264  QVEFKEGIVQPPEIKPSVDLPADIDVFGQRISLSPVQQSLGPLQDLVANISRTISGQPPL  323

Query  397  KFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLK  266
            K  +  + + SWLL TYLD +LRISRG+ G +FVL ++ SPLL+
Sbjct  324  KIPIPGNRSSSWLLITYLDEDLRISRGDGG-LFVLARQGSPLLE  366



>gb|EMS55390.1| putative plastid-lipid-associated protein 3, chloroplastic [Triticum 
urartu]
Length=325

 Score =   227 bits (579),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 122/259 (47%), Positives = 161/259 (62%), Gaps = 7/259 (3%)
 Frame = -3

Query  1042  SDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAE  863
             +DDEWG E       A       EDE       + LK+ LVD+ YG+  GL ASSE R E
Sbjct  72    NDDEWGGEPTPTPPKAKEAPVTKEDE-----GREELKRCLVDTVYGSGLGLKASSEVRGE  126

Query  862   VVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTID  683
             VVEL+ QLEA NPT AP +A  L +G W+L YT++  L P+L  G  P  RV++I Q ID
Sbjct  127   VVELVAQLEAANPTSAPVQAPEL-DGNWILLYTAYSELLPILLAGATPFTRVDKISQEID  185

Query  682   SESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVE  503
             S S T+ N+   S P A+ S S  A FEV++P R++++F+EG    P+++ S+ LPE + 
Sbjct  186   SRSMTIINASTISTPFASFSFSATASFEVQTPSRIEVQFKEGSFQPPEISSSVNLPEQIA  245

Query  502   FLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSN-AESWLLTTYLDSELRI  326
               GQK  L P K L+  LQ   +S+  SIS QPPLK  +   N A+SWLLTTYLD +LRI
Sbjct  246   IFGQKFSLGPVKELLEPLQRAFASIAGSISGQPPLKVPIPGDNKAKSWLLTTYLDKDLRI  305

Query  325   SRGEAGSIFVLIKEDSPLL  269
             S+G+ G +F+L KE SPLL
Sbjct  306   SKGDGGGVFILAKEGSPLL  324



>ref|XP_004983554.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic-like 
[Setaria italica]
Length=385

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 125/257 (49%), Positives = 169/257 (66%), Gaps = 7/257 (3%)
 Frame = -3

Query  1036  DEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEVV  857
             +EWG   K+P + APA  A   DE A   E   LK+ LVD+ YG+  G  AS+E R EVV
Sbjct  132   NEWG---KDPSAPAPAPAAEEVDEQAERRED--LKRCLVDTVYGSELGFRASTEVRGEVV  186

Query  856   ELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTIDSE  677
             EL+TQLEA NPTPAP EA  LL+G W+L YT++  L P+L+ G  P V+V++I Q IDS+
Sbjct  187   ELVTQLEAVNPTPAPVEAPDLLDGNWILIYTAYSELLPILAAGATPFVKVKQISQEIDSK  246

Query  676   SFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFL  497
             S T+ N+   + P A+ S S  A FEV+SP R++++F+EG    P ++ ++ LPE V+  
Sbjct  247   SMTIVNASTLTTPFASFSFSATASFEVQSPSRIEVQFKEGSFQPPAISSTVDLPEQVDIF  306

Query  496   GQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSL-ANSNAESWLLTTYLDSELRISR  320
             GQKI L P + ++  LQ T +S+  SIS QPPLK  +  N+   SWLLTTYLD + RISR
Sbjct  307   GQKISLGPVQQVLNPLQQTFASIAGSISGQPPLKVQIPGNNRGRSWLLTTYLDKDFRISR  366

Query  319   GEAGSIFVLIKEDSPLL  269
             G+ G +F+L KE SP L
Sbjct  367   GDGG-LFILAKEGSPFL  382



>gb|KIZ02337.1| hypothetical protein MNEG_5623 [Monoraphidium neglectum]
Length=266

 Score =   223 bits (569),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 114/225 (51%), Positives = 152/225 (68%), Gaps = 7/225 (3%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSF  758
            LK  L+DS +GT RGL+A SE RAE+ ELITQLEAKNPTP+PTE L+ LNG+W L YTS 
Sbjct  15   LKAALLDSLFGTERGLAARSEVRAEINELITQLEAKNPTPSPTEILSALNGEWKLVYTSN  74

Query  757  IGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRV  578
              L  +L+   LP V + +I Q +D  + TV+N    S PL+ T++ST A FEVRSPKR+
Sbjct  75   SELLAILALSKLPFVTIGDITQRVDVLNNTVENKAQISVPLSRTAVSTTASFEVRSPKRL  134

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKS----ISS  410
             I+FE G I TPQL   + +P+++  LGQ +DLT  +GL+  ++   S ++ S    IS 
Sbjct  135  AIRFERGAIATPQLLSDLSIPDSISVLGQSVDLTAVRGLLQPVESGLSGLISSVGSLISQ  194

Query  409  QPPLKFSL---ANSNAESWLLTTYLDSELRISRGEAGSIFVLIKE  284
            QP L F L   A    E+WLLTTYLD + RI+RG+ GS+F+L+KE
Sbjct  195  QPDLSFPLPGAAGERGETWLLTTYLDDDTRITRGDGGSVFILVKE  239



>ref|XP_002467442.1| hypothetical protein SORBIDRAFT_01g028150 [Sorghum bicolor]
 gb|EER94440.1| hypothetical protein SORBIDRAFT_01g028150 [Sorghum bicolor]
Length=381

 Score =   227 bits (579),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 167/256 (65%), Gaps = 3/256 (1%)
 Frame = -3

Query  1033  EWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEVVE  854
             EW EE +  +       A  E++  A+   + LK+ LVD+ YG++ G  AS+E R EVVE
Sbjct  125   EWEEEPEASVPDPTPAPAAAEEDEQAVKREE-LKRCLVDTVYGSDLGFRASTEVRGEVVE  183

Query  853   LITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTIDSES  674
             L+TQLEA NPT AP E   LL+G W+L YT++  L P+L+ G  PLV+V++I Q IDS+S
Sbjct  184   LVTQLEAANPTTAPVETSDLLDGNWILIYTAYSELLPILAAGATPLVKVKQISQEIDSKS  243

Query  673   FTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLG  494
              T+ N+   + P A+ S S  A FEV+SP R++++F+EG    P ++ S+ LP+ ++  G
Sbjct  244   MTIVNASTLTTPFASFSFSATASFEVQSPSRIEVQFKEGSFQPPVISSSVDLPQQIDIFG  303

Query  493   QKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSL-ANSNAESWLLTTYLDSELRISRG  317
             QKI L P +  +  LQ   +S+  SIS QPPLK  +  N+ A SWLLTTYLD +LRISRG
Sbjct  304   QKISLGPVQQALNPLQQAFASIAGSISGQPPLKVPIPGNNRARSWLLTTYLDKDLRISRG  363

Query  316   EAGSIFVLIKEDSPLL  269
             + G +F+L KE SPLL
Sbjct  364   DGG-LFILAKEGSPLL  378



>ref|XP_006294405.1| hypothetical protein CARUB_v10023422mg [Capsella rubella]
 gb|EOA27303.1| hypothetical protein CARUB_v10023422mg [Capsella rubella]
Length=381

 Score =   227 bits (578),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 119/259 (46%), Positives = 165/259 (64%), Gaps = 7/259 (3%)
 Frame = -3

Query  1042  SDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAE  863
             ++DEW E+      A     + V D+      T  LK+ L D+ YGT  G  A SE RAE
Sbjct  129   NEDEWEEDIGGETEADTGNGSAVSDQ------TWELKRCLADTVYGTELGFRAGSEVRAE  182

Query  862   VVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTID  683
             ++EL+ QLEA NPTPAP E   LL+G WVL YT+F  L PLL+ G+ PL++V+ I Q+ID
Sbjct  183   LLELVNQLEALNPTPAPIENPELLDGNWVLLYTAFSELIPLLAAGSTPLLKVKSISQSID  242

Query  682   SESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVE  503
             S + T+ N+   S P A  S S +A FEVRSP R+++ F+EG +  P++  S+ LPE+V 
Sbjct  243   SNNLTIDNATTLSSPFADFSFSASASFEVRSPSRIEVSFKEGTLKPPEIKSSVDLPESVG  302

Query  502   FLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRIS  323
               GQ+I L+  K  +  LQD A+++ +++S QPPLK     +   SWLLTTYLD +LRIS
Sbjct  303   VFGQQISLSLLKQSLNPLQDVAANISRALSGQPPLKLPFPGNRGSSWLLTTYLDKDLRIS  362

Query  322   RGEAGSIFVLIKEDSPLLK  266
             RG+ G +FVL +E S LL+
Sbjct  363   RGDGG-LFVLAREGSSLLE  380



>gb|KJB37720.1| hypothetical protein B456_006G217700 [Gossypium raimondii]
Length=368

 Score =   226 bits (577),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 157/224 (70%), Gaps = 2/224 (1%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSF  758
            LK+ LVDS YGT  G  A  E RAE++EL+ QLEA NPT AP EA  LL+G W+L YT+F
Sbjct  146  LKRCLVDSVYGTELGFRAGQELRAEILELVNQLEAVNPTRAPIEATQLLDGNWILLYTAF  205

Query  757  IGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRV  578
              L PLL+ G  PL++V+ I Q+ID+ S ++ NS   SGP A  S S +A FEVRSP R+
Sbjct  206  SELLPLLAAGATPLLKVKSISQSIDTASQSIVNSTTLSGPFADLSFSASATFEVRSPSRI  265

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPL  398
            Q++F+EGI+  P++  S+ LP +++  GQ+I L+P +  +  LQD  +++ ++IS QPPL
Sbjct  266  QVEFKEGIVQPPEIKPSVDLPADIDVFGQRISLSPVQQSLGPLQDLVANISRTISGQPPL  325

Query  397  KFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLK  266
            K  + N ++ SWLL TYLD +LRISRG+ G +FVL ++ SPLL+
Sbjct  326  KIPIGNRSS-SWLLITYLDEDLRISRGDGG-LFVLARQGSPLLE  367



>ref|XP_002881399.1| hypothetical protein ARALYDRAFT_902655 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57658.1| hypothetical protein ARALYDRAFT_902655 [Arabidopsis lyrata subsp. 
lyrata]
Length=375

 Score =   226 bits (577),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 119/259 (46%), Positives = 165/259 (64%), Gaps = 7/259 (3%)
 Frame = -3

Query  1042  SDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAE  863
             ++DEW EE  + +       + V D+      T  LK+ L D+ YGT  G  A S+ RAE
Sbjct  123   NEDEWEEEIGKEVEIDAGNGSAVSDK------TWELKRCLADTVYGTELGFRAGSDVRAE  176

Query  862   VVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTID  683
             V+EL+ QLEA NPTPAP E   LL+G WVL YT+F  L PLL+ G+ PL++V+ I Q+ID
Sbjct  177   VLELVNQLEALNPTPAPIENPELLDGNWVLLYTAFSELVPLLAAGSTPLLKVKSISQSID  236

Query  682   SESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVE  503
             +++ T+ NS   S P A  S S +A FEVRSP R+++ F+EG +  P++  S+ LPE+V 
Sbjct  237   TKNLTIDNSTTLSSPFADFSFSASASFEVRSPSRIEVSFKEGTLKPPEIKSSVDLPESVG  296

Query  502   FLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRIS  323
               GQ+I L   K  +  LQD A+++ + +S QPPLK     +   SWLLTTYLD +LRIS
Sbjct  297   VFGQQISLALLKQSLNPLQDVAANISRGLSGQPPLKLPFPGNRGSSWLLTTYLDKDLRIS  356

Query  322   RGEAGSIFVLIKEDSPLLK  266
             RG+ G +FVL +E S LL+
Sbjct  357   RGDGG-LFVLAREGSSLLE  374



>gb|KJB37719.1| hypothetical protein B456_006G217700 [Gossypium raimondii]
Length=375

 Score =   226 bits (577),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 157/224 (70%), Gaps = 2/224 (1%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSF  758
            LK+ LVDS YGT  G  A  E RAE++EL+ QLEA NPT AP EA  LL+G W+L YT+F
Sbjct  153  LKRCLVDSVYGTELGFRAGQELRAEILELVNQLEAVNPTRAPIEATQLLDGNWILLYTAF  212

Query  757  IGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRV  578
              L PLL+ G  PL++V+ I Q+ID+ S ++ NS   SGP A  S S +A FEVRSP R+
Sbjct  213  SELLPLLAAGATPLLKVKSISQSIDTASQSIVNSTTLSGPFADLSFSASATFEVRSPSRI  272

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPL  398
            Q++F+EGI+  P++  S+ LP +++  GQ+I L+P +  +  LQD  +++ ++IS QPPL
Sbjct  273  QVEFKEGIVQPPEIKPSVDLPADIDVFGQRISLSPVQQSLGPLQDLVANISRTISGQPPL  332

Query  397  KFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLK  266
            K  + N ++ SWLL TYLD +LRISRG+ G +FVL ++ SPLL+
Sbjct  333  KIPIGNRSS-SWLLITYLDEDLRISRGDGG-LFVLARQGSPLLE  374



>ref|NP_181092.1| putative plastid-lipid-associated protein 3 [Arabidopsis thaliana]
 sp|O82291.1|PAP3_ARATH RecName: Full=Probable plastid-lipid-associated protein 3, chloroplastic; 
Short=AtPap3; AltName: Full=Fibrillin-2; AltName: 
Full=Plastoglobulin 40; Short=AtPGL40; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC36172.1| putative fibrillin [Arabidopsis thaliana]
 gb|AAM65369.1| putative fibrillin [Arabidopsis thaliana]
 gb|AEC09113.1| putative plastid-lipid-associated protein 3 [Arabidopsis thaliana]
Length=376

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/259 (47%), Positives = 161/259 (62%), Gaps = 7/259 (3%)
 Frame = -3

Query  1042  SDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAE  863
             ++DEWG E      A     + V D       T  LK+ L DS YGT  G  A SE RAE
Sbjct  124   NEDEWGGEIGGETEADAGNGSAVSDP------TWELKRCLADSVYGTELGFKAGSEVRAE  177

Query  862   VVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTID  683
             V+EL+ QLEA NPTPAP E   LL+G WVL YT+F  L PLL+ G+ PL++V+ I Q+ID
Sbjct  178   VLELVNQLEALNPTPAPLENPELLDGNWVLLYTAFSELIPLLAAGSTPLLKVKSISQSID  237

Query  682   SESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVE  503
             + +  + NS   S P A  S S  A FEVRSP R+++ F+EG +  P +  S+ LPE+V 
Sbjct  238   TNNLIIDNSTTLSSPFADFSFSATASFEVRSPSRIEVSFKEGTLKPPVIKSSVDLPESVG  297

Query  502   FLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRIS  323
               GQ+I L+  K  +  LQD A+++ +++S QPPLK     +   SWLLTTYLD +LRIS
Sbjct  298   VFGQQISLSLLKQSLNPLQDVAANISRALSGQPPLKLPFPGNRGSSWLLTTYLDKDLRIS  357

Query  322   RGEAGSIFVLIKEDSPLLK  266
             RG+ G +FVL +E S LL+
Sbjct  358   RGDGG-LFVLAREGSSLLE  375



>ref|XP_010505057.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic 
[Camelina sativa]
Length=378

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/241 (50%), Positives = 157/241 (65%), Gaps = 7/241 (3%)
 Frame = -3

Query  988  GVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPT  809
            G AV +D       T  LK+ L D+ YGT  G  A SE RAEV+EL+ QLEA NPTPAP 
Sbjct  144  GSAVSDDN------TFELKRCLADTVYGTELGFRAGSEVRAEVLELVNQLEALNPTPAPL  197

Query  808  EALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLAT  629
            E   LL+G WVL YT+F  L PLL+ G+ PL++V+ I Q+IDS + TV N    S P A 
Sbjct  198  ENPELLDGNWVLLYTAFSELIPLLAAGSTPLLKVKSISQSIDSNNLTVDNFTTLSSPFAD  257

Query  628  TSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSL  449
             S S +A FEVRSP RV++ F+EG +  P++  S+ LPE+V   GQ+I L   K  +  L
Sbjct  258  FSFSASASFEVRSPSRVEVSFKEGTLKPPEIKSSVDLPESVGVFGQQISLALLKQSLNPL  317

Query  448  QDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
            QD A+++ +++S QPPLK     + A SWLLTTYLD +LRISRG+ G +FVL +E S LL
Sbjct  318  QDVAANISRALSGQPPLKLPFPGNRASSWLLTTYLDKDLRISRGDGG-LFVLAREGSSLL  376

Query  268  K  266
            +
Sbjct  377  E  377



>dbj|BAJ85307.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=371

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/269 (46%), Positives = 168/269 (62%), Gaps = 16/269 (6%)
 Frame = -3

Query  1042  SDDEWGEE--------KKEPLSAAPAGVAVVEDEPAALTET--DVLKKQLVDSFYGTNRG  893
             +DDEWG E        K+ PL  A       E++P    +   + LK+ LVD+ YG+  G
Sbjct  107   NDDEWGGEPTPTPPKAKESPLFFA----DKAEEDPVTKEDEGREELKRCLVDTVYGSGLG  162

Query  892   LSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLV  713
             L ASSE R EVVEL+ QLEA NPT AP +A + L+G W+L YT++  L P+L  G  P  
Sbjct  163   LKASSEVRGEVVELVAQLEAANPTSAPVQA-SELDGNWILLYTAYSELLPILLAGATPFA  221

Query  712   RVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLT  533
             RV++I Q IDS S T+ N+     P A+ S S  A FEV++P R++++F+EG    P+++
Sbjct  222   RVDKISQEIDSRSMTIINASTILTPFASFSFSATASFEVQTPSRIEVQFKEGSFHPPEIS  281

Query  532   DSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSN-AESWLL  356
              S+ LPE +   GQKI L P K L+  LQ   +S+  SIS QPPLK  +   N A+SWLL
Sbjct  282   SSVNLPEQIAIFGQKISLGPVKQLLEPLQRAFASIAGSISGQPPLKVPIPGDNKAKSWLL  341

Query  355   TTYLDSELRISRGEAGSIFVLIKEDSPLL  269
             TTYLD +LRIS+G+ G +F+L KE SPLL
Sbjct  342   TTYLDKDLRISKGDGGGVFILAKEGSPLL  370



>ref|XP_006410707.1| hypothetical protein EUTSA_v10016800mg [Eutrema salsugineum]
 gb|ESQ52160.1| hypothetical protein EUTSA_v10016800mg [Eutrema salsugineum]
Length=380

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/259 (46%), Positives = 168/259 (65%), Gaps = 7/259 (3%)
 Frame = -3

Query  1042  SDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAE  863
             ++DEW EE+ +  +   AG      +P     T  LK+ L D+ YGT  G  A+SE RAE
Sbjct  128   NEDEW-EERNDGEAEVDAGNGNAVPDP-----TWELKRCLADTVYGTELGFRANSEVRAE  181

Query  862   VVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTID  683
             V+EL+ QLEA NPTPAP E   LL+G WVL YT+F  L PLL+ G+ PL++V+ I Q+ID
Sbjct  182   VLELVNQLEALNPTPAPVENPELLDGNWVLLYTAFSELLPLLAAGSTPLLKVKSISQSID  241

Query  682   SESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVE  503
             +++  + NS   S P A  S S +A FEVRSP R+++ F+EG +  P++  ++ LPE+V 
Sbjct  242   TKNLCIDNSTTLSSPFADFSFSASASFEVRSPSRIEVSFKEGTLRPPEIKSTVDLPESVG  301

Query  502   FLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRIS  323
               GQ+I L+  K  +  LQD A+++ ++IS QPPLK     +   SWLLTTYLD +LRIS
Sbjct  302   VFGQQISLSFLKQSLDPLQDVAANISRAISGQPPLKLPFPGNRGSSWLLTTYLDKDLRIS  361

Query  322   RGEAGSIFVLIKEDSPLLK  266
             RG+ G +FVL +E S LL+
Sbjct  362   RGDGG-LFVLGREGSSLLE  379



>dbj|BAJ98223.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=371

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 124/269 (46%), Positives = 168/269 (62%), Gaps = 16/269 (6%)
 Frame = -3

Query  1042  SDDEWGEE--------KKEPLSAAPAGVAVVEDEPAALTET--DVLKKQLVDSFYGTNRG  893
             +DDEWG E        K+ PL  A       E++P    +   + LK+ LVD+ YG+  G
Sbjct  107   NDDEWGGEPTPTPPKAKESPLFFA----DKAEEDPVTKEDEGREELKRCLVDTVYGSGLG  162

Query  892   LSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLV  713
             L ASSE R EVVEL+ QLEA NPT AP +A + L+G W+L YT++  L P+L  G  P  
Sbjct  163   LKASSEVRGEVVELVAQLEAANPTSAPVQA-SELDGNWILLYTAYSELLPILLAGATPFA  221

Query  712   RVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLT  533
             RV++I Q IDS S T+ N+     P A+ S S  A FEV++P R++++F+EG    P+++
Sbjct  222   RVDKISQEIDSRSMTIINASTILTPFASFSFSATASFEVQTPSRIEVQFKEGSFQPPEIS  281

Query  532   DSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSN-AESWLL  356
              S+ LPE +   GQKI L P K L+  LQ   +S+  SIS QPPLK  +   N A+SWLL
Sbjct  282   SSVNLPEQIAIFGQKISLGPVKQLLEPLQRAFASIAGSISGQPPLKVPIPGDNKAKSWLL  341

Query  355   TTYLDSELRISRGEAGSIFVLIKEDSPLL  269
             TTYLD +LRIS+G+ G +F+L KE SPLL
Sbjct  342   TTYLDKDLRISKGDGGGVFILAKEGSPLL  370



>gb|EMT01216.1| Putative plastid-lipid-associated protein 3, chloroplastic [Aegilops 
tauschii]
Length=360

 Score =   223 bits (569),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 121/259 (47%), Positives = 160/259 (62%), Gaps = 7/259 (3%)
 Frame = -3

Query  1042  SDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAE  863
             +DDEWG E       A       EDE       + LK+ LVD+ YG+  GL ASSE R E
Sbjct  107   NDDEWGGEPTPTPPKAKEAPVTKEDE-----GREELKRCLVDTVYGSGLGLKASSEVRGE  161

Query  862   VVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTID  683
             VVEL+ QLEA NPT AP +A  L +G W+L YT++  L P+L  G  P  RV++I Q ID
Sbjct  162   VVELVAQLEAANPTSAPVQAPEL-DGNWILLYTAYSELLPILLAGATPFTRVDKISQEID  220

Query  682   SESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVE  503
             S S T+ N+   S P A+ S S  A FEV++P R++++F+EG    P+++ S+ LPE + 
Sbjct  221   SRSMTIINASTISTPFASFSFSATASFEVQTPSRIEVQFKEGSFQPPEISSSVNLPEQIA  280

Query  502   FLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSN-AESWLLTTYLDSELRI  326
               GQK  L   K L+  LQ   +S+  SIS QPPLK  +   N A+SWLLTTYLD +LRI
Sbjct  281   IFGQKFSLGTVKELLEPLQRAFASIAGSISGQPPLKVPIPGDNKAKSWLLTTYLDKDLRI  340

Query  325   SRGEAGSIFVLIKEDSPLL  269
             S+G+ G +F+L KE SPLL
Sbjct  341   SKGDGGGVFILAKEGSPLL  359



>gb|AAK57563.1| plastid-lipid associated protein PAP3 [Brassica rapa subsp. oleifera]
Length=360

 Score =   223 bits (568),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 129/311 (41%), Positives = 179/311 (58%), Gaps = 38/311 (12%)
 Frame = -3

Query  1099  SFPNRGLANPNRKFVVRAVSDDEWGEEKKEPLSA---APAGVA---------VVEDEPAA  956
             S P+   + P   + V     DEWGE+  EP S    AP+ V+         V E+    
Sbjct  54    SLPSESDSEPEGGYSVT----DEWGEQPAEPESPPDNAPSAVSDEWGEKSESVPEESVTR  109

Query  955   LTETD---------------------VLKKQLVDSFYGTNRGLSASSETRAEVVELITQL  839
               E+D                      LK+ L D+ YGT  G  A SE RAEV+E++ QL
Sbjct  110   FAESDPPTNEDEWEEREADDGVDKTWELKRCLADTVYGTELGFRAGSEVRAEVLEIVNQL  169

Query  838   EAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTIDSESFTVQN  659
             EA NPT AP E   LL+G WVL YT+F  L PLL+ G+ PL++V+ I Q+ID++S ++ N
Sbjct  170   EALNPTQAPVENPELLDGNWVLLYTAFSELLPLLAAGSTPLLKVKSISQSIDTKSLSIDN  229

Query  658   SVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDL  479
             S   S P A  S S  A FEVR+P R+++ F+EG +  P++  S+ LPE+V   GQ+I+L
Sbjct  230   STTLSSPFADFSFSATASFEVRTPSRIEVSFKEGTLKPPEIKSSVDLPESVGVFGQEINL  289

Query  478   TPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIF  299
             +  K  +  LQD A+++ ++IS QPPLK     +   SWLLTTYLD +LRISRG+ G +F
Sbjct  290   SFLKQSLNPLQDVAANISRAISGQPPLKLPFPGNRGSSWLLTTYLDKDLRISRGDGG-LF  348

Query  298   VLIKEDSPLLK  266
             VL +E S LL+
Sbjct  349   VLAREGSSLLE  359



>ref|XP_009403116.1| PREDICTED: LOW QUALITY PROTEIN: probable plastid-lipid-associated 
protein 3, chloroplastic [Musa acuminata subsp. malaccensis]
Length=422

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 123/274 (45%), Positives = 171/274 (62%), Gaps = 19/274 (7%)
 Frame = -3

Query  1036  DEWGEEKKEPLSA-APAGVAVVEDE----PAAL-----------TETDV--LKKQLVDSF  911
             DEWGE+ +  + A +PA   V EDE    P              +E ++  LK+ LVDS 
Sbjct  147   DEWGEKAEPEVDAPSPADPPVDEDEWGREPGGAGNLSGNGTPTPSEDNLGDLKRCLVDSL  206

Query  910   YGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSR  731
             YGT  G  AS E RA+++EL+ QLEA NPTPAPTEA  LL+G W+L YT+   L PLL+ 
Sbjct  207   YGTELGFRASVEDRADILELVNQLEAANPTPAPTEAPELLDGNWILLYTASSELLPLLAV  266

Query  730   GTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGII  551
             GT PL++++ I Q ID ++  + N+   S P A  + S +A F VRS  R+Q++F+EG  
Sbjct  267   GTTPLLKIKRISQAIDCKTMEIVNATTLSSPFANFAFSVSASFGVRSSSRIQVQFKEGTF  326

Query  550   GTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNA  371
               P+++ ++ LPE  +  GQ I+L P +  +  +Q+  ++V +SIS QPPLK  L  + A
Sbjct  327   QPPEISSTLDLPEKFDIFGQSINLKPVQQTLNPVQEAVANVTRSISGQPPLKVPLPGNRA  386

Query  370   ESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
             ESWLL TYLD + RISRG+ G +FVL KE SPLL
Sbjct  387   ESWLLITYLDEDFRISRGDGG-LFVLAKEGSPLL  419



>sp|Q94KU5.1|PAP3_BRACM RecName: Full=Plastid lipid-associated protein 3, chloroplastic; 
Flags: Precursor [Brassica rapa]
 gb|AAK57566.1|AF290568_1 plastid-lipid associated protein PAP3 [Brassica rapa subsp. oleifera]
Length=360

 Score =   223 bits (568),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 125/290 (43%), Positives = 172/290 (59%), Gaps = 34/290 (12%)
 Frame = -3

Query  1036  DEWGEEKKEPLSA---APAGVA---------VVEDEPAALTETD----------------  941
             DEWGE+  EP S    AP+ V+         V E+      E+D                
Sbjct  71    DEWGEQPAEPESPPDNAPSAVSDEWGEKSESVPEESVTRFAESDPPTNEDEWEEREADDG  130

Query  940   -----VLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWV  776
                   LK+ L D+ YGT  G  A SE RAEV+E++ QLEA NPT AP E   LL+G WV
Sbjct  131   VDKTWELKRCLADTVYGTELGFRAGSEVRAEVLEIVNQLEALNPTQAPVENPELLDGNWV  190

Query  775   LAYTSFIGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEV  596
             L YT+F  L PLL+ G+ PL++V+ I Q+ID++S ++ NS   S P A  S S  A FEV
Sbjct  191   LLYTAFSELLPLLAAGSTPLLKVKSISQSIDTKSLSIDNSTTLSSPFADFSFSATASFEV  250

Query  595   RSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSI  416
             R+P R+++ F+EG +  P++  S+ LPE+V   GQ+I+L+  K  +  LQD A+++ ++I
Sbjct  251   RTPSRIEVSFKEGTLKPPEIKSSVDLPESVGVFGQEINLSFLKQSLNPLQDVAANISRAI  310

Query  415   SSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLK  266
             S QPPLK     +   SWLLTTYLD +LRISRG+ G +FVL +E S LL+
Sbjct  311   SGQPPLKLPFPGNRGSSWLLTTYLDKDLRISRGDGG-LFVLAREGSSLLE  359



>ref|XP_009143664.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic 
[Brassica rapa]
Length=360

 Score =   223 bits (568),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 125/290 (43%), Positives = 172/290 (59%), Gaps = 34/290 (12%)
 Frame = -3

Query  1036  DEWGEEKKEPLSA---APAGVA---------VVEDEPAALTETD----------------  941
             DEWGE+  EP S    AP+ V+         V E+      E+D                
Sbjct  71    DEWGEQPAEPESPPDNAPSAVSDEWGEKSESVPEESVTRFAESDPPTNEDEWEEREADDG  130

Query  940   -----VLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWV  776
                   LK+ L D+ YGT  G  A SE RAEV+E++ QLEA NPT AP E   LL+G WV
Sbjct  131   VDKTWELKRCLADTVYGTELGFRAGSEVRAEVLEIVNQLEALNPTQAPVENPELLDGNWV  190

Query  775   LAYTSFIGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEV  596
             L YT+F  L PLL+ G+ PL++V+ I Q+ID++S ++ NS   S P A  S S  A FEV
Sbjct  191   LLYTAFSELLPLLAAGSTPLLKVKSISQSIDTKSLSIDNSTTLSSPFADFSFSATASFEV  250

Query  595   RSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSI  416
             R+P R+++ F+EG +  P++  S+ LPE+V   GQ+I+L+  K  +  LQD A+++ ++I
Sbjct  251   RTPSRIEVSFKEGTLKPPEIKSSVDLPESVGVFGQEINLSFLKQSLNPLQDVAANISRAI  310

Query  415   SSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLK  266
             S QPPLK     +   SWLLTTYLD +LRISRG+ G +FVL +E S LL+
Sbjct  311   SGQPPLKLPFPGNRGSSWLLTTYLDKDLRISRGDGG-LFVLAREGSSLLE  359



>ref|XP_006432747.1| hypothetical protein CICLE_v10002003mg [Citrus clementina]
 ref|XP_006432748.1| hypothetical protein CICLE_v10002003mg [Citrus clementina]
 ref|XP_006432749.1| hypothetical protein CICLE_v10002003mg [Citrus clementina]
 ref|XP_006471524.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic-like 
isoform X1 [Citrus sinensis]
 ref|XP_006471525.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic-like 
isoform X2 [Citrus sinensis]
 gb|ESR45987.1| hypothetical protein CICLE_v10002003mg [Citrus clementina]
 gb|ESR45988.1| hypothetical protein CICLE_v10002003mg [Citrus clementina]
 gb|ESR45989.1| hypothetical protein CICLE_v10002003mg [Citrus clementina]
 gb|KDO50349.1| hypothetical protein CISIN_1g016935mg [Citrus sinensis]
 gb|KDO50350.1| hypothetical protein CISIN_1g016935mg [Citrus sinensis]
 gb|KDO50351.1| hypothetical protein CISIN_1g016935mg [Citrus sinensis]
Length=380

 Score =   223 bits (569),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/223 (50%), Positives = 153/223 (69%), Gaps = 1/223 (0%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSF  758
            LK+ LVD+ YGT  G  A S+ RAEV+EL+ QLEA NPTP P  A  +L+G WVL YT+F
Sbjct  157  LKRCLVDTVYGTELGFRAGSDVRAEVLELVNQLEALNPTPNPVNAAGVLDGNWVLVYTAF  216

Query  757  IGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRV  578
              L PLL+ G +PL++VE+ICQ ID+ S T++NS   S P A+ S S  A FEVRSP R+
Sbjct  217  SELLPLLAAGAIPLLKVEKICQKIDTSSLTIENSTTLSSPFASFSFSATASFEVRSPSRI  276

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPL  398
            Q++F+EG +  P +  ++ LP N+   GQ I+L+P +  ++ LQ+   S+ +++S QPPL
Sbjct  277  QVQFKEGTLQPPDIKSTVDLPGNLNIFGQNINLSPVQQTLSPLQEAVGSISRAVSGQPPL  336

Query  397  KFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
            K  +     +SWLL TYLD + RISRG+ G +FVL+KE SPLL
Sbjct  337  KVPIPGERTQSWLLITYLDEDFRISRGDGG-LFVLVKEGSPLL  378



>ref|XP_004512496.1| PREDICTED: plastoglobulin-1, chloroplastic-like [Cicer arietinum]
Length=354

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/223 (52%), Positives = 155/223 (70%), Gaps = 1/223 (0%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSF  758
            LK+ LVD+ YGT  G  A SE RAEV EL+TQLEA NPTPAP + L LL+G WVL YT+ 
Sbjct  131  LKRALVDTVYGTELGFRAGSEVRAEVTELVTQLEAVNPTPAPVDELDLLSGNWVLLYTAS  190

Query  757  IGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRV  578
              L PLL+ G+LPL++V++I QTID +SFT+ NS   S P A+ S S +A FEVRSP RV
Sbjct  191  SELLPLLAAGSLPLLKVDKITQTIDIDSFTIINSTTLSSPFASLSFSASASFEVRSPARV  250

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPL  398
            Q+ F+EG +  P++   I LP N++  GQK+ L P +  +  L++  +++ ++IS QPPL
Sbjct  251  QVTFKEGSLQPPEIKSRIDLPGNIDIFGQKLSLGPLQQSLGPLENVVANISRAISGQPPL  310

Query  397  KFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
            K  +      SWLLTTYLD +LRISRG+ G +FVL +E SPLL
Sbjct  311  KIPIPGERTSSWLLTTYLDKDLRISRGDGG-LFVLAREGSPLL  352



>emb|CDY31692.1| BnaA05g08550D [Brassica napus]
Length=360

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/290 (42%), Positives = 168/290 (58%), Gaps = 34/290 (12%)
 Frame = -3

Query  1036  DEWGEEKKEPLSAAPAGVAVVEDEPAALTE------------------------------  947
             DEWGE+  EP S      + V DE    +E                              
Sbjct  71    DEWGEQPAEPESPPDNAPSAVSDEWGEKSESVPEETVTRFAESDPPTNDDEWEEREADDG  130

Query  946   ---TDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWV  776
                T  LK+ L D+ YGT  G  A SE RAEV+E++ QLEA NPT AP E   LL+G WV
Sbjct  131   VDKTWELKRCLADTVYGTELGFRAGSEVRAEVLEIVNQLEALNPTQAPVENPELLDGNWV  190

Query  775   LAYTSFIGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEV  596
             L YT+F  L PLL+ G+ PL++V+ I Q+ID++S ++ NS   S P A  S S  A FEV
Sbjct  191   LLYTAFSELLPLLAAGSTPLLKVKSISQSIDTKSLSIDNSTTLSSPFADFSFSATASFEV  250

Query  595   RSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSI  416
             R+P R+++ F+EG +  P++  S+ LPE+V   GQ+I+L+  K  +  LQD A+++ ++I
Sbjct  251   RTPSRIEVSFKEGTLKPPEIKSSVDLPESVGVFGQEINLSFLKQSLNPLQDVAANISRAI  310

Query  415   SSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLK  266
             S QPPLK     +   SWLLTTYLD +LRISRG+ G +FVL +E S LL+
Sbjct  311   SGQPPLKLPFPGNRGSSWLLTTYLDKDLRISRGDGG-LFVLAREGSSLLE  359



>ref|XP_010235051.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic 
[Brachypodium distachyon]
Length=351

 Score =   222 bits (566),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/274 (46%), Positives = 164/274 (60%), Gaps = 5/274 (2%)
 Frame = -3

Query  1084  GLANPNRKFVVRA-VSDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFY  908
             G+A P +     A  +DDEWG E               E E       D LK+ LVD+ Y
Sbjct  80    GVAEPEQPSGADAPTNDDEWGGEPTPTPPTP-VPATAAEGEDKDEGRED-LKRCLVDTVY  137

Query  907   GTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRG  728
              +  GL ASSE R EVVEL+ QLEA NPTPAP +A  L +G W+L YT++  L P+L  G
Sbjct  138   DSGLGLKASSEVRGEVVELVAQLEAANPTPAPVQAPDL-DGNWILLYTAYSELLPILLAG  196

Query  727   TLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIG  548
               P  +VE+I Q IDS S T+ N+   S P A+ S S  A FEV+S  R++++F+EG   
Sbjct  197   ATPFSKVEKISQEIDSRSMTIVNASTISTPFASFSFSATASFEVQSSSRIEVQFKEGSFQ  256

Query  547   TPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSL-ANSNA  371
              P+++ S+ LP  +   GQKI L P + L+  LQ   + +  SIS QPPLK  +  N+ A
Sbjct  257   PPEISSSVKLPAQIAIFGQKISLGPVQQLLNPLQQAFAGIAGSISGQPPLKVPIPGNNRA  316

Query  370   ESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
             +SWLLTTYLD +LRISRG+ G +FVL KE SPLL
Sbjct  317   KSWLLTTYLDKDLRISRGDGGGLFVLAKEGSPLL  350



>ref|XP_010677363.1| PREDICTED: plastid lipid-associated protein 3, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=411

 Score =   223 bits (569),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/223 (49%), Positives = 153/223 (69%), Gaps = 1/223 (0%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSF  758
            LK+ L+DS YG++ G  AS+E RAEV EL++QLEA NP+P PTE   LL+G W+L YT+F
Sbjct  188  LKRCLLDSVYGSDLGFRASAEVRAEVSELVSQLEAVNPSPKPTEVSGLLDGNWILVYTAF  247

Query  757  IGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRV  578
              L PLL+ GT  L++V++I Q ID+ + TV+NS   S P AT + S  A F+VRSP R+
Sbjct  248  SELLPLLAVGTTQLLKVQQISQAIDTTNQTVENSTTLSSPFATFTFSATATFDVRSPSRI  307

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPL  398
            Q++F+E     PQ+   I LPE+V+  GQK+ L P +  ++ LQD A+S+ +++   PPL
Sbjct  308  QVRFKEATFKPPQIKSQIDLPESVDVFGQKVTLPPVQQFLSPLQDAATSISRALYGLPPL  367

Query  397  KFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
            K S+      SWLL TY+D + RISRG+ G +FVL++E SPLL
Sbjct  368  KISIPGERTASWLLFTYVDEDFRISRGDGG-LFVLVREGSPLL  409



>ref|XP_008676981.1| PREDICTED: fibrillin1 isoform X1 [Zea mays]
 tpg|DAA46452.1| TPA: plastid-lipid associated protein 3 isoform 1 [Zea mays]
 tpg|DAA46453.1| TPA: plastid-lipid associated protein 3 isoform 2 [Zea mays]
Length=382

 Score =   222 bits (566),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 154/224 (69%), Gaps = 2/224 (1%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSF  758
            LK+ LVD+ YG++ G  AS+E R EVVEL+TQLEA NPT AP E+  LL+G W+L YT++
Sbjct  157  LKRCLVDTVYGSDLGFRASTEVRGEVVELVTQLEAVNPTTAPVESPDLLDGNWILIYTAY  216

Query  757  IGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRV  578
              L P+L+ G  PLV+V++I Q IDS+  T+ N+   + P A+ S S  A FEV+SP R+
Sbjct  217  SELLPILAAGATPLVKVKQISQEIDSKIMTIVNASTLTTPFASFSFSATASFEVQSPSRI  276

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPL  398
            +++F+EG    P ++ S+ LP+ V+  GQKI L P +  +  LQ   +S+  SIS QPPL
Sbjct  277  EVQFKEGSFQPPTISSSVDLPQQVDIFGQKISLGPVQQALNPLQQAFASIAGSISGQPPL  336

Query  397  KFSL-ANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
            K  +  N+ A SWLLTTYLD +LRISRG+ G +F+L KE SPLL
Sbjct  337  KVPIPGNNRARSWLLTTYLDKDLRISRGDGG-LFILAKEGSPLL  379



>gb|AAK68845.1| putative fibrillin [Arabidopsis thaliana]
 gb|AAM10011.1| putative fibrillin [Arabidopsis thaliana]
Length=376

 Score =   222 bits (565),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 120/259 (46%), Positives = 160/259 (62%), Gaps = 7/259 (3%)
 Frame = -3

Query  1042  SDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAE  863
             ++DEWG E      A     + V D       T  LK+ L DS YGT  G  A SE RAE
Sbjct  124   NEDEWGGEIGGETEADAGNGSAVSDP------TWELKRCLADSVYGTELGFKAGSEVRAE  177

Query  862   VVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTID  683
             V+EL+ QLEA NPTPAP E   LL+G WVL  T+F  L PLL+ G+ PL++V+ I Q+ID
Sbjct  178   VLELVNQLEALNPTPAPLENPELLDGNWVLLCTAFSELIPLLAAGSTPLLKVKSISQSID  237

Query  682   SESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVE  503
             + +  + NS   S P A  S S  A FEVRSP R+++ F+EG +  P +  S+ LPE+V 
Sbjct  238   TNNLIIDNSTTLSSPFADFSFSATASFEVRSPSRIEVSFKEGTLKPPVIKSSVDLPESVG  297

Query  502   FLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRIS  323
               GQ+I L+  K  +  LQD A+++ +++S QPPLK     +   SWLLTTYLD +LRIS
Sbjct  298   VFGQQISLSLLKQSLNPLQDVAANISRALSGQPPLKLPFPGNRGSSWLLTTYLDKDLRIS  357

Query  322   RGEAGSIFVLIKEDSPLLK  266
             RG+ G +FVL +E S LL+
Sbjct  358   RGDGG-LFVLAREGSSLLE  375



>gb|KFK36419.1| hypothetical protein AALP_AA4G121600 [Arabis alpina]
Length=376

 Score =   221 bits (564),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 114/233 (49%), Positives = 153/233 (66%), Gaps = 7/233 (3%)
 Frame = -3

Query  982  AVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEA  803
            +VVED       T  LK+ L D+ YGT  G  A SE RAEV+EL+ QLEA NPT AP E 
Sbjct  137  SVVEDR------TSELKRCLADTVYGTELGFRAGSEVRAEVLELVNQLEALNPTQAPVEN  190

Query  802  LTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTS  623
              LL+G WVL YT+F  L PLL+ G+ PL++V+ I Q+ID++S ++ NS   S P A  S
Sbjct  191  PELLDGNWVLMYTAFSELLPLLAAGSTPLLKVKSITQSIDTKSLSIDNSTTLSSPFADFS  250

Query  622  ISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQD  443
             S  A FEVRSP R+++ F+EG +  P++  S+ LPE+V   GQ+I L+  K  +  LQD
Sbjct  251  FSATASFEVRSPSRIEVSFKEGTLKPPEIKSSVDLPESVGVFGQQISLSLLKQSLNPLQD  310

Query  442  TASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKE  284
             A+++ ++I+ QPPLK     +   SWLLTTYLD +LRISRG+ G +FVL KE
Sbjct  311  VAANISRAITGQPPLKLPFPGNRGSSWLLTTYLDKDLRISRGDGG-LFVLAKE  362



>emb|CDX84202.1| BnaC04g09640D [Brassica napus]
Length=362

 Score =   221 bits (562),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 119/272 (44%), Positives = 166/272 (61%), Gaps = 17/272 (6%)
 Frame = -3

Query  1036  DEWGEEKKEPLSAAPAGVAVVEDEPA---------------ALTETDVLKKQLVDSFYGT  902
             DEWGE K EP+           D P                 + +T  LK+ L D+ YGT
Sbjct  92    DEWGE-KSEPVPEESVTRFAESDPPTNEDEWEEREGGGGDEGVDKTLELKRCLADTVYGT  150

Query  901   NRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTL  722
               G  A SE RAEV+E++ QLEA NPT AP E   LL+G WVL YT+F  L PLL+ G+ 
Sbjct  151   ELGFRAGSEVRAEVLEIVNQLEALNPTQAPVENPELLDGNWVLLYTAFSELLPLLAAGST  210

Query  721   PLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTP  542
             PL++V+ I Q+ID+++ ++ NS   S P A  S S  A FEVR+P R+++ F+EG +  P
Sbjct  211   PLLKVKSISQSIDTKNLSIDNSTTLSTPFADFSFSATASFEVRTPSRIEVSFKEGTLKPP  270

Query  541   QLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESW  362
             ++  S+ LPE+V   GQ+++L+  K  +  LQD A+++ ++IS QPPLK     +   SW
Sbjct  271   EIKSSVDLPESVGVFGQEVNLSFLKQSLNPLQDVAANISRAISGQPPLKLPFPGNRGSSW  330

Query  361   LLTTYLDSELRISRGEAGSIFVLIKEDSPLLK  266
             LLTTYLD +LRISRG+ G +FVL +E S LL+
Sbjct  331   LLTTYLDKDLRISRGDGG-LFVLAREGSSLLE  361



>ref|XP_009373486.1| PREDICTED: plastoglobulin-1, chloroplastic [Pyrus x bretschneideri]
Length=355

 Score =   220 bits (561),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 161/245 (66%), Gaps = 4/245 (2%)
 Frame = -3

Query  1003  SAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNP  824
             +AA   VA+ E     L+E   LK+ LVD+ YGT  G  A SE RAE +E ++QLEA NP
Sbjct  113   NAAKTEVAIEEKVDGKLSE---LKRGLVDTVYGTEFGFRAGSEVRAEALEFVSQLEAANP  169

Query  823   TPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFS  644
              PAPTE   LL+G WVL YT+   L PLL+ G  PL++V +I Q I+S S T+ NS   S
Sbjct  170   NPAPTENPGLLDGNWVLLYTASSELLPLLAAGGTPLLKVNKITQAINSSSLTILNSTTLS  229

Query  643   GPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKG  464
             GP A+ S S +A FEVRSP R+Q++F+EG    P++  S+ LP+ VE  GQKI+L+P + 
Sbjct  230   GPFASFSFSASASFEVRSPSRIQVEFKEGSFQPPEIKSSVDLPQEVEVFGQKINLSPVQQ  289

Query  463   LITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKE  284
              +  LQD  + + ++IS QPPLK  +     +SWLL TYLD +LRISRG+ G +FVL +E
Sbjct  290   TLNPLQDAVAGISRTISGQPPLKVPVPGERTKSWLLITYLDEDLRISRGDGG-LFVLARE  348

Query  283   DSPLL  269
              SPLL
Sbjct  349   GSPLL  353



>gb|ACG41445.1| plastid-lipid associated protein 3 [Zea mays]
Length=382

 Score =   221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 154/224 (69%), Gaps = 2/224 (1%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSF  758
            LK+ LVD+ YG++ G  AS+E R EVVEL+TQLEA NPT AP ++  LL+G W+L YT++
Sbjct  157  LKRCLVDTVYGSDLGFRASTEVRGEVVELVTQLEAVNPTTAPVDSPDLLDGNWILIYTAY  216

Query  757  IGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRV  578
              L P+L+ G  PLV+V++I Q IDS+  T+ N+   + P A+ S S  A FEV+SP R+
Sbjct  217  SELLPILAAGATPLVKVKQISQEIDSKIMTIVNASTLTTPFASFSFSATASFEVQSPSRI  276

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPL  398
            +++F+EG    P ++ S+ LP+ V+  GQKI L P +  +  LQ   +S+  SIS QPPL
Sbjct  277  EVQFKEGSFQPPAISSSVDLPQQVDIFGQKISLGPVQQALNPLQQAFASIAGSISGQPPL  336

Query  397  KFSL-ANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
            K  +  N+ A SWLLTTYLD +LRISRG+ G +F+L KE SPLL
Sbjct  337  KVPIPGNNRARSWLLTTYLDKDLRISRGDGG-LFILAKEGSPLL  379



>ref|NP_001149315.1| fibrillin1 [Zea mays]
 gb|ACG34995.1| plastid-lipid associated protein 3 [Zea mays]
Length=382

 Score =   221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 154/224 (69%), Gaps = 2/224 (1%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSF  758
            LK+ LVD+ YG++ G  AS+E R EVVEL+TQLEA NPT AP ++  LL+G W+L YT++
Sbjct  157  LKRCLVDTVYGSDLGFRASTEVRGEVVELVTQLEAVNPTTAPVDSPDLLDGNWILIYTAY  216

Query  757  IGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRV  578
              L P+L+ G  PLV+V++I Q IDS+  T+ N+   + P A+ S S  A FEV+SP R+
Sbjct  217  SELLPILAAGATPLVKVKQISQEIDSKIMTIVNASTLTTPFASFSFSATASFEVQSPSRI  276

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPL  398
            +++F+EG    P ++ S+ LP+ V+  GQKI L P +  +  LQ   +S+  SIS QPPL
Sbjct  277  EVQFKEGSFQPPAISSSVDLPQQVDIFGQKISLGPVQQALNPLQQAFASIAGSISGQPPL  336

Query  397  KFSL-ANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
            K  +  N+ A SWLLTTYLD +LRISRG+ G +F+L KE SPLL
Sbjct  337  KVPIPGNNRARSWLLTTYLDKDLRISRGDGG-LFILAKEGSPLL  379



>ref|XP_006368003.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic-like 
[Solanum tuberosum]
Length=418

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 125/274 (46%), Positives = 173/274 (63%), Gaps = 19/274 (7%)
 Frame = -3

Query  1090  NRGLANPNRKFVVRAVSDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSF  911
             N+G+  P        + +D W E   E +    AGV   EDE  A      +K+ L+D+ 
Sbjct  162   NQGVLEP------ETMEEDGWDE--AEVVGRINAGVE--EDERIA-----EMKRCLIDTV  206

Query  910   YGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSR  731
             YGT+ GL ASSE RAE +EL+ +LEA NPTP P E   LL+G W+L +T+F  L PLL+ 
Sbjct  207   YGTDFGLRASSEVRAEALELVAKLEAANPTPNPVE---LLDGNWILVFTAFSELLPLLAV  263

Query  730   GTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGII  551
             GT+PL++VE+I QTI   S T++NS   S P+AT+S S  A FEV+SP R+QI+F+EG  
Sbjct  264   GTIPLLKVEKISQTISMSSLTIENSTTLSSPVATSSFSATAVFEVQSPSRIQIEFKEGTF  323

Query  550   GTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNA  371
               P++   I LPEN++  GQ I L+P +  +  L++    + ++IS  P LK  +     
Sbjct  324   KPPEIKSKIDLPENMDIFGQNISLSPLQQSLGPLENAMVGIARTISGLPLLKVPIPGERT  383

Query  370   ESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
             +SWL+TTYLDS+LRISRG+ G IFVL+KE S LL
Sbjct  384   KSWLITTYLDSDLRISRGDGG-IFVLVKEKSSLL  416



>ref|XP_007158264.1| hypothetical protein PHAVU_002G137800g [Phaseolus vulgaris]
 gb|ESW30258.1| hypothetical protein PHAVU_002G137800g [Phaseolus vulgaris]
Length=366

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 147/367 (40%), Positives = 194/367 (53%), Gaps = 47/367 (13%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGM-ICPRSSSTPKPSVFPVNSTIFASKVAALRSFPN-RGLANPNR  1064
             MA IS +   +  PV M + P +S TP   +F  N    +            R    P+R
Sbjct  1     MAQISVWVSPYSHPVPMALVPVTSRTP--FIFSQNVKPLSLSSPLSHLSLTPRSPRFPSR  58

Query  1063  KFVVRAVSD---------DEWGEE---------KKEPLSAAP--------------AG--  986
             +F   A  D         DEWGE+          K P S  P              AG  
Sbjct  59    RFRASAADDAGKPAGKISDEWGEDLEPEAQASSSKLPDSDPPKYEDEWEEGGEAPDAGGY  118

Query  985   --------VAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAK  830
                     +A    E     + + LK+ LVD+ YGT  G+ A SE RAEV EL+TQLEA 
Sbjct  119   IDGGNGTPIAETPAEEGVDDKVEGLKRALVDTLYGTELGIQAGSEVRAEVSELVTQLEAV  178

Query  829   NPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVV  650
             NP  AP E   +L+G WVL YT+   LFPLL+ G LPL++V+ I QTID+ SFT+ NS  
Sbjct  179   NPNLAPVEEPAILDGNWVLLYTASSELFPLLAAGRLPLLKVDRISQTIDTSSFTIINSTT  238

Query  649   FSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPF  470
              S P A+ S S +A FEVRSP R+Q+ F+EG +  P++   + LPENV+  GQK+ L P 
Sbjct  239   LSSPFASLSFSASASFEVRSPARIQVTFKEGSVQPPEIKSKVELPENVDIFGQKLSLQPL  298

Query  469   KGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLI  290
             +  +  LQ    ++ + IS QPPLK  +      SWLLTTYLD +LRISRG+ G +F+L 
Sbjct  299   QQSLGPLQGLVENISRVISGQPPLKIPIPGERTSSWLLTTYLDQDLRISRGDGG-LFILA  357

Query  289   KEDSPLL  269
             +E SPLL
Sbjct  358   REGSPLL  364



>ref|XP_008448650.1| PREDICTED: plastoglobulin-1, chloroplastic [Cucumis melo]
 ref|XP_008448651.1| PREDICTED: plastoglobulin-1, chloroplastic [Cucumis melo]
 ref|XP_008448652.1| PREDICTED: plastoglobulin-1, chloroplastic [Cucumis melo]
Length=367

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 126/258 (49%), Positives = 168/258 (65%), Gaps = 5/258 (2%)
 Frame = -3

Query  1039  DDEWG-EEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAE  863
             DDEWG +E     S          D+   L E   LK+ LVD+ YGT  G  A  E RAE
Sbjct  112   DDEWGGDEGNGKPSVVEEKSEEYADDRDKLLE---LKRCLVDTVYGTEFGFRAGLEERAE  168

Query  862   VVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTID  683
             ++E++ QLEA NPTPAP EA  LL+G W+L YT+F  L PLL+ G LPLV+VE+I Q ID
Sbjct  169   ILEIVNQLEAANPTPAPVEASGLLDGNWILLYTAFSELLPLLALGALPLVKVEKITQEID  228

Query  682   SESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVE  503
             S++FT+ NS   S P  T S S +A FEVRSP R+Q++F+EGI+  P++   + LPEN++
Sbjct  229   SKTFTIVNSTTLSSPFTTFSFSASAAFEVRSPSRIQVQFKEGILQPPEIKSRLDLPENID  288

Query  502   FLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRIS  323
               GQK++L+P +  +  +Q T +S+ + IS QPPLK  +      SWLL TYLD +LRIS
Sbjct  289   IFGQKVNLSPVQQTLNPVQQTVASLFQVISGQPPLKIPIPGDRNRSWLLITYLDEDLRIS  348

Query  322   RGEAGSIFVLIKEDSPLL  269
             RG+ G +FVL+KE S LL
Sbjct  349   RGDGG-LFVLVKEGSALL  365



>ref|XP_007040679.1| Plastid-lipid associated protein PAP / fibrillin family protein 
isoform 1 [Theobroma cacao]
 ref|XP_007040680.1| Plastid-lipid associated protein PAP / fibrillin family protein 
isoform 1 [Theobroma cacao]
 gb|EOY25180.1| Plastid-lipid associated protein PAP / fibrillin family protein 
isoform 1 [Theobroma cacao]
 gb|EOY25181.1| Plastid-lipid associated protein PAP / fibrillin family protein 
isoform 1 [Theobroma cacao]
Length=367

 Score =   218 bits (556),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 109/224 (49%), Positives = 150/224 (67%), Gaps = 1/224 (0%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSF  758
            LK+ LVD+ YGT  G     E RAEV+EL+ QLEA NPTPAP EA  LL+G WVL YT+ 
Sbjct  144  LKRCLVDTVYGTELGFRTGPEVRAEVLELVNQLEAVNPTPAPVEATQLLDGYWVLLYTAS  203

Query  757  IGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRV  578
              L PLL+ G+ PL++V+ I QTID+E  ++ NS   + P    S S +A FEVR+P R+
Sbjct  204  SELLPLLAAGSTPLLKVKSISQTIDTERLSIVNSTTLASPFVNFSFSASAAFEVRTPSRI  263

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPL  398
            Q++F+EG +  P++  SI LP +V+  GQKI L P +  +  LQ+  +++  +IS QPPL
Sbjct  264  QVEFKEGTLQPPEIKPSIDLPADVDVFGQKISLLPVQQSLNPLQELVANISTAISGQPPL  323

Query  397  KFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLK  266
            K  +    + SWLL TYLD +LRISRG+ G +FVL ++ SPLL+
Sbjct  324  KIPIPGERSGSWLLITYLDEDLRISRGDGG-LFVLARQGSPLLE  366



>gb|ERN06170.1| hypothetical protein AMTR_s00016p00122150 [Amborella trichopoda]
Length=157

 Score =   211 bits (537),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 127/156 (81%), Gaps = 2/156 (1%)
 Frame = -3

Query  730  GTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGII  551
            GTLP+++ EEI QTID+ESFTV+NSV+FSGPLATTS +T+AKFEVRSPKRVQ  FEEG+ 
Sbjct  2    GTLPILKAEEISQTIDAESFTVENSVLFSGPLATTSFTTHAKFEVRSPKRVQ--FEEGVF  59

Query  550  GTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNA  371
            GTPQLTDSI +PENVE LGQ I+L+PF+  IT LQD A+SV +SIS   P KF +    A
Sbjct  60   GTPQLTDSIEIPENVEVLGQTIELSPFREFITPLQDAATSVARSISGSTPFKFLITIDRA  119

Query  370  ESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLKP  263
            ESWLLTT+LD +L ISRG+A S+FVLIKE S LL P
Sbjct  120  ESWLLTTFLDEDLCISRGDASSVFVLIKEGSSLLPP  155



>ref|XP_003516983.1| PREDICTED: plastoglobulin-1, chloroplastic-like [Glycine max]
Length=370

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 127/265 (48%), Positives = 165/265 (62%), Gaps = 10/265 (4%)
 Frame = -3

Query  1039  DDEWGEEKKEPLSAAPA----GVAVVEDEPAALTETD----VLKKQLVDSFYGTNRGLSA  884
             +DEW +E   P +        G  V   E  A  E D     LK+ LVD+ YGT  G+ A
Sbjct  106   EDEW-QEGGAPDAGGYVDGGNGTPVTGAEDPAEEEVDDKLEALKRALVDTLYGTELGIRA  164

Query  883   SSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVE  704
              SE RAEV EL++QLEA NPT AP E   LLNG WVL YT+   L PLL+ G LPL++V+
Sbjct  165   GSEVRAEVSELVSQLEAANPTLAPVEEPALLNGNWVLLYTASSELLPLLAAGRLPLLKVD  224

Query  703   EICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSI  524
             +I QTID+ S T+ NS   S P A+ S S +A FEVR+P R+Q+ F+EG I  P++  ++
Sbjct  225   KITQTIDTSSSTIINSTTLSSPFASLSFSASASFEVRTPTRIQVTFKEGSIQPPEIKSNV  284

Query  523   VLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYL  344
              LPENV+  GQK+ L P +  +  LQ    ++ + IS QPPLK  +      SWLLTTYL
Sbjct  285   ELPENVDIFGQKLSLQPLQQSLGPLQGLVENISRVISGQPPLKIPIPGERTSSWLLTTYL  344

Query  343   DSELRISRGEAGSIFVLIKEDSPLL  269
             D +LRISRG+ G +FVL +E SPLL
Sbjct  345   DKDLRISRGDGG-LFVLAREGSPLL  368



>ref|XP_005645631.1| hypothetical protein COCSUDRAFT_17945 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21087.1| hypothetical protein COCSUDRAFT_17945 [Coccomyxa subellipsoidea 
C-169]
Length=296

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 153/221 (69%), Gaps = 4/221 (2%)
 Frame = -3

Query  940  VLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTS  761
            +++ QL+DS +GT RGLSASSE RAE+ ELITQLEAKNP P+ TEA  +L+G+W L YTS
Sbjct  10   LIQAQLLDSLFGTERGLSASSEVRAEINELITQLEAKNPNPSLTEAEKVLDGQWKLVYTS  69

Query  760  FIGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKR  581
               LF LL+   LP V V +I Q I++ +FTVQ +V    P + TS ST A FEVRSPKR
Sbjct  70   NSELFALLALSRLPFVSVGDITQKIEASTFTVQLTV----PFSRTSFSTTASFEVRSPKR  125

Query  580  VQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPP  401
            +Q++FE G + TP+L   + LP +V  LGQ IDL+  K   ++ Q+    + + +S QP 
Sbjct  126  LQVRFERGTVATPELLQDVELPSSVSVLGQPIDLSSLKPAQSAAQEAIQRLARLVSQQPD  185

Query  400  LKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDS  278
            L+F + +  A++WL+ T+LD + RI+RG+ GS+FVL+K+ S
Sbjct  186  LQFPITSDKAQAWLINTFLDEDTRITRGDGGSVFVLVKDVS  226



>ref|XP_002505473.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO66731.1| predicted protein, partial [Micromonas sp. RCC299]
Length=251

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 115/234 (49%), Positives = 153/234 (65%), Gaps = 11/234 (5%)
 Frame = -3

Query  943  DVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYT  764
            D +K +L+DSFYGTNRGLSASS+TRAEV ELI++LEA NPTP+P+  L  L+GKW L YT
Sbjct  12   DAVKSRLLDSFYGTNRGLSASSKTRAEVNELISRLEAMNPTPSPSYELAALSGKWRLVYT  71

Query  763  SFIGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPK  584
            S   +  LL+   LP + V +I QTID     V+N V FS P+  +S+S NA FEVRSPK
Sbjct  72   SNSEVMFLLAAENLPGLNVGDITQTIDGVGGRVENRVAFSAPMLESSVSANASFEVRSPK  131

Query  583  RVQIKFEEGIIGTPQLTDSIV----LPENVEFLGQKIDLTPFKGLI----TSLQDTASSV  428
            R+Q+KF+E  + TP +   +     LP  V+ +GQ ID  P   L+    + L D  + V
Sbjct  132  RLQVKFDEAGVETPTIVADVFQYMSLPMTVDVMGQSIDTAPLADLMQPFQSGLTDALNGV  191

Query  427  VKSISSQPPLKFSL---ANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSP  275
              ++S  P LK  L   A+  +E+WLLTTYLD +LRI+RG+ GS+FVL K + P
Sbjct  192  KSAVSGLPSLKVPLPESASPGSEAWLLTTYLDGDLRIARGDGGSVFVLTKVNDP  245



>emb|CAA75658.1| Plastid-lipid-Associated Protein [Solanum lycopersicum]
Length=146

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 123/143 (86%), Gaps = 4/143 (3%)
 Frame = -3

Query  1039  DDEWGEEKKEPLSAAPAGVAVVEDEPAAL-TETDVLKKQLVDSFYGTNRGLSASSETRAE  863
             +DEWG E ++    +P GVAVV++EP    +E ++LKKQL DSFYGTNRGLSASSETRAE
Sbjct  7     EDEWGPEVEK---LSPGGVAVVDEEPPKEPSEIELLKKQLADSFYGTNRGLSASSETRAE  63

Query  862   VVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTID  683
             +VELITQLE+KNP PAPTEALTLLNGKW+LAYTSF GLFP LSRG L LVRVEEI QTID
Sbjct  64    IVELITQLESKNPNPAPTEALTLLNGKWILAYTSFSGLFPSLSRGNLLLVRVEEISQTID  123

Query  682   SESFTVQNSVVFSGPLATTSIST  614
             SESFTVQ+S VF+GPL+TTSIST
Sbjct  124   SESFTVQDSAVFAGPLSTTSIST  146



>ref|XP_009349223.1| PREDICTED: plastoglobulin-1, chloroplastic-like [Pyrus x bretschneideri]
Length=353

 Score =   216 bits (550),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 125/263 (48%), Positives = 173/263 (66%), Gaps = 9/263 (3%)
 Frame = -3

Query  1042  SDDEWGEEKKEPL-----SAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASS  878
             ++DEWG    E +     SAA A +A+ E     LTE   LK+ LVD+ YGT  G  A S
Sbjct  93    NEDEWGGGGDEVVEVGNGSAAKAEIAIEEKVDTKLTE---LKRGLVDAVYGTEFGFRAGS  149

Query  877   ETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEI  698
             E RAEV+E ++QLEA NP PAPTE L +L+G WVL YT+   L PLL+ G+ P ++V +I
Sbjct  150   EVRAEVMEFVSQLEAANPNPAPTENLGILDGNWVLLYTASSELLPLLATGSTPFLKVNKI  209

Query  697   CQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVL  518
              Q I++ S T+ NS  FS P A+ S S +A FEVRSP R+Q++F+EG    P++  SI L
Sbjct  210   TQAINTSSLTILNSTTFSSPFASFSFSASASFEVRSPLRIQVEFKEGSFQPPEIKSSIDL  269

Query  517   PENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDS  338
             P+ V+  GQK++L+P +  ++ LQD  + + ++IS QPPLK S+     +SWL+ TYLD 
Sbjct  270   PQEVDVFGQKVNLSPVQQTLSPLQDAVAGISRTISGQPPLKVSIPGERTKSWLVITYLDE  329

Query  337   ELRISRGEAGSIFVLIKEDSPLL  269
             +LRISRG+ G +FVL +E S LL
Sbjct  330   DLRISRGDGG-LFVLAREGSVLL  351



>ref|XP_004244405.1| PREDICTED: plastoglobulin-1, chloroplastic [Solanum lycopersicum]
Length=418

 Score =   218 bits (555),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 120/274 (44%), Positives = 175/274 (64%), Gaps = 19/274 (7%)
 Frame = -3

Query  1090  NRGLANPNRKFVVRAVSDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSF  911
             N+G++ P       +  +D W E   E +    AGV   EDE  A      +K+ L+D+ 
Sbjct  162   NQGVSEP------ESTEEDGWDE--AEVVGRINAGVE--EDERVA-----EMKRCLIDTV  206

Query  910   YGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSR  731
             YGT+ GL ASSE RAE +EL+ +LEA NPTP   E   LL+G W+L +T+F  L PLL+ 
Sbjct  207   YGTDFGLRASSEVRAEALELVAKLEAANPTPTTVE---LLDGNWILVFTAFSELLPLLAV  263

Query  730   GTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGII  551
             GT+PL++VE+I QTI + S T++NS   S P+AT+S S  A FEV+S  R+Q++ +EG  
Sbjct  264   GTIPLLKVEKISQTISTSSLTIENSTTLSSPVATSSFSATAIFEVQSSSRIQVEIKEGTF  323

Query  550   GTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNA  371
               P++   I LPEN++  GQ I L+P +  +  L++  + + ++IS  PPLK  +     
Sbjct  324   KPPEIKSKIDLPENMDIFGQNISLSPLQQSLGPLENVVAGIARTISGLPPLKVPIPGERT  383

Query  370   ESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
             +SWL+TTY+DS+LRISRG+ G +FVL+KE+S LL
Sbjct  384   KSWLITTYVDSDLRISRGDGG-LFVLVKEESSLL  416



>sp|Q7XBW5.1|PAP3_ORYSJ RecName: Full=Probable plastid-lipid-associated protein 3, chloroplastic; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|AAL67595.1|AC018929_17 putative plastid-lipid associated protein [Oryza sativa Japonica 
Group]
 gb|AAP55143.1| plastid-lipid associated protein 3, chloroplast precursor, putative, 
expressed [Oryza sativa Japonica Group]
Length=374

 Score =   216 bits (551),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 123/276 (45%), Positives = 168/276 (61%), Gaps = 20/276 (7%)
 Frame = -3

Query  1036  DEWGEEK-KEPLSAAPAGVAVVEDEPAA-----------------LTETDVLKKQLVDSF  911
             DEWGE    EP S + A     +DE                        + LK+ LVD+ 
Sbjct  98    DEWGEPGVPEPQSTSAADPPTNDDEWGGDPAPPPPPPPVPEEDNEEERREELKRCLVDTV  157

Query  910   YGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSR  731
             YG++ G  ASSE R EV+EL+TQLEA NPTP P +A  LL G W+L YT++  L P+L+ 
Sbjct  158   YGSDLGFRASSEVRGEVLELVTQLEATNPTPEPVQATHLLAGNWILIYTAYSELLPILAV  217

Query  730   GTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGII  551
             G  PL +V+EI Q ID+ S T+ N+   S P A+ S S  A F+V+SP R++++F+EG  
Sbjct  218   GAAPLFKVDEISQEIDTNSMTIVNASTISSPFASFSFSATASFDVQSPSRIEVQFKEGSF  277

Query  550   GTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSL-ANSN  374
               P+++ S+ LP  V+  GQKI L P + ++  LQ   +S+  SIS QPPLK  +  N+ 
Sbjct  278   QPPKISSSVDLPAEVDIFGQKISLGPVQQVLNPLQQAFASIAGSISGQPPLKLPIPGNNR  337

Query  373   AESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLK  266
             A SWLLTTYLD +LRISRG+ G +F+L+KE SPLL 
Sbjct  338   ARSWLLTTYLDKDLRISRGDGG-LFILVKEGSPLLD  372



>ref|XP_004148751.1| PREDICTED: plastoglobulin-1, chloroplastic [Cucumis sativus]
 ref|XP_011650334.1| PREDICTED: plastoglobulin-1, chloroplastic [Cucumis sativus]
 ref|XP_011650335.1| PREDICTED: plastoglobulin-1, chloroplastic [Cucumis sativus]
 gb|KGN55727.1| hypothetical protein Csa_3G008840 [Cucumis sativus]
Length=363

 Score =   216 bits (550),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 124/259 (48%), Positives = 167/259 (64%), Gaps = 7/259 (3%)
 Frame = -3

Query  1039  DDEWG--EEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRA  866
             DDEWG  E   +P          V++    L     LK+ LVD+ YGT  G  A  E RA
Sbjct  108   DDEWGGDEGNGKPSVVEEKSEEYVDNRDKLLE----LKRCLVDTVYGTEFGFRAGLEERA  163

Query  865   EVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTI  686
             E++E++ QLEA NPTPAP EA  LL+G W+L YT+F  L PLL+ G LPLV+VE+I Q I
Sbjct  164   EILEIVNQLEAANPTPAPVEASGLLDGNWILVYTAFSELLPLLALGALPLVKVEKITQEI  223

Query  685   DSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENV  506
             DS + T+ NS   S P  T S S +A FEVRSP R+Q++F+EGI+  P++   + LPEN+
Sbjct  224   DSNTLTIVNSTTLSSPFTTFSFSASAAFEVRSPSRIQVQFKEGILQPPEIKSRLDLPENI  283

Query  505   EFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRI  326
             +  GQK++L+P +  +  +Q T +S+ + IS QPPLK  +     +SWLL TYLD +LRI
Sbjct  284   DIFGQKVNLSPVQQTLDPVQQTVASLFQVISGQPPLKIPIPGDRNKSWLLITYLDEDLRI  343

Query  325   SRGEAGSIFVLIKEDSPLL  269
             SRG+ G +FVL+KE S LL
Sbjct  344   SRGDGG-LFVLVKEGSALL  361



>gb|EEE51456.1| hypothetical protein OsJ_32570 [Oryza sativa Japonica Group]
Length=374

 Score =   216 bits (550),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 123/276 (45%), Positives = 168/276 (61%), Gaps = 20/276 (7%)
 Frame = -3

Query  1036  DEWGEEK-KEPLSAAPAGVAVVEDEPAA-----------------LTETDVLKKQLVDSF  911
             DEWGE    EP S + A     +DE                        + LK+ LVD+ 
Sbjct  98    DEWGEPGVPEPQSTSAADPPTNDDEWGGDPAPPPPPPPVPEEDNEEERREELKRCLVDTV  157

Query  910   YGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSR  731
             YG++ G  ASSE R EV+EL+TQLEA NPTP P +A  LL G W+L YT++  L P+L+ 
Sbjct  158   YGSDLGFRASSEVRGEVLELVTQLEATNPTPEPVQATHLLAGNWILIYTAYSELLPILAV  217

Query  730   GTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGII  551
             G  PL +V+EI Q ID+ S T+ N+   S P A+ S S  A F+V+SP R++++F+EG  
Sbjct  218   GAAPLFKVDEISQEIDTNSMTIVNASTISSPFASFSFSATASFDVQSPSRIEVQFKEGSF  277

Query  550   GTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSL-ANSN  374
               P+++ S+ LP  V+  GQKI L P + ++  LQ   +S+  SIS QPPLK  +  N+ 
Sbjct  278   QPPKISSSVDLPAEVDIFGQKISLGPVQQVLNPLQQAFASIAGSISGQPPLKLPIPGNNR  337

Query  373   AESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLLK  266
             A SWLLTTYLD +LRISRG+ G +F+L+KE SPLL 
Sbjct  338   ARSWLLTTYLDKDLRISRGDGG-LFILVKEGSPLLD  372



>ref|XP_008373508.1| PREDICTED: plastoglobulin-1, chloroplastic [Malus domestica]
Length=355

 Score =   213 bits (543),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 160/245 (65%), Gaps = 4/245 (2%)
 Frame = -3

Query  1003  SAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNP  824
             SAA   VA+ E     L+E   LK+ LVD+ YGT  G  A SE RAE +E ++QLEA NP
Sbjct  113   SAAKTEVAIEEKVDGKLSE---LKRGLVDTVYGTEFGFRAGSEVRAEALEFVSQLEAANP  169

Query  823   TPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFS  644
              PAPTE   LL+G WVL YT+   L PLL+ G  PL++V +I Q I+S S T+ NS   S
Sbjct  170   NPAPTENPGLLDGNWVLLYTASSELLPLLAAGGTPLLKVNKITQAINSSSLTILNSTTLS  229

Query  643   GPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKG  464
              P A+ S S +A FEVRSP R+Q++F+EG    P++  S+ LP+ VE  GQKI+L+P + 
Sbjct  230   SPFASFSFSASASFEVRSPSRIQVEFKEGSFQPPEIKSSVDLPQEVEIFGQKINLSPVQQ  289

Query  463   LITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKE  284
              +  LQD  + + ++IS QPPLK  +     +SWLL TYLD +LRISRG+ G +FVL +E
Sbjct  290   TLNPLQDAVAGISRTISGQPPLKVPVPGERTKSWLLITYLDEDLRISRGDGG-LFVLARE  348

Query  283   DSPLL  269
              SPLL
Sbjct  349   GSPLL  353



>gb|ADK79127.1| astaxanthin vesicles associated protein [Haematococcus pluvialis]
Length=306

 Score =   208 bits (530),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 111/223 (50%), Positives = 142/223 (64%), Gaps = 7/223 (3%)
 Frame = -3

Query  934  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFI  755
            K  L+DS YGT RGL+A SE RAE+ ELI QLEAKNPTP PTE L  L+G+W L YTS  
Sbjct  83   KAALLDSLYGTERGLTARSEIRAEINELIGQLEAKNPTPNPTEVLEKLDGEWRLMYTSSS  142

Query  754  GLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQ  575
             L  +L    LP V V ++ QTI+    TV+N VV SGPL+ T+++T A FEVRSPKR+Q
Sbjct  143  ALITVLGLKNLPFVTVGDLTQTINVAEQTVENKVVLSGPLSRTALTTRASFEVRSPKRLQ  202

Query  574  IKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKG----LITSLQDTAS---SVVKSI  416
            +K E G I TP+L   + +P ++  LGQ +DLT  K     L  SLQ   S   SV+ S 
Sbjct  203  LKLERGSIATPELLSDVEIPSSISLLGQAVDLTQLKDALVPLSNSLQGVVSQVNSVINST  262

Query  415  SSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIK  287
            +    L   L   NA++W LTTY D +LRI+RG+ GS+FV  +
Sbjct  263  AGPAGLSVPLQGENAQTWQLTTYADDDLRITRGDGGSVFVYCR  305



>gb|AFW58455.1| hypothetical protein ZEAMMB73_538731 [Zea mays]
Length=230

 Score =   201 bits (512),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 124/159 (78%), Gaps = 5/159 (3%)
 Frame = -3

Query  1039  DDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEV  860
             +DEW  E +    +A  G AV E   A   E   LK QL D+ YGT RGL ASSE+RA+V
Sbjct  60    EDEWVPEPEG--GSAVTGTAVAEAPEAG--EVAELKAQLKDALYGTERGLRASSESRAKV  115

Query  859   VELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLP-LVRVEEICQTID  683
             +ELITQLE +NPTPAPTEALTLLNGKW+LAYTSF  LFPLL  G LP LV+VEEI QTID
Sbjct  116   LELITQLETRNPTPAPTEALTLLNGKWILAYTSFSQLFPLLEFGKLPALVKVEEISQTID  175

Query  682   SESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKF  566
             S++FTVQN + FSGPLATTS+STNAKFE+RSPKRVQ++F
Sbjct  176   SKNFTVQNCIKFSGPLATTSVSTNAKFEIRSPKRVQVRF  214



>sp|Q9ZP40.1|PG1_PEA RecName: Full=Plastoglobulin-1, chloroplastic; Flags: Precursor 
[Pisum sativum]
 gb|AAD02288.1| plastoglobule associated protein PG1 precursor [Pisum sativum]
Length=358

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 112/223 (50%), Positives = 149/223 (67%), Gaps = 1/223 (0%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSF  758
            LK+ LVD+ YGT  G  A SE RAEV E + QLEA NPTPAP E   LLNG WVL YT+ 
Sbjct  135  LKRSLVDTVYGTELGFRARSEVRAEVSEFVAQLEAANPTPAPVEEPDLLNGNWVLLYTAS  194

Query  757  IGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRV  578
              L PLL+ G+LPL+++++I QTID++SFTV NS   S P A+ S S +A FEVRSP R+
Sbjct  195  SELLPLLAAGSLPLLKLDKISQTIDTDSFTVVNSTTLSSPFASFSFSVSASFEVRSPTRI  254

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPL  398
            Q+ F+EG +  P++   I LPEN+   GQ++ L P    +  L++  +++ + IS Q PL
Sbjct  255  QVTFKEGSLQPPEIKSKIDLPENINIFGQQLSLGPLLQSLGPLENVVANISRVISGQSPL  314

Query  397  KFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
            K  +      SWL+TTYLD +LRISRG+ G +FVL +E S LL
Sbjct  315  KIPIPGERTSSWLITTYLDKDLRISRGDGG-LFVLAREGSSLL  356



>ref|XP_001760672.1| predicted protein [Physcomitrella patens]
 gb|EDQ74411.1| predicted protein, partial [Physcomitrella patens]
Length=251

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/208 (45%), Positives = 135/208 (65%), Gaps = 2/208 (1%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSF  758
            LKK L ++ YGTN G++A+ ET A + ++ITQLEA NPTPAPTE L  +NGKW++AYTS 
Sbjct  1    LKKSLANAVYGTNWGMNATRETHAAIADIITQLEAVNPTPAPTENLETINGKWIMAYTSV  60

Query  757  IGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRV  578
                P ++   LPLV + EI Q ID++S T+ N+V F+GP   T+ +  A F+VRSPKR+
Sbjct  61   EEFLPFIAAKYLPLVNITEIAQDIDADSLTIDNTVSFTGPYMKTTFTKCASFDVRSPKRL  120

Query  577  QIKFEEGIIGTPQLTDSIVL--PENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQP  404
            Q+ +EE  I T Q+ + +V   PE  +F+G KI+L   K L+  ++D    V K  +S P
Sbjct  121  QMMYEESFIATSQVDEEVVDNGPEMTDFMGHKINLRGLKSLLQPIEDVTKQVTKQAASHP  180

Query  403  PLKFSLANSNAESWLLTTYLDSELRISR  320
            PL+     +  +SW + TY+D  +RI+R
Sbjct  181  PLRIPYPANTVQSWQVITYVDDCVRIAR  208



>ref|NP_001065482.2| Os10g0575700 [Oryza sativa Japonica Group]
 dbj|BAF27319.2| Os10g0575700 [Oryza sativa Japonica Group]
Length=409

 Score =   199 bits (506),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 123/311 (40%), Positives = 168/311 (54%), Gaps = 55/311 (18%)
 Frame = -3

Query  1036  DEWGEEK-KEPLSAAPAGVAVVEDEPAA-----------------LTETDVLKKQLVDSF  911
             DEWGE    EP S + A     +DE                        + LK+ LVD+ 
Sbjct  98    DEWGEPGVPEPQSTSAADPPTNDDEWGGDPAPPPPPPPVPEEDNEEERREELKRCLVDTV  157

Query  910   YGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSR  731
             YG++ G  ASSE R EV+EL+TQLEA NPTP P +A  LL G W+L YT++  L P+L+ 
Sbjct  158   YGSDLGFRASSEVRGEVLELVTQLEATNPTPEPVQATHLLAGNWILIYTAYSELLPILAV  217

Query  730   GTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQ--------  575
             G  PL +V+EI Q ID+ S T+ N+   S P A+ S S  A F+V+SP R++        
Sbjct  218   GAAPLFKVDEISQEIDTNSMTIVNASTISSPFASFSFSATASFDVQSPSRIEKLEMCIEI  277

Query  574   ---------------------------IKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLT  476
                                        ++F+EG    P+++ S+ LP  V+  GQKI L 
Sbjct  278   IEISDHQLSCANMYIDQTDMLMVIPMKVQFKEGSFQPPKISSSVDLPAEVDIFGQKISLG  337

Query  475   PFKGLITSLQDTASSVVKSISSQPPLKFSL-ANSNAESWLLTTYLDSELRISRGEAGSIF  299
             P + ++  LQ   +S+  SIS QPPLK  +  N+ A SWLLTTYLD +LRISRG+ G +F
Sbjct  338   PVQQVLNPLQQAFASIAGSISGQPPLKLPIPGNNRARSWLLTTYLDKDLRISRGDGG-LF  396

Query  298   VLIKEDSPLLK  266
             +L+KE SPLL 
Sbjct  397   ILVKEGSPLLD  407



>ref|XP_005846413.1| hypothetical protein CHLNCDRAFT_11571, partial [Chlorella variabilis]
 gb|EFN54311.1| hypothetical protein CHLNCDRAFT_11571, partial [Chlorella variabilis]
Length=228

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 146/224 (65%), Gaps = 9/224 (4%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQ------LEAKNPTPAPTEALTLLNGKWV  776
            LK  L+DSF+GT+RGL+ASS++RAE+ ELIT+      LEA NPTP P EA   L G W 
Sbjct  8    LKMALLDSFWGTDRGLAASSDSRAEINELITKAGRCRSLEALNPTPEPNEARQALGGTWR  67

Query  775  LAYTSFIGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEV  596
            LAYTS   L  LL+   LPLVRV EI Q+ID    TV+N V    PL+ TS+S  A FEV
Sbjct  68   LAYTSNSELVALLALARLPLVRVGEITQSIDPMGQTVENRVELEAPLSKTSLSATATFEV  127

Query  595  RSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSI  416
            RS K +Q+ FEEG + TPQL   + LP +++ LGQ+IDL P +G + S   T   ++  +
Sbjct  128  RSSKLLQVSFEEGRVATPQLLADLQLPASLDLLGQQIDLAPLQGPLRSALGTLGGLLSQV  187

Query  415  SSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKE  284
               P L+  + N  A SWLL TYLD  LRI+RG+ GS+FVL+++
Sbjct  188  ---PDLRIPVRNVQASSWLLNTYLDDSLRITRGDGGSVFVLVRD  228



>ref|XP_003612834.1| Plastoglobulin-1 [Medicago truncatula]
 gb|AES95792.1| plastid fibrillin [Medicago truncatula]
Length=355

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 125/265 (47%), Positives = 165/265 (62%), Gaps = 8/265 (3%)
 Frame = -3

Query  1042  SDDEWGEEKK-------EPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSA  884
             ++DEWGE  K       +  +  PA  +    E     E + LK+ LVD+ YGT  G  A
Sbjct  91    NEDEWGEGAKNDAGSYSDAGNGTPAFASEAPVEEGGNDELEGLKRALVDTVYGTELGFRA  150

Query  883   SSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVE  704
              SE RAEV E + QLEA NPTPAP E   LLNG WVL YT+   L PLL+ G LPLV+V+
Sbjct  151   GSEVRAEVSEFVAQLEAANPTPAPVEEPELLNGNWVLLYTASSELLPLLAAGALPLVKVD  210

Query  703   EICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSI  524
             +I QTID+ S TV NSV  S P A++S S +A FEVRSP R+Q+ F+EG +  P++   I
Sbjct  211   KILQTIDTYSSTVVNSVTLSSPFASSSFSASASFEVRSPTRIQVTFKEGSLQPPEIKSKI  270

Query  523   VLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYL  344
              LPEN+   GQ + L P +  +  L++  +++ + IS Q PLK  +      SWLLTTYL
Sbjct  271   DLPENINIFGQNLSLGPLQQSLGPLENVVANISRVISGQSPLKIPIPGERTSSWLLTTYL  330

Query  343   DSELRISRGEAGSIFVLIKEDSPLL  269
             D +LRISRG+ G +FVL +E SP+L
Sbjct  331   DKDLRISRGDGG-LFVLAREGSPIL  354



>gb|ACJ84215.1| unknown [Medicago truncatula]
Length=355

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 124/265 (47%), Positives = 164/265 (62%), Gaps = 8/265 (3%)
 Frame = -3

Query  1042  SDDEWGEEKK-------EPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSA  884
             ++DEWGE  K       +  +  PA  +    E     E + LK+ LVD+ YGT  G  A
Sbjct  91    NEDEWGEGAKNDAGSYSDAGNGTPAFASEAPVEEGGNDELEGLKRALVDTVYGTELGFRA  150

Query  883   SSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVE  704
              SE RAEV E + QLEA NPTPAP     LLNG WVL YT+   L PLL+ G LPLV+V+
Sbjct  151   GSEVRAEVSEFVAQLEAANPTPAPVGEPELLNGNWVLLYTASSELLPLLAAGALPLVKVD  210

Query  703   EICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSI  524
             +I QTID+ S TV NSV  S P A++S S +A FEVRSP R+Q+ F+EG +  P++   I
Sbjct  211   KILQTIDTYSSTVVNSVTLSSPFASSSFSASASFEVRSPTRIQVTFKEGSLQPPEIKSKI  270

Query  523   VLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYL  344
              LPEN+   GQ + L P +  +  L++  +++ + IS Q PLK  +      SWLLTTYL
Sbjct  271   DLPENINIFGQNLSLGPLQQSLGPLENVVANISRVISGQSPLKIPIPGERTSSWLLTTYL  330

Query  343   DSELRISRGEAGSIFVLIKEDSPLL  269
             D +LRISRG+ G +FVL +E SP+L
Sbjct  331   DKDLRISRGDGG-LFVLAREGSPIL  354



>gb|AFK33388.1| unknown [Medicago truncatula]
Length=355

 Score =   189 bits (480),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 123/265 (46%), Positives = 161/265 (61%), Gaps = 8/265 (3%)
 Frame = -3

Query  1042  SDDEWGEEKK-------EPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSA  884
             ++DEWGE  K       +  +  PA  +    E     E + LK+ LVD+ YGT  G  A
Sbjct  91    NEDEWGEGAKNDAGSYSDAGNGTPAFASEAPVEEGGNDELEGLKRALVDTVYGTELGFRA  150

Query  883   SSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVE  704
              SE RAEV E + QLEA NPTPAP     LLNG WVL YT+   L PLL+ G LPLV+V+
Sbjct  151   GSEVRAEVSEFVAQLEAANPTPAPVGEPELLNGNWVLLYTASSELLPLLAAGALPLVKVD  210

Query  703   EICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSI  524
             +I QTID+ S TV NSV  S P A++S S +A FEVRSP R+Q+ F+EG +  P++   I
Sbjct  211   KILQTIDTYSSTVVNSVTLSSPFASSSFSASASFEVRSPTRIQVTFKEGSLQPPEIKSKI  270

Query  523   VLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYL  344
              LPEN+   GQ   L P +     L++  +++ + IS Q P K  +      SWLLTTYL
Sbjct  271   DLPENINIFGQNFSLGPLQQFFGPLENVVANISRVISGQSPFKIPIPGERTSSWLLTTYL  330

Query  343   DSELRISRGEAGSIFVLIKEDSPLL  269
             D +LRISRG+ G +FVL +E SP+L
Sbjct  331   DKDLRISRGDGG-LFVLAREGSPIL  354



>ref|XP_008802537.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Phoenix dactylifera]
Length=190

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 132/206 (64%), Gaps = 54/206 (26%)
 Frame = -3

Query  967  EPAALTETDVLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLN  788
            EP+ + E   LK++L+D  YGT+RGL+ASSETRAE++ELITQLE+KNPTPAP EALTLLN
Sbjct  39   EPSEIGE---LKRKLMDLLYGTDRGLNASSETRAEILELITQLESKNPTPAPIEALTLLN  95

Query  787  GKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNA  608
            GKW LA ++             P + ++  C      SF +                   
Sbjct  96   GKWNLAKST-------------PEI-MDNWC------SFQI-------------------  116

Query  607  KFEVRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSV  428
                        KFEEGIIGTPQ+TDSIV+PE VEFLGQ IDL+PFKG+ITS+QD ASSV
Sbjct  117  ------------KFEEGIIGTPQITDSIVIPEKVEFLGQNIDLSPFKGVITSVQDAASSV  164

Query  427  VKSISSQPPLKFSLANSNAESWLLTT  350
             ++IS +PP K  ++N+N +SWLLTT
Sbjct  165  ARTISERPPWKIPISNNNTQSWLLTT  190



>ref|XP_009804524.1| PREDICTED: light-induced protein, chloroplastic-like [Nicotiana 
sylvestris]
Length=124

 Score =   177 bits (448),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = -3

Query  769  YTSFIGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRS  590
            YTSF GLFPLLSRGTLPLVRVEEI QTIDSE+F VQN VVF+GPLATTSI+TNAKFEV+S
Sbjct  28   YTSFSGLFPLLSRGTLPLVRVEEISQTIDSETFAVQNCVVFAGPLATTSITTNAKFEVKS  87

Query  589  PKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDL  479
            PKRVQIKF+EGIIGTPQLTDSI LPENVEFLGQKIDL
Sbjct  88   PKRVQIKFDEGIIGTPQLTDSIELPENVEFLGQKIDL  124



>gb|EPS69991.1| hypothetical protein M569_04771 [Genlisea aurea]
Length=325

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 112/263 (43%), Positives = 163/263 (62%), Gaps = 22/263 (8%)
 Frame = -3

Query  1036  DEWGEEKKEPLSAAPAGVAVVE-------DEPAALTETDVLKKQLVDSFYGTNRGLSASS  878
             DEW     EP S+  +  AV +       DE   L E   LK+ LVD+ YG++ G  AS+
Sbjct  77    DEWEASGVEPSSSNGSPGAVDDNSSNSKKDEEDLLLE---LKRALVDTVYGSDLGFRASA  133

Query  877   ETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEI  698
             E RAE +EL++QLEA NPTPAPTEA  LL+G W+L +T+F  L PLL+   +P V+VE I
Sbjct  134   EIRAEALELVSQLEAVNPTPAPTEAAALLDGNWILVFTAFSELLPLLAVNAIPSVKVERI  193

Query  697   CQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPQLTDSIVL  518
              Q+ID+ S  ++NS   S PL+T+S +++A FEVR+P R+Q++F+E     P++   I L
Sbjct  194   VQSIDTNSLAIENSATISTPLSTSSFTSSASFEVRTPFRIQVQFKEATFKPPEIKSRIDL  253

Query  517   PENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPLKFSLANSNAESWLLTTYLDS  338
             P      GQ I+L   + ++  L+    ++ + +S   PL   +  ++  SWLL TYLD 
Sbjct  254   P------GQNINL---QQILAPLEGGLENLARIVSGLSPLTVPVPRTS--SWLLITYLDE  302

Query  337   ELRISRGEAGSIFVLIKEDSPLL  269
             ++RISRG+ G +FVL+KE S LL
Sbjct  303   DVRISRGDGG-LFVLVKEGSSLL  324



>ref|XP_006367875.1| PREDICTED: plastoglobulin-1, chloroplastic-like [Solanum tuberosum]
Length=204

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 118/170 (69%), Gaps = 1/170 (1%)
 Frame = -3

Query  778  VLAYTSFIGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFE  599
            +L +T+F  L PLL+ GT+PL++VE+I QTI   S T++NS   S P+AT+S S  A FE
Sbjct  35   LLMFTAFSELLPLLAVGTIPLLKVEKISQTISMSSLTIENSTTLSSPVATSSFSATAVFE  94

Query  598  VRSPKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKS  419
            V+SP R+Q++F+EG    P++   I LP+NV+  GQ I L+P +  +  L++  + + ++
Sbjct  95   VQSPSRIQVEFKEGTFKPPEIKSKIDLPKNVDIFGQNISLSPLQQSLGPLENVVAGIARN  154

Query  418  ISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
            ISS PPLK  +     +SWL+TTYLDS+LRISRG+ G +FVL+KE S LL
Sbjct  155  ISSMPPLKVPIPGERTKSWLITTYLDSDLRISRGDGG-LFVLVKEQSSLL  203



>ref|XP_009789727.1| PREDICTED: plastoglobulin-1, chloroplastic-like, partial [Nicotiana 
sylvestris]
Length=184

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 115/167 (69%), Gaps = 1/167 (1%)
 Frame = -3

Query  769  YTSFIGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRS  590
            +T+F  L PLL+ GT+PL++VE I Q I + + T++NS   S P AT+S S NA FEVRS
Sbjct  17   FTAFSELLPLLAVGTIPLLKVENISQAISTSNLTIENSTTLSSPFATSSFSANAAFEVRS  76

Query  589  PKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISS  410
            P R+Q++F+EG +  P++   I LPENV+  GQ I L+P +  +  L++  + + ++IS 
Sbjct  77   PSRIQVEFKEGTVNPPEVKSKIDLPENVDIFGQTISLSPIQQSLGPLENVVAGIARAISG  136

Query  409  QPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
             PPLK  +     +SWL+TTYLD +LRISRG+ G +FVL+KE+S L+
Sbjct  137  LPPLKIPIPGERTKSWLITTYLDKDLRISRGDGG-LFVLVKEESSLI  182



>gb|EYU19055.1| hypothetical protein MIMGU_mgv1a026687mg, partial [Erythranthe 
guttata]
Length=168

 Score =   159 bits (402),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 114/167 (68%), Gaps = 1/167 (1%)
 Frame = -3

Query  769  YTSFIGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRS  590
            YT+   L PLL+ G++PLV+VE+I Q+ID+ S T+ NSV  S P++T S S +A FEVR+
Sbjct  1    YTASSELLPLLAAGSIPLVKVEKIVQSIDTSSLTIDNSVTLSSPVSTLSFSASASFEVRT  60

Query  589  PKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISS  410
            P R+Q++F++G    P++  SI LPE++   GQ I L+  +  ++ L++    + ++IS 
Sbjct  61   PSRIQVEFKQGTFKPPEIKSSIDLPESINIFGQNISLSSVQQYMSPLENAVEGLARTISG  120

Query  409  QPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
            QP LK  +     +SWLLTTYLD + RISRG+ G +FVL+KE SPLL
Sbjct  121  QPSLKIPIPGEGTKSWLLTTYLDKDFRISRGDGG-LFVLVKEGSPLL  166



>gb|KDO78380.1| hypothetical protein CISIN_1g020639mg [Citrus sinensis]
 gb|KDO78381.1| hypothetical protein CISIN_1g020639mg [Citrus sinensis]
Length=181

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 105/161 (65%), Gaps = 4/161 (2%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFASKVAALRSFPNRGLANPNRKF  1058
             MASIS   QF CK +    P +  T KPS+ P+NS   +  +A       +G        
Sbjct  1     MASISQTNQFPCKTLSQNPPHNQFTSKPSILPLNSVRISRSLAKKSFLSIQGFTRARPLV  60

Query  1057  VVRAVSDDEWGEEKKEPLSAAPAGVAVVEDE-PAALTETDVLKKQLVDSFYGTNRGLSAS  881
             + RA  DDEWG EK++    A   +AV E+E P  +TE D LKK LVDSFYGT+RGL+A+
Sbjct  61    LTRAADDDEWGPEKEKEEGGA---LAVAEEESPKEVTEIDNLKKALVDSFYGTDRGLNAT  117

Query  880   SETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSF  758
             SETRAE+VELITQLEAKNPTPAPTEALTLLN KW+L +  F
Sbjct  118   SETRAEIVELITQLEAKNPTPAPTEALTLLNAKWILVHIFF  158



>ref|XP_001692028.1| plastid lipid associated protein [Chlamydomonas reinhardtii]
 gb|EDP04518.1| plastid lipid associated protein [Chlamydomonas reinhardtii]
Length=314

 Score =   159 bits (402),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/227 (38%), Positives = 132/227 (58%), Gaps = 10/227 (4%)
 Frame = -3

Query  940  VLKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTS  761
            ++K  L+D+  GT RGL A SE RAE+ EL+ QLE +    A   +L    G W L YT+
Sbjct  82   IVKAALLDAICGTERGLVARSEVRAEINELVNQLEVQGGQGADVASLEF-EGTWELLYTN  140

Query  760  FIGLFPLLSRGTLPL--VRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSP  587
             + L  +L+   LPL  V++  + QTI+S   TV+NS+    PL  TS+ST + + V SP
Sbjct  141  AVELLAILAINKLPLSPVKIGAVTQTINSTDRTVENSLELQLPLIITSLSTVSNYNVASP  200

Query  586  KRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDT----ASSVVKS  419
            KR+Q   E G++ TP +  ++ LP ++  +GQ +DL P +  +  LQD     A+S    
Sbjct  201  KRLQFTVERGVLHTPSIEGNLELPASITVMGQTLDLAPLRDAVKPLQDATKGLAASASDL  260

Query  418  ISSQPPLKF---SLANSNAESWLLTTYLDSELRISRGEAGSIFVLIK  287
            +   P L+    SL  +N + W LTTYLD ELR++RG+ G++++  K
Sbjct  261  LGQAPDLELPLQSLGQANTQGWQLTTYLDPELRVTRGDGGAVYIFKK  307



>gb|AFA36496.1| fibrillin-like protein, partial [Lolium perenne]
Length=104

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = -3

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPL  398
            QIKF+EGIIGTPQLTDSIVLPE  EF GQ IDLTP  G+ TS+++ ASSV K+IS QPPL
Sbjct  1    QIKFDEGIIGTPQLTDSIVLPEKFEFFGQNIDLTPLSGIFTSIENAASSVAKTISGQPPL  60

Query  397  KFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKEDSPLL  269
            K  +++  A SWLLTTYLD ELRISRG+  SIFVL KE S LL
Sbjct  61   KIPISSDKAGSWLLTTYLDDELRISRGDGSSIFVLFKEGSTLL  103



>ref|XP_003592199.1| Plastid-lipid-associated protein [Medicago truncatula]
 gb|AES62450.1| plastid fibrillin [Medicago truncatula]
Length=198

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 99/147 (67%), Gaps = 16/147 (11%)
 Frame = -3

Query  1060  FVVRAVSDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSAS  881
             +V    +DDEWG    EP +       +V D      ET+ LKK LV  FYGT+ G  A+
Sbjct  3     YVQENANDDEWG---SEPSADVAVAEVIVTD-----IETEKLKKDLVGLFYGTDHGSKAA  54

Query  880   SETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEE  701
             SETRAE+ ELI+QLEAK PTPA T+AL+LL+GKW+LAYTS+ GLFPLLS G LP + VEE
Sbjct  55    SETRAEIFELISQLEAKFPTPASTDALSLLDGKWILAYTSYAGLFPLLSSGLLPFLEVEE  114

Query  700   ICQTIDSESFTVQNSVVFSGPLATTSI  620
             + QTID        SV+F+GPL TTSI
Sbjct  115   LSQTID--------SVLFAGPLTTTSI  133



>ref|XP_001698968.1| plastid lipid associated protein [Chlamydomonas reinhardtii]
 gb|EDO99022.1| plastid lipid associated protein [Chlamydomonas reinhardtii]
Length=320

 Score =   150 bits (379),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 91/244 (37%), Positives = 142/244 (58%), Gaps = 27/244 (11%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSF  758
            LK  L+D  YGT RG+ A+  TRA + E ++ LEA+NP   PT+A++ L G+W L YTS 
Sbjct  64   LKSGLLDLVYGTARGVHAAPVTRAAIEEFVSALEARNPHSVPTDAVSALAGRWKLVYTSN  123

Query  757  IGLFPLL-SRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKR  581
            +G   LL +   LPLV V ++CQTID  + T  N +  + P+   S+   A  EVRSP++
Sbjct  124  VGTVMLLGALDNLPLVDVGDVCQTIDPVTLTATNKIDIAVPV-LLSLRAEAGLEVRSPRQ  182

Query  580  VQIKFE----EGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSL-----------Q  446
             +++F     +  I TPQLT ++ +PE+V  LG  +DL P + L+  +           +
Sbjct  183  FKVQFTRVGLDTFIRTPQLTAALEIPESVTVLGATLDLGPLRRLVEPINSGLEVRVGGRR  242

Query  445  DTASSVV-KSIS-----SQPPLKFSLA----NSNAESWLLTTYLDSELRISRGEAGSIFV  296
            + A  ++ +++S     SQ P+   ++    +S A  W+LTTYLD  LRISR + G +FV
Sbjct  243  EAAQDLLGRAVSPEFGVSQVPMPPGISPGALSSAASLWMLTTYLDDNLRISRDDEGRVFV  302

Query  295  LIKE  284
            ++K+
Sbjct  303  MLKD  306



>ref|XP_001698965.1| plastid lipid associated protein [Chlamydomonas reinhardtii]
 gb|EDO99019.1| plastid lipid associated protein [Chlamydomonas reinhardtii]
Length=419

 Score =   152 bits (383),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 88/234 (38%), Positives = 137/234 (59%), Gaps = 19/234 (8%)
 Frame = -3

Query  934  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFI  755
            K  L+D+ Y T RG++A+ + RA + EL+  LEA+NP  APT+A++ L G+W L YTS +
Sbjct  176  KAALLDAVYATARGVNATPQQRAAIDELVAALEAQNPNTAPTDAVSALAGRWKLVYTSNV  235

Query  754  GLFPLL-SRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPK--  584
            G   LL +   LPLV V ++CQTID  + T  N V  + P+   S+   +  EVRSP+  
Sbjct  236  GTVMLLGALDNLPLVDVGDVCQTIDPVTLTATNKVDLAVPM-MLSLRAESGLEVRSPRQF  294

Query  583  ------RVQIKFE----EGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQ---D  443
                  + Q++      +  I TPQL  ++ +PE+V  LG  +DL P + L+  +    +
Sbjct  295  KSLTMHQTQVRLTKVGLDTFISTPQLLAALEIPESVTVLGATLDLGPLRRLVEPINNGLE  354

Query  442  TASSVVKSISSQPPLKFSLANSNAES-WLLTTYLDSELRISRGEAGSIFVLIKE  284
             A  ++  +++ P L    + S+A S W+LTTYLD  LRISR + G +FV++K+
Sbjct  355  AAQDLMNRVTA-PELPLGPSMSSAASLWMLTTYLDDNLRISRDDEGRVFVMLKD  407



>ref|XP_010279319.1| PREDICTED: plastid-lipid-associated protein, chloroplastic-like 
[Nelumbo nucifera]
Length=179

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 88/120 (73%), Gaps = 18/120 (15%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSF  758
            LKK L+DS YGT+RGL ASSETRA++VELITQLEAKN                   YTSF
Sbjct  78   LKKTLIDSLYGTDRGLRASSETRAKIVELITQLEAKN------------------QYTSF  119

Query  757  IGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRV  578
            +GLFPL  RGTLPLV+VEEI Q+IDS +F V+N V F+GPLATT++STNAKFE++  K V
Sbjct  120  MGLFPLFPRGTLPLVKVEEISQSIDSSNFMVENVVQFTGPLATTTLSTNAKFEIQRSKCV  179



>ref|XP_008800090.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic 
isoform X2 [Phoenix dactylifera]
Length=336

 Score =   145 bits (366),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 106/160 (66%), Gaps = 4/160 (3%)
 Frame = -3

Query  1045  VSDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSETRA  866
             + +DEWG   KEP S    G       P    +   LK+ LVD+ YGT+ GL AS+E RA
Sbjct  145   MDEDEWG---KEPGSGG-MGYISGNGSPVPSDKLGDLKRCLVDTLYGTDFGLRASAEVRA  200

Query  865   EVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEICQTI  686
             E++EL+ QLEA+NPT APT +  LL+G W+L YT+F  L PLL+ G  PL+++++I Q I
Sbjct  201   EILELVNQLEAENPTRAPTTSPELLDGNWILLYTAFSELLPLLAVGATPLLKIKKISQAI  260

Query  685   DSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQIKF  566
             D+++ T+ N+ + S P AT S S +A FEVRSP R+Q+++
Sbjct  261   DTKNMTIVNATMLSSPFATFSFSASASFEVRSPSRIQLRY  300



>ref|XP_003059745.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH55697.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=238

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 93/236 (39%), Positives = 130/236 (55%), Gaps = 21/236 (9%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEA--LTLLNGKWVLAYT  764
            +K QL+D+  GT RGL+AS   RA + ELI  LEA NPTP+P  A     L G+W +AYT
Sbjct  3    VKSQLMDAVAGTKRGLAASGAARARINELIATLEASNPTPSPATADGAAGLAGEWKIAYT  62

Query  763  SFIGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPK  584
            S   L  LL+   LP V + +I QTID  + TV+N V    PL  TS+   A FE  SPK
Sbjct  63   SASELLLLLASENLPGVTIGDITQTIDVVAGTVENRVNVRAPLIDTSLIATADFEATSPK  122

Query  583  RVQIKFEEGIIGTPQLTDS-----IVLPENVEFLGQKIDLTPFKGLITSLQDTA----SS  431
            R+++KF +  + TP +  S     I LP  ++  GQ ID T     +  L+  A      
Sbjct  123  RIRVKFTDAGVVTPSIDTSSVLQYIDLPPTIDVAGQIIDTTAASEALEPLRKAAEGALGG  182

Query  430  VVKSISSQPP-LKF---------SLANSNAESWLLTTYLDSELRISRGEAGSIFVL  293
            + +++ + PP LK          + A     +WLLTTYLD + R++RG+ GS+FV+
Sbjct  183  LAEAVKTLPPALKVPLPGGGLGAAGAEGAESTWLLTTYLDEDTRVARGDGGSVFVM  238



>ref|XP_011018505.1| PREDICTED: probable plastid-lipid-associated protein 3, chloroplastic 
isoform X2 [Populus euphratica]
Length=311

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 103/161 (64%), Gaps = 5/161 (3%)
 Frame = -3

Query  1045  VSDDEWGEE---KKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYGTNRGLSASSE  875
             ++DDEWGE+        +AAP+  + V  E     E   LK+ LVD+ YGT  G  A+ E
Sbjct  109   INDDEWGEQFVASGNGTAAAPSTSSAVVVEKDRRIED--LKRCLVDTVYGTEFGFRATPE  166

Query  874   TRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEIC  695
              RAEV+EL+ QLEA NPT AP +A  +L+GKWVL YT+F  L PLL+ G  PL++V+ I 
Sbjct  167   IRAEVLELVNQLEAVNPTSAPVDATGVLDGKWVLVYTAFSELLPLLAAGATPLLKVKSIS  226

Query  694   QTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQI  572
             QTIDS + ++ N    S P AT S S +A F+VR+P R+Q+
Sbjct  227   QTIDSSNLSIVNKTTLSSPFATFSFSASATFDVRTPSRIQV  267



>ref|XP_006588307.1| PREDICTED: plastoglobulin-1, chloroplastic-like [Glycine max]
Length=291

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 107/162 (66%), Gaps = 1/162 (1%)
 Frame = -3

Query  769  YTSFIGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRS  590
            YT+   L PLL+ G LPL++V++I QTID+ S T+ NS   S P A+ S S ++ FEV+S
Sbjct  129  YTASSELLPLLAAGRLPLLKVDKITQTIDTSSSTIINSTTLSSPFASLSFSASSSFEVQS  188

Query  589  PKRVQIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISS  410
            P R+Q+ F+EG I  P +  ++ LPENV+  GQK++L P +  +  LQ    ++ + IS 
Sbjct  189  PTRIQVAFKEGSIQAPDIKSNVELPENVDIFGQKLNLQPLQQSLGPLQGLVENISRVISG  248

Query  409  QPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKE  284
            QPPLK  +      SWLLTTYLD +LRISRG+ G +FVL +E
Sbjct  249  QPPLKIPIPGEKTSSWLLTTYLDKDLRISRGDGG-LFVLARE  289



>ref|XP_002945995.1| hypothetical protein VOLCADRAFT_46047 [Volvox carteri f. nagariensis]
 gb|EFJ52990.1| hypothetical protein VOLCADRAFT_46047, partial [Volvox carteri 
f. nagariensis]
Length=249

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 83/241 (34%), Positives = 127/241 (53%), Gaps = 24/241 (10%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSF  758
            L+  L++  YGT RG++A++  R  + EL+  LEA+NP  +PT+A+T L G+W L YTS 
Sbjct  3    LRADLLEMLYGTARGVTATAAQRTAIDELVAALEARNPNTSPTDAVTALGGRWKLVYTSN  62

Query  757  IGLFPLL-SRGTLPLVRVEEICQTIDSESFTVQNSVVFSGP------LAT---TSISTNA  608
            +    LL +   +PLV V ++ Q ID E  T  N     G       LA     S+   +
Sbjct  63   VATLLLLGALDGMPLVDVGDVVQIIDPEGLTATNKARERGKKKERIDLAVPVLLSLRAES  122

Query  607  KFEVRSPKRVQIKFE----EGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDT  440
              EVRSP++ +++      +  + TPQL  ++ +P +V  LG  +DLTP + L+  +   
Sbjct  123  GLEVRSPRQFKVRLTRVGLDTYVATPQLLAALEVPPSVTLLGATLDLTPLRKLLEPINSG  182

Query  439  ASSVV----------KSISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLI  290
              S+V           S+   P L     +  A  W+LTTYLD  LRISR + G +FV++
Sbjct  183  LESIVSRAVAPEISMDSVPVPPGLTRGSVSEAASLWMLTTYLDDTLRISRDDEGRVFVML  242

Query  289  K  287
            K
Sbjct  243  K  243



>ref|XP_002945997.1| hypothetical protein VOLCADRAFT_46017 [Volvox carteri f. nagariensis]
 gb|EFJ52992.1| hypothetical protein VOLCADRAFT_46017, partial [Volvox carteri 
f. nagariensis]
Length=247

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 86/241 (36%), Positives = 126/241 (52%), Gaps = 24/241 (10%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSF  758
            LK +L+D  YGT RG+SA+S  RA + EL+  LE +NP    T+A+T L G+W L YTS 
Sbjct  1    LKSRLLDMVYGTARGVSATSTQRAVIEELVEALELRNPNVMATDAVTALGGRWKLVYTSN  60

Query  757  IGLFPLL-SRGTLPLVRVEEICQTIDSESFTVQNSVVFSGP------LAT---TSISTNA  608
            +    LL +   +PLV V ++ Q ID E  T  N     G       LA     S+   +
Sbjct  61   VATLLLLGALDGMPLVDVGDVVQIIDPEGLTATNKARGRGKKKERIDLAVPVLLSLRAES  120

Query  607  KFEVRSPKRVQIKFE----EGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDT  440
              EVRSP++ +++      +  + TPQL  ++ +P +V  LG  +DLTP + L+  +   
Sbjct  121  GLEVRSPRQFKVRLTRVGLDTYVATPQLLAALEVPPSVTLLGATLDLTPLRKLLEPINSG  180

Query  439  ASSVV----------KSISSQPPLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLI  290
              S+V           S+   P L     +  A  W+LTTYLD  LRISR + G +FV++
Sbjct  181  LESIVSRAVAPEISMDSVPVPPGLTRGSVSEAASLWMLTTYLDDTLRISRDDEGRVFVML  240

Query  289  K  287
            K
Sbjct  241  K  241



>gb|KJB37718.1| hypothetical protein B456_006G217700 [Gossypium raimondii]
Length=274

 Score =   135 bits (340),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 84/122 (69%), Gaps = 0/122 (0%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSF  758
            LK+ LVDS YGT  G  A  E RAE++EL+ QLEA NPT AP EA  LL+G W+L YT+F
Sbjct  153  LKRCLVDSVYGTELGFRAGQELRAEILELVNQLEAVNPTRAPIEATQLLDGNWILLYTAF  212

Query  757  IGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRV  578
              L PLL+ G  PL++V+ I Q+ID+ S ++ NS   SGP A  S S +A FEVRSP R+
Sbjct  213  SELLPLLAAGATPLLKVKSISQSIDTASQSIVNSTTLSGPFADLSFSASATFEVRSPSRI  272

Query  577  QI  572
            QI
Sbjct  273  QI  274



>ref|XP_006432746.1| hypothetical protein CICLE_v10002003mg [Citrus clementina]
 gb|ESR45986.1| hypothetical protein CICLE_v10002003mg [Citrus clementina]
Length=298

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 96/144 (67%), Gaps = 2/144 (1%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSF  758
            LK+ LVD+ YGT  G  A S+ RAEV+EL+ QLEA NPTP P  A  +L+G WVL YT+F
Sbjct  157  LKRCLVDTVYGTELGFRAGSDVRAEVLELVNQLEALNPTPNPVNAAGVLDGNWVLVYTAF  216

Query  757  IGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRV  578
              L PLL+ G +PL++VE+ICQ ID+ S T++NS   S P A+ S S  A FEVRSP R+
Sbjct  217  SELLPLLAAGAIPLLKVEKICQKIDTSSLTIENSTTLSSPFASFSFSATASFEVRSPSRI  276

Query  577  QIKFEEGIIGTPQLTDSIVLPENV  506
            Q  +    + +  +T +  LP+N+
Sbjct  277  QCNWL--TLCSENVTCNTKLPQNL  298



>ref|XP_007040682.1| Plastid-lipid associated protein PAP / fibrillin family protein 
isoform 4 [Theobroma cacao]
 ref|XP_007040683.1| Plastid-lipid associated protein PAP / fibrillin family protein 
isoform 4 [Theobroma cacao]
 gb|EOY25183.1| Plastid-lipid associated protein PAP / fibrillin family protein 
isoform 4 [Theobroma cacao]
 gb|EOY25184.1| Plastid-lipid associated protein PAP / fibrillin family protein 
isoform 4 [Theobroma cacao]
Length=337

 Score =   132 bits (332),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 85/130 (65%), Gaps = 0/130 (0%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSF  758
            LK+ LVD+ YGT  G     E RAEV+EL+ QLEA NPTPAP EA  LL+G WVL YT+ 
Sbjct  144  LKRCLVDTVYGTELGFRTGPEVRAEVLELVNQLEAVNPTPAPVEATQLLDGYWVLLYTAS  203

Query  757  IGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRV  578
              L PLL+ G+ PL++V+ I QTID+E  ++ NS   + P    S S +A FEVR+P R+
Sbjct  204  SELLPLLAAGSTPLLKVKSISQTIDTERLSIVNSTTLASPFVNFSFSASAAFEVRTPSRI  263

Query  577  QIKFEEGIIG  548
            Q+  +  + G
Sbjct  264  QVNLKLNLTG  273



>ref|XP_007040681.1| Plastid-lipid associated protein PAP / fibrillin family protein 
isoform 3 [Theobroma cacao]
 gb|EOY25182.1| Plastid-lipid associated protein PAP / fibrillin family protein 
isoform 3 [Theobroma cacao]
Length=274

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 81/121 (67%), Gaps = 0/121 (0%)
 Frame = -3

Query  937  LKKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSF  758
            LK+ LVD+ YGT  G     E RAEV+EL+ QLEA NPTPAP EA  LL+G WVL YT+ 
Sbjct  144  LKRCLVDTVYGTELGFRTGPEVRAEVLELVNQLEAVNPTPAPVEATQLLDGYWVLLYTAS  203

Query  757  IGLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRV  578
              L PLL+ G+ PL++V+ I QTID+E  ++ NS   + P    S S +A FEVR+P R+
Sbjct  204  SELLPLLAAGSTPLLKVKSISQTIDTERLSIVNSTTLASPFVNFSFSASAAFEVRTPSRI  263

Query  577  Q  575
            Q
Sbjct  264  Q  264



>ref|XP_007158263.1| hypothetical protein PHAVU_002G137800g [Phaseolus vulgaris]
 gb|ESW30257.1| hypothetical protein PHAVU_002G137800g [Phaseolus vulgaris]
Length=265

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 100/162 (62%), Gaps = 6/162 (4%)
 Frame = -3

Query  1039  DDEWGEEKKEPLSAA----PAGVAVVED--EPAALTETDVLKKQLVDSFYGTNRGLSASS  878
             +DEW E  + P +        G  + E   E     + + LK+ LVD+ YGT  G+ A S
Sbjct  103   EDEWEEGGEAPDAGGYIDGGNGTPIAETPAEEGVDDKVEGLKRALVDTLYGTELGIQAGS  162

Query  877   ETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFIGLFPLLSRGTLPLVRVEEI  698
             E RAEV EL+TQLEA NP  AP E   +L+G WVL YT+   LFPLL+ G LPL++V+ I
Sbjct  163   EVRAEVSELVTQLEAVNPNLAPVEEPAILDGNWVLLYTASSELFPLLAAGRLPLLKVDRI  222

Query  697   CQTIDSESFTVQNSVVFSGPLATTSISTNAKFEVRSPKRVQI  572
              QTID+ SFT+ NS   S P A+ S S +A FEVRSP R+Q+
Sbjct  223   SQTIDTSSFTIINSTTLSSPFASLSFSASASFEVRSPARIQM  264



>gb|ACN41157.1| unknown [Picea sitchensis]
Length=161

 Score =   121 bits (304),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 100/164 (61%), Gaps = 13/164 (8%)
 Frame = -3

Query  1237  MASISSFTQFHCKPVGMICPRSSSTPKPSVFPVNSTIFAS-----KVAALRSFP---NRG  1082
             MA+ISSF+  H      +   +S + KP+   +++  FA+      V  L S P      
Sbjct  1     MAAISSFSAHHYANSPAVAQLTSGS-KPAASAISAVGFAASKPSNHVITLSSRPLSIFHA  59

Query  1081  LANPNRKFVVRAV-SDDEWGEEKKEPLSAAPAGVAVVEDEPAALTETDVLKKQLVDSFYG  905
               +    F V A+ ++DEW   K    + +     VVE+EP+ + +   LK+ LVDSFYG
Sbjct  60    WGSRRTNFKVFAIDAEDEWSGGKNGEEAPSTVTATVVEEEPSEMKD---LKRALVDSFYG  116

Query  904   TNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVL  773
             T+RGL ASSETRAE+VELITQLEAKNPTPAPTEAL LLNGKW+L
Sbjct  117   TDRGLRASSETRAEIVELITQLEAKNPTPAPTEALNLLNGKWIL  160



>ref|WP_007353810.1| MULTISPECIES: fibrillin [Kamptonema]
 emb|CBN54585.1| PAP fibrillin [ [[Oscillatoria] sp. PCC 6506]
Length=194

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 110/217 (51%), Gaps = 28/217 (13%)
 Frame = -3

Query  934  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFI  755
            K  L+++  G NRGL A+   +  ++  I QLE  NPTP P EA  LLNG W L YT+  
Sbjct  4    KSTLLEAIAGKNRGLLATETDKQAILAAIAQLEDYNPTPRPVEATELLNGDWRLLYTTSN  63

Query  754  GLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSG-PLATTSISTNAKFEVRSPKRV  578
            G   LL    LPL+++ +I Q+I +    V N     G P     +S  A+FEV S KRV
Sbjct  64   G---LLGFDKLPLIKLGQIYQSIRANEAKVYNIAELYGLPFVEGIVSVAARFEVVSEKRV  120

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPL  398
            Q+KFE  I+G  +L   I      +F+ Q          I + +  A++           
Sbjct  121  QVKFERSIVGLQRL---INYESPADFIAQ----------IEAGKKFAAA-----------  156

Query  397  KFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIK  287
             F L +   + WL  TYLDS+LRI RG  GS+FVL K
Sbjct  157  DFKLDSREQQGWLDITYLDSDLRIGRGNEGSVFVLTK  193



>ref|WP_016862318.1| fibrillin [Fischerella muscicola]
Length=194

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 80/217 (37%), Positives = 109/217 (50%), Gaps = 28/217 (13%)
 Frame = -3

Query  934  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFI  755
            K  L+++  G NRGL AS + R  ++  I  LE  NPTP P EA  LL+G W L YT+  
Sbjct  4    KATLLEAIAGKNRGLLASEQDRQAILIAIANLEDFNPTPRPVEAGDLLDGNWRLLYTTSK  63

Query  754  GLFPLLSRGTLPLVRVEEICQTIDSESFTVQN-SVVFSGPLATTSISTNAKFEVRSPKRV  578
             L  L      PL ++ +I Q I  +S +V N + ++  P     +S  AKFE  S +RV
Sbjct  64   ALLNL---DRFPLYKLGQIYQCIRVKSNSVYNIAEIYGLPFLEGIVSVAAKFEPVSGRRV  120

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPL  398
            Q+KFE  I+G  +L D                 +P         D     ++S    P +
Sbjct  121  QVKFERSIVGFQRLIDY---------------KSP---------DKYIQQIESGQKFPAI  156

Query  397  KFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIK  287
             FSL ++  + WL  TYLDSELRI RG  GS+FVL K
Sbjct  157  DFSLNSNEQQGWLDITYLDSELRIGRGNEGSVFVLTK  193



>ref|WP_039742995.1| fibrillin [Hassallia byssoidea]
 gb|KIF35617.1| fibrillin [Hassallia byssoidea VB512170]
Length=194

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 80/217 (37%), Positives = 111/217 (51%), Gaps = 28/217 (13%)
 Frame = -3

Query  934  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFI  755
            K  L+++   TNRG+ A+   +  ++  I  LE  NPTP P EA+ LLNG W L YT+ I
Sbjct  4    KAYLINAIASTNRGILATETEKQVILAAIANLEDLNPTPRPVEAVHLLNGNWRLLYTTSI  63

Query  754  GLFPLLSRGTLPLVRVEEICQTIDSESFTVQN-SVVFSGPLATTSISTNAKFEVRSPKRV  578
            GL  L     +PL +V +I Q I  E+ +V N + ++  PL    +S  AKFEV S +RV
Sbjct  64   GLLNL---DRIPLSKVGQIYQCIRVETNSVYNIAEIYGLPLLQGLVSVAAKFEVVSERRV  120

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPL  398
            ++KFE  IIG   L        N E   Q+I+              A     +I      
Sbjct  121  KVKFERSIIGLKNLIGY----SNPETFIQQIE--------------AGKKFTAID-----  157

Query  397  KFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIK  287
             F + +   + WL  TYLD++LRI RG  GS+FVL K
Sbjct  158  -FPIKSGEQQGWLDITYLDNDLRIGRGNEGSVFVLTK  193



>ref|WP_017310080.1| fibrillin [Fischerella sp. PCC 9339]
Length=194

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 107/217 (49%), Gaps = 28/217 (13%)
 Frame = -3

Query  934  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFI  755
            K  L+++  G NRGL AS + R  ++  I  LE  NPTP P EA  LL+G W L YTS  
Sbjct  4    KATLLEAIAGKNRGLLASEQDRQAILMAIANLEDLNPTPRPVEAGDLLDGNWRLLYTSSK  63

Query  754  GLFPLLSRGTLPLVRVEEICQTIDSESFTVQN-SVVFSGPLATTSISTNAKFEVRSPKRV  578
             L  L      PL ++ +I Q I  +S +V N + ++  P     +S  AKFE  S +RV
Sbjct  64   ALLNL---DRFPLYKLGQIYQCIRVKSNSVYNIAEIYGLPFLEGIVSVAAKFEPVSGRRV  120

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPL  398
            Q+KFE  I+G  +L                ID       I  ++D              +
Sbjct  121  QVKFERSIVGFQRL----------------IDYKSPDKYIQQIEDGQKFTA--------I  156

Query  397  KFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIK  287
             FS+ ++  + WL  TYLDSELRI RG  GS+FVL K
Sbjct  157  DFSINSNEQQGWLDITYLDSELRIGRGNEGSVFVLAK  193



>ref|WP_044450060.1| fibrillin [Mastigocladus laminosus]
 gb|KIY13054.1| fibrillin [Mastigocladus laminosus UU774]
Length=194

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 79/217 (36%), Positives = 107/217 (49%), Gaps = 28/217 (13%)
 Frame = -3

Query  934  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFI  755
            K  L+++  G NRGL AS + R  ++  I  LE  NPTP P EA  LL+G W L YTS  
Sbjct  4    KATLLEAIAGKNRGLLASEQDRQAILMAIANLEDLNPTPRPVEAGDLLDGNWRLLYTSSK  63

Query  754  GLFPLLSRGTLPLVRVEEICQTIDSESFTVQN-SVVFSGPLATTSISTNAKFEVRSPKRV  578
             L  L      PL ++ +I Q I  +S +V N + ++  P     +S  AKFE  S +RV
Sbjct  64   ALLNL---DRFPLYKLGQIYQCIRVKSNSVYNIAEIYGLPFLEGIVSVAAKFEPVSGRRV  120

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPL  398
            Q+KFE  I+G  +L                ID       I  ++D              +
Sbjct  121  QVKFERSIVGFQRL----------------IDYKSPDKYIQQIEDGQKFTA--------I  156

Query  397  KFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIK  287
             FS+ ++  + WL  TYLDSELRI RG  GS+FVL K
Sbjct  157  DFSINSNEQQGWLDITYLDSELRIGRGNEGSVFVLTK  193



>ref|WP_041226434.1| fibrillin [Crinalium epipsammum]
Length=194

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 113/217 (52%), Gaps = 28/217 (13%)
 Frame = -3

Query  934  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFI  755
            K +L+++  G NRGL A+   +  ++  ++QLE +NPTP P EAL LL G W L YTS  
Sbjct  4    KAKLLEAIAGKNRGLLATEVDKQAILVAVSQLEERNPTPKPFEALDLLEGNWRLLYTSSD  63

Query  754  GLFPLLSRGTLPLVRVEEICQTIDSESFTVQN-SVVFSGPLATTSISTNAKFEVRSPKRV  578
                LL     PL+++ +I Q I ++   V N + V+  P     +S  AKFEV +  RV
Sbjct  64   ---ELLRIDNFPLLKLGQIYQCIRAKDSRVYNIAEVYGLPYLEGLVSVAAKFEVLTKIRV  120

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPL  398
            Q+KFE  IIG  +L   +      EF+ Q                     +++    P +
Sbjct  121  QVKFERSIIGLQRL---VGYESPNEFIRQ---------------------IENGKKFPAI  156

Query  397  KFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIK  287
             F++ +++ + WL  TYLD +LRI RG  GS+FVL K
Sbjct  157  DFNINSNDQQGWLDITYLDEDLRIGRGNKGSVFVLTK  193



>gb|AFZ12211.1| PAP fibrillin family protein [Crinalium epipsammum PCC 9333]
Length=193

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 113/217 (52%), Gaps = 28/217 (13%)
 Frame = -3

Query  934  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFI  755
            K +L+++  G NRGL A+   +  ++  ++QLE +NPTP P EAL LL G W L YTS  
Sbjct  3    KAKLLEAIAGKNRGLLATEVDKQAILVAVSQLEERNPTPKPFEALDLLEGNWRLLYTSSD  62

Query  754  GLFPLLSRGTLPLVRVEEICQTIDSESFTVQN-SVVFSGPLATTSISTNAKFEVRSPKRV  578
                LL     PL+++ +I Q I ++   V N + V+  P     +S  AKFEV +  RV
Sbjct  63   ---ELLRIDNFPLLKLGQIYQCIRAKDSRVYNIAEVYGLPYLEGLVSVAAKFEVLTKIRV  119

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPL  398
            Q+KFE  IIG  +L   +      EF+ Q                     +++    P +
Sbjct  120  QVKFERSIIGLQRL---VGYESPNEFIRQ---------------------IENGKKFPAI  155

Query  397  KFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIK  287
             F++ +++ + WL  TYLD +LRI RG  GS+FVL K
Sbjct  156  DFNINSNDQQGWLDITYLDEDLRIGRGNKGSVFVLTK  192



>ref|WP_009545266.1| MULTISPECIES: fibrillin [Cyanothece]
Length=196

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 79/221 (36%), Positives = 108/221 (49%), Gaps = 34/221 (15%)
 Frame = -3

Query  934  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFI  755
            K +L+++  G NRGL AS   R  V+  I QLE  NP P+P +   LL G W L YT+  
Sbjct  4    KAKLLETIAGKNRGLLASEMDRVRVLSAIEQLEDHNPNPSPIKTPELLEGNWRLLYTTSK  63

Query  754  GLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSG-PLATTSISTNAKFEVRSPKRV  578
            G+  L      P++++ +I Q I  E   + N     G PL    +S  A+FE  S KRV
Sbjct  64   GILGL---DRFPVLQLGQIYQCIRIEEAKLYNIAEIVGVPLLEGIVSVAARFEATSDKRV  120

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQP--  404
            Q+KFE  I G  +L            LG +               + S ++K I +    
Sbjct  121  QVKFERYIAGLQRL------------LGYQ---------------SPSKLIKEIETGKKF  153

Query  403  -PLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKE  284
             PL FSL +   + WL  TYLD +LR+ RG  GS+FVL KE
Sbjct  154  FPLDFSLESREQQGWLEITYLDDDLRVGRGNEGSVFVLAKE  194



>ref|WP_006527167.1| fibrillin [Gloeocapsa sp. PCC 73106]
 gb|ELS00014.1| fibrillin [Gloeocapsa sp. PCC 73106]
Length=195

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 70/218 (32%), Positives = 113/218 (52%), Gaps = 28/218 (13%)
 Frame = -3

Query  934  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFI  755
            K  L+++  G NRGL A+   +  V+ L  QLE +NP P P +AL LL+G W L YT+  
Sbjct  4    KTALLEAIAGQNRGLLATEADKVRVLSLFQQLEDENPYPLPFQALNLLDGNWRLLYTTSR  63

Query  754  GLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSG-PLATTSISTNAKFEVRSPKRV  578
            G+  L     LPL+++ +I Q + +E   + N     G PL    +S  A+FEV S +RV
Sbjct  64   GILGL---NRLPLLQLGQIYQYLRAEQGILYNIAEIVGIPLLEGVVSVCARFEVVSERRV  120

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQPPL  398
             ++FE  +I   +L +                   ++  +  +++     ++     PP+
Sbjct  121  NVRFERSVIVLQRLIN-------------------YRSPLNFIEE-----IEGGKKFPPI  156

Query  397  KFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKE  284
             F+++N   + WL  TYLD ++R+ RG  G+IFVL KE
Sbjct  157  DFNISNREQKGWLEITYLDEDIRLGRGNEGNIFVLAKE  194



>gb|ACB52918.1| fibrillin [Cyanothece sp. ATCC 51142]
Length=212

 Score =   117 bits (293),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 79/221 (36%), Positives = 108/221 (49%), Gaps = 34/221 (15%)
 Frame = -3

Query  934  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFI  755
            K +L+++  G NRGL AS   R  V+  I QLE  NP P+P +   LL G W L YT+  
Sbjct  20   KAKLLETIAGKNRGLLASEMDRVRVLSAIEQLEDHNPNPSPIKTPELLEGNWRLLYTTSK  79

Query  754  GLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSG-PLATTSISTNAKFEVRSPKRV  578
            G+  L      P++++ +I Q I  E   + N     G PL    +S  A+FE  S KRV
Sbjct  80   GILGL---DRFPVLQLGQIYQCIRIEEAKLYNIAEIVGVPLLEGIVSVAARFEATSDKRV  136

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQP--  404
            Q+KFE  I G  +L            LG +               + S ++K I +    
Sbjct  137  QVKFERYIAGLQRL------------LGYQ---------------SPSKLIKEIETGKKF  169

Query  403  -PLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKE  284
             PL FSL +   + WL  TYLD +LR+ RG  GS+FVL KE
Sbjct  170  FPLDFSLESREQQGWLEITYLDDDLRVGRGNEGSVFVLAKE  210



>ref|WP_008274287.1| fibrillin [Cyanothece sp. CCY0110]
 gb|EAZ92714.1| fibrillin [Cyanothece sp. CCY0110]
Length=196

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 79/221 (36%), Positives = 107/221 (48%), Gaps = 34/221 (15%)
 Frame = -3

Query  934  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFI  755
            K +L+++  G NRGL AS   R +V+  I QLE  NP P P +   LL G W L YT+  
Sbjct  4    KAKLLETIAGKNRGLLASEMDRVKVLSAIEQLEDHNPNPNPIKTPELLEGNWRLLYTTSK  63

Query  754  GLFPLLSRGTLPLVRVEEICQTIDSESFTVQNSVVFSG-PLATTSISTNAKFEVRSPKRV  578
            G+  L      P++++ +I Q I  E   + N     G PL    +S  A+FE  S KRV
Sbjct  64   GILGL---DKFPVLQLGQIYQCIRVEEAKLYNIAEIVGVPLLEGLVSVAARFEPTSDKRV  120

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQP--  404
            Q+KFE  I G  +            FLG +               + + ++K I      
Sbjct  121  QVKFERYIAGLQK------------FLGYQ---------------SPNKLIKEIEKGKKF  153

Query  403  -PLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIKE  284
             PL FSL N   + WL  TYLD +LRI RG  GS+FVL +E
Sbjct  154  FPLDFSLENREQQGWLEITYLDDDLRIGRGNEGSVFVLSRE  194



>ref|WP_026733113.1| fibrillin [Fischerella sp. PCC 9605]
Length=194

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 109/220 (50%), Gaps = 34/220 (15%)
 Frame = -3

Query  934  KKQLVDSFYGTNRGLSASSETRAEVVELITQLEAKNPTPAPTEALTLLNGKWVLAYTSFI  755
            K  L+++  G NRGL AS + +  ++  I  LE  NPTP P EA  LL+G W L YT+  
Sbjct  4    KATLLEAIAGKNRGLLASEQDKQAILVAIANLEDLNPTPRPVEAGDLLDGNWRLLYTTSK  63

Query  754  GLFPLLSRGTLPLVRVEEICQTIDSESFTVQN-SVVFSGPLATTSISTNAKFEVRSPKRV  578
             L  L      PL ++ EI Q I   + +V N + ++  PL  + +S  AKFE  S +RV
Sbjct  64   ALLNL---DRFPLSKLGEIYQCIRVNTNSVYNIAEIYGLPLLESLVSVAAKFEPVSGRRV  120

Query  577  QIKFEEGIIGTPQLTDSIVLPENVEFLGQKIDLTPFKGLITSLQDTASSVVKSISSQP--  404
            Q+KFE  I+G  +L D                            ++  S ++ I +    
Sbjct  121  QVKFERSIVGLQRLID---------------------------YNSPDSFIQRIEAGQKF  153

Query  403  -PLKFSLANSNAESWLLTTYLDSELRISRGEAGSIFVLIK  287
              L F L ++  + WL  TYLDSELRI RG  GS+FVL K
Sbjct  154  TALDFPLNSNEQQGWLDITYLDSELRIGRGNEGSVFVLTK  193



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3699789985128