BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13833

Length=930
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009791345.1|  PREDICTED: rab11 family-interacting protein ...    128   4e-30   Nicotiana sylvestris
ref|XP_006339180.1|  PREDICTED: micronuclear linker histone polyp...    124   2e-28   Solanum tuberosum [potatoes]
ref|XP_010312207.1|  PREDICTED: cell wall protein RBR3                  122   3e-28   
ref|XP_009617728.1|  PREDICTED: uncharacterized protein LOC104110016    122   7e-28   Nicotiana tomentosiformis
ref|XP_009783701.1|  PREDICTED: protein WVD2-like 1                     122   7e-28   Nicotiana sylvestris
ref|XP_009608539.1|  PREDICTED: rab11 family-interacting protein ...    119   5e-27   Nicotiana tomentosiformis
ref|XP_011077774.1|  PREDICTED: micronuclear linker histone polyp...    116   5e-26   Sesamum indicum [beniseed]
ref|XP_011094204.1|  PREDICTED: uncharacterized protein LOC105173962    113   9e-25   Sesamum indicum [beniseed]
ref|XP_002524093.1|  conserved hypothetical protein                     111   3e-24   Ricinus communis
ref|XP_004228629.1|  PREDICTED: uncharacterized protein LOC101249396    109   2e-23   Solanum lycopersicum
emb|CDP10567.1|  unnamed protein product                                108   2e-23   Coffea canephora [robusta coffee]
gb|KHG09829.1|  30S ribosomal S8                                        108   4e-23   Gossypium arboreum [tree cotton]
ref|XP_002323363.2|  hypothetical protein POPTR_0016s06690g             108   4e-23   
ref|XP_011042551.1|  PREDICTED: uncharacterized protein LOC105138210    108   4e-23   Populus euphratica
gb|KJB16516.1|  hypothetical protein B456_002G233700                    108   4e-23   Gossypium raimondii
gb|KJB16520.1|  hypothetical protein B456_002G233700                    108   4e-23   Gossypium raimondii
gb|EPS68122.1|  hypothetical protein M569_06652                         101   6e-23   Genlisea aurea
ref|XP_006430022.1|  hypothetical protein CICLE_v10012108mg             107   8e-23   
ref|XP_006348433.1|  PREDICTED: micronuclear linker histone polyp...    107   1e-22   Solanum tuberosum [potatoes]
ref|XP_006481634.1|  PREDICTED: neurofilament heavy polypeptide-l...    107   1e-22   Citrus sinensis [apfelsine]
ref|XP_006481633.1|  PREDICTED: neurofilament heavy polypeptide-l...    107   1e-22   
ref|XP_004303390.1|  PREDICTED: uncharacterized protein LOC101300...    106   3e-22   Fragaria vesca subsp. vesca
ref|XP_012074268.1|  PREDICTED: uncharacterized protein LOC105635...    105   4e-22   Jatropha curcas
ref|XP_012074269.1|  PREDICTED: uncharacterized protein LOC105635...    105   4e-22   
ref|XP_010541818.1|  PREDICTED: general transcriptional corepress...    104   7e-22   Tarenaya hassleriana [spider flower]
ref|XP_007028040.1|  TPX2 family protein, putative isoform 1            104   8e-22   
ref|XP_007028041.1|  TPX2 family protein, putative isoform 2            104   9e-22   
ref|XP_007028042.1|  TPX2 family protein, putative isoform 3            103   9e-22   
gb|EYU38708.1|  hypothetical protein MIMGU_mgv1a007088mg                103   1e-21   Erythranthe guttata [common monkey flower]
ref|XP_007163000.1|  hypothetical protein PHAVU_001G197800g             103   2e-21   Phaseolus vulgaris [French bean]
ref|XP_010247933.1|  PREDICTED: uncharacterized protein LOC104590...    103   2e-21   Nelumbo nucifera [Indian lotus]
ref|XP_003535829.1|  PREDICTED: uncharacterized protein DDB_G0284...    103   2e-21   Glycine max [soybeans]
ref|XP_010247903.1|  PREDICTED: uncharacterized protein LOC104590...    103   3e-21   Nelumbo nucifera [Indian lotus]
ref|XP_004489868.1|  PREDICTED: uncharacterized protein LOC101509998  99.8    3e-21   
ref|XP_004136531.1|  PREDICTED: uncharacterized protein LOC101211...    102   4e-21   Cucumis sativus [cucumbers]
ref|XP_011652047.1|  PREDICTED: uncharacterized protein LOC101211...    102   4e-21   Cucumis sativus [cucumbers]
ref|XP_010525946.1|  PREDICTED: hepatoma-derived growth factor-re...    102   5e-21   Tarenaya hassleriana [spider flower]
ref|XP_008442956.1|  PREDICTED: neurofilament heavy polypeptide i...    102   6e-21   Cucumis melo [Oriental melon]
ref|XP_008442957.1|  PREDICTED: neurofilament heavy polypeptide i...    102   6e-21   
gb|EYU18154.1|  hypothetical protein MIMGU_mgv1a006530mg                101   8e-21   Erythranthe guttata [common monkey flower]
gb|KEH24283.1|  targeting protein for Xklp2 protein                     101   8e-21   Medicago truncatula
ref|XP_010696215.1|  PREDICTED: uncharacterized protein LOC104908...    101   9e-21   
ref|XP_010696225.1|  PREDICTED: uncharacterized protein LOC104908...    101   9e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006604667.1|  PREDICTED: micronuclear linker histone polyp...    101   1e-20   Glycine max [soybeans]
ref|XP_006604669.1|  PREDICTED: micronuclear linker histone polyp...    101   1e-20   Glycine max [soybeans]
ref|XP_010106961.1|  hypothetical protein L484_016889                   100   2e-20   Morus notabilis
ref|XP_010058838.1|  PREDICTED: uncharacterized protein LOC104446...    100   2e-20   Eucalyptus grandis [rose gum]
ref|XP_010058833.1|  PREDICTED: uncharacterized protein LOC104446...    100   2e-20   Eucalyptus grandis [rose gum]
ref|XP_010058819.1|  PREDICTED: uncharacterized protein LOC104446...    100   2e-20   Eucalyptus grandis [rose gum]
ref|XP_009348636.1|  PREDICTED: uncharacterized protein LOC103940268    100   2e-20   Pyrus x bretschneideri [bai li]
ref|XP_010058844.1|  PREDICTED: uncharacterized protein LOC104446...    100   2e-20   Eucalyptus grandis [rose gum]
ref|XP_010505111.1|  PREDICTED: protein WAVE-DAMPENED 2-like          97.1    3e-20   Camelina sativa [gold-of-pleasure]
gb|KEH41827.1|  TPX2 (targeting protein for Xklp2) family protein     99.8    4e-20   Medicago truncatula
ref|XP_008387137.1|  PREDICTED: neurofilament heavy polypeptide-like  99.8    4e-20   Malus domestica [apple tree]
ref|XP_003519103.1|  PREDICTED: uncharacterized protein DDB_G0284...  99.4    4e-20   Glycine max [soybeans]
ref|XP_009362663.1|  PREDICTED: uncharacterized protein LOC103952721  99.8    5e-20   Pyrus x bretschneideri [bai li]
ref|NP_565829.1|  TPX2 (targeting protein for Xklp2)-like protein     99.0    5e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007145768.1|  hypothetical protein PHAVU_007G266000g           99.4    5e-20   Phaseolus vulgaris [French bean]
ref|XP_006826420.1|  PREDICTED: uncharacterized protein LOC18421644   99.8    6e-20   Amborella trichopoda
ref|XP_010263082.1|  PREDICTED: uncharacterized protein LOC104601...  99.4    6e-20   Nelumbo nucifera [Indian lotus]
ref|XP_006295617.1|  hypothetical protein CARUB_v10024730mg           99.0    6e-20   Capsella rubella
ref|XP_002881415.1|  hypothetical protein ARALYDRAFT_482558           99.0    6e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_010263081.1|  PREDICTED: uncharacterized protein LOC104601...  99.4    7e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010677582.1|  PREDICTED: protein WVD2-like 1                   99.4    8e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008790219.1|  PREDICTED: uncharacterized protein LOC103707486  98.6    1e-19   Phoenix dactylifera
ref|XP_004497628.1|  PREDICTED: biorientation of chromosomes in c...  97.8    2e-19   Cicer arietinum [garbanzo]
gb|KJB65826.1|  hypothetical protein B456_010G115100                  97.8    2e-19   Gossypium raimondii
ref|XP_010516794.1|  PREDICTED: general transcriptional corepress...  97.4    2e-19   Camelina sativa [gold-of-pleasure]
gb|KJB65828.1|  hypothetical protein B456_010G115100                  97.8    2e-19   Gossypium raimondii
gb|KJB65827.1|  hypothetical protein B456_010G115100                  97.8    2e-19   Gossypium raimondii
gb|KHG18348.1|  Abnormal spindle-like microcephaly-associated pro...  97.1    3e-19   Gossypium arboreum [tree cotton]
ref|XP_002515513.1|  conserved hypothetical protein                   97.1    3e-19   Ricinus communis
ref|XP_008241097.1|  PREDICTED: nucleolar and coiled-body phospho...  97.4    3e-19   Prunus mume [ume]
ref|XP_009133052.1|  PREDICTED: general transcriptional corepress...  96.7    3e-19   Brassica rapa
gb|KJB16518.1|  hypothetical protein B456_002G233700                  97.1    3e-19   Gossypium raimondii
emb|CDX79632.1|  BnaC03g19680D                                        96.3    3e-19   
emb|CDX75079.1|  BnaA05g08250D                                        96.7    4e-19   
ref|XP_002308335.2|  hypothetical protein POPTR_0006s21470g           97.1    4e-19   
emb|CDX84593.1|  BnaA03g16370D                                        96.3    4e-19   
gb|EMT24340.1|  hypothetical protein F775_04460                       95.9    4e-19   
ref|XP_011047144.1|  PREDICTED: uncharacterized protein LOC105141583  97.1    4e-19   Populus euphratica
ref|XP_003549281.1|  PREDICTED: protein gar2-like isoform X1          97.1    5e-19   Glycine max [soybeans]
ref|XP_009143624.1|  PREDICTED: neurofilament heavy polypeptide-like  96.7    5e-19   Brassica rapa
ref|XP_006601154.1|  PREDICTED: protein gar2-like isoform X3          96.7    5e-19   Glycine max [soybeans]
ref|XP_006410758.1|  hypothetical protein EUTSA_v10016634mg           96.7    5e-19   Eutrema salsugineum [saltwater cress]
emb|CDX84165.1|  BnaC04g09270D                                        96.3    6e-19   
gb|EMS54637.1|  hypothetical protein TRIUR3_19981                     95.1    7e-19   Triticum urartu
ref|XP_009415304.1|  PREDICTED: uncharacterized protein LOC103996173  95.9    8e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010509545.1|  PREDICTED: general transcriptional corepress...  95.5    9e-19   Camelina sativa [gold-of-pleasure]
ref|XP_007161209.1|  hypothetical protein PHAVU_001G051200g           95.5    1e-18   Phaseolus vulgaris [French bean]
ref|XP_003545471.1|  PREDICTED: micronuclear linker histone polyp...  95.5    1e-18   Glycine max [soybeans]
ref|XP_006596104.1|  PREDICTED: micronuclear linker histone polyp...  95.1    2e-18   Glycine max [soybeans]
gb|ABK95344.1|  unknown                                               94.4    2e-18   Populus trichocarpa [western balsam poplar]
ref|XP_009392362.1|  PREDICTED: serine/arginine repetitive matrix...  94.4    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK46777.1|  unknown                                               94.0    2e-18   Lotus japonicus
ref|XP_002324860.2|  hypothetical protein POPTR_0018s01730g           94.4    2e-18   
ref|XP_006662975.1|  PREDICTED: protein WAVE-DAMPENED 2-like          92.8    3e-18   
ref|XP_011036554.1|  PREDICTED: uncharacterized protein LOC105134...  94.0    3e-18   Populus euphratica
ref|XP_011036553.1|  PREDICTED: uncharacterized protein LOC105134...  94.0    3e-18   Populus euphratica
ref|XP_011467173.1|  PREDICTED: uncharacterized protein LOC101300...  94.4    3e-18   Fragaria vesca subsp. vesca
gb|EPS64572.1|  hypothetical protein M569_10209                       89.7    4e-18   Genlisea aurea
emb|CDP13518.1|  unnamed protein product                              93.6    5e-18   Coffea canephora [robusta coffee]
ref|XP_010250125.1|  PREDICTED: uncharacterized protein LOC104592447  94.0    5e-18   Nelumbo nucifera [Indian lotus]
gb|AES59018.2|  TPX2 (targeting protein for Xklp2) family protein     93.2    6e-18   Medicago truncatula
ref|XP_003588767.1|  Seed specific protein Bn15D14A                   93.2    7e-18   
gb|EEC68390.1|  hypothetical protein OsI_36542                        92.8    9e-18   Oryza sativa Indica Group [Indian rice]
ref|NP_001068122.1|  Os11g0571900                                     92.8    9e-18   
ref|XP_009415983.1|  PREDICTED: uncharacterized protein LOC103996729  92.4    1e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010917924.1|  PREDICTED: uncharacterized protein LOC105042421  92.8    1e-17   Elaeis guineensis
gb|EYU32347.1|  hypothetical protein MIMGU_mgv1a007026mg              92.0    1e-17   Erythranthe guttata [common monkey flower]
ref|XP_010526215.1|  PREDICTED: peptidyl-prolyl isomerase cwc-27-...  92.0    2e-17   Tarenaya hassleriana [spider flower]
gb|KJB55012.1|  hypothetical protein B456_009G058200                  92.0    2e-17   Gossypium raimondii
ref|XP_009589928.1|  PREDICTED: neurofilament medium polypeptide-...  91.7    2e-17   Nicotiana tomentosiformis
ref|XP_009589927.1|  PREDICTED: RNA polymerase II degradation fac...  91.7    2e-17   Nicotiana tomentosiformis
ref|XP_010526217.1|  PREDICTED: peptidyl-prolyl isomerase cwc-27-...  92.0    2e-17   Tarenaya hassleriana [spider flower]
ref|XP_002878856.1|  hypothetical protein ARALYDRAFT_481399           91.3    2e-17   
gb|KJB07046.1|  hypothetical protein B456_001G033600                  90.1    2e-17   Gossypium raimondii
ref|XP_010546566.1|  PREDICTED: protein WVD2-like 1 isoform X1        91.7    2e-17   Tarenaya hassleriana [spider flower]
ref|XP_010546567.1|  PREDICTED: protein WVD2-like 1 isoform X2        91.7    2e-17   Tarenaya hassleriana [spider flower]
tpg|DAA42159.1|  TPA: hypothetical protein ZEAMMB73_567014            89.4    2e-17   
ref|XP_009589926.1|  PREDICTED: RNA polymerase II degradation fac...  91.7    2e-17   Nicotiana tomentosiformis
gb|KJB07048.1|  hypothetical protein B456_001G033600                  91.3    2e-17   Gossypium raimondii
ref|XP_009803429.1|  PREDICTED: histone H1-I-like isoform X1          91.7    2e-17   Nicotiana sylvestris
ref|XP_009589924.1|  PREDICTED: RNA polymerase II degradation fac...  91.7    2e-17   Nicotiana tomentosiformis
ref|XP_009803431.1|  PREDICTED: histone H1-I-like isoform X2          91.7    2e-17   Nicotiana sylvestris
ref|XP_009803432.1|  PREDICTED: histone H1-I-like isoform X3          91.7    2e-17   Nicotiana sylvestris
ref|XP_004965929.1|  PREDICTED: neurofilament heavy polypeptide-like  90.9    3e-17   Setaria italica
ref|XP_004498741.1|  PREDICTED: serine-rich adhesin for platelets...  91.7    3e-17   Cicer arietinum [garbanzo]
gb|KJB07045.1|  hypothetical protein B456_001G033600                  90.9    3e-17   Gossypium raimondii
gb|KJB07043.1|  hypothetical protein B456_001G033600                  91.7    3e-17   Gossypium raimondii
gb|KJB07042.1|  hypothetical protein B456_001G033600                  91.7    3e-17   Gossypium raimondii
gb|KJB07044.1|  hypothetical protein B456_001G033600                  91.3    3e-17   Gossypium raimondii
gb|KJB82700.1|  hypothetical protein B456_013G214800                  89.4    3e-17   Gossypium raimondii
gb|KJB07047.1|  hypothetical protein B456_001G033600                  91.3    3e-17   Gossypium raimondii
ref|XP_011039686.1|  PREDICTED: ankyrin repeat domain-containing ...  91.3    3e-17   Populus euphratica
ref|XP_003526407.1|  PREDICTED: neurofilament heavy polypeptide-l...  91.3    4e-17   Glycine max [soybeans]
ref|XP_006647040.1|  PREDICTED: microtubule-associated protein 1B...  90.5    4e-17   Oryza brachyantha
ref|XP_009412316.1|  PREDICTED: uncharacterized protein LOC103993842  90.9    4e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010102672.1|  hypothetical protein L484_000806                 90.9    5e-17   Morus notabilis
ref|XP_004979518.1|  PREDICTED: protein WVD2-like 1-like              90.9    5e-17   Setaria italica
gb|ACL52672.1|  unknown                                               90.1    5e-17   Zea mays [maize]
gb|ACG45595.1|  WDL1                                                  89.7    5e-17   Zea mays [maize]
ref|XP_009405789.1|  PREDICTED: neurofilament heavy polypeptide-l...  90.1    6e-17   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY23322.1|  BnaA08g12240D                                        90.1    6e-17   Brassica napus [oilseed rape]
ref|NP_001130992.1|  uncharacterized protein LOC100192097             89.7    6e-17   Zea mays [maize]
ref|XP_009108879.1|  PREDICTED: protein WVD2-like 1 isoform X1        90.1    6e-17   Brassica rapa
ref|XP_009108881.1|  PREDICTED: protein WVD2-like 1 isoform X2        90.1    6e-17   Brassica rapa
ref|XP_010648669.1|  PREDICTED: nucleolar and coiled-body phospho...  90.1    6e-17   Vitis vinifera
ref|XP_002309627.2|  hypothetical protein POPTR_0006s27050g           90.1    7e-17   
ref|XP_002449726.1|  hypothetical protein SORBIDRAFT_05g022180        90.1    7e-17   
emb|CBI21044.3|  unnamed protein product                              90.1    7e-17   Vitis vinifera
ref|NP_001168424.1|  hypothetical protein                             89.4    7e-17   Zea mays [maize]
ref|XP_006283755.1|  hypothetical protein CARUB_v10004833mg           90.1    8e-17   Capsella rubella
gb|KJB82702.1|  hypothetical protein B456_013G214800                  90.1    8e-17   Gossypium raimondii
tpg|DAA42158.1|  TPA: lymphoid organ expressed yellow head virus ...  90.1    8e-17   
ref|NP_001149997.1|  LOC100283624                                     90.1    8e-17   Zea mays [maize]
ref|XP_012076560.1|  PREDICTED: serine/threonine-protein kinase P...  90.1    8e-17   Jatropha curcas
ref|NP_567893.1|  TPX2 (targeting protein for Xklp2) protein family   89.7    9e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006353688.1|  PREDICTED: protein WVD2-like 1-like              87.8    9e-17   Solanum tuberosum [potatoes]
ref|NP_974659.1|  TPX2 (targeting protein for Xklp2) protein family   89.7    9e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008394082.1|  PREDICTED: neurofilament heavy polypeptide-l...  90.1    9e-17   
ref|XP_008352059.1|  PREDICTED: neurofilament heavy polypeptide-l...  90.1    9e-17   
ref|XP_008352057.1|  PREDICTED: neurofilament heavy polypeptide-l...  90.1    9e-17   
ref|XP_008394080.1|  PREDICTED: neurofilament heavy polypeptide-l...  90.1    9e-17   
ref|XP_007223133.1|  hypothetical protein PRUPE_ppa005440mg           89.7    1e-16   Prunus persica
ref|XP_006412488.1|  hypothetical protein EUTSA_v10025240mg           89.7    1e-16   Eutrema salsugineum [saltwater cress]
ref|XP_006412487.1|  hypothetical protein EUTSA_v10025240mg           89.7    1e-16   Eutrema salsugineum [saltwater cress]
gb|EYU20263.1|  hypothetical protein MIMGU_mgv1a007003mg              89.4    1e-16   Erythranthe guttata [common monkey flower]
ref|XP_008219499.1|  PREDICTED: neurofilament heavy polypeptide i...  89.7    1e-16   Prunus mume [ume]
ref|XP_008219498.1|  PREDICTED: neurofilament heavy polypeptide i...  89.7    1e-16   Prunus mume [ume]
ref|XP_006412486.1|  hypothetical protein EUTSA_v10025240mg           89.4    1e-16   Eutrema salsugineum [saltwater cress]
ref|XP_002869282.1|  hypothetical protein ARALYDRAFT_491495           89.7    1e-16   
ref|XP_009800879.1|  PREDICTED: uncharacterized protein LOC104246...  89.7    1e-16   Nicotiana sylvestris
ref|XP_009800881.1|  PREDICTED: uncharacterized protein LOC104246...  89.7    1e-16   Nicotiana sylvestris
ref|XP_008219500.1|  PREDICTED: neurofilament heavy polypeptide i...  89.7    1e-16   Prunus mume [ume]
ref|XP_008676785.1|  PREDICTED: uncharacterized protein LOC100272...  89.7    1e-16   Zea mays [maize]
ref|XP_009624287.1|  PREDICTED: DNA ligase 1-like isoform X1          89.7    1e-16   Nicotiana tomentosiformis
ref|NP_001140809.1|  uncharacterized protein LOC100272884             89.7    1e-16   Zea mays [maize]
ref|XP_010437923.1|  PREDICTED: uncharacterized protein LOC104721...  89.4    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010437921.1|  PREDICTED: uncharacterized protein LOC104721...  89.4    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009624289.1|  PREDICTED: DNA ligase 1-like isoform X2          89.7    1e-16   Nicotiana tomentosiformis
ref|XP_011070068.1|  PREDICTED: protein WVD2-like 1 isoform X2        89.7    1e-16   Sesamum indicum [beniseed]
ref|XP_011069988.1|  PREDICTED: protein WVD2-like 1 isoform X1        89.7    1e-16   Sesamum indicum [beniseed]
ref|XP_011459178.1|  PREDICTED: uncharacterized protein LOC101310...  89.7    1e-16   Fragaria vesca subsp. vesca
ref|XP_004291456.1|  PREDICTED: uncharacterized protein LOC101310...  89.7    1e-16   Fragaria vesca subsp. vesca
ref|XP_010447404.1|  PREDICTED: uncharacterized protein LOC104730...  89.4    1e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010447406.1|  PREDICTED: uncharacterized protein LOC104730...  89.4    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_011070147.1|  PREDICTED: protein WVD2-like 1 isoform X3        89.4    2e-16   Sesamum indicum [beniseed]
ref|XP_010525961.1|  PREDICTED: protein WVD2-like 1 isoform X2        88.6    2e-16   Tarenaya hassleriana [spider flower]
ref|XP_006364924.1|  PREDICTED: micronuclear linker histone polyp...  89.4    2e-16   Solanum tuberosum [potatoes]
ref|XP_004245024.1|  PREDICTED: RNA polymerase II degradation fac...  89.0    2e-16   Solanum lycopersicum
ref|XP_010525960.1|  PREDICTED: protein WVD2-like 1 isoform X1        88.6    2e-16   Tarenaya hassleriana [spider flower]
ref|XP_007011861.1|  TPX2 family protein, putative                    89.0    2e-16   
ref|XP_003603388.1|  BRI1-KD interacting protein 118-like protein     88.2    2e-16   
ref|NP_001159176.1|  hypothetical protein                             88.2    2e-16   Zea mays [maize]
gb|AES73638.2|  TPX2 (targeting protein for Xklp2) family protein     88.6    2e-16   Medicago truncatula
gb|AFK45470.1|  unknown                                               88.6    3e-16   Medicago truncatula
ref|XP_009376919.1|  PREDICTED: serine/arginine repetitive matrix...  88.6    3e-16   Pyrus x bretschneideri [bai li]
ref|XP_009376920.1|  PREDICTED: serine/arginine repetitive matrix...  88.6    3e-16   Pyrus x bretschneideri [bai li]
ref|XP_003603387.1|  BRI1-KD interacting protein 118-like protein     88.6    3e-16   
ref|XP_009376921.1|  PREDICTED: serine/arginine repetitive matrix...  88.6    3e-16   
gb|AFW70700.1|  hypothetical protein ZEAMMB73_271181                  87.4    3e-16   
ref|XP_008378377.1|  PREDICTED: neurofilament heavy polypeptide-l...  88.2    3e-16   
ref|XP_008378378.1|  PREDICTED: neurofilament heavy polypeptide-l...  88.2    3e-16   
ref|XP_008378379.1|  PREDICTED: neurofilament heavy polypeptide-l...  88.2    4e-16   
ref|XP_006483365.1|  PREDICTED: enolase-phosphatase E1-like isofo...  88.2    4e-16   Citrus sinensis [apfelsine]
gb|KDO61734.1|  hypothetical protein CISIN_1g013648mg                 88.2    4e-16   Citrus sinensis [apfelsine]
ref|XP_006450433.1|  hypothetical protein CICLE_v10008326mg           88.2    4e-16   Citrus clementina [clementine]
ref|XP_006656223.1|  PREDICTED: neurofilament heavy polypeptide-like  87.4    4e-16   Oryza brachyantha
ref|XP_004241776.1|  PREDICTED: RNA polymerase II degradation fac...  88.2    4e-16   Solanum lycopersicum
ref|XP_010322719.1|  PREDICTED: RNA polymerase II degradation fac...  88.2    4e-16   
ref|XP_010322718.1|  PREDICTED: RNA polymerase II degradation fac...  88.2    4e-16   Solanum lycopersicum
ref|XP_010322717.1|  PREDICTED: RNA polymerase II degradation fac...  88.2    4e-16   Solanum lycopersicum
ref|NP_001058026.1|  Os06g0606800                                     87.0    4e-16   
ref|XP_010322721.1|  PREDICTED: serine/arginine repetitive matrix...  88.2    4e-16   
ref|XP_010322720.1|  PREDICTED: serine/arginine repetitive matrix...  88.2    4e-16   Solanum lycopersicum
ref|NP_001046221.1|  Os02g0200800                                     86.7    4e-16   
ref|XP_003563653.1|  PREDICTED: protein WVD2-like 1                   87.0    5e-16   Brachypodium distachyon [annual false brome]
ref|XP_008466404.1|  PREDICTED: probable GPI-anchored adhesin-lik...  88.2    5e-16   Cucumis melo [Oriental melon]
ref|XP_006578145.1|  PREDICTED: neurofilament heavy polypeptide i...  87.8    5e-16   
ref|XP_003522613.1|  PREDICTED: neurofilament heavy polypeptide i...  87.8    5e-16   Glycine max [soybeans]
ref|XP_010048967.1|  PREDICTED: uncharacterized protein LOC104437670  87.8    5e-16   Eucalyptus grandis [rose gum]
ref|XP_009355746.1|  PREDICTED: titin-like isoform X2                 87.8    5e-16   Pyrus x bretschneideri [bai li]
gb|KCW81395.1|  hypothetical protein EUGRSUZ_C02774                   87.4    5e-16   Eucalyptus grandis [rose gum]
ref|XP_009355744.1|  PREDICTED: titin-like isoform X1                 87.8    5e-16   Pyrus x bretschneideri [bai li]
ref|XP_004136350.1|  PREDICTED: nucleolar and coiled-body phospho...  88.2    5e-16   Cucumis sativus [cucumbers]
ref|XP_004501334.1|  PREDICTED: uncharacterized protein DDB_G0284...  87.8    5e-16   Cicer arietinum [garbanzo]
dbj|BAD36112.1|  BRI1-KD interacting protein 118-like                 83.2    6e-16   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK04989.1|  predicted protein                                    87.0    6e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAD15848.1|  putative BRI1-KD interacting protein                 87.0    6e-16   Oryza sativa Japonica Group [Japonica rice]
gb|EAY84904.1|  hypothetical protein OsI_06272                        87.0    6e-16   Oryza sativa Indica Group [Indian rice]
gb|EMT19041.1|  hypothetical protein F775_30851                       87.4    7e-16   
ref|XP_006578144.1|  PREDICTED: neurofilament heavy polypeptide i...  87.4    7e-16   
ref|XP_003575947.1|  PREDICTED: E3 ubiquitin-protein ligase TRIP12    87.4    8e-16   Brachypodium distachyon [annual false brome]
ref|XP_007137018.1|  hypothetical protein PHAVU_009G093100g           87.0    1e-15   Phaseolus vulgaris [French bean]
ref|NP_001148491.1|  LOC100282106                                     86.3    1e-15   Zea mays [maize]
ref|NP_180118.2|  TPX2 (targeting protein for Xklp2) family protein   86.3    1e-15   Arabidopsis thaliana [mouse-ear cress]
gb|AAD20707.1|  unknown protein                                       86.3    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006842059.1|  PREDICTED: uncharacterized protein LOC18431876   86.7    1e-15   Amborella trichopoda
ref|XP_007161211.1|  hypothetical protein PHAVU_001G051200g           85.9    2e-15   Phaseolus vulgaris [French bean]
ref|XP_009405787.1|  PREDICTED: uncharacterized protein LOC103988...  85.5    2e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002962886.1|  hypothetical protein SELMODRAFT_38526            79.0    3e-15   
ref|XP_009376913.1|  PREDICTED: titin-like isoform X1                 85.5    3e-15   
ref|XP_009376914.1|  PREDICTED: titin-like isoform X2                 85.5    3e-15   Pyrus x bretschneideri [bai li]
ref|XP_010048196.1|  PREDICTED: cylicin-1-like                        84.7    5e-15   Eucalyptus grandis [rose gum]
ref|XP_010437922.1|  PREDICTED: general transcriptional corepress...  84.7    5e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010447405.1|  PREDICTED: uncharacterized protein LOC104730...  84.7    6e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010447403.1|  PREDICTED: uncharacterized protein LOC104730...  84.7    6e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010932896.1|  PREDICTED: protein WVD2-like 1                   84.3    6e-15   Elaeis guineensis
gb|KDO80219.1|  hypothetical protein CISIN_1g012146mg                 84.7    6e-15   Citrus sinensis [apfelsine]
gb|KDO80221.1|  hypothetical protein CISIN_1g012146mg                 84.7    6e-15   Citrus sinensis [apfelsine]
ref|XP_006450904.1|  hypothetical protein CICLE_v10008193mg           84.7    6e-15   
ref|XP_006475864.1|  PREDICTED: uncharacterized protein LOC102610...  84.7    6e-15   
ref|XP_006450903.1|  hypothetical protein CICLE_v10008193mg           84.3    6e-15   
ref|XP_006475865.1|  PREDICTED: uncharacterized protein LOC102610...  84.7    6e-15   
ref|XP_006450902.1|  hypothetical protein CICLE_v10008193mg           84.7    7e-15   
ref|XP_006475866.1|  PREDICTED: uncharacterized protein LOC102610...  84.3    7e-15   
ref|XP_006450901.1|  hypothetical protein CICLE_v10008193mg           84.3    7e-15   
ref|XP_002451734.1|  hypothetical protein SORBIDRAFT_04g006860        83.2    1e-14   
gb|ACR34932.1|  unknown                                               83.2    1e-14   Zea mays [maize]
ref|NP_001152149.1|  WDL1                                             83.2    1e-14   
ref|XP_002438655.1|  hypothetical protein SORBIDRAFT_10g023700        83.2    1e-14   
ref|XP_006410757.1|  hypothetical protein EUTSA_v10016634mg           83.6    1e-14   
ref|XP_008806231.1|  PREDICTED: protein WVD2-like 1                   83.2    1e-14   Phoenix dactylifera
emb|CDX72356.1|  BnaC07g43780D                                        83.2    2e-14   
ref|XP_004979598.1|  PREDICTED: protein WVD2-like 1-like              82.4    2e-14   
ref|XP_009138078.1|  PREDICTED: uncharacterized protein LOC103862...  83.2    2e-14   Brassica rapa
gb|KDO70678.1|  hypothetical protein CISIN_1g011063mg                 82.4    2e-14   Citrus sinensis [apfelsine]
ref|XP_009138080.1|  PREDICTED: uncharacterized protein LOC103862...  83.2    2e-14   Brassica rapa
emb|CDY13483.1|  BnaA03g52010D                                        82.8    2e-14   Brassica napus [oilseed rape]
gb|KDO70677.1|  hypothetical protein CISIN_1g011063mg                 82.0    2e-14   Citrus sinensis [apfelsine]
ref|XP_006430026.1|  hypothetical protein CICLE_v10012108mg           82.0    2e-14   
emb|CBI28213.3|  unnamed protein product                              82.8    2e-14   Vitis vinifera
ref|XP_010905445.1|  PREDICTED: protein WVD2-like 1                   82.4    2e-14   Elaeis guineensis
ref|XP_006663019.1|  PREDICTED: protein WVD2-like 1-like              82.4    3e-14   Oryza brachyantha
ref|XP_008677395.1|  PREDICTED: WDL1 isoform X1                       82.4    3e-14   
ref|XP_002282218.1|  PREDICTED: troponin T, skeletal muscle-like      82.8    3e-14   Vitis vinifera
ref|NP_001068194.1|  Os11g0592600                                     82.4    3e-14   
ref|XP_009126143.1|  PREDICTED: serine/arginine repetitive matrix...  82.0    4e-14   Brassica rapa
emb|CDX75236.1|  BnaA01g04660D                                        82.0    4e-14   
emb|CDX68836.1|  BnaC01g06170D                                        82.0    4e-14   
ref|XP_009126164.1|  PREDICTED: serine/arginine repetitive matrix...  82.0    4e-14   
dbj|BAK06368.1|  predicted protein                                    77.4    6e-14   
ref|XP_003577402.1|  PREDICTED: protein WVD2-like 1                   81.3    7e-14   
ref|XP_009397016.1|  PREDICTED: protein WVD2-like 1                   80.9    7e-14   
ref|XP_008777693.1|  PREDICTED: protein WVD2-like 1                   79.3    1e-13   
gb|KJB72326.1|  hypothetical protein B456_011G171200                  79.0    2e-13   
gb|KJB72324.1|  hypothetical protein B456_011G171200                  79.0    2e-13   
emb|CAN82789.1|  hypothetical protein VITISV_030600                   80.1    2e-13   
gb|KHG06101.1|  hypothetical protein F383_32475                       79.7    2e-13   
gb|KHG06100.1|  hypothetical protein F383_32475                       79.7    2e-13   
gb|KJB72325.1|  hypothetical protein B456_011G171200                  79.0    2e-13   
ref|XP_010650007.1|  PREDICTED: protein WVD2-like 1 isoform X2        79.7    2e-13   
ref|XP_002284360.1|  PREDICTED: protein WVD2-like 1 isoform X1        79.7    2e-13   
ref|XP_009389026.1|  PREDICTED: protein WVD2-like 1 isoform X3        79.3    3e-13   
emb|CBI26373.3|  unnamed protein product                              79.7    3e-13   
ref|XP_009389023.1|  PREDICTED: protein WVD2-like 1 isoform X1        79.3    3e-13   
ref|XP_008392000.1|  PREDICTED: uncharacterized protein LOC103454187  79.7    3e-13   
ref|XP_009389025.1|  PREDICTED: protein WVD2-like 1 isoform X2        79.0    3e-13   
ref|XP_006430023.1|  hypothetical protein CICLE_v10012108mg           78.2    4e-13   
ref|XP_006481635.1|  PREDICTED: neurofilament heavy polypeptide-l...  78.2    4e-13   
gb|EMS64350.1|  hypothetical protein TRIUR3_26680                     79.0    5e-13   
gb|EMT24638.1|  hypothetical protein F775_07554                       78.6    5e-13   
emb|CBI75536.1|  Targeting protein for Xklp2 domain containing pr...  78.6    5e-13   
ref|XP_002267972.2|  PREDICTED: protein WVD2-like 1                   78.2    6e-13   
gb|EMS49189.1|  hypothetical protein TRIUR3_05320                     78.6    7e-13   
ref|XP_007034996.1|  TPX2 family protein, putative isoform 6          78.2    8e-13   
emb|CBI35180.3|  unnamed protein product                              78.2    8e-13   
ref|XP_007034991.1|  TPX2 family protein, putative isoform 1          78.2    8e-13   
ref|XP_006588462.1|  PREDICTED: uncharacterized protein LOC100798...  77.8    1e-12   
ref|NP_001242515.1|  uncharacterized protein LOC100798109             77.8    1e-12   
ref|NP_001239708.1|  uncharacterized protein LOC100797456             77.4    1e-12   
ref|XP_006588461.1|  PREDICTED: uncharacterized protein LOC100798...  77.8    1e-12   
ref|XP_009398385.1|  PREDICTED: protein WVD2-like 1 isoform X1        77.0    1e-12   
ref|XP_009398386.1|  PREDICTED: protein WVD2-like 1 isoform X2        77.0    1e-12   
gb|EYU32521.1|  hypothetical protein MIMGU_mgv1a024698mg              75.9    2e-12   
ref|XP_002312576.1|  hypothetical protein POPTR_0008s16270g           77.0    2e-12   
ref|XP_007144068.1|  hypothetical protein PHAVU_007G125800g           76.6    2e-12   
emb|CAN66334.1|  hypothetical protein VITISV_000602                   76.6    2e-12   
ref|XP_011029866.1|  PREDICTED: uncharacterized protein LOC105129481  77.0    2e-12   
ref|XP_008360383.1|  PREDICTED: uncharacterized protein LOC103424087  76.6    3e-12   
ref|XP_009378794.1|  PREDICTED: uncharacterized protein LOC103967244  76.6    3e-12   
ref|XP_001769462.1|  predicted protein                                72.0    3e-12   
ref|XP_009347796.1|  PREDICTED: uncharacterized protein LOC103939433  76.6    3e-12   
ref|XP_010436296.1|  PREDICTED: transcriptional regulator ATRX ho...  75.5    3e-12   
ref|XP_006420125.1|  hypothetical protein CICLE_v10005113mg           76.3    3e-12   
gb|KHN22588.1|  hypothetical protein glysoja_037738                   75.9    4e-12   
ref|XP_002517010.1|  conserved hypothetical protein                   75.9    4e-12   
ref|XP_009413929.1|  PREDICTED: protein WVD2-like 1 isoform X2        74.3    6e-12   
ref|XP_009408478.1|  PREDICTED: protein WVD2-like 1                   75.1    6e-12   
ref|XP_006431338.1|  hypothetical protein CICLE_v10003186mg           75.1    6e-12   
ref|XP_011030548.1|  PREDICTED: uncharacterized protein LOC105129...  75.5    6e-12   
gb|AFK44597.1|  unknown                                               71.6    7e-12   
ref|XP_006378356.1|  hypothetical protein POPTR_0010s08670g           75.5    7e-12   
ref|XP_011030549.1|  PREDICTED: uncharacterized protein LOC105129...  75.5    7e-12   
ref|XP_011030546.1|  PREDICTED: uncharacterized protein LOC105129...  75.5    7e-12   
ref|XP_006489531.1|  PREDICTED: uncharacterized protein LOC102620...  75.5    7e-12   
gb|ABK93119.1|  unknown                                               75.5    7e-12   
ref|XP_002314647.2|  hypothetical protein POPTR_0010s08670g           75.5    8e-12   
ref|XP_009413924.1|  PREDICTED: protein WVD2-like 1 isoform X1        74.3    8e-12   
gb|KDO45898.1|  hypothetical protein CISIN_1g0150552mg                75.1    8e-12   
gb|KEH39832.1|  TPX2 (targeting protein for Xklp2) family protein     74.7    9e-12   
ref|XP_010069153.1|  PREDICTED: uncharacterized protein LOC104456...  74.7    9e-12   
gb|KDO45899.1|  hypothetical protein CISIN_1g0150552mg                75.1    1e-11   
ref|XP_012069780.1|  PREDICTED: protein WVD2-like 1 isoform X2        74.7    1e-11   
ref|XP_012069778.1|  PREDICTED: protein WVD2-like 1 isoform X1        74.7    1e-11   
gb|KCW57408.1|  hypothetical protein EUGRSUZ_H00191                   74.7    1e-11   
gb|KHN13150.1|  hypothetical protein glysoja_040430                   74.7    1e-11   
ref|XP_009779666.1|  PREDICTED: uncharacterized protein LOC104228...  74.3    2e-11   
ref|XP_004495344.1|  PREDICTED: protein WVD2-like 1-like              74.3    2e-11   
ref|XP_011649161.1|  PREDICTED: protein TPX2 isoform X1               73.9    2e-11   
ref|XP_004150404.2|  PREDICTED: protein TPX2 isoform X2               73.9    2e-11   
gb|KCW60434.1|  hypothetical protein EUGRSUZ_H03155                   73.2    2e-11   
gb|KCW60438.1|  hypothetical protein EUGRSUZ_H03155                   73.2    2e-11   
ref|XP_009779665.1|  PREDICTED: uncharacterized protein LOC104228...  73.9    2e-11   
gb|KCW60435.1|  hypothetical protein EUGRSUZ_H03155                   73.2    2e-11   
ref|XP_010024021.1|  PREDICTED: uncharacterized protein LOC104414569  73.2    2e-11   
gb|KCW60433.1|  hypothetical protein EUGRSUZ_H03155                   73.2    2e-11   
ref|XP_004247651.1|  PREDICTED: protein WVD2-like 1                   73.6    3e-11   
ref|XP_010278108.1|  PREDICTED: protein WVD2-like 1                   73.6    3e-11   
ref|XP_008224418.1|  PREDICTED: uncharacterized protein LOC103324158  73.2    4e-11   
ref|XP_006838831.1|  PREDICTED: uncharacterized protein LOC18429482   73.2    5e-11   
emb|CDO99169.1|  unnamed protein product                              73.2    5e-11   
ref|XP_010532605.1|  PREDICTED: protein WVD2-like 1 isoform X1        72.8    5e-11   
ref|XP_010532606.1|  PREDICTED: protein WVD2-like 1 isoform X2        72.4    5e-11   
ref|XP_006382819.1|  hypothetical protein POPTR_0005s05770g           72.4    6e-11   
ref|XP_003590791.1|  hypothetical protein MTR_1g075310                72.4    6e-11   
ref|XP_001766159.1|  predicted protein                                68.6    7e-11   
ref|XP_003590792.1|  hypothetical protein MTR_1g075310                72.0    7e-11   
gb|ACU21173.1|  unknown                                               69.3    7e-11   
gb|EYU32991.1|  hypothetical protein MIMGU_mgv1a009668mg              72.0    7e-11   
ref|XP_001767556.1|  predicted protein                                67.4    8e-11   
ref|XP_004495607.1|  PREDICTED: protein WVD2-like 1-like              72.0    8e-11   
ref|XP_011032377.1|  PREDICTED: protein WVD2-like 1 isoform X2        72.0    8e-11   
ref|XP_010672103.1|  PREDICTED: protein WVD2-like 1 isoform X1        72.0    8e-11   
ref|XP_011032376.1|  PREDICTED: protein WVD2-like 1 isoform X1        72.0    1e-10   
ref|XP_001782191.1|  predicted protein                                72.4    1e-10   
gb|KDO48759.1|  hypothetical protein CISIN_1g022294mg                 71.2    1e-10   
gb|EYU26857.1|  hypothetical protein MIMGU_mgv1a010751mg              70.9    1e-10   
gb|KHN14839.1|  hypothetical protein glysoja_021012                   71.6    1e-10   
ref|NP_001240042.1|  uncharacterized protein LOC100810060             71.6    1e-10   
ref|XP_006589186.1|  PREDICTED: protein WVD2-like 1-like isoform X1   71.6    1e-10   
ref|XP_006589187.1|  PREDICTED: protein WVD2-like 1-like isoform X2   71.6    1e-10   
ref|XP_006423984.1|  hypothetical protein CICLE_v10028698mg           71.6    1e-10   
ref|XP_006487778.1|  PREDICTED: protein WAVE-DAMPENED 2-like          71.6    1e-10   
ref|XP_006352123.1|  PREDICTED: protein WVD2-like 1-like isoform X1   71.6    1e-10   
ref|XP_010274160.1|  PREDICTED: protein WVD2-like 1                   71.6    1e-10   
ref|XP_011091146.1|  PREDICTED: uncharacterized protein LOC105171...  71.6    1e-10   
ref|XP_009629654.1|  PREDICTED: uncharacterized protein LOC104119779  71.6    1e-10   
ref|XP_011091145.1|  PREDICTED: uncharacterized protein LOC105171...  71.6    1e-10   
ref|XP_011091142.1|  PREDICTED: uncharacterized protein LOC105171...  71.6    1e-10   
ref|XP_011091144.1|  PREDICTED: uncharacterized protein LOC105171...  71.6    1e-10   
ref|XP_002531270.1|  conserved hypothetical protein                   71.2    2e-10   
ref|XP_011465968.1|  PREDICTED: protein WVD2-like 1                   71.2    2e-10   
ref|XP_008465198.1|  PREDICTED: axoneme-associated protein mst101(2)  71.2    2e-10   
gb|AFK35533.1|  unknown                                               71.2    2e-10   
gb|KFK43971.1|  hypothetical protein AALP_AA1G198100                  68.6    2e-10   
gb|ACH87178.1|  unknown protein                                       70.9    2e-10   
ref|XP_011467878.1|  PREDICTED: protein WVD2-like 1                   70.9    2e-10   
ref|XP_011073495.1|  PREDICTED: uncharacterized protein LOC105158433  70.9    3e-10   
ref|XP_009412486.1|  PREDICTED: protein WVD2-like 1                   70.5    3e-10   
ref|XP_008391162.1|  PREDICTED: protein WVD2-like 1                   69.7    3e-10   
ref|XP_007144838.1|  hypothetical protein PHAVU_007G188500g           70.5    3e-10   
ref|XP_010069150.1|  PREDICTED: uncharacterized protein LOC104456...  70.1    3e-10   
ref|XP_002966638.1|  hypothetical protein SELMODRAFT_407685           70.5    4e-10   
ref|XP_010025003.1|  PREDICTED: protein WVD2-like 1 isoform X3        69.7    6e-10   
ref|XP_010025001.1|  PREDICTED: protein WVD2-like 1 isoform X1        69.7    6e-10   
ref|XP_010025002.1|  PREDICTED: protein WVD2-like 1 isoform X2        69.7    6e-10   
gb|AFK47616.1|  unknown                                               69.7    6e-10   
ref|XP_002882365.1|  hypothetical protein ARALYDRAFT_477724           68.2    8e-10   
gb|AFK44260.1|  unknown                                               66.6    9e-10   
dbj|BAD11344.1|  BRI1-KD interacting protein 116                      67.8    9e-10   
ref|NP_001051574.1|  Os03g0799100                                     68.6    1e-09   
gb|ABF99369.1|  Targeting protein for Xklp2 containing protein, e...  68.6    1e-09   
ref|XP_006483366.1|  PREDICTED: enolase-phosphatase E1-like isofo...  67.8    1e-09   
gb|EPS60881.1|  hypothetical protein M569_13920                       64.3    1e-09   
ref|XP_006604850.1|  PREDICTED: protein WVD2-like 1-like isoform X5   68.6    1e-09   
ref|XP_006604848.1|  PREDICTED: protein WVD2-like 1-like isoform X3   68.2    1e-09   
ref|XP_006651911.1|  PREDICTED: protein WVD2-like 1-like              68.2    1e-09   
ref|XP_002466283.1|  hypothetical protein SORBIDRAFT_01g005000        68.2    2e-09   
ref|XP_010102276.1|  hypothetical protein L484_024558                 68.2    2e-09   
ref|XP_010524945.1|  PREDICTED: protein WAVE-DAMPENED 2-like          67.4    2e-09   
ref|XP_002961055.1|  hypothetical protein SELMODRAFT_437498           68.2    2e-09   
gb|KHN43180.1|  hypothetical protein glysoja_001763                   67.8    2e-09   
ref|XP_002966957.1|  hypothetical protein SELMODRAFT_439827           68.2    2e-09   
gb|KEH43003.1|  TPX2 (targeting protein for Xklp2) family protein     67.8    2e-09   
ref|XP_001753322.1|  predicted protein                                63.9    3e-09   
ref|XP_010553756.1|  PREDICTED: protein WVD2-like 1                   67.8    3e-09   
ref|XP_010087790.1|  hypothetical protein L484_016361                 67.8    3e-09   
ref|XP_011660277.1|  PREDICTED: protein WVD2-like 1                   67.4    3e-09   
ref|XP_008462704.1|  PREDICTED: protein WVD2-like 1                   67.4    3e-09   
gb|EPS60828.1|  hypothetical protein M569_13974                       65.1    3e-09   
ref|XP_004139247.1|  PREDICTED: protein WVD2-like 1                   67.4    3e-09   
ref|XP_009595859.1|  PREDICTED: axoneme-associated protein mst101...  67.0    4e-09   
gb|AAP37969.1|  seed specific protein Bn15D14A                        66.2    4e-09   
gb|KGN60789.1|  hypothetical protein Csa_2G010250                     67.4    4e-09   
ref|XP_009417120.1|  PREDICTED: protein WVD2-like 1                   65.1    4e-09   
emb|CDY10352.1|  BnaC05g29270D                                        67.0    4e-09   
ref|XP_008456211.1|  PREDICTED: protein WVD2-like 1                   67.0    4e-09   
gb|EEC80940.1|  hypothetical protein OsI_23645                        67.0    4e-09   
ref|XP_006577291.1|  PREDICTED: uncharacterized LOC100795305 isof...  67.0    4e-09   
ref|XP_006297932.1|  hypothetical protein CARUB_v10013976mg           67.0    5e-09   
ref|XP_007030535.1|  TPX2 family protein, putative isoform 2          67.0    5e-09   
ref|XP_006577289.1|  PREDICTED: uncharacterized LOC100795305 isof...  67.0    5e-09   
gb|KHN31471.1|  hypothetical protein glysoja_035578                   66.6    5e-09   
ref|XP_009145236.1|  PREDICTED: protein WVD2-like 1 isoform X2        66.6    5e-09   
gb|EEE65987.1|  hypothetical protein OsJ_21919                        67.0    5e-09   
emb|CDY10699.1|  BnaA05g16630D                                        66.6    5e-09   
ref|XP_007147185.1|  hypothetical protein PHAVU_006G102900g           66.6    6e-09   
ref|XP_007030534.1|  TPX2 family protein, putative isoform 1          66.6    6e-09   
emb|CDP06837.1|  unnamed protein product                              66.6    6e-09   
ref|XP_008370715.1|  PREDICTED: protein WVD2-like 1                   66.6    6e-09   
ref|XP_009372166.1|  PREDICTED: protein WVD2-like 1                   66.6    7e-09   
ref|XP_011091942.1|  PREDICTED: protein WVD2-like 1 isoform X1        66.2    7e-09   
ref|XP_011038550.1|  PREDICTED: protein WVD2-like 1                   66.2    7e-09   
ref|XP_011091943.1|  PREDICTED: protein WVD2-like 1 isoform X2        66.2    7e-09   
ref|XP_004230080.1|  PREDICTED: protein WVD2-like 1                   66.2    7e-09   
emb|CDY40665.1|  BnaC03g33810D                                        65.1    8e-09   
ref|XP_010528808.1|  PREDICTED: protein WVD2-like 1                   66.2    8e-09   
ref|XP_006347730.1|  PREDICTED: protein WVD2-like 1-like              66.2    8e-09   
ref|XP_009151255.1|  PREDICTED: protein WAVE-DAMPENED 2               64.7    8e-09   
emb|CDX74177.1|  BnaA03g28700D                                        65.1    8e-09   
gb|KJB44896.1|  hypothetical protein B456_007G278600                  65.5    9e-09   
emb|CDY48657.1|  BnaC07g27520D                                        64.7    9e-09   
gb|AFK40699.1|  unknown                                               65.9    1e-08   
ref|XP_010488352.1|  PREDICTED: protein WVD2-like 1 isoform X6        65.9    1e-08   
ref|XP_006408170.1|  hypothetical protein EUTSA_v10022180mg           65.1    1e-08   
ref|XP_010488349.1|  PREDICTED: protein WVD2-like 1 isoform X3        65.5    1e-08   
ref|XP_010485844.1|  PREDICTED: protein WVD2-like 1                   65.1    1e-08   
dbj|BAJ98831.1|  predicted protein                                    65.9    1e-08   
ref|XP_009134776.1|  PREDICTED: LOW QUALITY PROTEIN: protein WVD2...  65.1    1e-08   
ref|XP_004981415.1|  PREDICTED: protein WVD2-like 1-like              65.5    1e-08   
ref|XP_001780208.1|  predicted protein                                62.4    1e-08   
ref|XP_009772405.1|  PREDICTED: axoneme-associated protein mst101...  65.5    1e-08   
ref|NP_001149188.1|  seed specific protein Bn15D14A                   65.5    1e-08   
ref|XP_010466609.1|  PREDICTED: protein WVD2-like 1 isoform X2        65.1    1e-08   
ref|XP_003557299.1|  PREDICTED: protein WVD2-like 1                   65.5    1e-08   
ref|XP_009772404.1|  PREDICTED: axoneme-associated protein mst101...  65.1    2e-08   
gb|KHG28502.1|  putative basic-leucine zipper transcription factor M  64.7    2e-08   
ref|XP_006406091.1|  hypothetical protein EUTSA_v10021164mg           64.7    2e-08   
ref|XP_006395025.1|  hypothetical protein EUTSA_v10005603mg           63.2    2e-08   
ref|XP_002319646.1|  hypothetical protein POPTR_0013s04010g           65.1    2e-08   
gb|KHG02276.1|  Adenine deaminase                                     65.1    2e-08   
ref|XP_006288696.1|  hypothetical protein CARUB_v10002005mg           62.8    2e-08   
ref|XP_006298075.1|  hypothetical protein CARUB_v10014119mg           64.7    2e-08   
ref|XP_006298076.1|  hypothetical protein CARUB_v10014119mg           64.7    2e-08   
gb|KJB38897.1|  hypothetical protein B456_007G3451002                 64.7    2e-08   
dbj|BAH19881.1|  AT3G04630                                            63.9    2e-08   
ref|NP_850514.1|  WVD2-like 1                                         63.9    2e-08   
ref|NP_566233.1|  WVD2-like 1                                         63.9    2e-08   
gb|KDO45897.1|  hypothetical protein CISIN_1g0150552mg                64.3    3e-08   
gb|AAM67336.1|  unknown                                               63.9    3e-08   
emb|CDY50745.1|  BnaAnng10520D                                        63.9    3e-08   
gb|AAF04893.1|AC011437_8  unknown protein                             63.9    3e-08   
ref|XP_009124185.1|  PREDICTED: protein WVD2-like 1                   63.5    3e-08   
emb|CDY41888.1|  BnaC05g47160D                                        63.5    3e-08   
ref|NP_001154744.1|  protein WAVE-DAMPENED 2                          62.4    3e-08   
ref|XP_009145235.1|  PREDICTED: protein WVD2-like 1 isoform X1        64.3    3e-08   
ref|XP_010553353.1|  PREDICTED: protein WAVE-DAMPENED 2-like          63.9    4e-08   
ref|XP_003557461.1|  PREDICTED: uncharacterized protein LOC100827305  63.9    4e-08   



>ref|XP_009791345.1| PREDICTED: rab11 family-interacting protein 1-like [Nicotiana 
sylvestris]
Length=455

 Score =   128 bits (322),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 119/191 (62%), Gaps = 10/191 (5%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskn  720
            NN+QAKSKENQEAEIKQ RKSLTFKATPMPSFYKEP PK EL+KIPTTR +SPKLGR+KN
Sbjct  272  NNMQAKSKENQEAEIKQLRKSLTFKATPMPSFYKEPPPKVELRKIPTTRAVSPKLGRNKN  331

Query  719  sasttnssesggsglSPRVAKEPDKSPK---SNGDKKSTATSTKPVRNLQTDTVSQPAVp  549
              STTNSSESGGS  SPRV KE  KSP    S  DK + A+  KP+   +    S     
Sbjct  332  FTSTTNSSESGGSCFSPRVVKEQVKSPMALLSTSDKVTGASKGKPIETKKPMKSSSTGKT  391

Query  548  ktkdksaatkskpskikkTGETETEPVIHTDELEQKMDEKSENSPADDNIAAAHSHLTNP  369
            K K     +K    K       E  P    D  ++ +DEK E +PAD+N        +N 
Sbjct  392  KAKAVGTKSKPAEVKNLDENICEENP---QDMHDKPVDEKCEMNPADENAV----QQSNT  444

Query  368  VVVPAQVAVEG  336
            VV+ AQV VEG
Sbjct  445  VVITAQVTVEG  455



>ref|XP_006339180.1| PREDICTED: micronuclear linker histone polyprotein-like [Solanum 
tuberosum]
Length=441

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 128/188 (68%), Gaps = 15/188 (8%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskn  720
            +NL AKSKENQEAE+KQFRKSLTFKA PMP FYKEP PK ELKKIPTTR ISPKLGR+KN
Sbjct  269  SNLLAKSKENQEAEVKQFRKSLTFKAAPMPCFYKEPPPKVELKKIPTTRAISPKLGRTKN  328

Query  719  sasttnssesggsglSPRVAKEPDKSPKSNGDKKSTATSTKPVRNLQTDTVSQPAVpktk  540
            S S TNSSESGGS  SP+V KE  KS  SN  K++ A+  KPV+  QT T   P    TK
Sbjct  329  STSMTNSSESGGSCFSPKVIKEQRKSLVSN--KENVASKGKPVKTSQT-TAQSPKASITK  385

Query  539  dksaatkskpskikkTGETETEPVIHTDELEQKMDEKSENSPADDNIAAAHSHLTNPVVV  360
             K A TKS+ ++  K  + +TE        + ++  +SE +  +DN+A      +NP+VV
Sbjct  386  VKPAETKSRLAEAAKISDEKTE--------QNEIQPESEMNCVEDNVA----RPSNPIVV  433

Query  359  PAQVAVEG  336
             A+V+VEG
Sbjct  434  QAEVSVEG  441



>ref|XP_010312207.1| PREDICTED: cell wall protein RBR3 [Solanum lycopersicum]
 ref|XP_010312208.1| PREDICTED: cell wall protein RBR3 [Solanum lycopersicum]
Length=441

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 125/187 (67%), Gaps = 15/187 (8%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskns  717
            NL AKSKENQEAE+KQFRKSLTFKATPMP FYKEP P  ELKKIPTTR ISPKLGR+KNS
Sbjct  270  NLLAKSKENQEAEVKQFRKSLTFKATPMPCFYKEPPPTVELKKIPTTRAISPKLGRTKNS  329

Query  716  asttnssesggsglSPRVAKEPDKSPKSNGDKKSTATSTKPVRNLQTDTVSQPAVpktkd  537
             S TNSSESGGS  SP+V KE  KS  SN D  + A+  KPV+  QT T   P    TK 
Sbjct  330  TSMTNSSESGGSCFSPKVIKEQRKSLVSNKD--NVASKGKPVKTSQT-TAQSPKTSITKA  386

Query  536  ksaatkskpskikkTGETETEPVIHTDELEQKMDEKSENSPADDNIAAAHSHLTNPVVVP  357
            K A TKS+ ++  K  + +TE          ++  +SE +  +DN+A      +NP+VV 
Sbjct  387  KPAETKSRLAEAAKVSDEKTE--------RNEIQPESEMNRVEDNVA----RPSNPIVVQ  434

Query  356  AQVAVEG  336
            A+V+VEG
Sbjct  435  AEVSVEG  441



>ref|XP_009617728.1| PREDICTED: uncharacterized protein LOC104110016 [Nicotiana tomentosiformis]
Length=446

 Score =   122 bits (305),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 127/192 (66%), Gaps = 14/192 (7%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskn  720
            NNL AKSKENQE E+KQFRKSLTFKATPMP+FYKEP PK ELKKIPTTR ISPKLGR+KN
Sbjct  265  NNLIAKSKENQEEEVKQFRKSLTFKATPMPNFYKEPPPKVELKKIPTTRAISPKLGRNKN  324

Query  719  sasttnssesggsglSPRVAKEPDKSPKSNGD----KKSTATSTKPVRNLQTDTVSQPAV  552
            S S TN SESGGS  SP+V KE  KSP+++ D    K       KPV+N QT T   P +
Sbjct  325  STSATNGSESGGSSFSPKVIKEQTKSPRASKDTVASKGKPVEIKKPVKNSQT-TSQSPKI  383

Query  551  pktkdksaatkskpskikkTGETETEPVIHTDELEQKMDEKSENSPADDNIAAAHSHLTN  372
              TK K A TK KP++ K + E   E  I  +        KSE +  +D++A      +N
Sbjct  384  STTKGKPAETKLKPTEAKGSDEKTEEMYIQPNSA-----PKSEMNSVEDSVACP----SN  434

Query  371  PVVVPAQVAVEG  336
            PVV+ A+V+VEG
Sbjct  435  PVVIQAEVSVEG  446



>ref|XP_009783701.1| PREDICTED: protein WVD2-like 1 [Nicotiana sylvestris]
 ref|XP_009783702.1| PREDICTED: protein WVD2-like 1 [Nicotiana sylvestris]
Length=449

 Score =   122 bits (305),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 125/200 (63%), Gaps = 30/200 (15%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskn  720
            NNL AKSKENQE E+KQFRKS TFKATPMP+FYKEP PK ELKKIPTTR ISPKLGR+KN
Sbjct  268  NNLLAKSKENQEEEVKQFRKSSTFKATPMPNFYKEPPPKVELKKIPTTRAISPKLGRNKN  327

Query  719  sasttnssesggsglSPRVAKEPDKSPKSNGD----KKSTATSTKPVRNLQTDTVSQPAV  552
            S S TN SESGGS  SP+V K+  KSP+++ D    K       KPV+N QT T   P +
Sbjct  328  SISATNGSESGGSSFSPKVIKDQSKSPRASKDTVASKGKPVEIKKPVKNSQT-TSQSPKI  386

Query  551  pktkdksaatkskpskikkTGETETEP--VIHTDELEQKMDEKSENSP------ADDNIA  396
                          +   K+ ET+ +P    ++DE  ++MD + ++ P       +DN+A
Sbjct  387  -------------STAKGKSAETKLKPAEAKNSDEKTEEMDIQPDSDPKPEMNSVEDNVA  433

Query  395  AAHSHLTNPVVVPAQVAVEG  336
                  +NPVVV A+V VEG
Sbjct  434  CP----SNPVVVQAEVTVEG  449



>ref|XP_009608539.1| PREDICTED: rab11 family-interacting protein 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009608540.1| PREDICTED: rab11 family-interacting protein 1-like [Nicotiana 
tomentosiformis]
Length=458

 Score =   119 bits (298),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 116/196 (59%), Gaps = 20/196 (10%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskn  720
            NN+QAKSKENQEAEIKQ RKSLTFKATPMPSFYKEP PK EL+KIPTTR +SPKLGR+KN
Sbjct  275  NNMQAKSKENQEAEIKQLRKSLTFKATPMPSFYKEPPPKVELRKIPTTRAVSPKLGRNKN  334

Query  719  sasttnssesggsglSPRVAKEPDKSPK---SNGDKKSTATSTKPVRNLQTDTVSQPAVp  549
            S STTNSSESGGS LSPRV KE  KSP    S  D  +  +  KP+   +    S  A  
Sbjct  335  STSTTNSSESGGSCLSPRVVKEQVKSPTALLSTSDNVTGVSKGKPIETKKPTKSSSTA--  392

Query  548  ktkdksaatkskpskikkTGETETEPVIHTDELEQKM-----DEKSENSPADDNIAAAHS  384
                             K  E +       +E  Q M     DEK E +PAD+N      
Sbjct  393  ------KTKAKAVGTKSKAAEVKNLEENICEENAQDMHVKPADEKYEMNPADENAV----  442

Query  383  HLTNPVVVPAQVAVEG  336
              +N VV+ A+V VEG
Sbjct  443  QPSNAVVITAEVTVEG  458



>ref|XP_011077774.1| PREDICTED: micronuclear linker histone polyprotein-like [Sesamum 
indicum]
 ref|XP_011077775.1| PREDICTED: micronuclear linker histone polyprotein-like [Sesamum 
indicum]
Length=457

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 78/100 (78%), Gaps = 8/100 (8%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskn  720
            NNLQAKSKENQEAEIKQ RKSLTFKATPMP+FYKEP PK ELKKIPTTRPISPKLGR   
Sbjct  278  NNLQAKSKENQEAEIKQLRKSLTFKATPMPTFYKEPPPKVELKKIPTTRPISPKLGR---  334

Query  719  sasttnssesggsglSPRVAKEPDKSPKS---NGDKKSTA  609
              +   + E+ GS +SPRV+K+  KSP+S   N DK + A
Sbjct  335  --NKGTTVENSGSCVSPRVSKDNCKSPRSPHANSDKVNAA  372



>ref|XP_011094204.1| PREDICTED: uncharacterized protein LOC105173962 [Sesamum indicum]
Length=483

 Score =   113 bits (282),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 81/100 (81%), Gaps = 4/100 (4%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskns  717
            N+QAKSKENQEAEIKQ RKSLTFKATPMPSFYKEP PK E+KKIPTTR ISPKLGR+K +
Sbjct  295  NMQAKSKENQEAEIKQLRKSLTFKATPMPSFYKEPPPKVEIKKIPTTRAISPKLGRNKTT  354

Query  716  a-sttnssesggsglSPRVAKEPDKSPKS---NGDKKSTA  609
              +  NS E+GGS ++PRV ++   SPK+   NGDK +TA
Sbjct  355  VPTAVNSIENGGSSVTPRVTRDNCSSPKASHVNGDKGNTA  394



>ref|XP_002524093.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38303.1| conserved hypothetical protein [Ricinus communis]
Length=484

 Score =   111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/57 (93%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NNLQAKS+ENQEAEIKQ RKSLTFKATPMPSFYKEP PK ELKKIPTTRPISPKLGR
Sbjct  285  NNLQAKSQENQEAEIKQLRKSLTFKATPMPSFYKEPPPKVELKKIPTTRPISPKLGR  341



>ref|XP_004228629.1| PREDICTED: uncharacterized protein LOC101249396 [Solanum lycopersicum]
 ref|XP_010315804.1| PREDICTED: uncharacterized protein LOC101249396 [Solanum lycopersicum]
 ref|XP_010315808.1| PREDICTED: uncharacterized protein LOC101249396 [Solanum lycopersicum]
Length=466

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 121/196 (62%), Gaps = 20/196 (10%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskn  720
            NNLQAKSKENQEAEIKQ RKSLTFKATPMP+FYKEP  K EL+KIPTTR +SPKLGR+KN
Sbjct  283  NNLQAKSKENQEAEIKQLRKSLTFKATPMPNFYKEPPQKVELRKIPTTRAVSPKLGRNKN  342

Query  719  sasttnssesggsglSPRVA-KEPDKSPK---SNGDKKSTATSTKPVRNLQTDTVSQPAV  552
            S STTNSSESGGS  SPRV  KE  KSP+   S  +K + A+  KP+   +T        
Sbjct  343  STSTTNSSESGGSCFSPRVVNKEQVKSPRAMLSTSNKVTGASKGKPIETKKT--------  394

Query  551  pktkdksaatkskpskikkTGETETEPVIHTDELEQKM---DEKSENSPADDNIAAAHSH  381
             K+   +       +   K  E +       DE  ++M   DE+S  +PAD+N       
Sbjct  395  MKSSSTTKTKGKAVATKSKPAEAKALDENICDEKSKEMIEPDERSAMNPADNN----AEK  450

Query  380  LTNPVVVP-AQVAVEG  336
              N +V+P A+V VEG
Sbjct  451  PPNAIVMPSARVTVEG  466



>emb|CDP10567.1| unnamed protein product [Coffea canephora]
Length=453

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 74/102 (73%), Gaps = 9/102 (9%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskns  717
            NLQAKSKE+QEAEIKQFR+SLTFKATPMPSFYKEP  K ELKKIPTTRP+SPKLGR    
Sbjct  285  NLQAKSKESQEAEIKQFRRSLTFKATPMPSFYKEPPQKVELKKIPTTRPVSPKLGR----  340

Query  716  asttnssesggsglSPRVAKEPD--KSPK---SNGDKKSTAT  606
            A ++ +  S      P  A   D  KSPK   +NGDK S+A+
Sbjct  341  AKSSINESSENGATCPGNAAVTDKGKSPKDFQANGDKGSSAS  382



>gb|KHG09829.1| 30S ribosomal S8 [Gossypium arboreum]
Length=469

 Score =   108 bits (270),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NNLQAKSKENQEAEIKQ RKSLTFKATPMP+FYKEP PK ELKKIPTTR ISPKLGR
Sbjct  274  NNLQAKSKENQEAEIKQLRKSLTFKATPMPNFYKEPPPKVELKKIPTTRAISPKLGR  330



>ref|XP_002323363.2| hypothetical protein POPTR_0016s06690g [Populus trichocarpa]
 gb|EEF05124.2| hypothetical protein POPTR_0016s06690g [Populus trichocarpa]
Length=500

 Score =   108 bits (271),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 81/116 (70%), Gaps = 11/116 (9%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskns  717
            NLQ KSKENQEAEIKQ RKSLTFKATPMPSFYKEP PKAELKKIPTTR ISPKLGR K+S
Sbjct  298  NLQEKSKENQEAEIKQLRKSLTFKATPMPSFYKEPPPKAELKKIPTTRAISPKLGRRKSS  357

Query  716  asttnssesggsgl-------SPRVAKE---PDKSPKSNGDKKSTATSTKPVRNLQ  579
             + TN+S              SPR+ +E   P K  + NG+K + A+ T P+R  Q
Sbjct  358  TTLTNNSLEDSGSSFSPRASHSPRLNQESSNPTKGIQRNGNKDNGASKT-PIRKSQ  412



>ref|XP_011042551.1| PREDICTED: uncharacterized protein LOC105138210 [Populus euphratica]
 ref|XP_011042552.1| PREDICTED: uncharacterized protein LOC105138210 [Populus euphratica]
 ref|XP_011042553.1| PREDICTED: uncharacterized protein LOC105138210 [Populus euphratica]
 ref|XP_011042554.1| PREDICTED: uncharacterized protein LOC105138210 [Populus euphratica]
Length=504

 Score =   108 bits (271),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 81/116 (70%), Gaps = 11/116 (9%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskns  717
            NLQ KSKENQEAEIKQ RKSLTFKATPMPSFYKEP PKAELKKIPTTR ISPKLGR K+S
Sbjct  302  NLQEKSKENQEAEIKQLRKSLTFKATPMPSFYKEPPPKAELKKIPTTRAISPKLGRRKSS  361

Query  716  asttnssesggsgl-------SPRVAKE---PDKSPKSNGDKKSTATSTKPVRNLQ  579
             + TN+S              SPR+ +E   P K  + NG+K + A+ T P+R  Q
Sbjct  362  TTLTNNSLEDSGSSFSPRASHSPRLNQESSNPTKGIQRNGNKDNGASKT-PIRKSQ  416



>gb|KJB16516.1| hypothetical protein B456_002G233700 [Gossypium raimondii]
 gb|KJB16519.1| hypothetical protein B456_002G233700 [Gossypium raimondii]
Length=468

 Score =   108 bits (270),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NNLQAKSKENQEAEIKQ RKSLTFKATPMP+FYKEP PK ELKKIPTTR ISPKLGR
Sbjct  273  NNLQAKSKENQEAEIKQLRKSLTFKATPMPNFYKEPPPKVELKKIPTTRAISPKLGR  329



>gb|KJB16520.1| hypothetical protein B456_002G233700 [Gossypium raimondii]
Length=469

 Score =   108 bits (270),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/57 (91%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NNLQAKSKENQEAEIKQ RKSLTFKATPMP+FYKEP PK ELKKIPTTR ISPKLGR
Sbjct  274  NNLQAKSKENQEAEIKQLRKSLTFKATPMPNFYKEPPPKVELKKIPTTRAISPKLGR  330



>gb|EPS68122.1| hypothetical protein M569_06652, partial [Genlisea aurea]
Length=104

 Score =   101 bits (252),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            +NLQAKSKENQEAEIKQ RKSLTFKATPMP+FYKEP PK ELKKIP TRP SPKLGR
Sbjct  39   SNLQAKSKENQEAEIKQLRKSLTFKATPMPTFYKEPPPKVELKKIPITRPKSPKLGR  95



>ref|XP_006430022.1| hypothetical protein CICLE_v10012108mg [Citrus clementina]
 ref|XP_006430024.1| hypothetical protein CICLE_v10012108mg [Citrus clementina]
 gb|ESR43262.1| hypothetical protein CICLE_v10012108mg [Citrus clementina]
 gb|ESR43264.1| hypothetical protein CICLE_v10012108mg [Citrus clementina]
Length=494

 Score =   107 bits (268),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 89/119 (75%), Gaps = 5/119 (4%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskns  717
            NLQ KSKE+QEAEIKQ RKSLTFKATPMPSFYKEP PK ELKKIPTTR +SPK GR+K+S
Sbjct  299  NLQEKSKESQEAEIKQLRKSLTFKATPMPSFYKEPPPKVELKKIPTTRAVSPKFGRNKSS  358

Query  716  asttnss-esggsglSPRVAKEPDKSPK---SNGDKKSTATSTKPVRNLQTDTVSQPAV  552
                +SS E+GGS  SPR+ + P+ S K   +NG+K+S ATS  P++  Q    SQ ++
Sbjct  359  VVAKDSSFENGGSCHSPRLNQGPNNSMKGTQANGNKES-ATSKTPIKKSQPKLQSQDSI  416



>ref|XP_006348433.1| PREDICTED: micronuclear linker histone polyprotein-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006348434.1| PREDICTED: micronuclear linker histone polyprotein-like isoform 
X2 [Solanum tuberosum]
Length=468

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 78/90 (87%), Gaps = 1/90 (1%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskn  720
            NNLQAKSKENQEAEIKQ RKSLTFKATPMP+FYKEP  K EL+KIPTTR +SPKLGR+KN
Sbjct  283  NNLQAKSKENQEAEIKQLRKSLTFKATPMPNFYKEPPQKVELRKIPTTRAVSPKLGRNKN  342

Query  719  sasttnssesggsglSPRVA-KEPDKSPKS  633
            S STTNSSESGGS  SPRV  KE  KSP++
Sbjct  343  STSTTNSSESGGSCFSPRVVNKEQVKSPRA  372



>ref|XP_006481634.1| PREDICTED: neurofilament heavy polypeptide-like isoform X2 [Citrus 
sinensis]
 gb|KDO70674.1| hypothetical protein CISIN_1g011063mg [Citrus sinensis]
Length=493

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 90/119 (76%), Gaps = 5/119 (4%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskns  717
            NLQ KSKE+QEAEIKQ RKSLTFKATPMPSFYKEP PK ELKKIPTTR +SPK GR+K+S
Sbjct  298  NLQEKSKESQEAEIKQLRKSLTFKATPMPSFYKEPPPKVELKKIPTTRAVSPKFGRNKSS  357

Query  716  asttnss-esggsglSPRVAKEPDKSPK---SNGDKKSTATSTKPVRNLQTDTVSQPAV  552
             +  +SS E+GGS  SPR+ + P+ S K   +NG+K+S ATS  P++  Q    SQ ++
Sbjct  358  VAAKDSSFENGGSCHSPRLNQGPNNSMKGTQANGNKES-ATSKTPIKKPQPKLQSQDSI  415



>ref|XP_006481633.1| PREDICTED: neurofilament heavy polypeptide-like isoform X1 [Citrus 
sinensis]
 gb|KDO70670.1| hypothetical protein CISIN_1g011063mg [Citrus sinensis]
 gb|KDO70671.1| hypothetical protein CISIN_1g011063mg [Citrus sinensis]
 gb|KDO70672.1| hypothetical protein CISIN_1g011063mg [Citrus sinensis]
 gb|KDO70673.1| hypothetical protein CISIN_1g011063mg [Citrus sinensis]
Length=494

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 90/119 (76%), Gaps = 5/119 (4%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskns  717
            NLQ KSKE+QEAEIKQ RKSLTFKATPMPSFYKEP PK ELKKIPTTR +SPK GR+K+S
Sbjct  299  NLQEKSKESQEAEIKQLRKSLTFKATPMPSFYKEPPPKVELKKIPTTRAVSPKFGRNKSS  358

Query  716  asttnss-esggsglSPRVAKEPDKSPK---SNGDKKSTATSTKPVRNLQTDTVSQPAV  552
             +  +SS E+GGS  SPR+ + P+ S K   +NG+K+S ATS  P++  Q    SQ ++
Sbjct  359  VAAKDSSFENGGSCHSPRLNQGPNNSMKGTQANGNKES-ATSKTPIKKPQPKLQSQDSI  416



>ref|XP_004303390.1| PREDICTED: uncharacterized protein LOC101300076 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=501

 Score =   106 bits (264),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 85/119 (71%), Gaps = 6/119 (5%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskn  720
            NN QAKSKENQEAEIKQ RKSLTF+A PMPSFYKEP PK E+KKIPTTRPISPKLGR KN
Sbjct  293  NNSQAKSKENQEAEIKQLRKSLTFRAAPMPSFYKEPPPKIEIKKIPTTRPISPKLGRHKN  352

Query  719  sa-sttnssesggsglSPRVAKEPDKSPKS---NGDKKSTATS--TKPVRNLQTDTVSQ  561
            S  S  + SE GG  LSPR+A+E +KS K     G+K  +  +   KP+R  Q    SQ
Sbjct  353  SIPSPNSPSEDGGMCLSPRLARERNKSIKGLKEKGEKDVSHVTEPKKPIRKSQHRLNSQ  411



>ref|XP_012074268.1| PREDICTED: uncharacterized protein LOC105635780 isoform X1 [Jatropha 
curcas]
 gb|KDP36079.1| hypothetical protein JCGZ_08723 [Jatropha curcas]
Length=492

 Score =   105 bits (263),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NLQAKSKENQEAEI+Q RKSL FKATPMP+FYKEP PK ELKKIPTTRPISPKLGR
Sbjct  288  NLQAKSKENQEAEIRQLRKSLKFKATPMPNFYKEPPPKVELKKIPTTRPISPKLGR  343



>ref|XP_012074269.1| PREDICTED: uncharacterized protein LOC105635780 isoform X2 [Jatropha 
curcas]
Length=491

 Score =   105 bits (263),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NLQAKSKENQEAEI+Q RKSL FKATPMP+FYKEP PK ELKKIPTTRPISPKLGR
Sbjct  287  NLQAKSKENQEAEIRQLRKSLKFKATPMPNFYKEPPPKVELKKIPTTRPISPKLGR  342



>ref|XP_010541818.1| PREDICTED: general transcriptional corepressor trfA-like [Tarenaya 
hassleriana]
 ref|XP_010541819.1| PREDICTED: general transcriptional corepressor trfA-like [Tarenaya 
hassleriana]
 ref|XP_010541820.1| PREDICTED: general transcriptional corepressor trfA-like [Tarenaya 
hassleriana]
Length=462

 Score =   104 bits (260),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 76/116 (66%), Gaps = 6/116 (5%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskn  720
            +NLQAKSKENQEAEIK+ RK LTFKA+PMPSFYKEP PK ELKKIPTTRP+SPKLGR   
Sbjct  264  SNLQAKSKENQEAEIKKLRKRLTFKASPMPSFYKEPPPKVELKKIPTTRPVSPKLGR--K  321

Query  719  sasttnssesggsglSPRVAKEPDKSPKSNGDKKSTATSTKPVR----NLQTDTVS  564
              +        GS  SPRV+ E   S K    +K ++   KPV      LQT  +S
Sbjct  322  KGNVDTVGGEAGSCASPRVSLENISSGKGMLKQKDSSILEKPVTKSQPKLQTREIS  377



>ref|XP_007028040.1| TPX2 family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY08542.1| TPX2 family protein, putative isoform 1 [Theobroma cacao]
Length=491

 Score =   104 bits (260),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NNLQAKSKENQEAEIKQ RKSL FKATPMPSFYKEP PK ELKKIPTTR  SPKLGR
Sbjct  296  NNLQAKSKENQEAEIKQLRKSLAFKATPMPSFYKEPPPKVELKKIPTTRAKSPKLGR  352



>ref|XP_007028041.1| TPX2 family protein, putative isoform 2 [Theobroma cacao]
 gb|EOY08543.1| TPX2 family protein, putative isoform 2 [Theobroma cacao]
Length=486

 Score =   104 bits (260),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NNLQAKSKENQEAEIKQ RKSL FKATPMPSFYKEP PK ELKKIPTTR  SPKLGR
Sbjct  291  NNLQAKSKENQEAEIKQLRKSLAFKATPMPSFYKEPPPKVELKKIPTTRAKSPKLGR  347



>ref|XP_007028042.1| TPX2 family protein, putative isoform 3 [Theobroma cacao]
 gb|EOY08544.1| TPX2 family protein, putative isoform 3 [Theobroma cacao]
Length=414

 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/57 (89%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NNLQAKSKENQEAEIKQ RKSL FKATPMPSFYKEP PK ELKKIPTTR  SPKLGR
Sbjct  219  NNLQAKSKENQEAEIKQLRKSLAFKATPMPSFYKEPPPKVELKKIPTTRAKSPKLGR  275



>gb|EYU38708.1| hypothetical protein MIMGU_mgv1a007088mg [Erythranthe guttata]
Length=420

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 71/93 (76%), Gaps = 2/93 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskn  720
            NN++AKSKE+++AEIKQ RKSLTFKA PMPSFYKEP PK ELKKIPTTRPISPKLGR K+
Sbjct  255  NNMKAKSKESRDAEIKQLRKSLTFKAAPMPSFYKEPLPKPELKKIPTTRPISPKLGRQKD  314

Query  719  sasttnssesggsglSPRVAKEPD-KSPK-SNG  627
            SA + + +       +PR+ K     SPK SNG
Sbjct  315  SALSPSGNSVENGVSTPRINKNSSCNSPKASNG  347



>ref|XP_007163000.1| hypothetical protein PHAVU_001G197800g [Phaseolus vulgaris]
 gb|ESW34994.1| hypothetical protein PHAVU_001G197800g [Phaseolus vulgaris]
Length=430

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/56 (89%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NLQAKSKENQEAEIK  RKSLTFKATPMP+FYKEP PK ELKKIPTTRP SPKLGR
Sbjct  272  NLQAKSKENQEAEIKLLRKSLTFKATPMPNFYKEPPPKVELKKIPTTRPKSPKLGR  327



>ref|XP_010247933.1| PREDICTED: uncharacterized protein LOC104590846 isoform X2 [Nelumbo 
nucifera]
Length=474

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NNLQ K+KE+QEAEIKQ RKSLTFKATPMP FYKEP PK ELKKIPTTR +SPKLGR
Sbjct  284  NNLQEKTKESQEAEIKQLRKSLTFKATPMPCFYKEPPPKVELKKIPTTRAVSPKLGR  340



>ref|XP_003535829.1| PREDICTED: uncharacterized protein DDB_G0284459-like [Glycine 
max]
 gb|KHN37759.1| hypothetical protein glysoja_043788 [Glycine soja]
Length=456

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 111/189 (59%), Gaps = 8/189 (4%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskns  717
            N Q KSKENQEAEIKQ RK++TFKATPMPSFYKEP PK ELKKIP TRP SPKLGR K S
Sbjct  270  NQQEKSKENQEAEIKQLRKTMTFKATPMPSFYKEPPPKVELKKIPITRPKSPKLGRHKGS  329

Query  716  asttnssesggsglSPRVAKEPDKSPKSNGDKKSTATSTKPVRNLQTDTVSQPAVpktkd  537
            A   ++ +S  S    +   +P K+ K+ G  K    S KP+R +Q    SQ +  +  +
Sbjct  330  AVNKSADKSCSSPHGKQQQNDPTKA-KAKGSNKE-VISKKPIRKIQAKVQSQESAIRKTE  387

Query  536  ksaatkskpskikkTGETETE----PVIHTDELEQKMDEKSENSPADDNIAAAHSHLTNP  369
            K +   +K ++  K G    E    P ++  E +  M+ +S+N   D N+A   +  + P
Sbjct  388  KDSVKPTKVNQDAKAGTGNNEECHDPSVNNSEYQNDMELESKNE-LDQNVALVLNS-SPP  445

Query  368  VVVPAQVAV  342
             +V  +VAV
Sbjct  446  EIVSYEVAV  454



>ref|XP_010247903.1| PREDICTED: uncharacterized protein LOC104590846 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010247908.1| PREDICTED: uncharacterized protein LOC104590846 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010247914.1| PREDICTED: uncharacterized protein LOC104590846 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010247921.1| PREDICTED: uncharacterized protein LOC104590846 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010247925.1| PREDICTED: uncharacterized protein LOC104590846 isoform X1 [Nelumbo 
nucifera]
Length=504

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NNLQ K+KE+QEAEIKQ RKSLTFKATPMP FYKEP PK ELKKIPTTR +SPKLGR
Sbjct  314  NNLQEKTKESQEAEIKQLRKSLTFKATPMPCFYKEPPPKVELKKIPTTRAVSPKLGR  370



>ref|XP_004489868.1| PREDICTED: uncharacterized protein LOC101509998 [Cicer arietinum]
Length=218

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            N QAKSKENQE EIKQ RKSLTFKATPMPSFYKEP PK EL KIPTTRP SPKLGR
Sbjct  142  NQQAKSKENQEVEIKQLRKSLTFKATPMPSFYKEPPPKVELNKIPTTRPRSPKLGR  197



>ref|XP_004136531.1| PREDICTED: uncharacterized protein LOC101211881 isoform X1 [Cucumis 
sativus]
Length=486

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 69/88 (78%), Gaps = 5/88 (6%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskns  717
            NLQ KSKE+Q+AEIKQ RKS+TFKATPMP+FYKEP PK ELKKIPTTRP+SPKLGR    
Sbjct  296  NLQVKSKESQQAEIKQLRKSMTFKATPMPNFYKEPLPKPELKKIPTTRPVSPKLGR----  351

Query  716  asttnssesggsglSPRVAKEPDKSPKS  633
             +  +++E+G S  SPR   EP  SPK+
Sbjct  352  -NKNSTAEAGTSVHSPRQNGEPSNSPKA  378



>ref|XP_011652047.1| PREDICTED: uncharacterized protein LOC101211881 isoform X2 [Cucumis 
sativus]
 ref|XP_011652048.1| PREDICTED: uncharacterized protein LOC101211881 isoform X2 [Cucumis 
sativus]
 gb|KGN59238.1| hypothetical protein Csa_3G783840 [Cucumis sativus]
Length=484

 Score =   102 bits (255),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 69/88 (78%), Gaps = 5/88 (6%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskns  717
            NLQ KSKE+Q+AEIKQ RKS+TFKATPMP+FYKEP PK ELKKIPTTRP+SPKLGR    
Sbjct  294  NLQVKSKESQQAEIKQLRKSMTFKATPMPNFYKEPLPKPELKKIPTTRPVSPKLGR----  349

Query  716  asttnssesggsglSPRVAKEPDKSPKS  633
             +  +++E+G S  SPR   EP  SPK+
Sbjct  350  -NKNSTAEAGTSVHSPRQNGEPSNSPKA  376



>ref|XP_010525946.1| PREDICTED: hepatoma-derived growth factor-related protein 2 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010526024.1| PREDICTED: hepatoma-derived growth factor-related protein 2 isoform 
X2 [Tarenaya hassleriana]
Length=464

 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            +NLQAKSKENQEAEIK+ R SLTFKA PMPSFYKEP PK +LKKIPTTRP+SPKLGR
Sbjct  260  SNLQAKSKENQEAEIKKLRTSLTFKAIPMPSFYKEPPPKVDLKKIPTTRPVSPKLGR  316



>ref|XP_008442956.1| PREDICTED: neurofilament heavy polypeptide isoform X1 [Cucumis 
melo]
Length=486

 Score =   102 bits (254),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 68/88 (77%), Gaps = 5/88 (6%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskns  717
            NLQ KSKE+Q+AEIKQ RKS+TFKATPMP+FYKEP PK ELKKIPTTRP+SPKLGR    
Sbjct  296  NLQVKSKESQQAEIKQLRKSMTFKATPMPNFYKEPLPKPELKKIPTTRPVSPKLGR----  351

Query  716  asttnssesggsglSPRVAKEPDKSPKS  633
                +++E+G S  SPR   EP  SPK+
Sbjct  352  -HKNSTAEAGTSVHSPRQNGEPSNSPKA  378



>ref|XP_008442957.1| PREDICTED: neurofilament heavy polypeptide isoform X2 [Cucumis 
melo]
 ref|XP_008442958.1| PREDICTED: neurofilament heavy polypeptide isoform X2 [Cucumis 
melo]
 ref|XP_008442959.1| PREDICTED: neurofilament heavy polypeptide isoform X2 [Cucumis 
melo]
 ref|XP_008442960.1| PREDICTED: neurofilament heavy polypeptide isoform X2 [Cucumis 
melo]
Length=484

 Score =   102 bits (254),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 68/88 (77%), Gaps = 5/88 (6%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskns  717
            NLQ KSKE+Q+AEIKQ RKS+TFKATPMP+FYKEP PK ELKKIPTTRP+SPKLGR    
Sbjct  294  NLQVKSKESQQAEIKQLRKSMTFKATPMPNFYKEPLPKPELKKIPTTRPVSPKLGR----  349

Query  716  asttnssesggsglSPRVAKEPDKSPKS  633
                +++E+G S  SPR   EP  SPK+
Sbjct  350  -HKNSTAEAGTSVHSPRQNGEPSNSPKA  376



>gb|EYU18154.1| hypothetical protein MIMGU_mgv1a006530mg [Erythranthe guttata]
Length=440

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = -2

Query  893  LQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            LQAKSKE+QEAEIKQ RKSLTFKA PMPSFYKEP  K ELKKIPTTRPISPKLGR
Sbjct  273  LQAKSKESQEAEIKQLRKSLTFKAAPMPSFYKEPPLKVELKKIPTTRPISPKLGR  327



>gb|KEH24283.1| targeting protein for Xklp2 protein [Medicago truncatula]
Length=421

 Score =   101 bits (251),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/56 (88%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            N QAKSKENQE EIKQ RKSLTFKA PMPSFYKEP PK ELKKIPTTRP SPKLGR
Sbjct  270  NQQAKSKENQEKEIKQLRKSLTFKAAPMPSFYKEPPPKVELKKIPTTRPRSPKLGR  325



>ref|XP_010696215.1| PREDICTED: uncharacterized protein LOC104908761 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010696219.1| PREDICTED: uncharacterized protein LOC104908761 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=472

 Score =   101 bits (252),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NNLQAKSKE+QEAEIK+ RK LTFKA+PMPSFY+EP PK ELKKIPTTRP SPKLGR
Sbjct  264  NNLQAKSKESQEAEIKRLRKKLTFKASPMPSFYQEPTPKVELKKIPTTRPRSPKLGR  320



>ref|XP_010696225.1| PREDICTED: uncharacterized protein LOC104908761 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=471

 Score =   101 bits (252),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 52/57 (91%), Gaps = 0/57 (0%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NNLQAKSKE+QEAEIK+ RK LTFKA+PMPSFY+EP PK ELKKIPTTRP SPKLGR
Sbjct  263  NNLQAKSKESQEAEIKRLRKKLTFKASPMPSFYQEPTPKVELKKIPTTRPRSPKLGR  319



>ref|XP_006604667.1| PREDICTED: micronuclear linker histone polyprotein-like isoform 
X1 [Glycine max]
 ref|XP_006604668.1| PREDICTED: micronuclear linker histone polyprotein-like isoform 
X2 [Glycine max]
 gb|KHN43597.1| hypothetical protein glysoja_002180 [Glycine soja]
Length=442

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 73/115 (63%), Gaps = 3/115 (3%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskns  717
            NLQAKSKENQEAEI+  RKS+ FKATPMPSFYKEP PK ELKKIPTTR  SPKLGR    
Sbjct  277  NLQAKSKENQEAEIRLLRKSMAFKATPMPSFYKEPPPKVELKKIPTTRAKSPKLGR-HKE  335

Query  716  asttnssesggsglSPRVAKEPDKSPKSNGDKKSTATSTKPVRNLQTDTVSQPAV  552
            ++  N+S    +   PR  ++ + S K  G K     S KP+R  Q    SQ  V
Sbjct  336  SAMNNNSGEDKTCSIPRGKQQQNDSNKVKGHKD--MVSKKPIRKTQAKVKSQENV  388



>ref|XP_006604669.1| PREDICTED: micronuclear linker histone polyprotein-like isoform 
X3 [Glycine max]
Length=441

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 73/115 (63%), Gaps = 3/115 (3%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskns  717
            NLQAKSKENQEAEI+  RKS+ FKATPMPSFYKEP PK ELKKIPTTR  SPKLGR    
Sbjct  276  NLQAKSKENQEAEIRLLRKSMAFKATPMPSFYKEPPPKVELKKIPTTRAKSPKLGR-HKE  334

Query  716  asttnssesggsglSPRVAKEPDKSPKSNGDKKSTATSTKPVRNLQTDTVSQPAV  552
            ++  N+S    +   PR  ++ + S K  G K     S KP+R  Q    SQ  V
Sbjct  335  SAMNNNSGEDKTCSIPRGKQQQNDSNKVKGHKD--MVSKKPIRKTQAKVKSQENV  387



>ref|XP_010106961.1| hypothetical protein L484_016889 [Morus notabilis]
 gb|EXC12959.1| hypothetical protein L484_016889 [Morus notabilis]
Length=469

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 74/106 (70%), Gaps = 7/106 (7%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskns  717
            N QAKSKENQEAEIK  RKS+TFKATPMP+FY+EP PK ELKKIPTTR ISPKLGR    
Sbjct  295  NQQAKSKENQEAEIKLLRKSMTFKATPMPNFYREPPPKIELKKIPTTRAISPKLGR----  350

Query  716  asttnssesggsglSPRVAKEPDKSPKSNGDKKSTATSTKPVRNLQ  579
                ++S  GG+ L+PRV +  + S K  G +K    S KP+R  Q
Sbjct  351  -HKNSNSLEGGATLTPRVNQNQNNSNK--GSEKEVTDSKKPIRKSQ  393



>ref|XP_010058838.1| PREDICTED: uncharacterized protein LOC104446691 isoform X3 [Eucalyptus 
grandis]
 gb|KCW90418.1| hypothetical protein EUGRSUZ_A02553 [Eucalyptus grandis]
Length=425

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            +LQ KSKENQEAEIKQ RKS+TFKA PMPSFYKEP PK ELKKIPTTRP SPKLGR
Sbjct  244  SLQEKSKENQEAEIKQLRKSMTFKAAPMPSFYKEPPPKVELKKIPTTRPKSPKLGR  299



>ref|XP_010058833.1| PREDICTED: uncharacterized protein LOC104446691 isoform X2 [Eucalyptus 
grandis]
 gb|KCW90417.1| hypothetical protein EUGRSUZ_A02553 [Eucalyptus grandis]
Length=425

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            +LQ KSKENQEAEIKQ RKS+TFKA PMPSFYKEP PK ELKKIPTTRP SPKLGR
Sbjct  244  SLQEKSKENQEAEIKQLRKSMTFKAAPMPSFYKEPPPKVELKKIPTTRPKSPKLGR  299



>ref|XP_010058819.1| PREDICTED: uncharacterized protein LOC104446691 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010058822.1| PREDICTED: uncharacterized protein LOC104446691 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010058827.1| PREDICTED: uncharacterized protein LOC104446691 isoform X1 [Eucalyptus 
grandis]
 gb|KCW90419.1| hypothetical protein EUGRSUZ_A02553 [Eucalyptus grandis]
Length=427

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            +LQ KSKENQEAEIKQ RKS+TFKA PMPSFYKEP PK ELKKIPTTRP SPKLGR
Sbjct  246  SLQEKSKENQEAEIKQLRKSMTFKAAPMPSFYKEPPPKVELKKIPTTRPKSPKLGR  301



>ref|XP_009348636.1| PREDICTED: uncharacterized protein LOC103940268 [Pyrus x bretschneideri]
 ref|XP_009348642.1| PREDICTED: uncharacterized protein LOC103940268 [Pyrus x bretschneideri]
Length=475

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NN QAKSKE+QEAEIK+ RKSLTFKA PMPSFYKEP PK ELKKIPTTRP SPKLGR
Sbjct  287  NNSQAKSKESQEAEIKRLRKSLTFKAAPMPSFYKEPPPKVELKKIPTTRPKSPKLGR  343



>ref|XP_010058844.1| PREDICTED: uncharacterized protein LOC104446691 isoform X4 [Eucalyptus 
grandis]
Length=423

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            +LQ KSKENQEAEIKQ RKS+TFKA PMPSFYKEP PK ELKKIPTTRP SPKLGR
Sbjct  242  SLQEKSKENQEAEIKQLRKSMTFKAAPMPSFYKEPPPKVELKKIPTTRPKSPKLGR  297



>ref|XP_010505111.1| PREDICTED: protein WAVE-DAMPENED 2-like [Camelina sativa]
Length=219

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 74/112 (66%), Gaps = 14/112 (13%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskns  717
            NLQAKS+E+QE EIK+ RKSLTFKA PMPSFYKEP PK ELKKIPTTRP SPKLGR    
Sbjct  63   NLQAKSQESQEEEIKRLRKSLTFKAGPMPSFYKEPPPKVELKKIPTTRPKSPKLGR----  118

Query  716  asttnssesggsglSPRVAKEPDKSPKSNGDKKSTATSTKPVRNLQTDTVSQ  561
                +SS++ G   +PRV K  D S        S++T  KP+   Q   V+Q
Sbjct  119  --RKSSSDATGVVAAPRVTKPKDSS--------SSSTLKKPITKSQPKLVTQ  160



>gb|KEH41827.1| TPX2 (targeting protein for Xklp2) family protein [Medicago truncatula]
Length=452

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 104/195 (53%), Gaps = 19/195 (10%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRskns  717
            NLQ KSKE+QEAEIK+ RK +TFKA PMPSFYKEP PK ELKKIPTTRP SPKLGR+K S
Sbjct  265  NLQEKSKESQEAEIKKLRKRMTFKAAPMPSFYKEPPPKVELKKIPTTRPKSPKLGRNKGS  324

Query  716  asttnssesggsglSPRVAKEPDKSPKSNGDKKSTATSTKPVRNLQTDTVSQP-------  558
             +  NS +   S    +  K      K  G K    +S KP++  Q    SQ        
Sbjct  325  IANNNSEDKSSSIPHEKQQKNDSTKAKVKGYK--DVSSKKPIKKTQAKVQSQEITVTKTE  382

Query  557  --AVpktkdksaatkskpskikkTGETET-EPVIHTDELEQKMDEKSENSPADDNIAAAH  387
              +V  + +K +            G  E  +P+++  E +  M+++S+NS    N +   
Sbjct  383  MDSVVSSTNKVSVIDQDAKTSIVEGSEECKDPIVNISEYQNGMEQESQNSVLVLNAST--  440

Query  386  SHLTNPVVVPAQVAV  342
                 P +VP +VAV
Sbjct  441  -----PEIVPYEVAV  450



>ref|XP_008387137.1| PREDICTED: neurofilament heavy polypeptide-like [Malus domestica]
 ref|XP_008387138.1| PREDICTED: neurofilament heavy polypeptide-like [Malus domestica]
Length=483

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NN QAKSKE+QEAEIK+ RKSLTFKA PMPSFYKEP PK ELKKIPTTRP SPKLGR
Sbjct  288  NNSQAKSKESQEAEIKRLRKSLTFKAAPMPSFYKEPPPKVELKKIPTTRPKSPKLGR  344



>ref|XP_003519103.1| PREDICTED: uncharacterized protein DDB_G0284459 isoform X1 [Glycine 
max]
 ref|XP_006575273.1| PREDICTED: uncharacterized protein DDB_G0284459 isoform X2 [Glycine 
max]
 gb|KHN23220.1| hypothetical protein glysoja_046201 [Glycine soja]
Length=448

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            N Q KSKENQEAEIKQ RK++TFKATPMPSFYKEP PK ELKKIP TRP SPKLGR
Sbjct  269  NQQEKSKENQEAEIKQLRKTMTFKATPMPSFYKEPPPKVELKKIPITRPKSPKLGR  324



>ref|XP_009362663.1| PREDICTED: uncharacterized protein LOC103952721 [Pyrus x bretschneideri]
Length=482

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NN QAKSKE+QEAEIK+ RKSLTFKA PMPSFYKEP PK ELKKIPTTRP SPKLGR
Sbjct  288  NNSQAKSKESQEAEIKRLRKSLTFKAAPMPSFYKEPPPKVELKKIPTTRPKSPKLGR  344



>ref|NP_565829.1| TPX2 (targeting protein for Xklp2)-like protein [Arabidopsis 
thaliana]
 gb|AAL14415.1| At2g35880/F11F19.21 [Arabidopsis thaliana]
 gb|AAD21469.2| expressed protein [Arabidopsis thaliana]
 gb|AAM98231.1| unknown protein [Arabidopsis thaliana]
 gb|AEC09173.1| TPX2 (targeting protein for Xklp2)-like protein [Arabidopsis 
thaliana]
Length=432

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NLQAKSKE+QE EIK+ RKSLTFKA PMPSFYKEP PK ELKKIPTTRP SPKLGR
Sbjct  277  NLQAKSKESQEEEIKRLRKSLTFKAGPMPSFYKEPPPKVELKKIPTTRPKSPKLGR  332



>ref|XP_007145768.1| hypothetical protein PHAVU_007G266000g [Phaseolus vulgaris]
 gb|ESW17762.1| hypothetical protein PHAVU_007G266000g [Phaseolus vulgaris]
Length=457

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            N Q KSKENQEAEIKQ RK++TFKATPMPSFYKEP PK ELKKIP TRP SPKLGR
Sbjct  271  NQQEKSKENQEAEIKQLRKTMTFKATPMPSFYKEPPPKVELKKIPITRPKSPKLGR  326



>ref|XP_006826420.1| PREDICTED: uncharacterized protein LOC18421644 [Amborella trichopoda]
 gb|ERM93657.1| hypothetical protein AMTR_s00004p00160730 [Amborella trichopoda]
Length=518

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 53/57 (93%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            NLQA+SKE+QEAEIKQ RKSLTFKATPMPSFY+EPA PK +LKKIPTTRP SPKLGR
Sbjct  314  NLQAQSKESQEAEIKQLRKSLTFKATPMPSFYQEPAPPKVDLKKIPTTRPRSPKLGR  370



>ref|XP_010263082.1| PREDICTED: uncharacterized protein LOC104601451 isoform X2 [Nelumbo 
nucifera]
Length=467

 Score = 99.4 bits (246),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NLQAK+KE+QEAEI++ RKSL FKATPMPSFYKEP PK ELKKIPTTR ISPK GR
Sbjct  275  NLQAKTKESQEAEIRELRKSLMFKATPMPSFYKEPPPKVELKKIPTTRAISPKFGR  330



>ref|XP_006295617.1| hypothetical protein CARUB_v10024730mg [Capsella rubella]
 gb|EOA28515.1| hypothetical protein CARUB_v10024730mg [Capsella rubella]
Length=433

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NLQAKSKE+QE EIK+ RKSLTFKA PMPSFYKEP PK ELKKIPTTRP SPKLGR
Sbjct  277  NLQAKSKESQEEEIKRLRKSLTFKAGPMPSFYKEPPPKVELKKIPTTRPKSPKLGR  332



>ref|XP_002881415.1| hypothetical protein ARALYDRAFT_482558 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57674.1| hypothetical protein ARALYDRAFT_482558 [Arabidopsis lyrata subsp. 
lyrata]
Length=433

 Score = 99.0 bits (245),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NLQAKSKE+QE EIK+ RKSLTFKA PMPSFYKEP PK ELKKIPTTRP SPKLGR
Sbjct  277  NLQAKSKESQEEEIKRLRKSLTFKAGPMPSFYKEPPPKVELKKIPTTRPKSPKLGR  332



>ref|XP_010263081.1| PREDICTED: uncharacterized protein LOC104601451 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010263083.1| PREDICTED: uncharacterized protein LOC104601451 isoform X3 [Nelumbo 
nucifera]
Length=467

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NLQAK+KE+QEAEI++ RKSL FKATPMPSFYKEP PK ELKKIPTTR ISPK GR
Sbjct  275  NLQAKTKESQEAEIRELRKSLMFKATPMPSFYKEPPPKVELKKIPTTRAISPKFGR  330



>ref|XP_010677582.1| PREDICTED: protein WVD2-like 1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010677584.1| PREDICTED: protein WVD2-like 1 [Beta vulgaris subsp. vulgaris]
Length=489

 Score = 99.4 bits (246),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NNLQ KSKE+QEAEIKQ RKSL FKA PMP+FYKEP P+ E+KKIPTTRP SPKLGR
Sbjct  296  NNLQEKSKESQEAEIKQLRKSLNFKAMPMPNFYKEPPPRVEIKKIPTTRPKSPKLGR  352



>ref|XP_008790219.1| PREDICTED: uncharacterized protein LOC103707486 [Phoenix dactylifera]
Length=481

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 52/57 (91%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            NLQAKSKE+QEAEI+Q RKSLTFKATPMPSFY+EP  PKAELKKIP TRP SPKLGR
Sbjct  266  NLQAKSKESQEAEIRQLRKSLTFKATPMPSFYQEPGPPKAELKKIPPTRPRSPKLGR  322



>ref|XP_004497628.1| PREDICTED: biorientation of chromosomes in cell division protein 
1-like 1-like [Cicer arietinum]
Length=461

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            N+Q KSKENQEAEIK+ RK +TFKA PMPSFYKEP PK ELKKIPTTRP SPKLGR
Sbjct  269  NMQEKSKENQEAEIKKLRKRMTFKAAPMPSFYKEPPPKVELKKIPTTRPKSPKLGR  324



>gb|KJB65826.1| hypothetical protein B456_010G115100 [Gossypium raimondii]
 gb|KJB65829.1| hypothetical protein B456_010G115100 [Gossypium raimondii]
Length=458

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            +NLQAKSKE QEAEIK+FRKSL FKATPMPSFY+EPA PK ELKKIPTTR  SPKLGR
Sbjct  249  SNLQAKSKETQEAEIKKFRKSLNFKATPMPSFYQEPAPPKVELKKIPTTRAKSPKLGR  306



>ref|XP_010516794.1| PREDICTED: general transcriptional corepressor trfA-like [Camelina 
sativa]
 ref|XP_010516795.1| PREDICTED: general transcriptional corepressor trfA-like [Camelina 
sativa]
 ref|XP_010516796.1| PREDICTED: general transcriptional corepressor trfA-like [Camelina 
sativa]
Length=434

 Score = 97.4 bits (241),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NLQAKS+E+QE EIK+ RKSLTFKA PMPSFYKEP PK ELKKIPTTRP SPKLGR
Sbjct  277  NLQAKSQESQEEEIKRLRKSLTFKAGPMPSFYKEPPPKVELKKIPTTRPKSPKLGR  332



>gb|KJB65828.1| hypothetical protein B456_010G115100 [Gossypium raimondii]
Length=457

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            +NLQAKSKE QEAEIK+FRKSL FKATPMPSFY+EPA PK ELKKIPTTR  SPKLGR
Sbjct  248  SNLQAKSKETQEAEIKKFRKSLNFKATPMPSFYQEPAPPKVELKKIPTTRAKSPKLGR  305



>gb|KJB65827.1| hypothetical protein B456_010G115100 [Gossypium raimondii]
Length=458

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            +NLQAKSKE QEAEIK+FRKSL FKATPMPSFY+EPA PK ELKKIPTTR  SPKLGR
Sbjct  249  SNLQAKSKETQEAEIKKFRKSLNFKATPMPSFYQEPAPPKVELKKIPTTRAKSPKLGR  306



>gb|KHG18348.1| Abnormal spindle-like microcephaly-associated protein [Gossypium 
arboreum]
Length=451

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 52/58 (90%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            +NLQAKSKE QEAEIK+FRKSL FKATPMPSFY+EPA PK ELKKIPTTR  SPKLGR
Sbjct  248  SNLQAKSKETQEAEIKKFRKSLNFKATPMPSFYQEPAPPKVELKKIPTTRAKSPKLGR  305



>ref|XP_002515513.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46962.1| conserved hypothetical protein [Ricinus communis]
Length=426

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 50/58 (86%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NNLQAKSKE QEAEIK  RKSL FKATPMPSFY+E P PK ELKKIPTTRP SPKLGR
Sbjct  244  NNLQAKSKETQEAEIKMLRKSLAFKATPMPSFYQEPPPPKMELKKIPTTRPKSPKLGR  301



>ref|XP_008241097.1| PREDICTED: nucleolar and coiled-body phosphoprotein 1 [Prunus 
mume]
Length=483

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NN QAKSKE+QEAEIK+ RKSLTFKA PMPSFYKEP PK ELKKIPTTR  SPKLGR
Sbjct  288  NNSQAKSKESQEAEIKKLRKSLTFKAAPMPSFYKEPPPKVELKKIPTTRAKSPKLGR  344



>ref|XP_009133052.1| PREDICTED: general transcriptional corepressor trfA [Brassica 
rapa]
Length=404

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  893  LQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            LQAKSKE+QE EIK+ RKSLTFKA PMPSFYKEP PK ELKKIPTTRP SPKLGR
Sbjct  254  LQAKSKESQEEEIKRLRKSLTFKAGPMPSFYKEPPPKVELKKIPTTRPKSPKLGR  308



>gb|KJB16518.1| hypothetical protein B456_002G233700 [Gossypium raimondii]
Length=465

 Score = 97.1 bits (240),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 50/57 (88%), Gaps = 3/57 (5%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NNLQAKSKE   AEIKQ RKSLTFKATPMP+FYKEP PK ELKKIPTTR ISPKLGR
Sbjct  273  NNLQAKSKE---AEIKQLRKSLTFKATPMPNFYKEPPPKVELKKIPTTRAISPKLGR  326



>emb|CDX79632.1| BnaC03g19680D [Brassica napus]
Length=413

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  893  LQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            LQAKSKE+QE EIK+ RKSLTFKA PMPSFYKEP PK ELKKIPTTRP SPKLGR
Sbjct  262  LQAKSKESQEEEIKRLRKSLTFKAGPMPSFYKEPPPKVELKKIPTTRPKSPKLGR  316



>emb|CDX75079.1| BnaA05g08250D [Brassica napus]
Length=433

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  893  LQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            LQAKSKE+QE EIK+ RKSLTFKA PMPSFYKEP PK ELKKIPTTRP SPKLGR
Sbjct  273  LQAKSKESQEEEIKRLRKSLTFKAGPMPSFYKEPPPKVELKKIPTTRPKSPKLGR  327



>ref|XP_002308335.2| hypothetical protein POPTR_0006s21470g [Populus trichocarpa]
 gb|EEE91858.2| hypothetical protein POPTR_0006s21470g [Populus trichocarpa]
Length=503

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NLQAKSKE+QEAEIK+ RKSLTFKA PMP FYKEP PK ELKKIPTTR  SPKLGR
Sbjct  301  NLQAKSKESQEAEIKKLRKSLTFKAAPMPCFYKEPPPKVELKKIPTTRAKSPKLGR  356



>emb|CDX84593.1| BnaA03g16370D [Brassica napus]
Length=409

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  893  LQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            LQAKSKE+QE EIK+ RKSLTFKA PMPSFYKEP PK ELKKIPTTRP SPKLGR
Sbjct  259  LQAKSKESQEEEIKRLRKSLTFKAGPMPSFYKEPPPKVELKKIPTTRPKSPKLGR  313



>gb|EMT24340.1| hypothetical protein F775_04460 [Aegilops tauschii]
Length=381

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 51/58 (88%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NN+QAKSKE +EAE++Q RKSL FKA PMPSFYKE PAPK ELKK+PTTRP SPKLGR
Sbjct  227  NNMQAKSKEMEEAELRQLRKSLNFKAAPMPSFYKEPPAPKVELKKVPTTRPRSPKLGR  284



>ref|XP_011047144.1| PREDICTED: uncharacterized protein LOC105141583 [Populus euphratica]
Length=503

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NLQAKSKE+QEAEIK+ RKSLTFKA PMP FYKEP PK ELKKIPTTR  SPKLGR
Sbjct  301  NLQAKSKESQEAEIKKLRKSLTFKAAPMPCFYKEPPPKVELKKIPTTRAKSPKLGR  356



>ref|XP_003549281.1| PREDICTED: protein gar2-like isoform X1 [Glycine max]
 ref|XP_006601153.1| PREDICTED: protein gar2-like isoform X2 [Glycine max]
 gb|KHN33910.1| hypothetical protein glysoja_031772 [Glycine soja]
Length=481

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAP-KAELKKIPTTRPISPKLGR  729
            NLQAKSKE QEAEIK  RKSL FKATPMPSFY+EPAP KAELKKIPTTR  SPKLGR
Sbjct  263  NLQAKSKETQEAEIKMLRKSLNFKATPMPSFYQEPAPAKAELKKIPTTRAKSPKLGR  319



>ref|XP_009143624.1| PREDICTED: neurofilament heavy polypeptide-like [Brassica rapa]
Length=447

 Score = 96.7 bits (239),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
              LQAKSKE+QE EIK+ RKSLTFKA PMPSFYKEP PK ELKKIPTTRP SPKLGR
Sbjct  271  TTLQAKSKESQEEEIKRLRKSLTFKAGPMPSFYKEPPPKVELKKIPTTRPKSPKLGR  327



>ref|XP_006601154.1| PREDICTED: protein gar2-like isoform X3 [Glycine max]
Length=480

 Score = 96.7 bits (239),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAP-KAELKKIPTTRPISPKLGR  729
            NLQAKSKE QEAEIK  RKSL FKATPMPSFY+EPAP KAELKKIPTTR  SPKLGR
Sbjct  262  NLQAKSKETQEAEIKMLRKSLNFKATPMPSFYQEPAPAKAELKKIPTTRAKSPKLGR  318



>ref|XP_006410758.1| hypothetical protein EUTSA_v10016634mg [Eutrema salsugineum]
 gb|ESQ52211.1| hypothetical protein EUTSA_v10016634mg [Eutrema salsugineum]
Length=457

 Score = 96.7 bits (239),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = -2

Query  893  LQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            LQAKSKE+QE EIK+ RKSLTFKA PMPSFYKEP PK ELKKIPTTRP SPKLGR
Sbjct  279  LQAKSKESQEEEIKRLRKSLTFKAGPMPSFYKEPPPKVELKKIPTTRPKSPKLGR  333



>emb|CDX84165.1| BnaC04g09270D [Brassica napus]
Length=445

 Score = 96.3 bits (238),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
              LQAKSKE+QE EIK+ RKSLTFKA PMPSFYKEP PK ELKKIPTTRP SPKLGR
Sbjct  267  TTLQAKSKESQEEEIKRLRKSLTFKAGPMPSFYKEPPPKVELKKIPTTRPKSPKLGR  323



>gb|EMS54637.1| hypothetical protein TRIUR3_19981 [Triticum urartu]
Length=383

 Score = 95.1 bits (235),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 51/58 (88%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NN+QAKSKE +EAE++Q RKSL FKA PMPSFYKE PAPK ELKK+PTTRP SPKLGR
Sbjct  227  NNMQAKSKEMEEAELRQLRKSLNFKAAPMPSFYKEPPAPKIELKKVPTTRPRSPKLGR  284



>ref|XP_009415304.1| PREDICTED: uncharacterized protein LOC103996173 [Musa acuminata 
subsp. malaccensis]
Length=442

 Score = 95.9 bits (237),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 51/57 (89%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            NLQAKSKENQEAEI++ RKSLTFKATPMP+FY+EP  PKAELKKIP TR  SPKLGR
Sbjct  256  NLQAKSKENQEAEIRRLRKSLTFKATPMPNFYQEPGPPKAELKKIPPTRARSPKLGR  312



>ref|XP_010509545.1| PREDICTED: general transcriptional corepressor trfA-like [Camelina 
sativa]
Length=432

 Score = 95.5 bits (236),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NLQAKS+E+QE EIK+ RKSLTFKA PMPSFYKEP PK E KKIPTTRP SPKLGR
Sbjct  277  NLQAKSQESQEEEIKRLRKSLTFKAGPMPSFYKEPPPKVEWKKIPTTRPKSPKLGR  332



>ref|XP_007161209.1| hypothetical protein PHAVU_001G051200g [Phaseolus vulgaris]
 ref|XP_007161210.1| hypothetical protein PHAVU_001G051200g [Phaseolus vulgaris]
 gb|ESW33203.1| hypothetical protein PHAVU_001G051200g [Phaseolus vulgaris]
 gb|ESW33204.1| hypothetical protein PHAVU_001G051200g [Phaseolus vulgaris]
Length=477

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 51/58 (88%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            NN+QAK+KE Q+AEIK+ RKSL FKATPMPSFY+EPA PK ELKKIPTTRP SPK GR
Sbjct  260  NNMQAKTKETQDAEIKKLRKSLNFKATPMPSFYQEPAPPKVELKKIPTTRPKSPKFGR  317



>ref|XP_003545471.1| PREDICTED: micronuclear linker histone polyprotein-like isoform 
X1 [Glycine max]
 ref|XP_006596103.1| PREDICTED: micronuclear linker histone polyprotein-like isoform 
X2 [Glycine max]
 gb|KHN13751.1| hypothetical protein glysoja_044340 [Glycine soja]
Length=481

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAP-KAELKKIPTTRPISPKLGR  729
            NLQAK+KE QEAEIK  RKSL FKATPMPSFY+EPAP KAELKKIPTTR  SPKLGR
Sbjct  263  NLQAKTKETQEAEIKMLRKSLNFKATPMPSFYQEPAPAKAELKKIPTTRAKSPKLGR  319



>ref|XP_006596104.1| PREDICTED: micronuclear linker histone polyprotein-like isoform 
X3 [Glycine max]
Length=480

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAP-KAELKKIPTTRPISPKLGR  729
            NLQAK+KE QEAEIK  RKSL FKATPMPSFY+EPAP KAELKKIPTTR  SPKLGR
Sbjct  262  NLQAKTKETQEAEIKMLRKSLNFKATPMPSFYQEPAPAKAELKKIPTTRAKSPKLGR  318



>gb|ABK95344.1| unknown [Populus trichocarpa]
Length=422

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = -2

Query  893  LQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAP-KAELKKIPTTRPISPKLGR  729
            LQAKSKE QEAEIK FRKSL FKATPMPSFY+EPAP K ELKKIPTTR  SPKLGR
Sbjct  237  LQAKSKETQEAEIKLFRKSLAFKATPMPSFYQEPAPLKVELKKIPTTRAKSPKLGR  292



>ref|XP_009392362.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009392363.1| PREDICTED: serine/arginine repetitive matrix protein 1-like [Musa 
acuminata subsp. malaccensis]
Length=424

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            NLQAKSKENQEAEI++ RK+LTFKATPMPSFY+EP  PK ELKKIP TR  SPKLGR
Sbjct  253  NLQAKSKENQEAEIRRLRKTLTFKATPMPSFYQEPGPPKVELKKIPPTRARSPKLGR  309



>gb|AFK46777.1| unknown [Lotus japonicus]
Length=406

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            N Q KSKENQEAEIK+ RKSL FKA PMPSFYKEP PK ELKKIPTTR  SPKLGR
Sbjct  252  NQQEKSKENQEAEIKKLRKSLAFKAAPMPSFYKEPPPKVELKKIPTTRARSPKLGR  307



>ref|XP_002324860.2| hypothetical protein POPTR_0018s01730g [Populus trichocarpa]
 gb|EEF03425.2| hypothetical protein POPTR_0018s01730g [Populus trichocarpa]
Length=422

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = -2

Query  893  LQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAP-KAELKKIPTTRPISPKLGR  729
            LQAKSKE QEAEIK FRKSL FKATPMPSFY+EPAP K ELKKIPTTR  SPKLGR
Sbjct  237  LQAKSKETQEAEIKLFRKSLAFKATPMPSFYQEPAPLKVELKKIPTTRAKSPKLGR  292



>ref|XP_006662975.1| PREDICTED: protein WAVE-DAMPENED 2-like, partial [Oryza brachyantha]
Length=323

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NLQAKSKE+QEAEIK  RKSLTFKATPMPSFYKE  PK ELKKIP TR  SPKLGR
Sbjct  133  NLQAKSKESQEAEIKLLRKSLTFKATPMPSFYKEQPPKVELKKIPPTRARSPKLGR  188



>ref|XP_011036554.1| PREDICTED: uncharacterized protein LOC105134022 isoform X2 [Populus 
euphratica]
Length=423

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = -2

Query  893  LQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAP-KAELKKIPTTRPISPKLGR  729
            LQAKSKE QEAEIK FRKSL FKATPMPSFY+EPAP K ELKKIPTTR  SPKLGR
Sbjct  239  LQAKSKETQEAEIKLFRKSLAFKATPMPSFYQEPAPLKVELKKIPTTRAKSPKLGR  294



>ref|XP_011036553.1| PREDICTED: uncharacterized protein LOC105134022 isoform X1 [Populus 
euphratica]
Length=435

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = -2

Query  893  LQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAP-KAELKKIPTTRPISPKLGR  729
            LQAKSKE QEAEIK FRKSL FKATPMPSFY+EPAP K ELKKIPTTR  SPKLGR
Sbjct  251  LQAKSKETQEAEIKLFRKSLAFKATPMPSFYQEPAPLKVELKKIPTTRAKSPKLGR  306



>ref|XP_011467173.1| PREDICTED: uncharacterized protein LOC101300076 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=477

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 78/111 (70%), Gaps = 6/111 (5%)
 Frame = -2

Query  875  ENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGRsknsa-sttns  699
            ENQEAEIKQ RKSLTF+A PMPSFYKEP PK E+KKIPTTRPISPKLGR KNS  S  + 
Sbjct  277  ENQEAEIKQLRKSLTFRAAPMPSFYKEPPPKIEIKKIPTTRPISPKLGRHKNSIPSPNSP  336

Query  698  sesggsglSPRVAKEPDKSPKS---NGDKKSTATS--TKPVRNLQTDTVSQ  561
            SE GG  LSPR+A+E +KS K     G+K  +  +   KP+R  Q    SQ
Sbjct  337  SEDGGMCLSPRLARERNKSIKGLKEKGEKDVSHVTEPKKPIRKSQHRLNSQ  387



>gb|EPS64572.1| hypothetical protein M569_10209, partial [Genlisea aurea]
Length=170

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 50/58 (86%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAP-KAELKKIPTTRPISPKLGR  729
            NNLQAK+KE Q+AEIK  RK++ FKATPMPSFY+EPAP K E KKIPTTRP SPKLGR
Sbjct  59   NNLQAKTKETQDAEIKNLRKTMAFKATPMPSFYQEPAPAKLESKKIPTTRPKSPKLGR  116



>emb|CDP13518.1| unnamed protein product [Coffea canephora]
Length=456

 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NLQAKSKE QEAEIK  RKSL FKATPMPSFY+E P PKAELKKIPTTR  SPKLGR
Sbjct  269  NLQAKSKETQEAEIKMLRKSLMFKATPMPSFYQEPPPPKAELKKIPTTRAKSPKLGR  325



>ref|XP_010250125.1| PREDICTED: uncharacterized protein LOC104592447 [Nelumbo nucifera]
Length=514

 Score = 94.0 bits (232),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/56 (86%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = -2

Query  893  LQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            LQAKSKE QEAEIK  RKSLTFKATPMPSFY+EPA PK ELKKIP TRP SPKLGR
Sbjct  339  LQAKSKETQEAEIKLLRKSLTFKATPMPSFYEEPAPPKVELKKIPPTRPKSPKLGR  394



>gb|AES59018.2| TPX2 (targeting protein for Xklp2) family protein [Medicago truncatula]
Length=459

 Score = 93.2 bits (230),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -2

Query  893  LQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            LQAKSKE+QEAEIK+ RKSLTFKATP+P+FY+EPA PK ELKKIPTTR  SPKLGR
Sbjct  260  LQAKSKESQEAEIKKLRKSLTFKATPLPTFYQEPAPPKVELKKIPTTRAKSPKLGR  315



>ref|XP_003588767.1| Seed specific protein Bn15D14A [Medicago truncatula]
Length=458

 Score = 93.2 bits (230),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = -2

Query  893  LQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            LQAKSKE+QEAEIK+ RKSLTFKATP+P+FY+EPA PK ELKKIPTTR  SPKLGR
Sbjct  259  LQAKSKESQEAEIKKLRKSLTFKATPLPTFYQEPAPPKVELKKIPTTRAKSPKLGR  314



>gb|EEC68390.1| hypothetical protein OsI_36542 [Oryza sativa Indica Group]
Length=430

 Score = 92.8 bits (229),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NLQAKSKE+QEAEIK  RKSLTFKATPMPSFYKE  PK ELKKIP TR  SPKLGR
Sbjct  239  NLQAKSKESQEAEIKLLRKSLTFKATPMPSFYKEQPPKVELKKIPPTRARSPKLGR  294



>ref|NP_001068122.1| Os11g0571900 [Oryza sativa Japonica Group]
 gb|ABA94344.1| Targeting protein for Xklp2 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF28485.1| Os11g0571900 [Oryza sativa Japonica Group]
 dbj|BAG93722.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67254.1| hypothetical protein OsJ_24413 [Oryza sativa Japonica Group]
Length=430

 Score = 92.8 bits (229),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NLQAKSKE+QEAEIK  RKSLTFKATPMPSFYKE  PK ELKKIP TR  SPKLGR
Sbjct  239  NLQAKSKESQEAEIKLLRKSLTFKATPMPSFYKEQPPKVELKKIPPTRARSPKLGR  294



>ref|XP_009415983.1| PREDICTED: uncharacterized protein LOC103996729 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009415992.1| PREDICTED: uncharacterized protein LOC103996729 [Musa acuminata 
subsp. malaccensis]
Length=424

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            NLQA+SKENQEAEI++ RKSLTFKATPMP+FY+EP  PK ELKKIP TR  SPKLGR
Sbjct  232  NLQARSKENQEAEIRRLRKSLTFKATPMPNFYQEPGPPKVELKKIPPTRARSPKLGR  288



>ref|XP_010917924.1| PREDICTED: uncharacterized protein LOC105042421 [Elaeis guineensis]
 ref|XP_010917925.1| PREDICTED: uncharacterized protein LOC105042421 [Elaeis guineensis]
Length=479

 Score = 92.8 bits (229),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            NLQAK+KE+QEAEI+Q RKSLTFKATPMPSFY+EP  PK ELKKIP TR  SPKLGR
Sbjct  264  NLQAKTKESQEAEIRQLRKSLTFKATPMPSFYQEPGPPKVELKKIPPTRAKSPKLGR  320



>gb|EYU32347.1| hypothetical protein MIMGU_mgv1a007026mg [Erythranthe guttata]
Length=422

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 50/58 (86%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            N++QAKSKE QEAEIK FRKSL FKATPMP+FY+E P PK ELKKIPTTR  SPKLGR
Sbjct  244  NDMQAKSKETQEAEIKMFRKSLAFKATPMPTFYQEPPPPKVELKKIPTTRAKSPKLGR  301



>ref|XP_010526215.1| PREDICTED: peptidyl-prolyl isomerase cwc-27-like isoform X1 [Tarenaya 
hassleriana]
Length=437

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            N++QAKSKE QEAEIK  RKSL FKATPMPSFY+EP  PK ELKKIP TRP SPKLGR
Sbjct  241  NDMQAKSKETQEAEIKMLRKSLNFKATPMPSFYQEPQPPKVELKKIPPTRPKSPKLGR  298



>gb|KJB55012.1| hypothetical protein B456_009G058200 [Gossypium raimondii]
Length=449

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 50/58 (86%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            +NLQAKSKE QEAEIK FRKSL FKATPMPSFY+EP+ P  E+KK+PTTR  SPKLGR
Sbjct  245  SNLQAKSKETQEAEIKMFRKSLNFKATPMPSFYQEPSPPMVEIKKLPTTRAKSPKLGR  302



>ref|XP_009589928.1| PREDICTED: neurofilament medium polypeptide-like isoform X4 [Nicotiana 
tomentosiformis]
Length=414

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NNLQA SKE+QEAEIK  RKSL FKATPMPSFY+E P PK ELKKIPTTR  SPKLGR
Sbjct  228  NNLQALSKESQEAEIKMLRKSLKFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGR  285



>ref|XP_009589927.1| PREDICTED: RNA polymerase II degradation factor 1-like isoform 
X3 [Nicotiana tomentosiformis]
Length=415

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NNLQA SKE+QEAEIK  RKSL FKATPMPSFY+E P PK ELKKIPTTR  SPKLGR
Sbjct  229  NNLQALSKESQEAEIKMLRKSLKFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGR  286



>ref|XP_010526217.1| PREDICTED: peptidyl-prolyl isomerase cwc-27-like isoform X2 [Tarenaya 
hassleriana]
Length=436

 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            N++QAKSKE QEAEIK  RKSL FKATPMPSFY+EP  PK ELKKIP TRP SPKLGR
Sbjct  240  NDMQAKSKETQEAEIKMLRKSLNFKATPMPSFYQEPQPPKVELKKIPPTRPKSPKLGR  297



>ref|XP_002878856.1| hypothetical protein ARALYDRAFT_481399 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55115.1| hypothetical protein ARALYDRAFT_481399 [Arabidopsis lyrata subsp. 
lyrata]
Length=395

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEP-APKAELKKIPTTRPISPKLGR  729
            N +QAKSKE QEAE+K  RKSL FKATPMP+FY+EP  PK ELKKIPTTRP SPKLGR
Sbjct  208  NTVQAKSKETQEAELKMLRKSLNFKATPMPTFYQEPQLPKTELKKIPTTRPKSPKLGR  265



>gb|KJB07046.1| hypothetical protein B456_001G033600 [Gossypium raimondii]
Length=298

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            +NLQAKSKE QEAEIK FRKSL FKATPMPSFY+E P PK ELKKIP TR  SPKLGR
Sbjct  96   SNLQAKSKETQEAEIKMFRKSLNFKATPMPSFYQEPPPPKVELKKIPPTRAKSPKLGR  153



>ref|XP_010546566.1| PREDICTED: protein WVD2-like 1 isoform X1 [Tarenaya hassleriana]
Length=439

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            N++QAKSKE QEAEIK  RKSL FKATPMPSFY+EP  PK ELKKIP TRP SPKLGR
Sbjct  240  NDMQAKSKETQEAEIKMLRKSLNFKATPMPSFYQEPQPPKVELKKIPPTRPKSPKLGR  297



>ref|XP_010546567.1| PREDICTED: protein WVD2-like 1 isoform X2 [Tarenaya hassleriana]
Length=438

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            N++QAKSKE QEAEIK  RKSL FKATPMPSFY+EP  PK ELKKIP TRP SPKLGR
Sbjct  239  NDMQAKSKETQEAEIKMLRKSLNFKATPMPSFYQEPQPPKVELKKIPPTRPKSPKLGR  296



>tpg|DAA42159.1| TPA: hypothetical protein ZEAMMB73_567014 [Zea mays]
Length=256

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NLQ KSKE+QEAEIK  RKSLTFKATPMPSFYKE  PK ELKKIP TR  SPKLGR
Sbjct  65   NLQEKSKESQEAEIKLLRKSLTFKATPMPSFYKEQPPKVELKKIPPTRARSPKLGR  120



>ref|XP_009589926.1| PREDICTED: RNA polymerase II degradation factor 1-like isoform 
X2 [Nicotiana tomentosiformis]
Length=438

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NNLQA SKE+QEAEIK  RKSL FKATPMPSFY+E P PK ELKKIPTTR  SPKLGR
Sbjct  252  NNLQALSKESQEAEIKMLRKSLKFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGR  309



>gb|KJB07048.1| hypothetical protein B456_001G033600 [Gossypium raimondii]
Length=401

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NLQAKSKE QEAEIK FRKSL FKATPMPSFY+E P PK ELKKIP TR  SPKLGR
Sbjct  200  NLQAKSKETQEAEIKMFRKSLNFKATPMPSFYQEPPPPKVELKKIPPTRAKSPKLGR  256



>ref|XP_009803429.1| PREDICTED: histone H1-I-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009803430.1| PREDICTED: histone H1-I-like isoform X1 [Nicotiana sylvestris]
Length=450

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NNLQA SKE+QEAEIK  RKSL FKATPMPSFY+E P PK ELKKIPTTR  SPKLGR
Sbjct  264  NNLQALSKESQEAEIKMLRKSLKFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGR  321



>ref|XP_009589924.1| PREDICTED: RNA polymerase II degradation factor 1-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009589925.1| PREDICTED: RNA polymerase II degradation factor 1-like isoform 
X1 [Nicotiana tomentosiformis]
Length=439

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NNLQA SKE+QEAEIK  RKSL FKATPMPSFY+E P PK ELKKIPTTR  SPKLGR
Sbjct  253  NNLQALSKESQEAEIKMLRKSLKFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGR  310



>ref|XP_009803431.1| PREDICTED: histone H1-I-like isoform X2 [Nicotiana sylvestris]
Length=449

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NNLQA SKE+QEAEIK  RKSL FKATPMPSFY+E P PK ELKKIPTTR  SPKLGR
Sbjct  263  NNLQALSKESQEAEIKMLRKSLKFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGR  320



>ref|XP_009803432.1| PREDICTED: histone H1-I-like isoform X3 [Nicotiana sylvestris]
Length=449

 Score = 91.7 bits (226),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NNLQA SKE+QEAEIK  RKSL FKATPMPSFY+E P PK ELKKIPTTR  SPKLGR
Sbjct  263  NNLQALSKESQEAEIKMLRKSLKFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGR  320



>ref|XP_004965929.1| PREDICTED: neurofilament heavy polypeptide-like [Setaria italica]
Length=383

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            +NLQAKSKE +EAE+K  RKSL FKA PMPSFYKE P PK ELKKIPTTRP SPKLGR
Sbjct  227  SNLQAKSKEAEEAELKMLRKSLNFKAAPMPSFYKEPPPPKVELKKIPTTRPRSPKLGR  284



>ref|XP_004498741.1| PREDICTED: serine-rich adhesin for platelets-like isoform X1 
[Cicer arietinum]
 ref|XP_004498742.1| PREDICTED: serine-rich adhesin for platelets-like isoform X2 
[Cicer arietinum]
 ref|XP_004498743.1| PREDICTED: serine-rich adhesin for platelets-like isoform X3 
[Cicer arietinum]
Length=475

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            NLQAK+ E+QE EIK+ RKSLTFKATPMP+FY+EPA PK ELKKIPTTR  SPKLGR
Sbjct  258  NLQAKTMESQEKEIKKLRKSLTFKATPMPTFYQEPAPPKVELKKIPTTRAKSPKLGR  314



>gb|KJB07045.1| hypothetical protein B456_001G033600 [Gossypium raimondii]
Length=391

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NLQAKSKE QEAEIK FRKSL FKATPMPSFY+E P PK ELKKIP TR  SPKLGR
Sbjct  190  NLQAKSKETQEAEIKMFRKSLNFKATPMPSFYQEPPPPKVELKKIPPTRAKSPKLGR  246



>gb|KJB07043.1| hypothetical protein B456_001G033600 [Gossypium raimondii]
 gb|KJB07049.1| hypothetical protein B456_001G033600 [Gossypium raimondii]
 gb|KJB07050.1| hypothetical protein B456_001G033600 [Gossypium raimondii]
Length=450

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NLQAKSKE QEAEIK FRKSL FKATPMPSFY+E P PK ELKKIP TR  SPKLGR
Sbjct  249  NLQAKSKETQEAEIKMFRKSLNFKATPMPSFYQEPPPPKVELKKIPPTRAKSPKLGR  305



>gb|KJB07042.1| hypothetical protein B456_001G033600 [Gossypium raimondii]
Length=451

 Score = 91.7 bits (226),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NLQAKSKE QEAEIK FRKSL FKATPMPSFY+E P PK ELKKIP TR  SPKLGR
Sbjct  250  NLQAKSKETQEAEIKMFRKSLNFKATPMPSFYQEPPPPKVELKKIPPTRAKSPKLGR  306



>gb|KJB07044.1| hypothetical protein B456_001G033600 [Gossypium raimondii]
Length=455

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NLQAKSKE QEAEIK FRKSL FKATPMPSFY+E P PK ELKKIP TR  SPKLGR
Sbjct  254  NLQAKSKETQEAEIKMFRKSLNFKATPMPSFYQEPPPPKVELKKIPPTRAKSPKLGR  310



>gb|KJB82700.1| hypothetical protein B456_013G214800 [Gossypium raimondii]
 gb|KJB82701.1| hypothetical protein B456_013G214800 [Gossypium raimondii]
Length=295

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            +NLQAKSKE QEAEIK FRK+L FKATPMPSFY+EP  PK ELKKIP TR  SPKLGR
Sbjct  96   SNLQAKSKETQEAEIKMFRKTLKFKATPMPSFYQEPTPPKVELKKIPPTRAKSPKLGR  153



>gb|KJB07047.1| hypothetical protein B456_001G033600 [Gossypium raimondii]
Length=454

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NLQAKSKE QEAEIK FRKSL FKATPMPSFY+E P PK ELKKIP TR  SPKLGR
Sbjct  253  NLQAKSKETQEAEIKMFRKSLNFKATPMPSFYQEPPPPKVELKKIPPTRAKSPKLGR  309



>ref|XP_011039686.1| PREDICTED: ankyrin repeat domain-containing protein 12 [Populus 
euphratica]
 ref|XP_011039687.1| PREDICTED: ankyrin repeat domain-containing protein 12 [Populus 
euphratica]
Length=439

 Score = 91.3 bits (225),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/56 (84%), Positives = 48/56 (86%), Gaps = 1/56 (2%)
 Frame = -2

Query  893  LQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            LQAKSKE QEAEIK  RKSL FKATPMPSFY+EPA PK ELKKIPTTR  SPKLGR
Sbjct  252  LQAKSKETQEAEIKLLRKSLGFKATPMPSFYQEPAPPKVELKKIPTTRAKSPKLGR  307



>ref|XP_003526407.1| PREDICTED: neurofilament heavy polypeptide-like isoform X1 [Glycine 
max]
 ref|XP_006581356.1| PREDICTED: neurofilament heavy polypeptide-like isoform X2 [Glycine 
max]
Length=461

 Score = 91.3 bits (225),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 50/57 (88%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NLQAK+KENQEAEIK  RKSL FKATPMPSFY+E P P+AEL+K+PTTR  SPKLGR
Sbjct  260  NLQAKTKENQEAEIKMLRKSLGFKATPMPSFYQEPPPPRAELRKMPTTRAKSPKLGR  316



>ref|XP_006647040.1| PREDICTED: microtubule-associated protein 1B-like [Oryza brachyantha]
Length=394

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            NNLQAKSKE +EAE++  RKSL FKATPMPSFY+EP  PK ELKKIP TRP SPKLGR
Sbjct  221  NNLQAKSKEAEEAELRMLRKSLNFKATPMPSFYQEPTPPKIELKKIPPTRPRSPKLGR  278



>ref|XP_009412316.1| PREDICTED: uncharacterized protein LOC103993842 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412317.1| PREDICTED: uncharacterized protein LOC103993842 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412318.1| PREDICTED: uncharacterized protein LOC103993842 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412319.1| PREDICTED: uncharacterized protein LOC103993842 [Musa acuminata 
subsp. malaccensis]
Length=445

 Score = 90.9 bits (224),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            NLQAKSKE+QEAEI+Q RKSLTFKATPMP+FY+EP  PK EL K+P TR  SPKLGR
Sbjct  259  NLQAKSKESQEAEIRQLRKSLTFKATPMPTFYQEPCPPKVELTKVPPTRARSPKLGR  315



>ref|XP_010102672.1| hypothetical protein L484_000806 [Morus notabilis]
 gb|EXC46039.1| hypothetical protein L484_000806 [Morus notabilis]
Length=462

 Score = 90.9 bits (224),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NLQAKSKE QEAEIK  RKSL FKATPMPSFY+E P PK ELKKIPTTR  SPKLGR
Sbjct  257  NLQAKSKETQEAEIKLLRKSLAFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGR  313



>ref|XP_004979518.1| PREDICTED: protein WVD2-like 1-like [Setaria italica]
Length=459

 Score = 90.9 bits (224),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NLQ KSKE+QEAEIK  RKSLTFKATPMPSFYKE  PK ELKKIP TR  SPKLGR
Sbjct  268  NLQEKSKESQEAEIKLLRKSLTFKATPMPSFYKEQPPKVELKKIPPTRARSPKLGR  323



>gb|ACL52672.1| unknown [Zea mays]
Length=385

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            +NLQAKSKE +EAE+K  RKSL FKATPMPSFYKE P PK ELKKIPTTR  SPKLGR
Sbjct  228  SNLQAKSKETEEAELKMLRKSLNFKATPMPSFYKEPPPPKVELKKIPTTRARSPKLGR  285



>gb|ACG45595.1| WDL1 [Zea mays]
Length=386

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            +NLQAKSKE +EAE+K  RKSL FKATPMPSFYKE P PK ELKKIPTTR  SPKLGR
Sbjct  228  SNLQAKSKETEEAELKMLRKSLNFKATPMPSFYKEPPPPKVELKKIPTTRARSPKLGR  285



>ref|XP_009405789.1| PREDICTED: neurofilament heavy polypeptide-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=398

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            NLQ KSKE+QEAEI++ RKSLTFKATPMPSFY+EP  PK ELKKIP TR  SPKLGR
Sbjct  206  NLQVKSKESQEAEIRKLRKSLTFKATPMPSFYQEPGPPKVELKKIPPTRAKSPKLGR  262



>emb|CDY23322.1| BnaA08g12240D [Brassica napus]
Length=410

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 50/58 (86%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            N++QAKSKE QEAE+++ RKSL FKATPMPSFY+EP  PK ELKKIP TRP SPKLGR
Sbjct  223  NSMQAKSKETQEAELRKLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRPKSPKLGR  280



>ref|NP_001130992.1| uncharacterized protein LOC100192097 [Zea mays]
 ref|XP_008658037.1| PREDICTED: uncharacterized protein LOC100192097 isoform X1 [Zea 
mays]
 gb|ACF79409.1| unknown [Zea mays]
 gb|AFW87216.1| WDL1 isoform 1 [Zea mays]
 gb|AFW87217.1| WDL1 isoform 2 [Zea mays]
 gb|AFW87218.1| WDL1 isoform 3 [Zea mays]
 gb|AFW87219.1| WDL1 isoform 4 [Zea mays]
 gb|AFW87220.1| WDL1 isoform 5 [Zea mays]
Length=385

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            +NLQAKSKE +EAE+K  RKSL FKATPMPSFYKE P PK ELKKIPTTR  SPKLGR
Sbjct  228  SNLQAKSKETEEAELKMLRKSLNFKATPMPSFYKEPPPPKVELKKIPTTRARSPKLGR  285



>ref|XP_009108879.1| PREDICTED: protein WVD2-like 1 isoform X1 [Brassica rapa]
 ref|XP_009108880.1| PREDICTED: protein WVD2-like 1 isoform X1 [Brassica rapa]
Length=419

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 50/58 (86%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            N++QAKSKE QEAE+++ RKSL FKATPMPSFY+EP  PK ELKKIP TRP SPKLGR
Sbjct  241  NSMQAKSKETQEAELRKLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRPKSPKLGR  298



>ref|XP_009108881.1| PREDICTED: protein WVD2-like 1 isoform X2 [Brassica rapa]
Length=418

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 50/58 (86%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            N++QAKSKE QEAE+++ RKSL FKATPMPSFY+EP  PK ELKKIP TRP SPKLGR
Sbjct  240  NSMQAKSKETQEAELRKLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRPKSPKLGR  297



>ref|XP_010648669.1| PREDICTED: nucleolar and coiled-body phosphoprotein 1 [Vitis 
vinifera]
Length=431

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NLQAKSKE QEAEIK  RKSLTFKATPMPSFY+E P PK ELKKIP TR  SPKLGR
Sbjct  265  NLQAKSKETQEAEIKMLRKSLTFKATPMPSFYQEPPPPKVELKKIPPTRAKSPKLGR  321



>ref|XP_002309627.2| hypothetical protein POPTR_0006s27050g [Populus trichocarpa]
 gb|EEE93150.2| hypothetical protein POPTR_0006s27050g [Populus trichocarpa]
Length=436

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = -2

Query  893  LQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            LQAKSKE  EAEIK  RKSL FKATPMPSFY+EPA PK ELKKIPTTR  SPKLGR
Sbjct  252  LQAKSKETHEAEIKMLRKSLGFKATPMPSFYQEPAPPKVELKKIPTTRAKSPKLGR  307



>ref|XP_002449726.1| hypothetical protein SORBIDRAFT_05g022180 [Sorghum bicolor]
 gb|EES08714.1| hypothetical protein SORBIDRAFT_05g022180 [Sorghum bicolor]
Length=429

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NLQ KSKE+QEAEIK  RKSLTFKATPMPSFYKE  PK ELKKIP TR  SPKLGR
Sbjct  240  NLQEKSKESQEAEIKLLRKSLTFKATPMPSFYKEQPPKVELKKIPPTRARSPKLGR  295



>emb|CBI21044.3| unnamed protein product [Vitis vinifera]
Length=439

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NLQAKSKE QEAEIK  RKSLTFKATPMPSFY+E P PK ELKKIP TR  SPKLGR
Sbjct  273  NLQAKSKETQEAEIKMLRKSLTFKATPMPSFYQEPPPPKVELKKIPPTRAKSPKLGR  329



>ref|NP_001168424.1| hypothetical protein [Zea mays]
 ref|XP_008648078.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN28167.1| unknown [Zea mays]
 gb|AFW76396.1| hypothetical protein ZEAMMB73_162127 [Zea mays]
 gb|AFW76397.1| hypothetical protein ZEAMMB73_162127 [Zea mays]
 gb|AFW76398.1| hypothetical protein ZEAMMB73_162127 [Zea mays]
Length=385

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            +NLQAKSKE +EAE+K  RKSL FKATPMPSFYKE P PK ELKKIPTTR  SPKLGR
Sbjct  227  SNLQAKSKETEEAELKMLRKSLKFKATPMPSFYKEPPPPKVELKKIPTTRARSPKLGR  284



>ref|XP_006283755.1| hypothetical protein CARUB_v10004833mg [Capsella rubella]
 gb|EOA16653.1| hypothetical protein CARUB_v10004833mg [Capsella rubella]
Length=438

 Score = 90.1 bits (222),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            N++QAKSKE QEAE++  RKSL FKATPMPSFY+EP  PK ELKKIP TRP SPKLGR
Sbjct  238  NSMQAKSKETQEAELRMLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRPKSPKLGR  295



>gb|KJB82702.1| hypothetical protein B456_013G214800 [Gossypium raimondii]
 gb|KJB82703.1| hypothetical protein B456_013G214800 [Gossypium raimondii]
 gb|KJB82704.1| hypothetical protein B456_013G214800 [Gossypium raimondii]
Length=434

 Score = 90.1 bits (222),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            +NLQAKSKE QEAEIK FRK+L FKATPMPSFY+EP  PK ELKKIP TR  SPKLGR
Sbjct  235  SNLQAKSKETQEAEIKMFRKTLKFKATPMPSFYQEPTPPKVELKKIPPTRAKSPKLGR  292



>tpg|DAA42158.1| TPA: lymphoid organ expressed yellow head virus receptor protein 
[Zea mays]
Length=454

 Score = 90.1 bits (222),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NLQ KSKE+QEAEIK  RKSLTFKATPMPSFYKE  PK ELKKIP TR  SPKLGR
Sbjct  263  NLQEKSKESQEAEIKLLRKSLTFKATPMPSFYKEQPPKVELKKIPPTRARSPKLGR  318



>ref|NP_001149997.1| LOC100283624 [Zea mays]
 gb|ACG37439.1| lymphoid organ expressed yellow head virus receptor protein [Zea 
mays]
Length=455

 Score = 90.1 bits (222),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NLQ KSKE+QEAEIK  RKSLTFKATPMPSFYKE  PK ELKKIP TR  SPKLGR
Sbjct  264  NLQEKSKESQEAEIKLLRKSLTFKATPMPSFYKEQPPKVELKKIPPTRARSPKLGR  319



>ref|XP_012076560.1| PREDICTED: serine/threonine-protein kinase PRP4 homolog [Jatropha 
curcas]
 gb|KDP33592.1| hypothetical protein JCGZ_07163 [Jatropha curcas]
Length=464

 Score = 90.1 bits (222),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            N LQAKSKE QEAEIK  RKSL FKATPMPSFY+E P PK ELKKIP TRP SPKLGR
Sbjct  272  NTLQAKSKETQEAEIKMLRKSLNFKATPMPSFYQEPPPPKLELKKIPPTRPKSPKLGR  329



>ref|NP_567893.1| TPX2 (targeting protein for Xklp2) protein family [Arabidopsis 
thaliana]
 ref|NP_001119094.1| TPX2 (targeting protein for Xklp2) protein family [Arabidopsis 
thaliana]
 gb|AAK59686.1| unknown protein [Arabidopsis thaliana]
 gb|AAM44942.1| unknown protein [Arabidopsis thaliana]
 gb|AEE86040.1| TPX2 (targeting protein for Xklp2) protein family [Arabidopsis 
thaliana]
 gb|AEE86042.1| TPX2 (targeting protein for Xklp2) protein family [Arabidopsis 
thaliana]
Length=437

 Score = 89.7 bits (221),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            N++QAKSKE QEAE++  RKSL FKATPMPSFY+EP  PK ELKKIP TRP SPKLGR
Sbjct  237  NSMQAKSKETQEAELRMLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRPKSPKLGR  294



>ref|XP_006353688.1| PREDICTED: protein WVD2-like 1-like [Solanum tuberosum]
Length=273

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            +N+QAK+KE QEAEIK  RKSL FKATPMPSFY+EPA PK ELKKIP TR  SPKLGR
Sbjct  70   SNMQAKTKETQEAEIKMLRKSLKFKATPMPSFYQEPAPPKMELKKIPPTRAKSPKLGR  127



>ref|NP_974659.1| TPX2 (targeting protein for Xklp2) protein family [Arabidopsis 
thaliana]
 gb|AEE86041.1| TPX2 (targeting protein for Xklp2) protein family [Arabidopsis 
thaliana]
Length=436

 Score = 89.7 bits (221),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            N++QAKSKE QEAE++  RKSL FKATPMPSFY+EP  PK ELKKIP TRP SPKLGR
Sbjct  236  NSMQAKSKETQEAELRMLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRPKSPKLGR  293



>ref|XP_008394082.1| PREDICTED: neurofilament heavy polypeptide-like isoform X2 [Malus 
domestica]
Length=458

 Score = 90.1 bits (222),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NNLQAKSKE  EAEI+  RK LTFKATPMPSFY+E P PK ELKKIPTTR  SPKLGR
Sbjct  258  NNLQAKSKETLEAEIRMLRKKLTFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGR  315



>ref|XP_008352059.1| PREDICTED: neurofilament heavy polypeptide-like isoform X2 [Malus 
domestica]
Length=458

 Score = 90.1 bits (222),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NNLQAKSKE  EAEI+  RK LTFKATPMPSFY+E P PK ELKKIPTTR  SPKLGR
Sbjct  258  NNLQAKSKETLEAEIRMLRKKLTFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGR  315



>ref|XP_008352057.1| PREDICTED: neurofilament heavy polypeptide-like isoform X1 [Malus 
domestica]
 ref|XP_008352058.1| PREDICTED: neurofilament heavy polypeptide-like isoform X1 [Malus 
domestica]
Length=459

 Score = 90.1 bits (222),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NNLQAKSKE  EAEI+  RK LTFKATPMPSFY+E P PK ELKKIPTTR  SPKLGR
Sbjct  259  NNLQAKSKETLEAEIRMLRKKLTFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGR  316



>ref|XP_008394080.1| PREDICTED: neurofilament heavy polypeptide-like isoform X1 [Malus 
domestica]
 ref|XP_008394081.1| PREDICTED: neurofilament heavy polypeptide-like isoform X1 [Malus 
domestica]
Length=459

 Score = 90.1 bits (222),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NNLQAKSKE  EAEI+  RK LTFKATPMPSFY+E P PK ELKKIPTTR  SPKLGR
Sbjct  259  NNLQAKSKETLEAEIRMLRKKLTFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGR  316



>ref|XP_007223133.1| hypothetical protein PRUPE_ppa005440mg [Prunus persica]
 gb|EMJ24332.1| hypothetical protein PRUPE_ppa005440mg [Prunus persica]
Length=461

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NNLQAKSKE  EAEI+  RK LTFKATPMPSFY+E P PK ELKKIPTTR  SPKLGR
Sbjct  260  NNLQAKSKETLEAEIRMLRKKLTFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGR  317



>ref|XP_006412488.1| hypothetical protein EUTSA_v10025240mg [Eutrema salsugineum]
 ref|XP_006412489.1| hypothetical protein EUTSA_v10025240mg [Eutrema salsugineum]
 ref|XP_006412490.1| hypothetical protein EUTSA_v10025240mg [Eutrema salsugineum]
 gb|ESQ53941.1| hypothetical protein EUTSA_v10025240mg [Eutrema salsugineum]
 gb|ESQ53942.1| hypothetical protein EUTSA_v10025240mg [Eutrema salsugineum]
 gb|ESQ53943.1| hypothetical protein EUTSA_v10025240mg [Eutrema salsugineum]
Length=435

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 50/58 (86%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            N++QAKSKE QEAE+++ RKSL FKATPMPSFY+EP  PK ELKKIP TRP SPKLGR
Sbjct  238  NSMQAKSKETQEAELRKLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRPKSPKLGR  295



>ref|XP_006412487.1| hypothetical protein EUTSA_v10025240mg [Eutrema salsugineum]
 gb|ESQ53940.1| hypothetical protein EUTSA_v10025240mg [Eutrema salsugineum]
Length=434

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 50/58 (86%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            N++QAKSKE QEAE+++ RKSL FKATPMPSFY+EP  PK ELKKIP TRP SPKLGR
Sbjct  237  NSMQAKSKETQEAELRKLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRPKSPKLGR  294



>gb|EYU20263.1| hypothetical protein MIMGU_mgv1a007003mg [Erythranthe guttata]
Length=423

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            +N+QAK+KE+Q+AEI+ FRKSL FKATPMPSFY+E P PK ELKKIPTTR  SPKLGR
Sbjct  257  SNIQAKTKESQDAEIRMFRKSLAFKATPMPSFYQEPPPPKLELKKIPTTRAKSPKLGR  314



>ref|XP_008219499.1| PREDICTED: neurofilament heavy polypeptide isoform X2 [Prunus 
mume]
Length=461

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NNLQAKSKE  EAEI+  RK LTFKATPMPSFY+E P PK ELKKIPTTR  SPKLGR
Sbjct  260  NNLQAKSKETLEAEIRMLRKKLTFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGR  317



>ref|XP_008219498.1| PREDICTED: neurofilament heavy polypeptide isoform X1 [Prunus 
mume]
Length=462

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NNLQAKSKE  EAEI+  RK LTFKATPMPSFY+E P PK ELKKIPTTR  SPKLGR
Sbjct  261  NNLQAKSKETLEAEIRMLRKKLTFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGR  318



>ref|XP_006412486.1| hypothetical protein EUTSA_v10025240mg [Eutrema salsugineum]
 gb|ESQ53939.1| hypothetical protein EUTSA_v10025240mg [Eutrema salsugineum]
Length=432

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 50/58 (86%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            N++QAKSKE QEAE+++ RKSL FKATPMPSFY+EP  PK ELKKIP TRP SPKLGR
Sbjct  235  NSMQAKSKETQEAELRKLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRPKSPKLGR  292



>ref|XP_002869282.1| hypothetical protein ARALYDRAFT_491495 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45541.1| hypothetical protein ARALYDRAFT_491495 [Arabidopsis lyrata subsp. 
lyrata]
Length=437

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            N++QAKSKE QEAE++  RKSL FKATPMPSFY+EP  PK ELKKIP TRP SPKLGR
Sbjct  237  NSMQAKSKETQEAELRMLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRPKSPKLGR  294



>ref|XP_009800879.1| PREDICTED: uncharacterized protein LOC104246702 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009800880.1| PREDICTED: uncharacterized protein LOC104246702 isoform X1 [Nicotiana 
sylvestris]
Length=476

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            NLQAK+KE QEAEIK  RKSL FKATPMPSFY+EPA PK ELKKIP TR  SPKLGR
Sbjct  274  NLQAKTKETQEAEIKMLRKSLKFKATPMPSFYQEPAPPKVELKKIPPTRAKSPKLGR  330



>ref|XP_009800881.1| PREDICTED: uncharacterized protein LOC104246702 isoform X2 [Nicotiana 
sylvestris]
Length=475

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            NLQAK+KE QEAEIK  RKSL FKATPMPSFY+EPA PK ELKKIP TR  SPKLGR
Sbjct  273  NLQAKTKETQEAEIKMLRKSLKFKATPMPSFYQEPAPPKVELKKIPPTRAKSPKLGR  329



>ref|XP_008219500.1| PREDICTED: neurofilament heavy polypeptide isoform X3 [Prunus 
mume]
Length=456

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NNLQAKSKE  EAEI+  RK LTFKATPMPSFY+E P PK ELKKIPTTR  SPKLGR
Sbjct  255  NNLQAKSKETLEAEIRMLRKKLTFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGR  312



>ref|XP_008676785.1| PREDICTED: uncharacterized protein LOC100272884 isoform X1 [Zea 
mays]
 gb|ACR36755.1| unknown [Zea mays]
Length=456

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NLQ KSKE+QEAEIK  RKSLTFKATPMPSFYKE  PK ELKKIP TR  SP+LGR
Sbjct  264  NLQEKSKESQEAEIKLLRKSLTFKATPMPSFYKEQPPKVELKKIPPTRARSPRLGR  319



>ref|XP_009624287.1| PREDICTED: DNA ligase 1-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009624288.1| PREDICTED: DNA ligase 1-like isoform X1 [Nicotiana tomentosiformis]
Length=476

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            +NLQAK+KE QEAEIK  RKSL FKATPMPSFY+EPA PK ELKKIP TR  SPKLGR
Sbjct  273  SNLQAKTKETQEAEIKMLRKSLKFKATPMPSFYQEPAPPKVELKKIPPTRAKSPKLGR  330



>ref|NP_001140809.1| uncharacterized protein LOC100272884 [Zea mays]
 gb|ACF84680.1| unknown [Zea mays]
 gb|AFW65259.1| hypothetical protein ZEAMMB73_329657 [Zea mays]
Length=459

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NLQ KSKE+QEAEIK  RKSLTFKATPMPSFYKE  PK ELKKIP TR  SP+LGR
Sbjct  267  NLQEKSKESQEAEIKLLRKSLTFKATPMPSFYKEQPPKVELKKIPPTRARSPRLGR  322



>ref|XP_010437923.1| PREDICTED: uncharacterized protein LOC104721599 isoform X3 [Camelina 
sativa]
Length=438

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            NN+QAKSKE QEAE++  RKSL FKATPMPSFY+EP  PK ELKKIP TR  SPKLGR
Sbjct  238  NNMQAKSKETQEAELRMLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRAKSPKLGR  295



>ref|XP_010437921.1| PREDICTED: uncharacterized protein LOC104721599 isoform X1 [Camelina 
sativa]
Length=439

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            NN+QAKSKE QEAE++  RKSL FKATPMPSFY+EP  PK ELKKIP TR  SPKLGR
Sbjct  239  NNMQAKSKETQEAELRMLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRAKSPKLGR  296



>ref|XP_009624289.1| PREDICTED: DNA ligase 1-like isoform X2 [Nicotiana tomentosiformis]
Length=475

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            +NLQAK+KE QEAEIK  RKSL FKATPMPSFY+EPA PK ELKKIP TR  SPKLGR
Sbjct  272  SNLQAKTKETQEAEIKMLRKSLKFKATPMPSFYQEPAPPKVELKKIPPTRAKSPKLGR  329



>ref|XP_011070068.1| PREDICTED: protein WVD2-like 1 isoform X2 [Sesamum indicum]
Length=469

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            +NLQAK+KE QEAEIK  RK+L FKATPMPSFY+E P PK ELKKIPTTR  SPKLGR
Sbjct  274  SNLQAKTKETQEAEIKMLRKTLGFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGR  331



>ref|XP_011069988.1| PREDICTED: protein WVD2-like 1 isoform X1 [Sesamum indicum]
Length=470

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            +NLQAK+KE QEAEIK  RK+L FKATPMPSFY+E P PK ELKKIPTTR  SPKLGR
Sbjct  275  SNLQAKTKETQEAEIKMLRKTLGFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGR  332



>ref|XP_011459178.1| PREDICTED: uncharacterized protein LOC101310775 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=469

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NNLQAKSKE  EAEIK  RK LTFKATPMPSFY+E P PK ELKK+PTTR  SPKLGR
Sbjct  253  NNLQAKSKETLEAEIKMLRKKLTFKATPMPSFYQEPPPPKVELKKLPTTRAKSPKLGR  310



>ref|XP_004291456.1| PREDICTED: uncharacterized protein LOC101310775 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=470

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NNLQAKSKE  EAEIK  RK LTFKATPMPSFY+E P PK ELKK+PTTR  SPKLGR
Sbjct  254  NNLQAKSKETLEAEIKMLRKKLTFKATPMPSFYQEPPPPKVELKKLPTTRAKSPKLGR  311



>ref|XP_010447404.1| PREDICTED: uncharacterized protein LOC104730041 isoform X2 [Camelina 
sativa]
Length=440

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            NN+QAKSKE QEAE++  RKSL FKATPMPSFY+EP  PK ELKKIP TR  SPKLGR
Sbjct  240  NNMQAKSKETQEAELRMLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRAKSPKLGR  297



>ref|XP_010447406.1| PREDICTED: uncharacterized protein LOC104730041 isoform X4 [Camelina 
sativa]
Length=439

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            NN+QAKSKE QEAE++  RKSL FKATPMPSFY+EP  PK ELKKIP TR  SPKLGR
Sbjct  239  NNMQAKSKETQEAELRMLRKSLNFKATPMPSFYQEPQPPKTELKKIPPTRAKSPKLGR  296



>ref|XP_011070147.1| PREDICTED: protein WVD2-like 1 isoform X3 [Sesamum indicum]
Length=458

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            +NLQAK+KE QEAEIK  RK+L FKATPMPSFY+E P PK ELKKIPTTR  SPKLGR
Sbjct  263  SNLQAKTKETQEAEIKMLRKTLGFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGR  320



>ref|XP_010525961.1| PREDICTED: protein WVD2-like 1 isoform X2 [Tarenaya hassleriana]
Length=400

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            N+QAKSKE QEAEIK  RKSL FKATPMP+FY+EP  PK ELKKIP T+P SPKLGR
Sbjct  232  NMQAKSKETQEAEIKMLRKSLNFKATPMPTFYQEPQPPKVELKKIPPTKPKSPKLGR  288



>ref|XP_006364924.1| PREDICTED: micronuclear linker histone polyprotein-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006364925.1| PREDICTED: micronuclear linker histone polyprotein-like isoform 
X2 [Solanum tuberosum]
Length=474

 Score = 89.4 bits (220),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NLQAK+KE QEAEIK  RKSL FKATPMPSFY+E P P+ ELKKIPTTR  SPKLGR
Sbjct  269  NLQAKTKETQEAEIKMLRKSLKFKATPMPSFYQEPPPPQVELKKIPTTRAKSPKLGR  325



>ref|XP_004245024.1| PREDICTED: RNA polymerase II degradation factor 1 [Solanum lycopersicum]
Length=460

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NLQAK+KE QEAEIK  RKSL FKATPMPSFY+E P P+ ELKKIPTTR  SPKLGR
Sbjct  266  NLQAKTKETQEAEIKMLRKSLKFKATPMPSFYQEPPPPQVELKKIPTTRAKSPKLGR  322



>ref|XP_010525960.1| PREDICTED: protein WVD2-like 1 isoform X1 [Tarenaya hassleriana]
Length=401

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            N+QAKSKE QEAEIK  RKSL FKATPMP+FY+EP  PK ELKKIP T+P SPKLGR
Sbjct  233  NMQAKSKETQEAEIKMLRKSLNFKATPMPTFYQEPQPPKVELKKIPPTKPKSPKLGR  289



>ref|XP_007011861.1| TPX2 family protein, putative [Theobroma cacao]
 gb|EOY29480.1| TPX2 family protein, putative [Theobroma cacao]
Length=457

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/57 (81%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NLQAKSKE QEAEIK  RKSL FKATPMPSFY+E P PK ELKKIP TR  SPKLGR
Sbjct  247  NLQAKSKETQEAEIKMLRKSLNFKATPMPSFYQEPPPPKVELKKIPPTRAKSPKLGR  303



>ref|XP_003603388.1| BRI1-KD interacting protein 118-like protein [Medicago truncatula]
Length=394

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAP-KAELKKIPTTRPISPKLGR  729
            +N+QAK+KE+QEAEIK+ RK L FKATPMPSFY+EP P + ELKKIPTTR  SPKLGR
Sbjct  182  SNIQAKTKESQEAEIKRLRKKLAFKATPMPSFYQEPTPSRVELKKIPTTRAKSPKLGR  239



>ref|NP_001159176.1| hypothetical protein [Zea mays]
 ref|XP_008643899.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN25320.1| unknown [Zea mays]
 gb|AFW70698.1| hypothetical protein ZEAMMB73_271181 [Zea mays]
 gb|AFW70699.1| hypothetical protein ZEAMMB73_271181 [Zea mays]
Length=388

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAP-KAELKKIPTTRPISPKLGR  729
            +NLQAKSKE +EAE+K  RKSL FKATPMPSFYKEP P K ELKKIP TR  SPKLGR
Sbjct  217  SNLQAKSKETEEAELKMLRKSLNFKATPMPSFYKEPTPAKVELKKIPPTRAKSPKLGR  274



>gb|AES73638.2| TPX2 (targeting protein for Xklp2) family protein [Medicago truncatula]
Length=453

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAP-KAELKKIPTTRPISPKLGR  729
            N+QAK+KE+QEAEIK+ RK L FKATPMPSFY+EP P + ELKKIPTTR  SPKLGR
Sbjct  242  NIQAKTKESQEAEIKRLRKKLAFKATPMPSFYQEPTPSRVELKKIPTTRAKSPKLGR  298



>gb|AFK45470.1| unknown [Medicago truncatula]
Length=452

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAP-KAELKKIPTTRPISPKLGR  729
            N+QAK+KE+QEAEIK+ RK L FKATPMPSFY+EP P + ELKKIPTTR  SPKLGR
Sbjct  241  NIQAKTKESQEAEIKRLRKKLAFKATPMPSFYQEPTPSRVELKKIPTTRAKSPKLGR  297



>ref|XP_009376919.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X1 [Pyrus x bretschneideri]
Length=460

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NNLQAKS+E  EAEI+  RK LTFKATPMPSFY+E P PK ELKKIPTTR  SPKLGR
Sbjct  259  NNLQAKSEETLEAEIRMLRKKLTFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGR  316



>ref|XP_009376920.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X2 [Pyrus x bretschneideri]
Length=459

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NNLQAKS+E  EAEI+  RK LTFKATPMPSFY+E P PK ELKKIPTTR  SPKLGR
Sbjct  258  NNLQAKSEETLEAEIRMLRKKLTFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGR  315



>ref|XP_003603387.1| BRI1-KD interacting protein 118-like protein [Medicago truncatula]
Length=442

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 49/57 (86%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAP-KAELKKIPTTRPISPKLGR  729
            N+QAK+KE+QEAEIK+ RK L FKATPMPSFY+EP P + ELKKIPTTR  SPKLGR
Sbjct  231  NIQAKTKESQEAEIKRLRKKLAFKATPMPSFYQEPTPSRVELKKIPTTRAKSPKLGR  287



>ref|XP_009376921.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform 
X3 [Pyrus x bretschneideri]
Length=454

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NNLQAKS+E  EAEI+  RK LTFKATPMPSFY+E P PK ELKKIPTTR  SPKLGR
Sbjct  253  NNLQAKSEETLEAEIRMLRKKLTFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGR  310



>gb|AFW70700.1| hypothetical protein ZEAMMB73_271181, partial [Zea mays]
Length=363

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAP-KAELKKIPTTRPISPKLGR  729
            +NLQAKSKE +EAE+K  RKSL FKATPMPSFYKEP P K ELKKIP TR  SPKLGR
Sbjct  192  SNLQAKSKETEEAELKMLRKSLNFKATPMPSFYKEPTPAKVELKKIPPTRAKSPKLGR  249



>ref|XP_008378377.1| PREDICTED: neurofilament heavy polypeptide-like isoform X1 [Malus 
domestica]
Length=459

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NNLQAKS+E  EAEI+  RK LTFKATPMPSFY+E P PK ELKKIPTTR  SPKLGR
Sbjct  259  NNLQAKSEETLEAEIRMLRKKLTFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGR  316



>ref|XP_008378378.1| PREDICTED: neurofilament heavy polypeptide-like isoform X2 [Malus 
domestica]
Length=453

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NNLQAKS+E  EAEI+  RK LTFKATPMPSFY+E P PK ELKKIPTTR  SPKLGR
Sbjct  253  NNLQAKSEETLEAEIRMLRKKLTFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGR  310



>ref|XP_008378379.1| PREDICTED: neurofilament heavy polypeptide-like isoform X3 [Malus 
domestica]
Length=429

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NNLQAKS+E  EAEI+  RK LTFKATPMPSFY+E P PK ELKKIPTTR  SPKLGR
Sbjct  229  NNLQAKSEETLEAEIRMLRKKLTFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLGR  286



>ref|XP_006483365.1| PREDICTED: enolase-phosphatase E1-like isoform X1 [Citrus sinensis]
Length=439

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = -2

Query  893  LQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            LQAKSKE QEAEIK  RKSL FKATPMP+FY+E P PK ELKKIPTTR  SPKLGR
Sbjct  251  LQAKSKETQEAEIKMLRKSLNFKATPMPTFYQEPPPPKVELKKIPTTRAKSPKLGR  306



>gb|KDO61734.1| hypothetical protein CISIN_1g013648mg [Citrus sinensis]
 gb|KDO61735.1| hypothetical protein CISIN_1g013648mg [Citrus sinensis]
Length=439

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = -2

Query  893  LQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            LQAKSKE QEAEIK  RKSL FKATPMP+FY+E P PK ELKKIPTTR  SPKLGR
Sbjct  251  LQAKSKETQEAEIKMLRKSLNFKATPMPTFYQEPPPPKVELKKIPTTRAKSPKLGR  306



>ref|XP_006450433.1| hypothetical protein CICLE_v10008326mg [Citrus clementina]
 gb|ESR63673.1| hypothetical protein CICLE_v10008326mg [Citrus clementina]
Length=439

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = -2

Query  893  LQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            LQAKSKE QEAEIK  RKSL FKATPMP+FY+E P PK ELKKIPTTR  SPKLGR
Sbjct  251  LQAKSKETQEAEIKMLRKSLNFKATPMPTFYQEPPPPKVELKKIPTTRAKSPKLGR  306



>ref|XP_006656223.1| PREDICTED: neurofilament heavy polypeptide-like [Oryza brachyantha]
Length=372

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            +N+QAKSKE +EAE+K+ RKSL FKA PMPSFYKE P PK ELKKIPTTR  SPKLGR
Sbjct  226  SNMQAKSKETEEAELKRLRKSLNFKANPMPSFYKEPPPPKVELKKIPTTRARSPKLGR  283



>ref|XP_004241776.1| PREDICTED: RNA polymerase II degradation factor 1 isoform X3 
[Solanum lycopersicum]
Length=476

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            +N+QAK+KE QEAEIK  RKSL FKATPMPSFY+EPA PK ELKKIP TR  SPKLGR
Sbjct  273  SNMQAKTKETQEAEIKMLRKSLKFKATPMPSFYQEPAPPKMELKKIPPTRAKSPKLGR  330



>ref|XP_010322719.1| PREDICTED: RNA polymerase II degradation factor 1 isoform X4 
[Solanum lycopersicum]
Length=475

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            +N+QAK+KE QEAEIK  RKSL FKATPMPSFY+EPA PK ELKKIP TR  SPKLGR
Sbjct  272  SNMQAKTKETQEAEIKMLRKSLKFKATPMPSFYQEPAPPKMELKKIPPTRAKSPKLGR  329



>ref|XP_010322718.1| PREDICTED: RNA polymerase II degradation factor 1 isoform X2 
[Solanum lycopersicum]
Length=476

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            +N+QAK+KE QEAEIK  RKSL FKATPMPSFY+EPA PK ELKKIP TR  SPKLGR
Sbjct  273  SNMQAKTKETQEAEIKMLRKSLKFKATPMPSFYQEPAPPKMELKKIPPTRAKSPKLGR  330



>ref|XP_010322717.1| PREDICTED: RNA polymerase II degradation factor 1 isoform X1 
[Solanum lycopersicum]
Length=477

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            +N+QAK+KE QEAEIK  RKSL FKATPMPSFY+EPA PK ELKKIP TR  SPKLGR
Sbjct  274  SNMQAKTKETQEAEIKMLRKSLKFKATPMPSFYQEPAPPKMELKKIPPTRAKSPKLGR  331



>ref|NP_001058026.1| Os06g0606800 [Oryza sativa Japonica Group]
 dbj|BAD36111.1| putative BRI1-KD interacting protein 118 [Oryza sativa Japonica 
Group]
 dbj|BAF19940.1| Os06g0606800 [Oryza sativa Japonica Group]
 dbj|BAG89931.1| unnamed protein product [Oryza sativa Japonica Group]
Length=372

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            +N+QAKSKE +EAE+K+ RKSL F+A PMPSFYKE P PK ELKKIPTTR  SPKLGR
Sbjct  226  SNMQAKSKETEEAELKKLRKSLNFRANPMPSFYKEPPPPKVELKKIPTTRARSPKLGR  283



>ref|XP_010322721.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X6 [Solanum lycopersicum]
Length=458

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            +N+QAK+KE QEAEIK  RKSL FKATPMPSFY+EPA PK ELKKIP TR  SPKLGR
Sbjct  255  SNMQAKTKETQEAEIKMLRKSLKFKATPMPSFYQEPAPPKMELKKIPPTRAKSPKLGR  312



>ref|XP_010322720.1| PREDICTED: serine/arginine repetitive matrix protein 1 isoform 
X5 [Solanum lycopersicum]
Length=459

 Score = 88.2 bits (217),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            +N+QAK+KE QEAEIK  RKSL FKATPMPSFY+EPA PK ELKKIP TR  SPKLGR
Sbjct  256  SNMQAKTKETQEAEIKMLRKSLKFKATPMPSFYQEPAPPKMELKKIPPTRAKSPKLGR  313



>ref|NP_001046221.1| Os02g0200800 [Oryza sativa Japonica Group]
 dbj|BAD11346.1| BRI1-KD interacting protein 118 [Oryza sativa Japonica Group]
 dbj|BAF08135.1| Os02g0200800, partial [Oryza sativa Japonica Group]
Length=334

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            +NLQAKSKE +EAE+K  RKSL FKATPMPSFY+EP  PK ELKKIP TR  SPKLGR
Sbjct  158  SNLQAKSKETEEAELKMLRKSLNFKATPMPSFYQEPTPPKVELKKIPPTRARSPKLGR  215



>ref|XP_003563653.1| PREDICTED: protein WVD2-like 1 [Brachypodium distachyon]
 ref|XP_010227540.1| PREDICTED: protein WVD2-like 1 [Brachypodium distachyon]
Length=381

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NL+AKSKE +EAE++Q RKSL FKA PMPSFYKE P PK +LKKIPTTR  SPKLGR
Sbjct  226  NLEAKSKETEEAELRQLRKSLNFKAAPMPSFYKEPPPPKVDLKKIPTTRARSPKLGR  282



>ref|XP_008466404.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 [Cucumis 
melo]
Length=506

 Score = 88.2 bits (217),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            N LQAKSKE QEAEIK  RKSL FKATPMPSFY+E P PK ELKKIP TR  SPKLGR
Sbjct  254  NTLQAKSKETQEAEIKMLRKSLNFKATPMPSFYQEPPPPKVELKKIPPTRAKSPKLGR  311



>ref|XP_006578145.1| PREDICTED: neurofilament heavy polypeptide isoform X3 [Glycine 
max]
Length=471

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NLQAK+KE QEAEIK  RKSL FKATPMPSFY+E P P+ ELKK+PTTR  SPKLGR
Sbjct  259  NLQAKTKETQEAEIKMLRKSLGFKATPMPSFYQEPPPPRVELKKMPTTRAKSPKLGR  315



>ref|XP_003522613.1| PREDICTED: neurofilament heavy polypeptide isoform X1 [Glycine 
max]
 ref|XP_006578146.1| PREDICTED: neurofilament heavy polypeptide isoform X4 [Glycine 
max]
 ref|XP_006578147.1| PREDICTED: neurofilament heavy polypeptide isoform X5 [Glycine 
max]
 gb|KHN08133.1| hypothetical protein glysoja_032317 [Glycine soja]
Length=468

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NLQAK+KE QEAEIK  RKSL FKATPMPSFY+E P P+ ELKK+PTTR  SPKLGR
Sbjct  256  NLQAKTKETQEAEIKMLRKSLGFKATPMPSFYQEPPPPRVELKKMPTTRAKSPKLGR  312



>ref|XP_010048967.1| PREDICTED: uncharacterized protein LOC104437670 [Eucalyptus grandis]
 gb|KCW81394.1| hypothetical protein EUGRSUZ_C02774 [Eucalyptus grandis]
Length=429

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = -2

Query  893  LQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            LQ KSKE  EAEIK  RKSLTFKATPMPSFY+E P PKAELKKIPTTR  SPKLGR
Sbjct  245  LQEKSKETLEAEIKMLRKSLTFKATPMPSFYQEPPPPKAELKKIPTTRAKSPKLGR  300



>ref|XP_009355746.1| PREDICTED: titin-like isoform X2 [Pyrus x bretschneideri]
Length=458

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NNLQAKSKE  EAEI+  RK LTFKATPMPSFY+E P PK ELKKIP TR  SPKLGR
Sbjct  258  NNLQAKSKETLEAEIRMLRKKLTFKATPMPSFYQEPPPPKVELKKIPITRAKSPKLGR  315



>gb|KCW81395.1| hypothetical protein EUGRSUZ_C02774 [Eucalyptus grandis]
Length=428

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = -2

Query  893  LQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            LQ KSKE  EAEIK  RKSLTFKATPMPSFY+E P PKAELKKIPTTR  SPKLGR
Sbjct  244  LQEKSKETLEAEIKMLRKSLTFKATPMPSFYQEPPPPKAELKKIPTTRAKSPKLGR  299



>ref|XP_009355744.1| PREDICTED: titin-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009355745.1| PREDICTED: titin-like isoform X1 [Pyrus x bretschneideri]
Length=459

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NNLQAKSKE  EAEI+  RK LTFKATPMPSFY+E P PK ELKKIP TR  SPKLGR
Sbjct  259  NNLQAKSKETLEAEIRMLRKKLTFKATPMPSFYQEPPPPKVELKKIPITRAKSPKLGR  316



>ref|XP_004136350.1| PREDICTED: nucleolar and coiled-body phosphoprotein 1-like [Cucumis 
sativus]
 gb|KGN60099.1| hypothetical protein Csa_3G878190 [Cucumis sativus]
Length=509

 Score = 88.2 bits (217),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            N LQAKSKE QEAEIK  RKSL FKATPMPSFY+E P PK ELKKIP TR  SPKLGR
Sbjct  257  NTLQAKSKETQEAEIKMLRKSLNFKATPMPSFYQEPPPPKVELKKIPPTRAKSPKLGR  314



>ref|XP_004501334.1| PREDICTED: uncharacterized protein DDB_G0284459-like [Cicer arietinum]
Length=473

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAP-KAELKKIPTTRPISPKLGR  729
            N+QAK+KE QEAEIK+ RK L FKATPMPSFY+EP P + ELKKIPTTR  SPKLGR
Sbjct  260  NMQAKTKETQEAEIKKLRKKLAFKATPMPSFYQEPPPSRVELKKIPTTRAKSPKLGR  316



>dbj|BAD36112.1| BRI1-KD interacting protein 118-like [Oryza sativa Japonica Group]
Length=145

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = -2

Query  893  LQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            +QAKSKE +EAE+K+ RKSL F+A PMPSFYKE P PK ELKKIPTTR  SPKLGR
Sbjct  1    MQAKSKETEEAELKKLRKSLNFRANPMPSFYKEPPPPKVELKKIPTTRARSPKLGR  56



>dbj|BAK04989.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=408

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NLQ KSKE+QEAEIK+ RKSLTFKA PMPSFYKE  PK ELKKI  TR  SPKLGR
Sbjct  258  NLQEKSKESQEAEIKRLRKSLTFKAAPMPSFYKEQPPKVELKKIAPTRARSPKLGR  313



>dbj|BAD15848.1| putative BRI1-KD interacting protein [Oryza sativa Japonica Group]
 gb|EEE56515.1| hypothetical protein OsJ_05791 [Oryza sativa Japonica Group]
Length=395

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            +NLQAKSKE +EAE+K  RKSL FKATPMPSFY+EP  PK ELKKIP TR  SPKLGR
Sbjct  219  SNLQAKSKETEEAELKMLRKSLNFKATPMPSFYQEPTPPKVELKKIPPTRARSPKLGR  276



>gb|EAY84904.1| hypothetical protein OsI_06272 [Oryza sativa Indica Group]
Length=395

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            +NLQAKSKE +EAE+K  RKSL FKATPMPSFY+EP  PK ELKKIP TR  SPKLGR
Sbjct  219  SNLQAKSKETEEAELKMLRKSLNFKATPMPSFYQEPTPPKVELKKIPPTRARSPKLGR  276



>gb|EMT19041.1| hypothetical protein F775_30851 [Aegilops tauschii]
Length=461

 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NLQ KSKE+QEAEIK+ RKSLTFKA PMPSFYKE  PK ELKKI  TR  SPKLGR
Sbjct  258  NLQEKSKESQEAEIKRLRKSLTFKAAPMPSFYKEQPPKVELKKIAPTRARSPKLGR  313



>ref|XP_006578144.1| PREDICTED: neurofilament heavy polypeptide isoform X2 [Glycine 
max]
Length=492

 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NLQAK+KE QEAEIK  RKSL FKATPMPSFY+E P P+ ELKK+PTTR  SPKLGR
Sbjct  280  NLQAKTKETQEAEIKMLRKSLGFKATPMPSFYQEPPPPRVELKKMPTTRAKSPKLGR  336



>ref|XP_003575947.1| PREDICTED: E3 ubiquitin-protein ligase TRIP12 [Brachypodium distachyon]
Length=456

 Score = 87.4 bits (215),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NLQ KSKE+QEAEIK+ RKSLTFKA PMPSFYKE  PK ELKKI  TR  SPKLGR
Sbjct  265  NLQEKSKESQEAEIKRLRKSLTFKAAPMPSFYKEQPPKVELKKIAPTRARSPKLGR  320



>ref|XP_007137018.1| hypothetical protein PHAVU_009G093100g [Phaseolus vulgaris]
 ref|XP_007137019.1| hypothetical protein PHAVU_009G093100g [Phaseolus vulgaris]
 gb|ESW09012.1| hypothetical protein PHAVU_009G093100g [Phaseolus vulgaris]
 gb|ESW09013.1| hypothetical protein PHAVU_009G093100g [Phaseolus vulgaris]
Length=478

 Score = 87.0 bits (214),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAP-KAELKKIPTTRPISPKLGR  729
            NLQAK+KE QEAEIK+ RKSL FKATPMPSFY+EP P + E KK+PTTR  SPKLGR
Sbjct  264  NLQAKTKETQEAEIKRLRKSLGFKATPMPSFYQEPPPARVEFKKMPTTRAKSPKLGR  320



>ref|NP_001148491.1| LOC100282106 [Zea mays]
 ref|XP_008677233.1| PREDICTED: LOC100282106 isoform X1 [Zea mays]
 gb|ACG31713.1| seed specific protein Bn15D14A [Zea mays]
 gb|ACN28182.1| unknown [Zea mays]
 gb|AFW66153.1| Seed specific protein Bn15D14A isoform 1 [Zea mays]
 gb|AFW66154.1| Seed specific protein Bn15D14A isoform 2 [Zea mays]
Length=397

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAP-KAELKKIPTTRPISPKLGR  729
            +NLQAKSKE +EAE+K  RKSL FKATPMPSFYKEP P K ELKKIP TR  SPK GR
Sbjct  219  SNLQAKSKETEEAELKMLRKSLNFKATPMPSFYKEPTPVKVELKKIPPTRAKSPKFGR  276



>ref|NP_180118.2| TPX2 (targeting protein for Xklp2) family protein [Arabidopsis 
thaliana]
 dbj|BAE99750.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC07706.1| TPX2 (targeting protein for Xklp2) family protein [Arabidopsis 
thaliana]
Length=403

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEP-APKAELKKIPTTRPISPKLGR  729
            N +QAKSKE QEAE+K  RKSL FKATPMP+FY+EP  PK ELKKI  TRP SPKLGR
Sbjct  212  NTVQAKSKETQEAELKMLRKSLNFKATPMPTFYQEPQLPKTELKKIAITRPKSPKLGR  269



>gb|AAD20707.1| unknown protein [Arabidopsis thaliana]
Length=404

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEP-APKAELKKIPTTRPISPKLGR  729
            N +QAKSKE QEAE+K  RKSL FKATPMP+FY+EP  PK ELKKI  TRP SPKLGR
Sbjct  213  NTVQAKSKETQEAELKMLRKSLNFKATPMPTFYQEPQLPKTELKKIAITRPKSPKLGR  270



>ref|XP_006842059.1| PREDICTED: uncharacterized protein LOC18431876 [Amborella trichopoda]
 gb|ERN03734.1| hypothetical protein AMTR_s00078p00037340 [Amborella trichopoda]
Length=459

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 47/57 (82%), Gaps = 1/57 (2%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            NLQAKSKE  EAEIK  RKSLTFKA PMP+FY+EPA PK ELKKIP TR  SPKLGR
Sbjct  274  NLQAKSKETLEAEIKLLRKSLTFKANPMPTFYQEPAPPKVELKKIPPTRAKSPKLGR  330



>ref|XP_007161211.1| hypothetical protein PHAVU_001G051200g [Phaseolus vulgaris]
 gb|ESW33205.1| hypothetical protein PHAVU_001G051200g [Phaseolus vulgaris]
Length=472

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 4/57 (7%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPAPKAELKKIPTTRPISPKLGR  729
            NN+QAK+KE Q+AEIK+ RKSL FKATPMPSFY+EPAP     KIPTTRP SPK GR
Sbjct  260  NNMQAKTKETQDAEIKKLRKSLNFKATPMPSFYQEPAP----PKIPTTRPKSPKFGR  312



>ref|XP_009405787.1| PREDICTED: uncharacterized protein LOC103988852 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009405788.1| PREDICTED: uncharacterized protein LOC103988852 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=399

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 49/58 (84%), Gaps = 2/58 (3%)
 Frame = -2

Query  896  NLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKK-IPTTRPISPKLGR  729
            NLQ KSKE+QEAEI++ RKSLTFKATPMPSFY+EP  PK ELKK IP TR  SPKLGR
Sbjct  206  NLQVKSKESQEAEIRKLRKSLTFKATPMPSFYQEPGPPKVELKKQIPPTRAKSPKLGR  263



>ref|XP_002962886.1| hypothetical protein SELMODRAFT_38526, partial [Selaginella moellendorffii]
 ref|XP_002989464.1| hypothetical protein SELMODRAFT_28462, partial [Selaginella moellendorffii]
 gb|EFJ09555.1| hypothetical protein SELMODRAFT_28462, partial [Selaginella moellendorffii]
 gb|EFJ36349.1| hypothetical protein SELMODRAFT_38526, partial [Selaginella moellendorffii]
Length=60

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = -2

Query  875  ENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            E  EAEIKQ RKSLTFKATPMPSFY+E P PKAEL+KIPTTR  SPKLGR
Sbjct  1    EEMEAEIKQLRKSLTFKATPMPSFYQEAPPPKAELRKIPTTRARSPKLGR  50



>ref|XP_009376913.1| PREDICTED: titin-like isoform X1 [Pyrus x bretschneideri]
Length=460

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NNLQAKS+E  EAEI+  RK LTFKATPMPSFY+E P PK ELKKIPTTR  SPKL R
Sbjct  259  NNLQAKSEETLEAEIRMLRKKLTFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLSR  316



>ref|XP_009376914.1| PREDICTED: titin-like isoform X2 [Pyrus x bretschneideri]
Length=459

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 47/58 (81%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            NNLQAKS+E  EAEI+  RK LTFKATPMPSFY+E P PK ELKKIPTTR  SPKL R
Sbjct  258  NNLQAKSEETLEAEIRMLRKKLTFKATPMPSFYQEPPPPKVELKKIPTTRAKSPKLSR  315



>ref|XP_010048196.1| PREDICTED: cylicin-1-like [Eucalyptus grandis]
 ref|XP_010048198.1| PREDICTED: cylicin-1-like [Eucalyptus grandis]
 ref|XP_010048199.1| PREDICTED: cylicin-1-like [Eucalyptus grandis]
 ref|XP_010048200.1| PREDICTED: cylicin-1-like [Eucalyptus grandis]
 gb|KCW80380.1| hypothetical protein EUGRSUZ_C01741 [Eucalyptus grandis]
Length=428

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 47/56 (84%), Gaps = 1/56 (2%)
 Frame = -2

Query  893  LQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            LQAKSKE QEAE+K  RKSL FKATPMP+FY+EP+ PK ELKKIP TR  SPKLGR
Sbjct  249  LQAKSKETQEAELKMLRKSLNFKATPMPNFYQEPSPPKVELKKIPPTRARSPKLGR  304



>ref|XP_010437922.1| PREDICTED: general transcriptional corepressor trfA-like isoform 
X2 [Camelina sativa]
Length=439

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 48/59 (81%), Gaps = 2/59 (3%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAEL-KKIPTTRPISPKLGR  729
            NN+QAKSKE QEAE++  RKSL FKATPMPSFY+EP  PK EL KKIP TR  SPKLGR
Sbjct  238  NNMQAKSKETQEAELRMLRKSLNFKATPMPSFYQEPQPPKTELKKKIPPTRAKSPKLGR  296



>ref|XP_010447405.1| PREDICTED: uncharacterized protein LOC104730041 isoform X3 [Camelina 
sativa]
Length=440

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 48/59 (81%), Gaps = 2/59 (3%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAEL-KKIPTTRPISPKLGR  729
            NN+QAKSKE QEAE++  RKSL FKATPMPSFY+EP  PK EL KKIP TR  SPKLGR
Sbjct  239  NNMQAKSKETQEAELRMLRKSLNFKATPMPSFYQEPQPPKTELKKKIPPTRAKSPKLGR  297



>ref|XP_010447403.1| PREDICTED: uncharacterized protein LOC104730041 isoform X1 [Camelina 
sativa]
Length=441

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 48/59 (81%), Gaps = 2/59 (3%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAEL-KKIPTTRPISPKLGR  729
            NN+QAKSKE QEAE++  RKSL FKATPMPSFY+EP  PK EL KKIP TR  SPKLGR
Sbjct  240  NNMQAKSKETQEAELRMLRKSLNFKATPMPSFYQEPQPPKTELKKKIPPTRAKSPKLGR  298



>ref|XP_010932896.1| PREDICTED: protein WVD2-like 1 [Elaeis guineensis]
 ref|XP_010932897.1| PREDICTED: protein WVD2-like 1 [Elaeis guineensis]
 ref|XP_010932899.1| PREDICTED: protein WVD2-like 1 [Elaeis guineensis]
Length=399

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  899  NNLQAKSKENQEAEIKQFRKSLTFKATPMPSFYKE-PAPKAELKKIPTTRPISPKLGR  729
            N  +A++KE +EA +KQ RKSLTFKA PMPSFY+E P PK ELKK+PTTRP SPKLGR
Sbjct  267  NQREARTKEEREAALKQLRKSLTFKAMPMPSFYREGPPPKVELKKLPTTRPKSPKLGR  324



>gb|KDO80219.1| hypothetical protein CISIN_1g012146mg [Citrus sinensis]
Length=461

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 46/56 (82%), Gaps = 1/56 (2%)
 Frame = -2

Query  893  LQAKSKENQEAEIKQFRKSLTFKATPMPSFYKEPA-PKAELKKIPTTRPISPKLGR  729
            +QAK++ENQEAEIK FRKSL FKATPMPSFY EPA PK ELKK P TR  SPKL R
Sbjct  282  IQAKTQENQEAEIKMFRKSLMFKATPMPSFYHEPAPPKVELKKTPPTRAKSPKLSR  337



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2200264392382