BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13814

Length=874
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009628597.1|  PREDICTED: ataxin-2 homolog                        250   8e-75   Nicotiana tomentosiformis
ref|XP_004248167.1|  PREDICTED: bromodomain-containing protein 4        245   5e-73   Solanum lycopersicum
ref|XP_009782976.1|  PREDICTED: vacuolar protein sorting-associat...    242   7e-72   Nicotiana sylvestris
ref|XP_004243351.1|  PREDICTED: bromodomain-containing protein 4-...    241   2e-71   Solanum lycopersicum
ref|XP_009628959.1|  PREDICTED: extensin-like                           239   6e-71   Nicotiana tomentosiformis
ref|XP_006367642.1|  PREDICTED: adenylate cyclase, terminal-diffe...    240   7e-71   Solanum tuberosum [potatoes]
ref|XP_009782624.1|  PREDICTED: pollen-specific leucine-rich repe...    239   1e-70   Nicotiana sylvestris
ref|XP_006357482.1|  PREDICTED: transcription factor SPT20 homolog      239   2e-70   Solanum tuberosum [potatoes]
emb|CDP14783.1|  unnamed protein product                                203   3e-57   Coffea canephora [robusta coffee]
ref|XP_010689008.1|  PREDICTED: RNA polymerase II degradation fac...    195   4e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010110218.1|  hypothetical protein L484_009824                   194   8e-54   Morus notabilis
ref|XP_002272844.1|  PREDICTED: arginine-glutamic acid dipeptide ...    178   8e-48   Vitis vinifera
gb|KJB31694.1|  hypothetical protein B456_005G201600                    177   3e-47   Gossypium raimondii
ref|XP_007198900.1|  hypothetical protein PRUPE_ppa004117mg             174   2e-46   Prunus persica
ref|XP_007043595.1|  Structural constituent of cell wall                172   1e-45   
ref|XP_008229158.1|  PREDICTED: mediator of RNA polymerase II tra...    170   6e-45   Prunus mume [ume]
ref|XP_008229157.1|  PREDICTED: mediator of RNA polymerase II tra...    170   7e-45   Prunus mume [ume]
ref|XP_002517918.1|  structural constituent of cell wall, putative      169   1e-44   Ricinus communis
ref|XP_012088286.1|  PREDICTED: mediator of RNA polymerase II tra...    166   3e-43   Jatropha curcas
gb|KEH17617.1|  structural constituent of cell wall protein, puta...    166   3e-43   Medicago truncatula
ref|XP_008337475.1|  PREDICTED: altered inheritance of mitochondr...    165   3e-43   
gb|KHN31988.1|  hypothetical protein glysoja_025822                     164   1e-42   Glycine soja [wild soybean]
ref|XP_003539922.1|  PREDICTED: putative uncharacterized protein ...    164   1e-42   Glycine max [soybeans]
ref|XP_006592435.1|  PREDICTED: putative uncharacterized protein ...    164   1e-42   Glycine max [soybeans]
gb|KJB77269.1|  hypothetical protein B456_012G128800                    160   2e-42   Gossypium raimondii
gb|KJB77267.1|  hypothetical protein B456_012G128800                    161   2e-42   Gossypium raimondii
ref|XP_007132659.1|  hypothetical protein PHAVU_011G113900g             163   2e-42   Phaseolus vulgaris [French bean]
gb|KJB77274.1|  hypothetical protein B456_012G128800                    162   2e-42   Gossypium raimondii
gb|KJB77268.1|  hypothetical protein B456_012G128800                    162   4e-42   Gossypium raimondii
gb|KJB77271.1|  hypothetical protein B456_012G128800                    162   4e-42   Gossypium raimondii
ref|XP_009357856.1|  PREDICTED: putative uncharacterized protein ...    161   8e-42   Pyrus x bretschneideri [bai li]
ref|XP_004506616.1|  PREDICTED: transcription factor SPT20 homolog      161   9e-42   Cicer arietinum [garbanzo]
gb|KHG27956.1|  S-adenosylmethionine synthase 1                         161   1e-41   Gossypium arboreum [tree cotton]
ref|XP_004303103.1|  PREDICTED: transcriptional regulator DEF1          160   2e-41   Fragaria vesca subsp. vesca
ref|XP_006447363.1|  hypothetical protein CICLE_v10014791mg             157   3e-40   Citrus clementina [clementine]
ref|XP_006447362.1|  hypothetical protein CICLE_v10014791mg             157   3e-40   Citrus clementina [clementine]
gb|KDO51850.1|  hypothetical protein CISIN_1g008878mg                   157   4e-40   Citrus sinensis [apfelsine]
gb|KDO51849.1|  hypothetical protein CISIN_1g008878mg                   157   4e-40   Citrus sinensis [apfelsine]
ref|XP_006582794.1|  PREDICTED: vacuolar protein sorting-associat...    155   6e-40   
ref|XP_011098021.1|  PREDICTED: extensin                                156   7e-40   Sesamum indicum [beniseed]
gb|KHN35253.1|  hypothetical protein glysoja_042323                     156   9e-40   Glycine soja [wild soybean]
ref|XP_008342910.1|  PREDICTED: extensin-like isoform X1                155   2e-39   
ref|XP_008342911.1|  PREDICTED: extensin-like isoform X2                155   2e-39   
ref|XP_002325597.2|  hydroxyproline-rich glycoprotein                   152   2e-38   Populus trichocarpa [western balsam poplar]
ref|XP_011002849.1|  PREDICTED: calcium-binding protein P-like          152   3e-38   Populus euphratica
ref|XP_009341976.1|  PREDICTED: ATP-dependent helicase brm-like i...    151   4e-38   Pyrus x bretschneideri [bai li]
ref|XP_009341977.1|  PREDICTED: ATP-dependent helicase brm-like i...    151   5e-38   Pyrus x bretschneideri [bai li]
ref|XP_009336199.1|  PREDICTED: mediator of RNA polymerase II tra...    150   6e-38   Pyrus x bretschneideri [bai li]
ref|XP_009336198.1|  PREDICTED: mediator of RNA polymerase II tra...    150   7e-38   Pyrus x bretschneideri [bai li]
ref|XP_006376495.1|  hydroxyproline-rich glycoprotein                   146   2e-36   Populus trichocarpa [western balsam poplar]
ref|XP_010035753.1|  PREDICTED: RNA polymerase II degradation fac...    144   2e-35   Eucalyptus grandis [rose gum]
gb|EYU28592.1|  hypothetical protein MIMGU_mgv1a004659mg                140   2e-34   Erythranthe guttata [common monkey flower]
ref|XP_003540363.1|  PREDICTED: integrator complex subunit 3 homo...    137   2e-33   Glycine max [soybeans]
ref|XP_011037330.1|  PREDICTED: putative uncharacterized protein ...    137   2e-33   Populus euphratica
ref|XP_011037329.1|  PREDICTED: bromodomain-containing protein 4-...    137   2e-33   Populus euphratica
gb|KCW89535.1|  hypothetical protein EUGRSUZ_A01820                     133   5e-32   Eucalyptus grandis [rose gum]
ref|XP_010051997.1|  PREDICTED: LOW QUALITY PROTEIN: bromodomain-...    133   5e-32   Eucalyptus grandis [rose gum]
ref|XP_007149849.1|  hypothetical protein PHAVU_005G103700g             132   2e-31   Phaseolus vulgaris [French bean]
gb|KEH39132.1|  structural constituent of cell wall protein, puta...    123   2e-28   Medicago truncatula
gb|KEH39131.1|  structural constituent of cell wall protein, puta...    122   3e-28   Medicago truncatula
ref|XP_010242911.1|  PREDICTED: RNA polymerase II degradation fac...    120   2e-27   Nelumbo nucifera [Indian lotus]
ref|XP_003543336.1|  PREDICTED: RNA polymerase II degradation fac...    115   1e-25   Glycine max [soybeans]
ref|XP_004136824.1|  PREDICTED: trithorax group protein osa             115   2e-25   Cucumis sativus [cucumbers]
ref|XP_008455323.1|  PREDICTED: mediator of RNA polymerase II tra...    114   3e-25   Cucumis melo [Oriental melon]
gb|KHN36637.1|  hypothetical protein glysoja_001368                     114   6e-25   Glycine soja [wild soybean]
ref|XP_008455322.1|  PREDICTED: transcription factor SPT20 homolog      113   7e-25   Cucumis melo [Oriental melon]
ref|XP_010924426.1|  PREDICTED: putative cyclin-dependent serine/...    109   7e-24   
ref|XP_004136823.1|  PREDICTED: trithorax group protein osa             110   2e-23   Cucumis sativus [cucumbers]
ref|XP_010924425.1|  PREDICTED: hepatocyte growth factor-regulate...    109   2e-23   Elaeis guineensis
ref|XP_008798248.1|  PREDICTED: putative cyclin-dependent serine/...    100   3e-20   Phoenix dactylifera
ref|XP_008810226.1|  PREDICTED: ataxin-2 homolog isoform X2           95.5    1e-18   Phoenix dactylifera
ref|XP_008810225.1|  PREDICTED: ataxin-2 homolog isoform X1           95.9    1e-18   Phoenix dactylifera
ref|XP_010919602.1|  PREDICTED: tyrosine-protein phosphatase non-...  94.0    3e-18   Elaeis guineensis
ref|XP_010919593.1|  PREDICTED: tyrosine-protein phosphatase non-...  94.0    4e-18   Elaeis guineensis
ref|XP_002869511.1|  hypothetical protein ARALYDRAFT_491942           90.1    7e-17   
emb|CDY14248.1|  BnaA08g13790D                                        87.8    4e-16   Brassica napus [oilseed rape]
ref|NP_974630.1|  uncharacterized protein                             87.4    5e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194559.2|  uncharacterized protein                             87.4    7e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CAB79632.1|  predicted proline-rich protein                       87.0    8e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009144355.1|  PREDICTED: protein transport protein SEC31-like  86.7    1e-15   Brassica rapa
ref|XP_010433239.1|  PREDICTED: bromodomain-containing protein 4-...  86.7    1e-15   Camelina sativa [gold-of-pleasure]
ref|XP_009137778.1|  PREDICTED: basic salivary proline-rich prote...  86.3    2e-15   Brassica rapa
ref|XP_006283593.1|  hypothetical protein CARUB_v10004649mg           86.3    2e-15   Capsella rubella
emb|CDY67879.1|  BnaC07g50480D                                        85.5    2e-15   Brassica napus [oilseed rape]
ref|XP_006412973.1|  hypothetical protein EUTSA_v10024987mg           85.9    2e-15   Eutrema salsugineum [saltwater cress]
gb|KFK35898.1|  hypothetical protein AALP_AA4G050800                  85.5    2e-15   Arabis alpina [alpine rockcress]
ref|XP_010540875.1|  PREDICTED: extensin                              85.5    3e-15   Tarenaya hassleriana [spider flower]
ref|XP_010448000.1|  PREDICTED: vacuolar protein-sorting protein ...  85.1    4e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010438481.1|  PREDICTED: formin-like protein 5                 84.3    6e-15   Camelina sativa [gold-of-pleasure]
emb|CDY18985.1|  BnaC01g20830D                                        84.3    6e-15   Brassica napus [oilseed rape]
emb|CDX89188.1|  BnaA01g17050D                                        84.3    7e-15   
gb|EPS62243.1|  hypothetical protein M569_12549                       83.6    1e-14   Genlisea aurea
emb|CDX97433.1|  BnaC08g12980D                                        83.6    1e-14   
emb|CDY25250.1|  BnaA02g22060D                                        82.8    2e-14   Brassica napus [oilseed rape]
ref|XP_009109102.1|  PREDICTED: formin-like protein 3                 82.0    4e-14   Brassica rapa
ref|NP_001044280.1|  Os01g0754500                                     81.6    7e-14   
gb|EEC71500.1|  hypothetical protein OsI_03777                        81.6    7e-14   Oryza sativa Indica Group [Indian rice]
dbj|BAK01177.1|  predicted protein                                    79.0    5e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008655245.1|  PREDICTED: uncharacterized protein LOC100383...  75.9    5e-12   Zea mays [maize]
ref|NP_001169238.1|  uncharacterized protein LOC100383096             75.5    7e-12   Zea mays [maize]
ref|XP_006644725.1|  PREDICTED: mediator of RNA polymerase II tra...  73.2    4e-11   Oryza brachyantha
ref|XP_006644724.1|  PREDICTED: mediator of RNA polymerase II tra...  73.2    4e-11   Oryza brachyantha
emb|CDM84126.1|  unnamed protein product                              71.6    1e-10   Triticum aestivum [Canadian hard winter wheat]
gb|EMT05386.1|  hypothetical protein F775_26441                       71.2    2e-10   
ref|XP_004969990.1|  PREDICTED: trithorax group protein osa-like      70.1    4e-10   Setaria italica
ref|XP_009395702.1|  PREDICTED: pollen-specific leucine-rich repe...  69.3    7e-10   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS50510.1|  hypothetical protein TRIUR3_23019                     68.6    1e-09   Triticum urartu
ref|XP_002458505.1|  hypothetical protein SORBIDRAFT_03g034890        67.4    3e-09   Sorghum bicolor [broomcorn]
ref|XP_009396506.1|  PREDICTED: pinin-like                            63.2    8e-08   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008795992.1|  PREDICTED: protein transport protein SEC31-like  58.2    4e-06   
gb|KEH24794.1|  DNA-binding protein, putative                         57.8    5e-06   Medicago truncatula
ref|XP_001784568.1|  predicted protein                                56.2    1e-05   
ref|XP_010940140.1|  PREDICTED: protein diaphanous homolog 1-like     56.6    1e-05   Elaeis guineensis
ref|XP_006643803.1|  PREDICTED: vegetative cell wall protein gp1-...  56.2    2e-05   Oryza brachyantha
ref|XP_008801947.1|  PREDICTED: arginine-glutamic acid dipeptide ...  54.7    5e-05   Phoenix dactylifera
emb|CAJ44247.1|  hypothetical protein                                 52.0    5e-05   Cocos nucifera
ref|XP_006655038.1|  PREDICTED: vegetative cell wall protein gp1-...  54.7    5e-05   Oryza brachyantha
ref|XP_001770189.1|  predicted protein                                54.3    5e-05   
ref|XP_006446566.1|  hypothetical protein CICLE_v10014743mg           54.7    5e-05   Citrus clementina [clementine]
ref|XP_006470271.1|  PREDICTED: COPII coat assembly protein sec16...  54.7    6e-05   Citrus sinensis [apfelsine]
ref|XP_011097415.1|  PREDICTED: protein enabled-like                  54.3    6e-05   Sesamum indicum [beniseed]
ref|XP_002300038.2|  hypothetical protein POPTR_0001s34990g           53.9    8e-05   
gb|KDO55180.1|  hypothetical protein CISIN_1g0084162mg                53.9    8e-05   Citrus sinensis [apfelsine]
ref|XP_001758183.1|  predicted protein                                53.5    1e-04   
gb|KDO55178.1|  hypothetical protein CISIN_1g0084162mg                53.5    1e-04   Citrus sinensis [apfelsine]
gb|KDO55179.1|  hypothetical protein CISIN_1g0084162mg                53.1    1e-04   Citrus sinensis [apfelsine]
ref|XP_010108811.1|  hypothetical protein L484_020546                 52.8    2e-04   Morus notabilis
ref|XP_009388841.1|  PREDICTED: bromodomain-containing protein 4      52.8    2e-04   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001042136.2|  Os01g0169900                                     52.4    3e-04   
ref|XP_011047322.1|  PREDICTED: vacuolar protein sorting-associat...  51.6    5e-04   Populus euphratica
ref|XP_002440684.1|  hypothetical protein SORBIDRAFT_09g005090        51.6    5e-04   
ref|XP_007031556.1|  Uncharacterized protein TCM_016944               51.6    5e-04   
ref|XP_011620611.1|  PREDICTED: altered inheritance of mitochondr...  51.6    5e-04   
gb|KHG02060.1|  Myosin-2                                              51.6    6e-04   Gossypium arboreum [tree cotton]
gb|ERM98731.1|  hypothetical protein AMTR_s00082p00053170             51.6    6e-04   Amborella trichopoda
gb|KJB75894.1|  hypothetical protein B456_012G063600                  51.2    6e-04   Gossypium raimondii
ref|XP_002524656.1|  DNA binding protein, putative                    51.2    7e-04   Ricinus communis
ref|XP_009611188.1|  PREDICTED: transcriptional regulator DEF1 is...  50.8    9e-04   Nicotiana tomentosiformis
ref|XP_009611187.1|  PREDICTED: transcriptional regulator DEF1 is...  50.8    0.001   Nicotiana tomentosiformis



>ref|XP_009628597.1| PREDICTED: ataxin-2 homolog [Nicotiana tomentosiformis]
Length=535

 Score =   250 bits (638),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYGV  691
            E  PN+M MQVPFSG++Q VASRPE MPYG   +SRP+Q Q    HLKP+F A GDGY  
Sbjct  357  ETAPNSMPMQVPFSGISQPVASRPEAMPYGYDRSSRPLQQQPAPPHLKPSFGAVGDGYAA  416

Query  690  SGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQ  511
            SG HP+ +PGNAYVMYD EG RGHPP QP F Q  YPPSSF   NP    + N+MVRPPQ
Sbjct  417  SGAHPTLSPGNAYVMYDGEGTRGHPPPQPNFSQSGYPPSSFPPQNPQPTPSANLMVRPPQ  476

Query  510  GMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
             +RN  PYNEL+EKL SMGYR DH++NVIQR+EESGQPVDFNAVLDRLNGHSSGGSQ+GW
Sbjct  477  LVRN-HPYNELIEKLVSMGYRADHVVNVIQRLEESGQPVDFNAVLDRLNGHSSGGSQRGW  535



>ref|XP_004248167.1| PREDICTED: bromodomain-containing protein 4 [Solanum lycopersicum]
Length=545

 Score =   245 bits (626),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 142/184 (77%), Gaps = 9/184 (5%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYGV  691
            E VPN+M MQV FS + Q+V+SRPE +PYG   + RP+Q Q P QHLKP+F APGDGY  
Sbjct  365  EPVPNSMPMQVSFSTIPQSVSSRPEAIPYGYDRSGRPLQSQPPTQHLKPSFGAPGDGYAA  424

Query  690  SGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANT----NVMV  523
            SGPHPS + GNAY+MYDSEGPRGHPPQ P FPQ  YPPSSF    PPQ A +    N M 
Sbjct  425  SGPHPSLSAGNAYLMYDSEGPRGHPPQPPNFPQSGYPPSSF----PPQNAQSSPSPNHMF  480

Query  522  RPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGS  343
            RPPQ MR   PYNEL+EKLASMGYR DH++NVIQR+EESGQ VDFN VLDRLNGHSSGG 
Sbjct  481  RPPQLMRT-HPYNELIEKLASMGYRGDHVVNVIQRLEESGQTVDFNTVLDRLNGHSSGGP  539

Query  342  QKGW  331
            Q+GW
Sbjct  540  QRGW  543



>ref|XP_009782976.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
[Nicotiana sylvestris]
Length=535

 Score =   242 bits (617),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 138/180 (77%), Gaps = 1/180 (1%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYGV  691
            E  PN+M MQVPFSG++Q VASRPE M YG   + RP+Q Q    HLKP+F A GDGY  
Sbjct  357  ETAPNSMPMQVPFSGISQPVASRPEAMSYGYDRSGRPLQQQPVAPHLKPSFGAVGDGYAA  416

Query  690  SGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQ  511
            +G HP+ +PGNAYVMYD EG RGHPP QP F Q  YPPSSF   NP    + N+MVRPPQ
Sbjct  417  NGAHPTLSPGNAYVMYDGEGTRGHPPPQPNFSQSGYPPSSFPPQNPQPTPSANLMVRPPQ  476

Query  510  GMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
             +RN  P+ EL+EK+ SMGYR DH+INVIQR+EESGQPVDFNAVLDRLNGHSSGGSQ+GW
Sbjct  477  LVRN-HPFKELIEKMVSMGYRADHVINVIQRLEESGQPVDFNAVLDRLNGHSSGGSQRGW  535



>ref|XP_004243351.1| PREDICTED: bromodomain-containing protein 4-like [Solanum lycopersicum]
Length=537

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 142/181 (78%), Gaps = 3/181 (2%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYGV  691
            E +PN+M MQVPFSG++Q VASRPE MPYG   + RP+Q Q    HLKP+F APGDGY  
Sbjct  359  ETMPNSMPMQVPFSGVSQPVASRPESMPYGYDRSGRPLQQQPATPHLKPSFGAPGDGYAA  418

Query  690  SGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPA-NTNVMVRPP  514
            SG HP+ +PGNAYVMYD EG R HPP QP F Q  YPPSSF   N  QPA + N+MVRPP
Sbjct  419  SGAHPTLSPGNAYVMYDGEGTRAHPPPQPNFQQSGYPPSSFPPQN-QQPAPSPNLMVRPP  477

Query  513  QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKG  334
            Q +RN  PYNEL+EKL SMGYR DH++NVIQR+EESGQPVDFNA+LDR+NGHSSGG Q+G
Sbjct  478  QQVRN-HPYNELIEKLVSMGYRGDHVVNVIQRLEESGQPVDFNAILDRMNGHSSGGPQRG  536

Query  333  W  331
            W
Sbjct  537  W  537



>ref|XP_009628959.1| PREDICTED: extensin-like [Nicotiana tomentosiformis]
Length=534

 Score =   239 bits (611),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 137/180 (76%), Gaps = 1/180 (1%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYGV  691
            E + N+M MQV FS + Q  ASRPE MPYG   + R +Q Q P QHL+P+F APGDGY  
Sbjct  356  EAIHNSMPMQVSFSAIPQPAASRPEAMPYGYDRSGRLLQSQPPTQHLRPSFGAPGDGYAA  415

Query  690  SGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQ  511
            SGPHPS + GNAY+MYDSEGPRGH  Q P FPQ  YPPSSF+  NP    + N+MVRPPQ
Sbjct  416  SGPHPSLSTGNAYLMYDSEGPRGHASQPPNFPQSGYPPSSFAPQNPQSTPSPNIMVRPPQ  475

Query  510  GMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
             +R   PYNEL+EK+ SMGYR DH++NVIQR+EESGQ VDFNAVLDRLNGHSSG SQ+GW
Sbjct  476  LVRT-HPYNELIEKMVSMGYRGDHVVNVIQRLEESGQTVDFNAVLDRLNGHSSGASQRGW  534



>ref|XP_006367642.1| PREDICTED: adenylate cyclase, terminal-differentiation specific-like 
[Solanum tuberosum]
Length=548

 Score =   240 bits (612),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 140/184 (76%), Gaps = 9/184 (5%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYGV  691
            E VPN+M MQ+ +S + Q+VA RPE +PYG   + RP+Q Q P QHLKP+F APGDGY  
Sbjct  368  EPVPNSMPMQMSYSAIPQSVACRPEAIPYGYDRSGRPLQSQPPTQHLKPSFGAPGDGYAT  427

Query  690  SGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANT----NVMV  523
            SGPHPS + GNAY+MYD EGPRGHP Q P FPQ  YPPSSF    PPQ A +    N MV
Sbjct  428  SGPHPSLSAGNAYLMYDGEGPRGHPSQPPNFPQSGYPPSSF----PPQNAQSSPSPNHMV  483

Query  522  RPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGS  343
            RPPQ MR   PYNEL+EKLASMGYR DH++NVIQR+EESGQ VDFN VLDRLNGHSSGG 
Sbjct  484  RPPQLMRT-HPYNELIEKLASMGYRGDHVVNVIQRLEESGQTVDFNTVLDRLNGHSSGGP  542

Query  342  QKGW  331
            Q+GW
Sbjct  543  QRGW  546



>ref|XP_009782624.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Nicotiana sylvestris]
Length=539

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 136/180 (76%), Gaps = 1/180 (1%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYGV  691
            E V N+M MQV FS + Q  ASRPE MPYG   + RP+Q Q   QHLKP+F APGD Y  
Sbjct  361  EAVHNSMPMQVSFSAIPQPAASRPEAMPYGYDRSGRPLQSQPLSQHLKPSFGAPGDSYAA  420

Query  690  SGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQ  511
            SGPHPS + GNAY+MYDSEG RGHP Q P FPQ  YPPSSF+  NP    + N+MVRPPQ
Sbjct  421  SGPHPSLSAGNAYLMYDSEGTRGHPSQPPNFPQSGYPPSSFAPQNPQSTPSPNIMVRPPQ  480

Query  510  GMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
             +R   PYNEL+EK+ SMGYR DH++NVIQR+EESGQ VDFNAVLDRLNGHSSG SQ+GW
Sbjct  481  LVRT-HPYNELIEKMVSMGYRGDHVVNVIQRLEESGQTVDFNAVLDRLNGHSSGASQRGW  539



>ref|XP_006357482.1| PREDICTED: transcription factor SPT20 homolog [Solanum tuberosum]
Length=537

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 138/180 (77%), Gaps = 1/180 (1%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYGV  691
            E +PN+M MQVPFSG++Q VASRPE MPYG   + RP+Q Q    HLKP+F APGDGY  
Sbjct  359  ETMPNSMPMQVPFSGVSQPVASRPEAMPYGYDRSGRPLQQQPAAPHLKPSFGAPGDGYAA  418

Query  690  SGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQ  511
            SG HP+ +PGNAYVMYD EG R HPP QP F Q  YPPSSF   N     + N+MVRP Q
Sbjct  419  SGAHPTLSPGNAYVMYDGEGTRTHPPPQPNFQQSRYPPSSFPPQNQQPTPSPNLMVRPTQ  478

Query  510  GMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
             +RN  PYNEL+EKL SMGYR DH++NVIQR+EESGQPVDFNA+LD +NGHSSGGSQ+GW
Sbjct  479  QVRN-HPYNELIEKLVSMGYRGDHVVNVIQRLEESGQPVDFNAILDSMNGHSSGGSQRGW  537



>emb|CDP14783.1| unnamed protein product [Coffea canephora]
Length=539

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYGV  691
            E +PN+M MQVPFSG++Q    R E +PYG G A+RPVQPQ   QHLK  + +P DGY  
Sbjct  359  EALPNSMPMQVPFSGISQPGPVRAETVPYGYGGAARPVQPQPQPQHLKATYASPADGYAA  418

Query  690  SGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQ  511
            SGPHP+ +PGN YVMYD  G   HP QQP FPQ  YPP++    N      +N++VRPPQ
Sbjct  419  SGPHPTLSPGNTYVMYDEAGRPHHPAQQPHFPQSPYPPTTMPPQNLQPNTGSNLVVRPPQ  478

Query  510  GMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
             +RN  PY +L+EK+ SMGYR DH+++ IQR+EESGQPVDFNAVLDRLNGHS+GG Q+GW
Sbjct  479  FVRN-HPYGDLIEKVVSMGYRGDHVVSAIQRLEESGQPVDFNAVLDRLNGHSAGGPQRGW  537



>ref|XP_010689008.1| PREDICTED: RNA polymerase II degradation factor 1 [Beta vulgaris 
subsp. vulgaris]
Length=542

 Score =   195 bits (496),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 129/184 (70%), Gaps = 5/184 (3%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAF-CAPGDGYG  694
            E +P++MSMQ+PF GM Q+  SRPEGMPYG G  SRP QPQ    H+K  F   PGDGY 
Sbjct  360  ETIPSSMSMQMPFPGMPQSGVSRPEGMPYGYGGPSRPAQPQPSPPHMKGGFPSQPGDGYA  419

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVR--  520
              G HP  +   +Y++YD+EG R H   Q  + QG YPP++ SL N P P +++ MVR  
Sbjct  420  TGGSHPPVSSAGSYMLYDNEGGRSHHSLQTHYSQGVYPPANPSLPNLPAPGSSSHMVRNP  479

Query  519  -PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGS  343
             P Q +RN P YNEL++KL SMGYR DH+++VIQR+EESG  VDFNAVLDRLNGHSSG S
Sbjct  480  GPQQYVRNHP-YNELIDKLVSMGYRSDHVVSVIQRLEESGLAVDFNAVLDRLNGHSSGSS  538

Query  342  QKGW  331
            Q+ W
Sbjct  539  QRSW  542



>ref|XP_010110218.1| hypothetical protein L484_009824 [Morus notabilis]
 gb|EXC25515.1| hypothetical protein L484_009824 [Morus notabilis]
Length=527

 Score =   194 bits (493),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 125/178 (70%), Gaps = 3/178 (2%)
 Frame = -2

Query  858  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYGVSGP  682
            N+M MQVP+SG+ Q   S  + +P+G     R    Q P Q +K A+ A PGDGY  SGP
Sbjct  349  NSMPMQVPYSGIPQAGTSLGDAVPFGYTAPGRAAPQQLPPQQMKGAYAAQPGDGYAASGP  408

Query  681  HPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPPQGM  505
            HP+F PG+ Y+MYDS+G R H PPQ P F QG YPP+S SL N       NVMVR PQ M
Sbjct  409  HPAFPPGSTYMMYDSDGGRAHYPPQVPHFAQGGYPPTSASLPNQLPNVAPNVMVRNPQFM  468

Query  504  RNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            RN P Y EL+EKLASMG+R DHI++VIQRMEESGQP+DFN VLDRLN HSSG  Q+GW
Sbjct  469  RNHP-YAELIEKLASMGFRGDHIVSVIQRMEESGQPIDFNGVLDRLNVHSSGAPQRGW  525



>ref|XP_002272844.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein [Vitis 
vinifera]
Length=550

 Score =   178 bits (452),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 131/186 (70%), Gaps = 10/186 (5%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAF-CAPGDGYG  694
            EM+P++M MQ+ FSG++Q  ASR + +PYG G A RPV  Q P QH+K  F   PGD Y 
Sbjct  367  EMLPSSMPMQMSFSGISQPGASRADTLPYGYGAAGRPVPQQPPPQHIKGTFGTQPGDAYA  426

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVR--  520
             SGPHP+  PGNAY+MYD+E    HPPQ P FPQG YPP S S  NP     +N+MVR  
Sbjct  427  ASGPHPALHPGNAYMMYDNEARAHHPPQPPHFPQGVYPPVSVSSQNPQPTVGSNLMVRNS  486

Query  519  ---PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSG  349
               PP+      PYNE +EKL +MGYR DH++NVIQRMEESGQP+DFN++LDRLN + SG
Sbjct  487  GQPPPRNH----PYNEWIEKLMNMGYRGDHVVNVIQRMEESGQPIDFNSLLDRLNANPSG  542

Query  348  GSQKGW  331
            GSQ+GW
Sbjct  543  GSQRGW  548



>gb|KJB31694.1| hypothetical protein B456_005G201600 [Gossypium raimondii]
Length=546

 Score =   177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 131/187 (70%), Gaps = 10/187 (5%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYG  694
            E +PN+M+MQV +SG+ Q V+SR + + YG GV  R   PQ P Q +K  F A P D Y 
Sbjct  363  EALPNSMAMQVSYSGLPQPVSSRADTITYGYGVPGRTA-PQQPPQQIKGTFGAQPTDRYT  421

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSS-FSLANPPQPANTNVMVR  520
              G +P+F PG+AY++YDSEG R H P QQP F QG YPP++  SL   P  A  NVMVR
Sbjct  422  GPGSNPTFPPGSAYMVYDSEGGRTHHPSQQPNFSQGGYPPAANVSLQTQP-GAGPNVMVR  480

Query  519  P---PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSG  349
                PQ +RN P Y+EL+EKL SMG+R DH+ +VIQRMEESGQP DFNAVLDRLN HSSG
Sbjct  481  NTNHPQFVRNHP-YSELIEKLVSMGFRGDHVASVIQRMEESGQPPDFNAVLDRLNAHSSG  539

Query  348  GSQK-GW  331
            GSQ+ GW
Sbjct  540  GSQRGGW  546



>ref|XP_007198900.1| hypothetical protein PRUPE_ppa004117mg [Prunus persica]
 gb|EMJ00099.1| hypothetical protein PRUPE_ppa004117mg [Prunus persica]
Length=529

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 124/182 (68%), Gaps = 5/182 (3%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYG  694
            E VP++MSMQVP+S + Q    R + MP+G   A RP+Q Q P Q LK AF A  G+GY 
Sbjct  349  EAVPSSMSMQVPYSSIPQQGPGRSDAMPFGYSGAGRPIQQQPPPQQLKGAFGAQAGEGYA  408

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP  514
             SGPHP+  PG+ Y+MYD EG R H   Q   P   YPP+S S   P      N+M R P
Sbjct  409  ASGPHPALPPGSTYMMYDGEGGRTHYSAQ--VPHYGYPPTSASHQTPQPTTAPNLMARNP  466

Query  513  QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRL-NGHSSGGSQK  337
            Q +RN P Y+EL+EKLASMG+R DH+++VIQRMEE G+P+DFNAV+DRL N HSSGG Q+
Sbjct  467  QFIRNHP-YSELIEKLASMGFRSDHVLSVIQRMEERGEPIDFNAVIDRLSNVHSSGGPQR  525

Query  336  GW  331
            GW
Sbjct  526  GW  527



>ref|XP_007043595.1| Structural constituent of cell wall [Theobroma cacao]
 gb|EOX99426.1| Structural constituent of cell wall [Theobroma cacao]
Length=552

 Score =   172 bits (437),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 132/186 (71%), Gaps = 9/186 (5%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAP-GDGYG  694
            E +PN++ MQVP+SG+ Q V+SR + +PYG G+  R   PQ P Q +K  F AP  +GY 
Sbjct  370  EALPNSLPMQVPYSGVPQPVSSRADTIPYGYGLPGRTA-PQQP-QQIKGTFGAPPAEGYT  427

Query  693  VSGPHPSFAPGNAYVMYDSEGPR-GHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRP  517
              GPHP   PG+AY+MYDSEG R  HPPQQP F QG Y P++ SL  P      NVM+R 
Sbjct  428  APGPHPPLPPGSAYMMYDSEGGRPLHPPQQPHFSQGGYSPANVSLQTPQTGTGPNVMIRN  487

Query  516  P---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG  346
                Q +R+ P Y++L+EKL SMG+RVDH+ +VIQRMEESGQPVDFNAVLDRLN HSSGG
Sbjct  488  TSHSQFIRSHP-YSDLIEKLVSMGFRVDHVASVIQRMEESGQPVDFNAVLDRLNVHSSGG  546

Query  345  SQK-GW  331
            SQ+ GW
Sbjct  547  SQRGGW  552



>ref|XP_008229158.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15 isoform X2 [Prunus mume]
Length=529

 Score =   170 bits (431),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 123/182 (68%), Gaps = 5/182 (3%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYG  694
            E VP++MSMQVP+S + Q    R + MP+G   A RP+Q Q P Q LK AF A  G+GY 
Sbjct  349  EAVPSSMSMQVPYSSIPQQGPGRSDAMPFGYSGAGRPIQQQPPPQQLKGAFGAQAGEGYA  408

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP  514
             +GPHP   PG+ Y+MYD EG R H   Q   P   YPP+S S   P      N+M R P
Sbjct  409  PAGPHPGLPPGSTYMMYDGEGGRTHYSAQ--VPHYGYPPTSASHQTPQPTTAPNLMARNP  466

Query  513  QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRL-NGHSSGGSQK  337
            Q +RN P Y+EL+EKLASMG+R DH+++VIQRMEE G+P+DFNAV+DRL N HSSGG Q+
Sbjct  467  QFIRNHP-YSELIEKLASMGFRSDHVLSVIQRMEERGEPIDFNAVIDRLSNVHSSGGPQR  525

Query  336  GW  331
            GW
Sbjct  526  GW  527



>ref|XP_008229157.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15 isoform X1 [Prunus mume]
Length=530

 Score =   170 bits (430),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 123/182 (68%), Gaps = 5/182 (3%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYG  694
            E VP++MSMQVP+S + Q    R + MP+G   A RP+Q Q P Q LK AF A  G+GY 
Sbjct  350  EAVPSSMSMQVPYSSIPQQGPGRSDAMPFGYSGAGRPIQQQPPPQQLKGAFGAQAGEGYA  409

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP  514
             +GPHP   PG+ Y+MYD EG R H   Q   P   YPP+S S   P      N+M R P
Sbjct  410  PAGPHPGLPPGSTYMMYDGEGGRTHYSAQ--VPHYGYPPTSASHQTPQPTTAPNLMARNP  467

Query  513  QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRL-NGHSSGGSQK  337
            Q +RN P Y+EL+EKLASMG+R DH+++VIQRMEE G+P+DFNAV+DRL N HSSGG Q+
Sbjct  468  QFIRNHP-YSELIEKLASMGFRSDHVLSVIQRMEERGEPIDFNAVIDRLSNVHSSGGPQR  526

Query  336  GW  331
            GW
Sbjct  527  GW  528



>ref|XP_002517918.1| structural constituent of cell wall, putative [Ricinus communis]
 gb|EEF44436.1| structural constituent of cell wall, putative [Ricinus communis]
Length=536

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 122/184 (66%), Gaps = 6/184 (3%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYGV  691
            E + ++M MQ+ ++ + Q ++S  + +PYG G      Q     Q        PGDGY  
Sbjct  353  ETMSSSMPMQLSYAAVPQPLSSGTDAIPYGYGAGRTVPQQPQAQQVKAAYGAPPGDGYAT  412

Query  690  SGPHPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP  514
             GPH +  PG+AY+MYDSEG R H PPQQP F QG YPP++ SL NP     TN+M R P
Sbjct  413  GGPHSALPPGSAYMMYDSEGGRAHHPPQQPHFSQGGYPPTNLSLQNPQSAPGTNMMARNP  472

Query  513  QG---MRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGS  343
                 +RN P Y+EL++KL SMG+R +HI+ VIQRMEESGQP+DFNAVLDRL+ +SSGGS
Sbjct  473  SHANFVRNHP-YSELIDKLVSMGFRAEHIVGVIQRMEESGQPLDFNAVLDRLS-NSSGGS  530

Query  342  QKGW  331
            Q+GW
Sbjct  531  QRGW  534



>ref|XP_012088286.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15 [Jatropha curcas]
 gb|KDP24130.1| hypothetical protein JCGZ_25787 [Jatropha curcas]
Length=532

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 125/186 (67%), Gaps = 11/186 (6%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAF-CAPGDGYG  694
            E +PN+M MQV ++ + Q + SR E MPYG G A R V  Q P Q +K  +    GDGY 
Sbjct  350  ETMPNSMPMQVSYAAVPQPLPSRAE-MPYGYG-AGRQVPQQPPPQQIKATYGTQTGDGYA  407

Query  693  VSGPHPSFAPGNAYVMYDS-EGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMVR  520
             +GP P+  PG+AY+MYDS EG R H PPQ   FPQ  YPP S SL N    A  NV+ R
Sbjct  408  TAGP-PALPPGSAYMMYDSSEGGRTHHPPQPSHFPQAGYPPGSLSLQNSQPAAGANVLAR  466

Query  519  PPQG---MRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSG  349
             P     +RN P YNEL+EKL +MG+R+DH+I VIQRMEESGQPVDFNAVLDRLN H +G
Sbjct  467  NPNHSHLVRNHP-YNELIEKLVNMGFRMDHVIGVIQRMEESGQPVDFNAVLDRLNVH-NG  524

Query  348  GSQKGW  331
             SQ+GW
Sbjct  525  SSQRGW  530



>gb|KEH17617.1| structural constituent of cell wall protein, putative [Medicago 
truncatula]
Length=527

 Score =   166 bits (419),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 126/190 (66%), Gaps = 16/190 (8%)
 Frame = -2

Query  873  SEMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAF-CAPGDGY  697
            +E +PN+M MQ+P+SG+ Q  +SR + M YG G   R V  Q P Q +K +F   PGD Y
Sbjct  343  TETLPNSMPMQMPYSGVPQPGSSRADSMQYGYGGTGRTVPQQPPPQQIKGSFPSQPGDVY  402

Query  696  GVSGPHPSFAP--GNAYVMYDS-EGPRGH--PPQQPIFPQGAYPPSSFSLANPPQPANTN  532
            G SG HP+  P  GNAY+MYD  EG R H  PPQ   F Q  YP +S SL NP      N
Sbjct  403  GASGTHPALPPPPGNAYMMYDGGEGGRAHHPPPQPSHFAQSGYPQTSASLTNP------N  456

Query  531  VMVRPP---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNG  361
            ++VR P   Q +RN P YNEL+EKL +MG+R DH+ +VIQRMEESGQ +DFN+VLDRLN 
Sbjct  457  LLVRNPSQSQFVRNHP-YNELIEKLVNMGFRGDHVASVIQRMEESGQTIDFNSVLDRLNV  515

Query  360  HSSGGSQKGW  331
            HSS G Q+GW
Sbjct  516  HSSVGPQRGW  525



>ref|XP_008337475.1| PREDICTED: altered inheritance of mitochondria protein 3-like 
[Malus domestica]
Length=521

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 119/181 (66%), Gaps = 7/181 (4%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYG  694
            E VPN+M MQVP+S + Q  + R + MP+G G A R +Q Q P Q +K AF A PG+GYG
Sbjct  345  ESVPNSMPMQVPYSNIPQPGSGRSDPMPFGYGGAGRTMQQQPPPQQIKGAFGAQPGEGYG  404

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP  514
             +GPHP+F PG+ Y +YDSEG R             YPP+S S   P      NVM R P
Sbjct  405  AAGPHPAFPPGSTYTVYDSEGGRTQ-----YSAHYGYPPTSISHHMPQPTTAPNVMARNP  459

Query  513  QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKG  334
            Q   N P YNEL+EKL  MG+R DH+++VIQRMEE GQPVDFNAV+DRLN H SGG Q+G
Sbjct  460  QFPGNHP-YNELIEKLVPMGFRSDHVVSVIQRMEEXGQPVDFNAVIDRLNAHPSGGPQRG  518

Query  333  W  331
            W
Sbjct  519  W  519



>gb|KHN31988.1| hypothetical protein glysoja_025822 [Glycine soja]
Length=505

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 127/187 (68%), Gaps = 9/187 (5%)
 Frame = -2

Query  873  SEMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAP-GDGY  697
            S+ +PN+M+MQ+P+SG+    +SR + +PYG G A R V  Q P Q +K +F AP  D Y
Sbjct  320  SKTLPNSMAMQMPYSGVPPPGSSRTDAIPYGYGGAGRTVPQQPPPQQMKSSFPAPPADMY  379

Query  696  GVSGPHPSFAP-GNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVR  520
            G SG  P+  P   AY+MYD EG R H P QP F Q  YPP+S SL NPP     N+MVR
Sbjct  380  GPSGNLPALPPPSGAYMMYDGEGGRTHHPPQPHFAQPGYPPTSASLQNPP--PGLNLMVR  437

Query  519  PP---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSG  349
             P   Q +RN P YNEL+EKL SMG+R DH+ +VIQRMEESGQ +DFN+VLDRLN HSS 
Sbjct  438  NPNQSQFIRNHP-YNELIEKLVSMGFRGDHVASVIQRMEESGQAIDFNSVLDRLNVHSSV  496

Query  348  GSQK-GW  331
            G Q+ GW
Sbjct  497  GPQRGGW  503



>ref|XP_003539922.1| PREDICTED: putative uncharacterized protein DDB_G0271606-like 
isoformX1 [Glycine max]
Length=533

 Score =   164 bits (415),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 127/187 (68%), Gaps = 9/187 (5%)
 Frame = -2

Query  873  SEMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAP-GDGY  697
            +E +PN+M+MQ+P+SG+    +SR + +PYG G A R V  Q P Q +K +F AP  D Y
Sbjct  348  AETLPNSMAMQMPYSGVPPPGSSRTDAIPYGYGGAGRTVPQQPPPQQMKSSFPAPPADMY  407

Query  696  GVSGPHPSFAP-GNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVR  520
            G SG  P+  P   AY+MYD EG R H P QP F Q  YPP+S SL NPP     N+MVR
Sbjct  408  GPSGNLPALPPPSGAYMMYDGEGGRTHHPPQPHFAQPGYPPTSASLQNPP--PGLNLMVR  465

Query  519  PP---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSG  349
             P   Q +RN P YNEL+EKL SMG+R DH+ +VIQRMEESGQ +DFN+VLDRLN HSS 
Sbjct  466  NPNQSQFIRNHP-YNELIEKLVSMGFRGDHVASVIQRMEESGQAIDFNSVLDRLNVHSSV  524

Query  348  GSQK-GW  331
            G Q+ GW
Sbjct  525  GPQRGGW  531



>ref|XP_006592435.1| PREDICTED: putative uncharacterized protein DDB_G0271606-like 
isoform X2 [Glycine max]
Length=534

 Score =   164 bits (414),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 127/187 (68%), Gaps = 9/187 (5%)
 Frame = -2

Query  873  SEMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAP-GDGY  697
            +E +PN+M+MQ+P+SG+    +SR + +PYG G A R V  Q P Q +K +F AP  D Y
Sbjct  349  AETLPNSMAMQMPYSGVPPPGSSRTDAIPYGYGGAGRTVPQQPPPQQMKSSFPAPPADMY  408

Query  696  GVSGPHPSFAP-GNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVR  520
            G SG  P+  P   AY+MYD EG R H P QP F Q  YPP+S SL NPP     N+MVR
Sbjct  409  GPSGNLPALPPPSGAYMMYDGEGGRTHHPPQPHFAQPGYPPTSASLQNPP--PGLNLMVR  466

Query  519  PP---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSG  349
             P   Q +RN P YNEL+EKL SMG+R DH+ +VIQRMEESGQ +DFN+VLDRLN HSS 
Sbjct  467  NPNQSQFIRNHP-YNELIEKLVSMGFRGDHVASVIQRMEESGQAIDFNSVLDRLNVHSSV  525

Query  348  GSQK-GW  331
            G Q+ GW
Sbjct  526  GPQRGGW  532



>gb|KJB77269.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=342

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 124/186 (67%), Gaps = 12/186 (6%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYG  694
            E + ++  MQVP+SG+ Q ++S  + +PYG GV  R     AP Q +K  F A P DGY 
Sbjct  163  EALAHSTPMQVPYSGVRQPLSSCVDTIPYGYGVPGR----TAP-QPIKGTFEAQPRDGYQ  217

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMVR-  520
             S  HP   PG+AY+MYDSEG R H PPQQP F QG YPP++ SL  P    + NVM+R 
Sbjct  218  ASVSHPPLPPGSAYMMYDSEGGRAHHPPQQPHFSQGGYPPANVSLQTPQPGPSPNVMMRN  277

Query  519  --PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG  346
                Q +RN P Y+ L+EK  SMG+R DHI +VIQRMEESGQ VDFNAVLDRLN  SSGG
Sbjct  278  SSHSQYVRNHP-YSYLIEKFVSMGFRADHIASVIQRMEESGQAVDFNAVLDRLNVQSSGG  336

Query  345  SQK-GW  331
            +Q+ GW
Sbjct  337  TQRGGW  342



>gb|KJB77267.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=419

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 124/186 (67%), Gaps = 12/186 (6%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYG  694
            E + ++  MQVP+SG+ Q ++S  + +PYG GV  R     AP Q +K  F A P DGY 
Sbjct  240  EALAHSTPMQVPYSGVRQPLSSCVDTIPYGYGVPGR----TAP-QPIKGTFEAQPRDGYQ  294

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMVR-  520
             S  HP   PG+AY+MYDSEG R H PPQQP F QG YPP++ SL  P    + NVM+R 
Sbjct  295  ASVSHPPLPPGSAYMMYDSEGGRAHHPPQQPHFSQGGYPPANVSLQTPQPGPSPNVMMRN  354

Query  519  --PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG  346
                Q +RN P Y+ L+EK  SMG+R DHI +VIQRMEESGQ VDFNAVLDRLN  SSGG
Sbjct  355  SSHSQYVRNHP-YSYLIEKFVSMGFRADHIASVIQRMEESGQAVDFNAVLDRLNVQSSGG  413

Query  345  SQK-GW  331
            +Q+ GW
Sbjct  414  TQRGGW  419



>ref|XP_007132659.1| hypothetical protein PHAVU_011G113900g [Phaseolus vulgaris]
 gb|ESW04653.1| hypothetical protein PHAVU_011G113900g [Phaseolus vulgaris]
Length=541

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 128/185 (69%), Gaps = 8/185 (4%)
 Frame = -2

Query  873  SEMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAP-GDGY  697
            +E +PN+M MQ P+SG+    +SRP+ +PYG G + R V  Q P Q +K +F AP G+ Y
Sbjct  359  AETLPNSMPMQGPYSGVPPPGSSRPDTIPYGYGGSGRTVPQQPPPQQMKSSFPAPPGEMY  418

Query  696  GVSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRP  517
            G +G   +  P +AY+MY+ EG R H P QP F Q  YPP+S SL NPP   + N+MVR 
Sbjct  419  GPTGSLAALPPSSAYMMYEGEGGRTHHPPQPHFTQPGYPPTSASLQNPP---SHNLMVRN  475

Query  516  P---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG  346
            P   Q +RN P Y+EL+EKL SMG+R DH+++VIQRMEESGQ +DFN+VLDRLN HSS G
Sbjct  476  PNQSQFVRNHP-YSELIEKLVSMGFRGDHVMSVIQRMEESGQAIDFNSVLDRLNVHSSVG  534

Query  345  SQKGW  331
              +GW
Sbjct  535  PPRGW  539



>gb|KJB77274.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=461

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 124/186 (67%), Gaps = 12/186 (6%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYG  694
            E + ++  MQVP+SG+ Q ++S  + +PYG GV  R     AP Q +K  F A P DGY 
Sbjct  282  EALAHSTPMQVPYSGVRQPLSSCVDTIPYGYGVPGR----TAP-QPIKGTFEAQPRDGYQ  336

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMVR-  520
             S  HP   PG+AY+MYDSEG R H PPQQP F QG YPP++ SL  P    + NVM+R 
Sbjct  337  ASVSHPPLPPGSAYMMYDSEGGRAHHPPQQPHFSQGGYPPANVSLQTPQPGPSPNVMMRN  396

Query  519  --PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG  346
                Q +RN P Y+ L+EK  SMG+R DHI +VIQRMEESGQ VDFNAVLDRLN  SSGG
Sbjct  397  SSHSQYVRNHP-YSYLIEKFVSMGFRADHIASVIQRMEESGQAVDFNAVLDRLNVQSSGG  455

Query  345  SQK-GW  331
            +Q+ GW
Sbjct  456  TQRGGW  461



>gb|KJB77268.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
 gb|KJB77270.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
 gb|KJB77272.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=551

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 124/186 (67%), Gaps = 12/186 (6%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYG  694
            E + ++  MQVP+SG+ Q ++S  + +PYG GV  R     AP Q +K  F A P DGY 
Sbjct  372  EALAHSTPMQVPYSGVRQPLSSCVDTIPYGYGVPGRT----AP-QPIKGTFEAQPRDGYQ  426

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMVR-  520
             S  HP   PG+AY+MYDSEG R H PPQQP F QG YPP++ SL  P    + NVM+R 
Sbjct  427  ASVSHPPLPPGSAYMMYDSEGGRAHHPPQQPHFSQGGYPPANVSLQTPQPGPSPNVMMRN  486

Query  519  --PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG  346
                Q +RN P Y+ L+EK  SMG+R DHI +VIQRMEESGQ VDFNAVLDRLN  SSGG
Sbjct  487  SSHSQYVRNHP-YSYLIEKFVSMGFRADHIASVIQRMEESGQAVDFNAVLDRLNVQSSGG  545

Query  345  SQK-GW  331
            +Q+ GW
Sbjct  546  TQRGGW  551



>gb|KJB77271.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
 gb|KJB77273.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=566

 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 124/186 (67%), Gaps = 12/186 (6%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYG  694
            E + ++  MQVP+SG+ Q ++S  + +PYG GV  R     AP Q +K  F A P DGY 
Sbjct  387  EALAHSTPMQVPYSGVRQPLSSCVDTIPYGYGVPGRT----AP-QPIKGTFEAQPRDGYQ  441

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMVR-  520
             S  HP   PG+AY+MYDSEG R H PPQQP F QG YPP++ SL  P    + NVM+R 
Sbjct  442  ASVSHPPLPPGSAYMMYDSEGGRAHHPPQQPHFSQGGYPPANVSLQTPQPGPSPNVMMRN  501

Query  519  --PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG  346
                Q +RN P Y+ L+EK  SMG+R DHI +VIQRMEESGQ VDFNAVLDRLN  SSGG
Sbjct  502  SSHSQYVRNHP-YSYLIEKFVSMGFRADHIASVIQRMEESGQAVDFNAVLDRLNVQSSGG  560

Query  345  SQK-GW  331
            +Q+ GW
Sbjct  561  TQRGGW  566



>ref|XP_009357856.1| PREDICTED: putative uncharacterized protein DDB_G0294196 [Pyrus 
x bretschneideri]
 ref|XP_009357877.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein-like 
[Pyrus x bretschneideri]
Length=521

 Score =   161 bits (408),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 118/181 (65%), Gaps = 7/181 (4%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYG  694
            E  PN+M MQVP+S + Q  + R + MP+G G A R +Q Q P Q +K AF A PG+GYG
Sbjct  345  ESAPNSMPMQVPYSNIPQPGSGRSDPMPFGYGGAGRTMQQQPPPQQIKGAFGAQPGEGYG  404

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP  514
             +GPHP+  PG+ Y++YDSEG R             YPP+S S   P      N+M R P
Sbjct  405  AAGPHPALPPGSTYMVYDSEGGRTQ-----YSAHYGYPPTSISHHTPQPTTAPNLMARNP  459

Query  513  QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKG  334
            Q   N P YNEL+EKL  MG+R DH+++VIQRMEESGQPVDFNAV+DRLN H SG  Q+G
Sbjct  460  QFPHNHP-YNELIEKLVPMGFRSDHVVSVIQRMEESGQPVDFNAVIDRLNAHPSGVPQRG  518

Query  333  W  331
            W
Sbjct  519  W  519



>ref|XP_004506616.1| PREDICTED: transcription factor SPT20 homolog [Cicer arietinum]
Length=523

 Score =   161 bits (408),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 127/188 (68%), Gaps = 18/188 (10%)
 Frame = -2

Query  873  SEMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGY  697
            +E +PN+M MQ+P+SG+ Q+ +SR + M YG G A R V  Q P Q +K +F A PGD Y
Sbjct  347  TETLPNSMPMQMPYSGVPQSGSSRADSMQYGYGGAGRTVPQQPPPQQIKGSFPAQPGDVY  406

Query  696  GVSGPHPSFAPGNAYVMYDS-EGPRGHPPQQPI--FPQGAYPPSSFSLANPPQPANTNVM  526
            G SG HP+    NAY+MYD  EG R H P      F QG YPP+S SL NP      N+M
Sbjct  407  GASGTHPA----NAYMMYDGGEGGRTHHPPPQPPHFAQGGYPPTSASLQNP------NLM  456

Query  525  VRPP---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHS  355
            VR P   Q +RN P YNEL+EKL +MG+R DH+ +VIQRMEESGQ +DFN+VLDRLN H+
Sbjct  457  VRNPSQSQFVRNHP-YNELIEKLVNMGFRGDHVASVIQRMEESGQTIDFNSVLDRLNVHN  515

Query  354  SGGSQKGW  331
            S G Q+GW
Sbjct  516  SVGPQRGW  523



>gb|KHG27956.1| S-adenosylmethionine synthase 1 [Gossypium arboreum]
Length=552

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 125/186 (67%), Gaps = 12/186 (6%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYG  694
            E + ++  MQVP+SG+ Q ++SR + +PYG  V  R     AP Q +K  F A P DGY 
Sbjct  373  EALAHSTPMQVPYSGVPQPLSSRVDTIPYGYRVPGR----TAP-QPIKGTFEAQPRDGYQ  427

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMVR-  520
                HP   PG+AY+MYDSEG R H PPQQP F QG YPP++ SL  P    + NVM+R 
Sbjct  428  APVSHPPLPPGSAYMMYDSEGGRAHHPPQQPHFSQGGYPPANVSLQTPQPGPSPNVMMRN  487

Query  519  --PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG  346
                Q +RN P Y++L+EKL SMG+R DHI +VIQRMEESGQ VDFNAVLDRLN  SSGG
Sbjct  488  SSHSQYVRNHP-YSDLIEKLVSMGFRGDHIASVIQRMEESGQAVDFNAVLDRLNVQSSGG  546

Query  345  SQK-GW  331
            +Q+ GW
Sbjct  547  TQRGGW  552



>ref|XP_004303103.1| PREDICTED: transcriptional regulator DEF1 [Fragaria vesca subsp. 
vesca]
Length=540

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 124/185 (67%), Gaps = 8/185 (4%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQH-LKPAFCAP-GDGY  697
            E +PN+M MQV +S + Q  + R + MP+G   A R +  Q P Q  +K AF A  GDGY
Sbjct  357  ETLPNSMPMQVSYSSVPQPGSGRSDAMPFGYSGAGRTMPQQPPPQQQIKGAFGAQQGDGY  416

Query  696  GVSGPHPSFAPGNAYVMYDSEGPRG-HPPQQPIFPQGAYPPSSFSLANPPQPANT-NVMV  523
              +GPHP+  PG+ Y+MYDSEG R  +  Q P + QG YPP+S S    PQP    + MV
Sbjct  417  AAAGPHPALPPGSTYMMYDSEGGRNPYSAQVPHYSQGGYPPASGSQT--PQPTTAPSHMV  474

Query  522  RPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG-  346
            R PQ +RN P YNEL+EKL SMG+R DH+ +VIQRMEESGQ +DFNAV+DRLN HSSG  
Sbjct  475  RNPQFIRNHP-YNELIEKLVSMGFRGDHVASVIQRMEESGQTIDFNAVIDRLNVHSSGAP  533

Query  345  SQKGW  331
             Q+GW
Sbjct  534  PQRGW  538



>ref|XP_006447363.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
 gb|ESR60603.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
Length=554

 Score =   157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 123/190 (65%), Gaps = 20/190 (11%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQH---LKPAFCA-PGD  703
            EM+PN+  MQV ++G+ Q V++R + MPYG G   RPV  Q P      +K  + A PGD
Sbjct  373  EMLPNSAPMQVQYTGVPQPVSTRADVMPYGYGAPGRPVPQQPPPLQPQPIKGNYGAQPGD  432

Query  702  GYGVSGPHPSFAPGNAYVMYDSEGPRG-HPPQQPIFPQGAYPPSSFSLANPPQPAN-TNV  529
            GY  +GP P+  PG+ Y+MYDSE  R  HPPQQ  F QG YP          QP   +N+
Sbjct  433  GYAAAGPRPTLPPGSGYMMYDSESGRTPHPPQQSHFAQGGYPS---------QPTTGSNL  483

Query  528  MVR---PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGH  358
            + R    PQ +RN   Y+EL+E L SMGYR DH  +VIQRMEESGQPVDFNAVLDRLN H
Sbjct  484  LARNPSQPQFIRNHT-YSELIENLVSMGYRGDHAASVIQRMEESGQPVDFNAVLDRLNVH  542

Query  357  SSGGSQK-GW  331
            SSGGSQ+ GW
Sbjct  543  SSGGSQRGGW  552



>ref|XP_006447362.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
 gb|ESR60602.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
Length=553

 Score =   157 bits (397),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 123/190 (65%), Gaps = 20/190 (11%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQH---LKPAFCA-PGD  703
            EM+PN+  MQV ++G+ Q V++R + MPYG G   RPV  Q P      +K  + A PGD
Sbjct  372  EMLPNSAPMQVQYTGVPQPVSTRADVMPYGYGAPGRPVPQQPPPLQPQPIKGNYGAQPGD  431

Query  702  GYGVSGPHPSFAPGNAYVMYDSEGPRG-HPPQQPIFPQGAYPPSSFSLANPPQPAN-TNV  529
            GY  +GP P+  PG+ Y+MYDSE  R  HPPQQ  F QG YP          QP   +N+
Sbjct  432  GYAAAGPRPTLPPGSGYMMYDSESGRTPHPPQQSHFAQGGYPS---------QPTTGSNL  482

Query  528  MVR---PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGH  358
            + R    PQ +RN   Y+EL+E L SMGYR DH  +VIQRMEESGQPVDFNAVLDRLN H
Sbjct  483  LARNPSQPQFIRNHT-YSELIENLVSMGYRGDHAASVIQRMEESGQPVDFNAVLDRLNVH  541

Query  357  SSGGSQK-GW  331
            SSGGSQ+ GW
Sbjct  542  SSGGSQRGGW  551



>gb|KDO51850.1| hypothetical protein CISIN_1g008878mg [Citrus sinensis]
Length=550

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 123/190 (65%), Gaps = 20/190 (11%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQH---LKPAFCA-PGD  703
            EM+PN+  MQV ++G+ Q V++R + MPYG G   RPV  Q P      +K  + A PGD
Sbjct  369  EMLPNSAPMQVQYTGVPQPVSTRADVMPYGYGAPGRPVPQQPPPLQPQPIKGNYGAQPGD  428

Query  702  GYGVSGPHPSFAPGNAYVMYDSEGPRG-HPPQQPIFPQGAYPPSSFSLANPPQPAN-TNV  529
            GY  +GP P+  PG+ Y+MYDSE  R  HPPQQ  F QG YP          QP   +N+
Sbjct  429  GYAAAGPRPTLPPGSGYMMYDSESGRTPHPPQQSHFAQGGYPS---------QPTTGSNL  479

Query  528  MVR---PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGH  358
            + R    PQ +RN   Y+EL+E L SMGYR DH  +VIQRMEESGQPVDFNAVLDRLN H
Sbjct  480  LARNPSQPQFIRNHT-YSELIENLVSMGYRGDHAASVIQRMEESGQPVDFNAVLDRLNVH  538

Query  357  SSGGSQK-GW  331
            SSGGSQ+ GW
Sbjct  539  SSGGSQRGGW  548



>gb|KDO51849.1| hypothetical protein CISIN_1g008878mg [Citrus sinensis]
Length=549

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 123/190 (65%), Gaps = 20/190 (11%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQH---LKPAFCA-PGD  703
            EM+PN+  MQV ++G+ Q V++R + MPYG G   RPV  Q P      +K  + A PGD
Sbjct  368  EMLPNSAPMQVQYTGVPQPVSTRADVMPYGYGAPGRPVPQQPPPLQPQPIKGNYGAQPGD  427

Query  702  GYGVSGPHPSFAPGNAYVMYDSEGPRG-HPPQQPIFPQGAYPPSSFSLANPPQPAN-TNV  529
            GY  +GP P+  PG+ Y+MYDSE  R  HPPQQ  F QG YP          QP   +N+
Sbjct  428  GYAAAGPRPTLPPGSGYMMYDSESGRTPHPPQQSHFAQGGYPS---------QPTTGSNL  478

Query  528  MVR---PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGH  358
            + R    PQ +RN   Y+EL+E L SMGYR DH  +VIQRMEESGQPVDFNAVLDRLN H
Sbjct  479  LARNPSQPQFIRNHT-YSELIENLVSMGYRGDHAASVIQRMEESGQPVDFNAVLDRLNVH  537

Query  357  SSGGSQK-GW  331
            SSGGSQ+ GW
Sbjct  538  SSGGSQRGGW  547



>ref|XP_006582794.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
[Glycine max]
Length=486

 Score =   155 bits (393),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 128/187 (68%), Gaps = 11/187 (6%)
 Frame = -2

Query  873  SEMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAP-GDGY  697
            +E +PN+M+MQ+P+SG+    ++R + +PYG G A R V  Q P Q +K +F AP G+ Y
Sbjct  303  AETLPNSMAMQMPYSGVPPQGSNRADAIPYGYGGAGRTVPQQPPPQQMKSSFPAPPGEMY  362

Query  696  GVSGPHPSFAP-GNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMV  523
            G +G  P+  P  +AY+MYD EG R H PPQ P F Q  YPP+S SL NPPQ    N+MV
Sbjct  363  GPTGSLPALPPPSSAYMMYDGEGGRSHHPPQPPHFAQPGYPPTSASLQNPPQ--GHNLMV  420

Query  522  RPP---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSS  352
            R P   Q +RN P YNEL+EKL SMG+R DH+ +VIQRMEESGQ VDFN+VLDRL+  S 
Sbjct  421  RNPNQSQFVRNHP-YNELIEKLVSMGFRGDHVASVIQRMEESGQAVDFNSVLDRLS--SV  477

Query  351  GGSQKGW  331
            G  + GW
Sbjct  478  GPQRGGW  484



>ref|XP_011098021.1| PREDICTED: extensin [Sesamum indicum]
Length=525

 Score =   156 bits (394),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 121/183 (66%), Gaps = 14/183 (8%)
 Frame = -2

Query  873  SEMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAF-CAPGDGY  697
            +EMVPN+M MQV F G  Q  ++ PE   YG G A RP+Q Q P QHLKP +    G+GY
Sbjct  353  AEMVPNSMPMQVSFVGAPQPGSTGPEAT-YGYGNAGRPIQQQPPPQHLKPGYGSQSGEGY  411

Query  696  GVSGPHPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMVR  520
              SGP  +  PGN Y+++D EG R H PP QP F Q AYPP        P P   N++V 
Sbjct  412  VPSGPRSTLPPGNTYMVFDGEGGRTHHPPPQPHFQQNAYPPQRM-----PSP---NMVV-  462

Query  519  PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQ  340
             P  +R+ P YNEL+EKL  MGYR DH++ VIQR+EESGQ +DFN+VLDRLNGH SGGSQ
Sbjct  463  -PHSIRSHP-YNELIEKLVGMGYRGDHVVGVIQRLEESGQTIDFNSVLDRLNGHPSGGSQ  520

Query  339  KGW  331
            + W
Sbjct  521  RVW  523



>gb|KHN35253.1| hypothetical protein glysoja_042323 [Glycine soja]
Length=531

 Score =   156 bits (394),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 128/187 (68%), Gaps = 11/187 (6%)
 Frame = -2

Query  873  SEMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAP-GDGY  697
            +E +PN+M+MQ+P+SG+    ++R + +PYG G A R V  Q P Q +K +F AP G+ Y
Sbjct  348  AETLPNSMAMQMPYSGVPPQGSNRADAIPYGYGGAGRTVPQQPPPQQMKSSFPAPPGEMY  407

Query  696  GVSGPHPSFAP-GNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMV  523
            G +G  P+  P  +AY+MYD EG R H PPQ P F Q  YPP+S SL NPPQ    N+MV
Sbjct  408  GPTGSLPALPPPSSAYMMYDGEGGRSHHPPQPPHFAQPGYPPTSASLQNPPQ--GHNLMV  465

Query  522  RPP---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSS  352
            R P   Q +RN P YNEL+EKL SMG+R DH+ +VIQRMEESGQ VDFN+VLDRL+  S 
Sbjct  466  RNPNQSQFVRNHP-YNELIEKLVSMGFRGDHVASVIQRMEESGQAVDFNSVLDRLS--SV  522

Query  351  GGSQKGW  331
            G  + GW
Sbjct  523  GPQRGGW  529



>ref|XP_008342910.1| PREDICTED: extensin-like isoform X1 [Malus domestica]
Length=522

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 116/183 (63%), Gaps = 11/183 (6%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYG  694
            E VPN+M M VP+S + Q    R + MP+G G A R +Q Q P Q +K AF A PG+GYG
Sbjct  346  ESVPNSMPMPVPYSNIPQPGPGRSDPMPFGYGGAGRTMQQQPPPQQIKGAFGAQPGEGYG  405

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP  514
             +GPHP+  PG+ Y++YDSEG R             YPP S S   P      N+M R  
Sbjct  406  AAGPHPALPPGSTYMVYDSEGGRTQ-----YSAHYGYPPXSISHHTPQPTTAPNLMAR--  458

Query  513  QGMRNPP--PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQ  340
               + PP  PYNEL+EKL  MG+R DH+ +VIQRMEESGQP+DFNAV+DRLN H SGG Q
Sbjct  459  -NQQFPPNHPYNELIEKLVPMGFRXDHVASVIQRMEESGQPIDFNAVIDRLNSHPSGGPQ  517

Query  339  KGW  331
            +GW
Sbjct  518  RGW  520



>ref|XP_008342911.1| PREDICTED: extensin-like isoform X2 [Malus domestica]
Length=521

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 116/183 (63%), Gaps = 11/183 (6%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYG  694
            E VPN+M M VP+S + Q    R + MP+G G A R +Q Q P Q +K AF A PG+GYG
Sbjct  345  ESVPNSMPMPVPYSNIPQPGPGRSDPMPFGYGGAGRTMQQQPPPQQIKGAFGAQPGEGYG  404

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP  514
             +GPHP+  PG+ Y++YDSEG R             YPP S S   P      N+M R  
Sbjct  405  AAGPHPALPPGSTYMVYDSEGGRTQ-----YSAHYGYPPXSISHHTPQPTTAPNLMAR--  457

Query  513  QGMRNPP--PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQ  340
               + PP  PYNEL+EKL  MG+R DH+ +VIQRMEESGQP+DFNAV+DRLN H SGG Q
Sbjct  458  -NQQFPPNHPYNELIEKLVPMGFRXDHVASVIQRMEESGQPIDFNAVIDRLNSHPSGGPQ  516

Query  339  KGW  331
            +GW
Sbjct  517  RGW  519



>ref|XP_002325597.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|EEE99978.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=537

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 116/190 (61%), Gaps = 20/190 (11%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQH---LKPAFCAP-GD  703
            E +PN++ MQV +SG+ Q++ASR + MPYG G     V  Q        +K  F     D
Sbjct  356  ETLPNSLPMQVSYSGVPQSLASRADTMPYGYGAGRTAVPQQPRQPSPQQIKGTFGGQHSD  415

Query  702  GYGVSGPHPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVM  526
             Y  +GPHP   P +AY++YD EG R H PPQQ  FPQG YPP         QPA    M
Sbjct  416  AYATAGPHPGQPPVSAYMVYDGEGGRTHHPPQQSHFPQGGYPP---------QPAAGTGM  466

Query  525  V----RPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGH  358
            +     P    RN P Y++L+EKL SMG+R DH  +VIQRMEESG+PVDFNAVLDRLN  
Sbjct  467  LPRHSSPSHFFRNHP-YSDLIEKLVSMGFRGDHAASVIQRMEESGEPVDFNAVLDRLNVQ  525

Query  357  SSGGSQK-GW  331
            SSGGSQ+ GW
Sbjct  526  SSGGSQRGGW  535



>ref|XP_011002849.1| PREDICTED: calcium-binding protein P-like [Populus euphratica]
Length=549

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 116/190 (61%), Gaps = 20/190 (11%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQH---LKPAFCAP-GD  703
            E +PN++ MQV +SG+ Q++ASR + MPYG G     V  Q        +K  F     D
Sbjct  368  ETLPNSLPMQVSYSGVPQSLASRADTMPYGYGAGRTAVPQQPRQPSPQQIKGTFGGQHSD  427

Query  702  GYGVSGPHPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVM  526
             Y  +GPHP   P +AY++YD EG R H PPQQ  FPQG YPP         QPA    M
Sbjct  428  AYATAGPHPGQPPVSAYMVYDGEGGRTHHPPQQSHFPQGGYPP---------QPAAGTSM  478

Query  525  V----RPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGH  358
            +     P    RN P Y++L+EKL SMG+R DH  +VIQRMEESG+PVDFNAVLDRLN  
Sbjct  479  LPRHSSPSHFFRNHP-YSDLIEKLVSMGFRGDHAASVIQRMEESGEPVDFNAVLDRLNVL  537

Query  357  SSGGSQK-GW  331
            SSGGSQ+ GW
Sbjct  538  SSGGSQRGGW  547



>ref|XP_009341976.1| PREDICTED: ATP-dependent helicase brm-like isoform X1 [Pyrus 
x bretschneideri]
Length=522

 Score =   151 bits (381),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 115/183 (63%), Gaps = 11/183 (6%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYG  694
            E VPN+M M VP+S + Q    R + MP+G G A R +Q Q P Q +K AF A PG+GYG
Sbjct  346  ESVPNSMPMPVPYSNIPQPGPGRSDPMPFGYGGAGRTMQQQPPPQQIKGAFGAQPGEGYG  405

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP  514
             +GPH +  PG+ Y++YDSEG R             YPP+S S   P      N+M R  
Sbjct  406  AAGPHTALPPGSTYMVYDSEGGRTQ-----YSAHYGYPPTSISHHTPQPTTAPNLMAR--  458

Query  513  QGMRNPP--PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQ  340
               + PP  PYNEL+EKL  MG+R DHI +VIQRMEESGQP+DFNAV+DRLN H SG  Q
Sbjct  459  -NQQFPPNHPYNELIEKLVPMGFRSDHIASVIQRMEESGQPIDFNAVIDRLNAHPSGVPQ  517

Query  339  KGW  331
            +GW
Sbjct  518  RGW  520



>ref|XP_009341977.1| PREDICTED: ATP-dependent helicase brm-like isoform X2 [Pyrus 
x bretschneideri]
Length=521

 Score =   151 bits (381),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 115/183 (63%), Gaps = 11/183 (6%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYG  694
            E VPN+M M VP+S + Q    R + MP+G G A R +Q Q P Q +K AF A PG+GYG
Sbjct  345  ESVPNSMPMPVPYSNIPQPGPGRSDPMPFGYGGAGRTMQQQPPPQQIKGAFGAQPGEGYG  404

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP  514
             +GPH +  PG+ Y++YDSEG R             YPP+S S   P      N+M R  
Sbjct  405  AAGPHTALPPGSTYMVYDSEGGRTQ-----YSAHYGYPPTSISHHTPQPTTAPNLMAR--  457

Query  513  QGMRNPP--PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQ  340
               + PP  PYNEL+EKL  MG+R DHI +VIQRMEESGQP+DFNAV+DRLN H SG  Q
Sbjct  458  -NQQFPPNHPYNELIEKLVPMGFRSDHIASVIQRMEESGQPIDFNAVIDRLNAHPSGVPQ  516

Query  339  KGW  331
            +GW
Sbjct  517  RGW  519



>ref|XP_009336199.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X2 [Pyrus x bretschneideri]
Length=521

 Score =   150 bits (380),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 115/183 (63%), Gaps = 11/183 (6%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYG  694
            E VPN+M M VP+S + Q    R + MP+G G A R +Q Q P Q +K AF A PG+GYG
Sbjct  345  ESVPNSMPMPVPYSNIPQPGPGRSDPMPFGYGGAGRTMQQQPPPQQIKGAFGAQPGEGYG  404

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP  514
             +GPH +  PG+ Y++YDSEG R             YPP+S S   P      N+M R  
Sbjct  405  AAGPHTALPPGSTYMVYDSEGGRTQ-----YSAHYGYPPTSISHHTPQPTTAPNLMAR--  457

Query  513  QGMRNPP--PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQ  340
               + PP  PYNEL+EKL  MG+R DH+ +VIQRMEESGQP+DFNAV+DRLN H SG  Q
Sbjct  458  -NQQFPPNHPYNELIEKLVPMGFRSDHVASVIQRMEESGQPIDFNAVIDRLNAHPSGVPQ  516

Query  339  KGW  331
            +GW
Sbjct  517  RGW  519



>ref|XP_009336198.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X1 [Pyrus x bretschneideri]
Length=522

 Score =   150 bits (380),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 115/183 (63%), Gaps = 11/183 (6%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYG  694
            E VPN+M M VP+S + Q    R + MP+G G A R +Q Q P Q +K AF A PG+GYG
Sbjct  346  ESVPNSMPMPVPYSNIPQPGPGRSDPMPFGYGGAGRTMQQQPPPQQIKGAFGAQPGEGYG  405

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP  514
             +GPH +  PG+ Y++YDSEG R             YPP+S S   P      N+M R  
Sbjct  406  AAGPHTALPPGSTYMVYDSEGGRTQ-----YSAHYGYPPTSISHHTPQPTTAPNLMAR--  458

Query  513  QGMRNPP--PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQ  340
               + PP  PYNEL+EKL  MG+R DH+ +VIQRMEESGQP+DFNAV+DRLN H SG  Q
Sbjct  459  -NQQFPPNHPYNELIEKLVPMGFRSDHVASVIQRMEESGQPIDFNAVIDRLNAHPSGVPQ  517

Query  339  KGW  331
            +GW
Sbjct  518  RGW  520



>ref|XP_006376495.1| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|ERP54292.1| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=532

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 116/186 (62%), Gaps = 15/186 (8%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYG  694
            E +PN+M MQV +SG+ Q ++S  + +PYG G     V  Q P Q +K  F A P D Y 
Sbjct  354  ETLPNSMPMQVSYSGVPQPMSSCADTVPYGYGAGRAAVPQQPPPQQIKGNFGAQPSDVYA  413

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMVR-  520
             +G HP   P +AY++YD E  R H   QQP FPQG YPP         Q A   ++ R 
Sbjct  414  TAGSHPGLPPVSAYMIYDGETGRTHHTSQQPHFPQGVYPPQ--------QAAGAGMLPRH  465

Query  519  --PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG  346
              P   +RN   YN+L+EKL +MG+R DH+++VIQRMEE G+PVDFN+VLDRL  HSSGG
Sbjct  466  SSPSHFVRNNF-YNDLIEKLVNMGFRGDHVVSVIQRMEEGGEPVDFNSVLDRLKVHSSGG  524

Query  345  SQK-GW  331
            SQ+ GW
Sbjct  525  SQRGGW  530



>ref|XP_010035753.1| PREDICTED: RNA polymerase II degradation factor 1-like [Eucalyptus 
grandis]
 gb|KCW47211.1| hypothetical protein EUGRSUZ_K01026 [Eucalyptus grandis]
Length=535

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 117/185 (63%), Gaps = 6/185 (3%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYG  694
            E +PN+M+MQ+ +SG+   V+SR + + Y  G   R  Q Q P    K  F A P + Y 
Sbjct  350  ETLPNSMAMQLSYSGVPPAVSSRVDTVSYEYGGPGRMGQQQPPLPPPKGTFGAHPSETYQ  409

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRP  517
             +GP     P + Y+MY+ +  R H  PQQ  FPQGAYPP++  + NP      N++ R 
Sbjct  410  AAGPQSMAPPTSGYMMYEGDMARAHHQPQQVHFPQGAYPPTNLPVQNPHPAPGGNLVGRN  469

Query  516  P---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG  346
            P   Q +RN P Y EL+EKL +MG+R DH+ +VIQR+EESGQPVDFNAVLDRLN H SG 
Sbjct  470  PSHSQFVRNHP-YGELIEKLVNMGFRGDHVASVIQRLEESGQPVDFNAVLDRLNVHPSGN  528

Query  345  SQKGW  331
            SQ+GW
Sbjct  529  SQRGW  533



>gb|EYU28592.1| hypothetical protein MIMGU_mgv1a004659mg [Erythranthe guttata]
Length=516

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 116/184 (63%), Gaps = 23/184 (13%)
 Frame = -2

Query  858  NNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYGVSG-P  682
            N+M MQV F G +Q   S    +PYG   ++RP+Q   P QHL+      GDGY  SG P
Sbjct  346  NSMPMQVSFVGASQQQPSSEAAIPYGY-TSNRPIQ-TPPPQHLR---QTAGDGYAPSGQP  400

Query  681  HPSFAPGNAYVMYDSEGPRG--HPPQ-QPIFPQG---AYPPSSFSLANPPQPANTNVMVR  520
             P+   GN+Y++YD EG RG  HPP  Q  F QG   AYPP    +  PP       MV 
Sbjct  401  RPA---GNSYMVYDGEGGRGPHHPPGPQSHFQQGVVGAYPPGPQRMPGPPN------MVV  451

Query  519  PPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQ  340
            P   MR+ P YNEL++KL +MGYR DH++ +IQRMEESGQ +DFN+VLDRLNGHSSG SQ
Sbjct  452  PQSSMRSHP-YNELIDKLVAMGYRTDHVVGIIQRMEESGQTIDFNSVLDRLNGHSSGTSQ  510

Query  339  K-GW  331
            + GW
Sbjct  511  RGGW  514



>ref|XP_003540363.1| PREDICTED: integrator complex subunit 3 homolog isoform 1 [Glycine 
max]
 gb|KHN27890.1| hypothetical protein glysoja_007622 [Glycine soja]
Length=532

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 118/190 (62%), Gaps = 16/190 (8%)
 Frame = -2

Query  873  SEMVPNNMSMQVPFSGM----TQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-P  709
            +E +PN++ MQ+P+SG+    + +     + MPYG   A R V  Q   QH++ +F A P
Sbjct  348  TETLPNSVPMQMPYSGIPPQGSSSGGGGSDAMPYGYSGAGRTVPQQPLLQHMRGSFSAQP  407

Query  708  GDGYGVSGPHPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTN  532
            GD YG SG H    P ++Y +YD E  R H PP+   + Q  YPP+S SL NP   A+ N
Sbjct  408  GDVYGNSGTHTMRPPASSYNVYDGENARAHYPPEPSHYAQAGYPPTSASLHNP---ASHN  464

Query  531  VMVRPP---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNG  361
            +MV  P   Q +R+ P YN+L+EK  SMG+R +H+ ++IQRMEE+ QP+DFN+V DRLN 
Sbjct  465  LMVPSPSQSQFIRSHP-YNDLIEKFVSMGFRGNHVASIIQRMEETQQPIDFNSVHDRLNV  523

Query  360  HSSGGSQKGW  331
            H     Q+GW
Sbjct  524  H---NPQRGW  530



>ref|XP_011037330.1| PREDICTED: putative uncharacterized protein DDB_G0294196 isoform 
X2 [Populus euphratica]
Length=526

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 111/182 (61%), Gaps = 16/182 (9%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYG  694
            E +PN+M MQV +SG+ Q ++SR + +PYG G     V  Q P Q +K  F A P D Y 
Sbjct  354  ETLPNSMPMQVSYSGVPQPMSSRADTVPYGYGAGRAAVPQQPPPQQIKGNFGAQPSDVYA  413

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMV--  523
             +GPHP   P +AY++YD E  R H   QQP FPQG YPP         QPA    M+  
Sbjct  414  TAGPHPGLPPVSAYMIYDGETGRTHHASQQPHFPQGVYPP---------QPAAGAGMLPR  464

Query  522  --RPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSG  349
               P    RN   YN+L+EKL +MG+R DH+++VIQRMEE G+PVDFN+VLDRL   SSG
Sbjct  465  HSSPSHFARNNF-YNDLIEKLVNMGFRGDHVVSVIQRMEEVGEPVDFNSVLDRLKVPSSG  523

Query  348  GS  343
             S
Sbjct  524  WS  525



>ref|XP_011037329.1| PREDICTED: bromodomain-containing protein 4-like isoform X1 [Populus 
euphratica]
Length=527

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 111/182 (61%), Gaps = 16/182 (9%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYG  694
            E +PN+M MQV +SG+ Q ++SR + +PYG G     V  Q P Q +K  F A P D Y 
Sbjct  355  ETLPNSMPMQVSYSGVPQPMSSRADTVPYGYGAGRAAVPQQPPPQQIKGNFGAQPSDVYA  414

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQPANTNVMV--  523
             +GPHP   P +AY++YD E  R H   QQP FPQG YPP         QPA    M+  
Sbjct  415  TAGPHPGLPPVSAYMIYDGETGRTHHASQQPHFPQGVYPP---------QPAAGAGMLPR  465

Query  522  --RPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSG  349
               P    RN   YN+L+EKL +MG+R DH+++VIQRMEE G+PVDFN+VLDRL   SSG
Sbjct  466  HSSPSHFARNNF-YNDLIEKLVNMGFRGDHVVSVIQRMEEVGEPVDFNSVLDRLKVPSSG  524

Query  348  GS  343
             S
Sbjct  525  WS  526



>gb|KCW89535.1| hypothetical protein EUGRSUZ_A01820 [Eucalyptus grandis]
Length=471

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 108/184 (59%), Gaps = 16/184 (9%)
 Frame = -2

Query  840  VPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQH---------LKPAFCAPGDG-YGV  691
            V +S +  T + RPE M  G G   R  Q                ++  F    +G YG 
Sbjct  288  VQYSRIPATASGRPENMAVGFGGPGRTTQQHQHQHQHQQQPPPQAIRSTFIMQNNGGYGA  347

Query  690  SGPHPSFAPGNAYVMYDSEGPR-GHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP  514
             GP+PS +PGN Y++YD E  R  H PQQP  PQGAYP ++ S  N  QP    + VR P
Sbjct  348  VGPNPSMSPGNTYMVYDGESGRMHHVPQQPPLPQGAYPQTNISYQNL-QPTPPPIQVRNP  406

Query  513  ---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGS  343
               Q +R     NELV++L SMG+RVDH+++VIQRMEESGQPVDFN+VLDRL+G SSG  
Sbjct  407  AYPQFIRKHAD-NELVDRLVSMGFRVDHVLSVIQRMEESGQPVDFNSVLDRLSGPSSGNP  465

Query  342  QKGW  331
            Q+ W
Sbjct  466  QRAW  469



>ref|XP_010051997.1| PREDICTED: LOW QUALITY PROTEIN: bromodomain-containing protein 
4 [Eucalyptus grandis]
Length=513

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 108/184 (59%), Gaps = 16/184 (9%)
 Frame = -2

Query  840  VPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQH---------LKPAFCAPGDG-YGV  691
            V +S +  T + RPE M  G G   R  Q                ++  F    +G YG 
Sbjct  330  VQYSRIPATASGRPENMAVGFGGPGRTTQQHQHQHQHQQQPPPQAIRSTFIMQNNGGYGA  389

Query  690  SGPHPSFAPGNAYVMYDSEGPR-GHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP  514
             GP+PS +PGN Y++YD E  R  H PQQP  PQGAYP ++ S  N  QP    + VR P
Sbjct  390  VGPNPSMSPGNTYMVYDGESGRMHHVPQQPPLPQGAYPQTNISYQNL-QPTPPPIQVRNP  448

Query  513  ---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGS  343
               Q +R     NELV++L SMG+RVDH+++VIQRMEESGQPVDFN+VLDRL+G SSG  
Sbjct  449  AYPQFIRKHAD-NELVDRLVSMGFRVDHVLSVIQRMEESGQPVDFNSVLDRLSGPSSGNP  507

Query  342  QKGW  331
            Q+ W
Sbjct  508  QRAW  511



>ref|XP_007149849.1| hypothetical protein PHAVU_005G103700g [Phaseolus vulgaris]
 gb|ESW21843.1| hypothetical protein PHAVU_005G103700g [Phaseolus vulgaris]
Length=513

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 107/176 (61%), Gaps = 18/176 (10%)
 Frame = -2

Query  846  MQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYGVSGPHPSF  670
            MQ+P+SG+   V+S  + +P+G     R V PQ P  H+K +F A PGD YG SG + + 
Sbjct  350  MQLPYSGIPPRVSSHADVLPHGYSGGGRTV-PQQPMLHMKGSFLAQPGDAYGTSGIYTAQ  408

Query  669  APGNAYVMYDSEGPRGHPPQQPIFP-QGAYPPSSFSLAN--PPQPANTNVMVRPPQGMRN  499
            +P +++++YD E  R H P QP    QG YPP+S SL N  P   +  N +         
Sbjct  409  SPASSFMVYDGENARSHYPSQPSHTTQGGYPPTSASLHNTAPHSQSQFNRI---------  459

Query  498  PPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
              P NEL+EK  SMG+R DH+++ IQRM+E+ QP+DFN+VLDRLN H     Q+GW
Sbjct  460  -NPNNELIEKFVSMGFRGDHVVSTIQRMQETEQPIDFNSVLDRLNVH---NLQRGW  511



>gb|KEH39132.1| structural constituent of cell wall protein, putative [Medicago 
truncatula]
Length=480

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 85/129 (66%), Gaps = 6/129 (5%)
 Frame = -2

Query  708  GDGYGVSGPHPSFAPGNAYVMYDSEGPRG-HPPQQPIFPQGAYPPSSFSLANPPQPANTN  532
            G+ YG SG H +  P + YVM + EG R  +PPQ   F QG YPP + SL NP   A  N
Sbjct  353  GNLYGTSGVHATPPPASVYVMNEGEGGRASYPPQPSPFAQGGYPPQNASLQNP---APHN  409

Query  531  VMVRPP--QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGH  358
            V +R P  Q +    PYNEL+E L SMG R D ++++IQRMEE+GQPV+FN+VLDRLN H
Sbjct  410  VTIRNPSQQKLMRSHPYNELIENLVSMGVRGDLVVSIIQRMEETGQPVNFNSVLDRLNAH  469

Query  357  SSGGSQKGW  331
            SS G Q+ W
Sbjct  470  SSLGPQREW  478



>gb|KEH39131.1| structural constituent of cell wall protein, putative [Medicago 
truncatula]
Length=500

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 85/129 (66%), Gaps = 6/129 (5%)
 Frame = -2

Query  708  GDGYGVSGPHPSFAPGNAYVMYDSEGPRG-HPPQQPIFPQGAYPPSSFSLANPPQPANTN  532
            G+ YG SG H +  P + YVM + EG R  +PPQ   F QG YPP + SL NP   A  N
Sbjct  373  GNLYGTSGVHATPPPASVYVMNEGEGGRASYPPQPSPFAQGGYPPQNASLQNP---APHN  429

Query  531  VMVRPP--QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGH  358
            V +R P  Q +    PYNEL+E L SMG R D ++++IQRMEE+GQPV+FN+VLDRLN H
Sbjct  430  VTIRNPSQQKLMRSHPYNELIENLVSMGVRGDLVVSIIQRMEETGQPVNFNSVLDRLNAH  489

Query  357  SSGGSQKGW  331
            SS G Q+ W
Sbjct  490  SSLGPQREW  498



>ref|XP_010242911.1| PREDICTED: RNA polymerase II degradation factor 1 [Nelumbo nucifera]
Length=560

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 105/193 (54%), Gaps = 18/193 (9%)
 Frame = -2

Query  855  NMSMQVPFSGMTQTVASRPEGMPYGSGVASRP-VQPQAPGQHLKP-------------AF  718
            +M MQVPFSG+ Q   SR E M YG   A R  VQ Q P QH                A 
Sbjct  366  SMPMQVPFSGIPQPGVSRAESMVYGYNAAGRTTVQQQPPLQHNMQQQPQPQTSQSTFGAH  425

Query  717  CAPGDG-YGVSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPA  541
             + G G Y  +G  P+   G   ++YD EG R      P + QG+Y P   SL NP  PA
Sbjct  426  LSSGTGAYPGAGAQPTQPQGQRSMIYDGEGGRAPHTLPPHYTQGSYTPGPVSLHNPQVPA  485

Query  540  -NTNVMVRP--PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDR  370
             ++N+M RP  P  M     Y EL+EK  SMGY  +H+ +VI R+EESGQPVDFN+VLDR
Sbjct  486  GSSNIMPRPRSPSHMMRNHVYAELIEKAVSMGYVREHVASVIHRLEESGQPVDFNSVLDR  545

Query  369  LNGHSSGGSQKGW  331
            LN   S G Q+GW
Sbjct  546  LNVQPSVGYQRGW  558



>ref|XP_003543336.1| PREDICTED: RNA polymerase II degradation factor 1-like [Glycine 
max]
Length=537

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 111/194 (57%), Gaps = 20/194 (10%)
 Frame = -2

Query  873  SEMVPNNMSMQVPFSGM------TQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA  712
            +E +PN++ MQ+P+SG+          +S  + MP G   A R V  Q   Q ++ +F A
Sbjct  349  TETLPNSVPMQMPYSGIPPQGSSHGGGSSSGDAMPNGYSGAGRTVPQQPLLQLMRGSFSA  408

Query  711  -PGDGYGVSGP--HPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQP  544
             P D YG SG   H +  P ++Y +YD E  R H PPQ   + Q  YPP+S S  N    
Sbjct  409  QPADVYGTSGAQSHTTRPPASSYDVYDGENARAHYPPQPSHYAQAGYPPTSASHQNH---  465

Query  543  ANTNVMVRPP---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLD  373
            A  N+MV  P   Q +R+   YN+L+EK  SMG+R DH+ N+IQRMEE+  P+DFN+V D
Sbjct  466  APHNLMVGSPSQSQFIRSHL-YNDLIEKFVSMGFRGDHVANIIQRMEETQLPIDFNSVHD  524

Query  372  RLNGHSSGGSQKGW  331
            RL+ H     Q+GW
Sbjct  525  RLDVH---NPQRGW  535



>ref|XP_004136824.1| PREDICTED: trithorax group protein osa [Cucumis sativus]
 gb|KGN43616.1| hypothetical protein Csa_7G048000 [Cucumis sativus]
Length=515

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 105/184 (57%), Gaps = 16/184 (9%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAP-GDGYG  694
            E +P++M MQ+ F  + Q  +SR +  PYG    S    PQ P Q +K A+  P G+GY 
Sbjct  344  ETLPSSMPMQMSFPSIPQPGSSRVDAGPYGYAAGSGGSAPQQPPQ-VKNAYGPPTGEGYM  402

Query  693  VSGPHPSFAPGNAYVMYDSEGPR--GHPPQQPIFPQGAYPPSSFSLANPPQ-PANTNVMV  523
                 P    G AY+MYD E  R   HPPQQ  F Q  YP ++     PPQ PA  +V  
Sbjct  403  P----PGQQSGGAYMMYDRESGRPPHHPPQQTHFNQSGYPLANAPHQVPPQAPAGPHVSA  458

Query  522  RPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGS  343
            R P        ++ L+EKL  MG+R DH+ ++IQRME+SGQPVDFNAVLDRL+  S  G 
Sbjct  459  RNPS-------HSHLIEKLVGMGFRGDHVASIIQRMEDSGQPVDFNAVLDRLSSPSGPGP  511

Query  342  QKGW  331
            Q+ W
Sbjct  512  QRAW  515



>ref|XP_008455323.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like [Cucumis melo]
Length=542

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 81/201 (40%), Positives = 109/201 (54%), Gaps = 25/201 (12%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA-PGDGYG  694
            E + N+M MQ+ FS + Q  +SR + +PYG   +   V  Q P   +K AF +  G+GY 
Sbjct  346  ETLSNSMPMQLSFSPIPQPGSSRIDTVPYGYVGSGVTVSQQPP--QVKNAFVSQAGEGYL  403

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGHPPQQPI--------------FPQGAYPPSSFSLAN  556
             SGP  + + G +Y+MYD E  R                      F Q  YPP++ S+  
Sbjct  404  PSGPQSALSSGASYMMYDRESGRPPHHPPQPQQPPHHPPQPQQSHFNQSGYPPANGSIQI  463

Query  555  PPQPANTNVMVRPPQG---MRNP---PPYNELVEKLASMGYRVDHIINVIQRMEESGQPV  394
               P+  +V+ R P     MRN     PY E+VEKL  MG+R DH+ +VI RMEESGQPV
Sbjct  464  SQHPSGPHVVARNPNHPHYMRNQNQNHPYGEIVEKLVGMGFRSDHVASVIHRMEESGQPV  523

Query  393  DFNAVLDRLNGHSSGGSQKGW  331
            DFNAVLD L+  +SGG Q+ W
Sbjct  524  DFNAVLDGLS--NSGGPQRVW  542



>gb|KHN36637.1| hypothetical protein glysoja_001368 [Glycine soja]
Length=537

 Score =   114 bits (284),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 110/194 (57%), Gaps = 20/194 (10%)
 Frame = -2

Query  873  SEMVPNNMSMQVPFSGM------TQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCA  712
            +E +PN++ MQ+P+SG+          +S  + MP G   A R V  Q   Q ++ +F A
Sbjct  349  TETLPNSVPMQMPYSGIPPQGSSHGGGSSSGDAMPNGYSGAGRTVPQQPLLQLMRGSFSA  408

Query  711  -PGDGYGVSGP--HPSFAPGNAYVMYDSEGPRGH-PPQQPIFPQGAYPPSSFSLANPPQP  544
             P D YG SG   H +  P ++Y +YD E  R H PPQ   + Q  YPP+S S  N    
Sbjct  409  QPADVYGTSGAQSHTTRPPASSYDVYDGENARAHYPPQPSHYAQAGYPPTSASHQNH---  465

Query  543  ANTNVMV---RPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLD  373
            A  N+MV      Q +R+   YN+L+EK  SMG+R DH+ N+IQRMEE+  P+DFN+V D
Sbjct  466  APHNLMVGSTSQSQFIRSHL-YNDLIEKFVSMGFRGDHVANIIQRMEETQLPIDFNSVND  524

Query  372  RLNGHSSGGSQKGW  331
            RL+ H     Q+GW
Sbjct  525  RLDVH---NPQRGW  535



>ref|XP_008455322.1| PREDICTED: transcription factor SPT20 homolog [Cucumis melo]
Length=514

 Score =   113 bits (283),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 105/184 (57%), Gaps = 16/184 (9%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAP-GDGYG  694
            E +P++M MQ+ F  + Q  +SR +  PYG    S    PQ P Q +K A+  P G+GY 
Sbjct  343  ETLPSSMPMQMSFPSIPQPGSSRVDAGPYGYAPGSGGSAPQQPPQ-VKNAYGPPTGEGYM  401

Query  693  VSGPHPSFAPGNAYVMYDSEGPR--GHPPQQPIFPQGAYPPSSFSLANPPQ-PANTNVMV  523
                 P    G AY+MYD E  R   HPPQQ  F Q  YP ++     PPQ PA  +V  
Sbjct  402  P----PGQQSGGAYMMYDRESGRPPHHPPQQAHFNQSGYPLANAPHQVPPQAPAGPHVSA  457

Query  522  RPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGS  343
            R P        ++ L+EKL  MG+R DH+ ++IQRME+SGQPVDFNAVLDRL+  S  G 
Sbjct  458  RNPS-------HSHLIEKLVGMGFRGDHVASIIQRMEDSGQPVDFNAVLDRLSSPSGPGP  510

Query  342  QKGW  331
            Q+ W
Sbjct  511  QRAW  514



>ref|XP_010924426.1| PREDICTED: putative cyclin-dependent serine/threonine-protein 
kinase DDB_G0272797/DDB_G0274007 isoform X2 [Elaeis guineensis]
Length=425

 Score =   109 bits (273),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 105/196 (54%), Gaps = 36/196 (18%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSG----VASRPV-------QPQAPGQHLKP  724
            E  P +M+MQVP++ ++Q V +RPE +P+G G    + S+P+       QPQ P    + 
Sbjct  248  ESYPGSMAMQVPYTTISQPVGNRPEAVPFGYGGPGSMVSQPLPQHGSQRQPQPPTS--QS  305

Query  723  AFCAPGDGYGVSGPHPSFAPGNAY---VMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANP  553
            +F  P +     GP P   P NA     MY                  +YPPS+ S A  
Sbjct  306  SFGRPLNKGAYVGPAPYTPPLNAQSYNTMY------------------SYPPSNVSPAQN  347

Query  552  PQ--PANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAV  379
            PQ  P+N   +  P   + +  PY E++EK  SMGY  DH  +VIQRMEESGQP+DFN++
Sbjct  348  PQLPPSNVVRVHHPGLQLMHTQPYGEMIEKAVSMGYARDHAASVIQRMEESGQPIDFNSL  407

Query  378  LDRLNGHSSGGSQKGW  331
            LDRLNG + G S + W
Sbjct  408  LDRLNGQAGGASSRPW  423



>ref|XP_004136823.1| PREDICTED: trithorax group protein osa [Cucumis sativus]
 gb|KGN43615.1| Structural constituent of cell wall [Cucumis sativus]
Length=545

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 107/206 (52%), Gaps = 32/206 (16%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYG---SGVASRPVQPQAPGQHLKPAFCAPGDG  700
            E + N+M MQ+ FS + Q  +SR + +PYG   SGV      PQ    ++  A    G+G
Sbjct  346  ETLSNSMPMQLSFSPIPQPGSSRIDTVPYGYVGSGVTVSQQPPQVKNAYVSQA----GEG  401

Query  699  YGVSGPHPSFAPGNAYVMYDSEGPRGHPPQQPI---------------FPQGAYPPSSFS  565
            Y  SGP  + + G +Y+MYD E  R                       F Q  Y P++ S
Sbjct  402  YLPSGPQSALSLGASYMMYDRESGRPQHHPPQPQQQPPHHPPQPQQSHFNQSGYSPANGS  461

Query  564  LANPPQPANTNVMVRPPQG---MRNP-----PPYNELVEKLASMGYRVDHIINVIQRMEE  409
            L     P+  +V+ R P     MRN       PY E+VEKL  MG+R DH+ ++I RMEE
Sbjct  462  LQISQHPSGPHVVARNPNHPHYMRNQNPNQNHPYGEIVEKLVGMGFRSDHVASIIHRMEE  521

Query  408  SGQPVDFNAVLDRLNGHSSGGSQKGW  331
            SGQPVDFNAVLD L+  +SGG Q+ W
Sbjct  522  SGQPVDFNAVLDGLS--NSGGPQRVW  545



>ref|XP_010924425.1| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase 
substrate-like isoform X1 [Elaeis guineensis]
Length=517

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 105/196 (54%), Gaps = 36/196 (18%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSG----VASRPV-------QPQAPGQHLKP  724
            E  P +M+MQVP++ ++Q V +RPE +P+G G    + S+P+       QPQ P    + 
Sbjct  340  ESYPGSMAMQVPYTTISQPVGNRPEAVPFGYGGPGSMVSQPLPQHGSQRQPQPPTS--QS  397

Query  723  AFCAPGDGYGVSGPHPSFAPGNAY---VMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANP  553
            +F  P +     GP P   P NA     MY                  +YPPS+ S A  
Sbjct  398  SFGRPLNKGAYVGPAPYTPPLNAQSYNTMY------------------SYPPSNVSPAQN  439

Query  552  PQ--PANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAV  379
            PQ  P+N   +  P   + +  PY E++EK  SMGY  DH  +VIQRMEESGQP+DFN++
Sbjct  440  PQLPPSNVVRVHHPGLQLMHTQPYGEMIEKAVSMGYARDHAASVIQRMEESGQPIDFNSL  499

Query  378  LDRLNGHSSGGSQKGW  331
            LDRLNG + G S + W
Sbjct  500  LDRLNGQAGGASSRPW  515



>ref|XP_008798248.1| PREDICTED: putative cyclin-dependent serine/threonine-protein 
kinase DDB_G0272797/DDB_G0274007 [Phoenix dactylifera]
Length=514

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 73/191 (38%), Positives = 99/191 (52%), Gaps = 36/191 (19%)
 Frame = -2

Query  855  NMSMQVPFSGMTQTVASRPEGMPYGSG----VASRPV-------QPQAPGQHLKPAFCAP  709
            +M+MQVP++ ++Q V +RPE +P+G G      S+P+       QPQ P    + +F  P
Sbjct  342  SMAMQVPYTTISQPVGNRPEAVPFGYGGPGSTVSQPLPQHSSQRQPQPPTS--QSSFGLP  399

Query  708  GDGYGVSGPHPSFAPGNAY---VMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQPAN  538
                G  GP P   P NA     MY                  +YPPS  S A  PQ  +
Sbjct  400  LHKGGYVGPAPYTPPLNAQSYNTMY------------------SYPPSIVSAAQNPQLPS  441

Query  537  TNV--MVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLN  364
            +NV  +  P   +    PY E++EK  SMGY  DH  + IQRM ESGQP+DFN++LDRLN
Sbjct  442  SNVGGVHHPGLQLMPAQPYGEMIEKAVSMGYARDHAASAIQRMGESGQPIDFNSLLDRLN  501

Query  363  GHSSGGSQKGW  331
            G + G S + W
Sbjct  502  GQAGGASPRIW  512



>ref|XP_008810226.1| PREDICTED: ataxin-2 homolog isoform X2 [Phoenix dactylifera]
 ref|XP_008810227.1| PREDICTED: ataxin-2 homolog isoform X2 [Phoenix dactylifera]
Length=493

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 96/192 (50%), Gaps = 28/192 (15%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLK---------PAF  718
            E  P +M +QVP+S ++Q   SRPE + +G G  S  V P  P   L+          +F
Sbjct  316  ESYPGSMVVQVPYSTISQPGGSRPEAVSFGYGEPSSTVSPPMPQHSLQRQPQPPTSQSSF  375

Query  717  CAPGDGYGVSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQ--P  544
              P    G  GP P   P N                Q       YPPS+ S A   Q  P
Sbjct  376  GPPPSKGGYVGPAPYTPPLNV---------------QSYSTTYNYPPSNVSAAQNQQLPP  420

Query  543  ANTNVMVRP-PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRL  367
             N   +  P PQ MR+ P Y E++EK  SMGY  DH+ +VIQR+ ESGQP+DFN++LD L
Sbjct  421  GNVVGVHHPGPQLMRSHP-YGEMIEKAVSMGYARDHVASVIQRVGESGQPMDFNSLLDML  479

Query  366  NGHSSGGSQKGW  331
            NG  +GGS + W
Sbjct  480  NGRVTGGSTRVW  491



>ref|XP_008810225.1| PREDICTED: ataxin-2 homolog isoform X1 [Phoenix dactylifera]
Length=516

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 96/192 (50%), Gaps = 28/192 (15%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLK---------PAF  718
            E  P +M +QVP+S ++Q   SRPE + +G G  S  V P  P   L+          +F
Sbjct  339  ESYPGSMVVQVPYSTISQPGGSRPEAVSFGYGEPSSTVSPPMPQHSLQRQPQPPTSQSSF  398

Query  717  CAPGDGYGVSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQ--P  544
              P    G  GP P   P N                Q       YPPS+ S A   Q  P
Sbjct  399  GPPPSKGGYVGPAPYTPPLNV---------------QSYSTTYNYPPSNVSAAQNQQLPP  443

Query  543  ANTNVMVRP-PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRL  367
             N   +  P PQ MR+ P Y E++EK  SMGY  DH+ +VIQR+ ESGQP+DFN++LD L
Sbjct  444  GNVVGVHHPGPQLMRSHP-YGEMIEKAVSMGYARDHVASVIQRVGESGQPMDFNSLLDML  502

Query  366  NGHSSGGSQKGW  331
            NG  +GGS + W
Sbjct  503  NGRVTGGSTRVW  514



>ref|XP_010919602.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 23-like 
isoform X2 [Elaeis guineensis]
Length=488

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 101/193 (52%), Gaps = 31/193 (16%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYG----SGVASRPV-------QPQAPGQHLKP  724
            E  P +M+MQVP+S ++Q   SRPE +P+G    S   S+P+       QPQ P  H   
Sbjct  312  ESYPGSMAMQVPYSTISQPGGSRPEAVPFGYVGSSSTVSQPMPQHSLQRQPQPPTSH--S  369

Query  723  AFCAPGDGYGVSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQP  544
            +F  P    G  GP P   P N                Q      +YPPS+ S A   Q 
Sbjct  370  SFGPPPIKGGYVGPAPYTPPLNV---------------QSYSTTYSYPPSNASAAQNQQL  414

Query  543  ANTNVM-VRP-PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDR  370
               NV+ V P PQ +R+ P Y E++EK   MGY  +H+ +VIQRM E+GQP+DFN++LD 
Sbjct  415  PPGNVVGVHPGPQLVRSHP-YGEMIEKAVGMGYAREHVASVIQRMGETGQPMDFNSLLDM  473

Query  369  LNGHSSGGSQKGW  331
            LNG ++  S + W
Sbjct  474  LNGRATSASARVW  486



>ref|XP_010919593.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 23-like 
isoform X1 [Elaeis guineensis]
Length=515

 Score = 94.0 bits (232),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 101/193 (52%), Gaps = 31/193 (16%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYG----SGVASRPV-------QPQAPGQHLKP  724
            E  P +M+MQVP+S ++Q   SRPE +P+G    S   S+P+       QPQ P  H   
Sbjct  339  ESYPGSMAMQVPYSTISQPGGSRPEAVPFGYVGSSSTVSQPMPQHSLQRQPQPPTSH--S  396

Query  723  AFCAPGDGYGVSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQP  544
            +F  P    G  GP P   P N                Q      +YPPS+ S A   Q 
Sbjct  397  SFGPPPIKGGYVGPAPYTPPLNV---------------QSYSTTYSYPPSNASAAQNQQL  441

Query  543  ANTNVM-VRP-PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDR  370
               NV+ V P PQ +R+ P Y E++EK   MGY  +H+ +VIQRM E+GQP+DFN++LD 
Sbjct  442  PPGNVVGVHPGPQLVRSHP-YGEMIEKAVGMGYAREHVASVIQRMGETGQPMDFNSLLDM  500

Query  369  LNGHSSGGSQKGW  331
            LNG ++  S + W
Sbjct  501  LNGRATSASARVW  513



>ref|XP_002869511.1| hypothetical protein ARALYDRAFT_491942 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45770.1| hypothetical protein ARALYDRAFT_491942 [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score = 90.1 bits (222),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 93/200 (47%), Gaps = 50/200 (25%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYGV  691
            E +PN+M MQ P+SG  Q          YG G       PQ       P     GDGY  
Sbjct  325  ESLPNSMQMQSPYSGPPQQSM-----QAYGYGAPPPQAPPQQTKMSYSPQ---TGDGYLP  376

Query  690  SGPHPSFAPGNAYVMYDS--------------------EGPRGHPPQQPIFPQGAYPPSS  571
            SGP P     NA  MYD                     +GP+G          G Y P  
Sbjct  377  SGPPPPAGYANA--MYDGGRMQYPPPQPQQQQQQAHYLQGPQG----------GGYAP--  422

Query  570  FSLANPPQPANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVD  391
                 P Q    N    P   +R+   Y EL+EKL SMG+R DH++ VIQRMEESGQP+D
Sbjct  423  ----QPHQSGGGNTGAPPV--LRSK--YGELIEKLVSMGFRGDHVMAVIQRMEESGQPID  474

Query  390  FNAVLDRLNGHSSGGSQKGW  331
            FNA+LDRL+G SSGG  +GW
Sbjct  475  FNALLDRLSGQSSGGPPRGW  494



>emb|CDY14248.1| BnaA08g13790D [Brassica napus]
Length=491

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 91/191 (48%), Gaps = 33/191 (17%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYGV  691
            E +P +M MQ P+ G  Q          YG G       PQAP Q         GDGY  
Sbjct  323  EPLPGSMQMQSPYGGPPQQSM-----QAYGYGAPP----PQAPQQTKMSYNPQTGDGYLP  373

Query  690  SGPHPSFAPGNAYVMYDS-----------EGPRGHPPQQPIFPQGAYPPSSFSLANPPQP  544
            SGP P   PG A  MY+            +  +GH  Q P  P G Y P           
Sbjct  374  SGPPP---PGYASAMYEDGRMQYPPPQPQQQQQGHYMQGP--PGGGYAPQQHQAGGGGNT  428

Query  543  ANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLN  364
               + ++R          Y EL+EKL SMG+R DH++ VIQRMEESGQ +DFNA+LDRL+
Sbjct  429  GTPSPVLRSK--------YGELIEKLVSMGFRGDHVMAVIQRMEESGQAIDFNALLDRLS  480

Query  363  GHSSGGSQKGW  331
              SSGG  +GW
Sbjct  481  VQSSGGPPRGW  491



>ref|NP_974630.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE85467.1| uncharacterized protein AT4G28300 [Arabidopsis thaliana]
Length=438

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFN +LDRL+G SSGG  +GW
Sbjct  386  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNTLLDRLSGQSSGGPPRGW  438



>ref|NP_194559.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL36251.1| putative proline-rich protein [Arabidopsis thaliana]
 gb|AAM20028.1| putative proline-rich protein [Arabidopsis thaliana]
 gb|AEE85466.1| uncharacterized protein AT4G28300 [Arabidopsis thaliana]
Length=496

 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFN +LDRL+G SSGG  +GW
Sbjct  444  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNTLLDRLSGQSSGGPPRGW  496



>emb|CAB79632.1| predicted proline-rich protein [Arabidopsis thaliana]
Length=508

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFN +LDRL+G SSGG  +GW
Sbjct  456  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNTLLDRLSGQSSGGPPRGW  508



>ref|XP_009144355.1| PREDICTED: protein transport protein SEC31-like [Brassica rapa]
Length=476

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFNA+LDRL+  SSGG  +GW
Sbjct  424  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNALLDRLSAQSSGGPPRGW  476



>ref|XP_010433239.1| PREDICTED: bromodomain-containing protein 4-like [Camelina sativa]
Length=494

 Score = 86.7 bits (213),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 95/192 (49%), Gaps = 35/192 (18%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYGV  691
            E +P++M MQ P+SG  Q          YG G    P  PQ       P     GDGY  
Sbjct  326  ESLPSSMQMQSPYSGPPQQSM-----QAYGYGAPPPPQAPQQTKMSYSPQ---TGDGYLQ  377

Query  690  SGPHPSFAPGNAYVMYDSEGPR-----------GHPPQQPIFPQGAYPPSSFSLANPPQP  544
            SGP P  A G A  MY  EG R            H  Q P    G Y P       P Q 
Sbjct  378  SGPPPPSA-GYANAMY--EGGRMQYTPPQPQQQAHCLQGP--QGGGYAP------QPHQA  426

Query  543  ANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLN  364
               N    P   +R+   Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFNA+LDRL+
Sbjct  427  GGGNTGAPPV--LRSK--YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNALLDRLS  482

Query  363  GHSSGG-SQKGW  331
            G SSGG  + GW
Sbjct  483  GQSSGGPPRGGW  494



>ref|XP_009137778.1| PREDICTED: basic salivary proline-rich protein 1-like [Brassica 
rapa]
 emb|CDY29896.1| BnaA03g49170D [Brassica napus]
Length=487

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = -2

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            Y EL+EKL SMG+R DH+++VIQRMEESGQP+DFNA+LDRL+  SSGG  +GW
Sbjct  435  YGELIEKLVSMGFRGDHVMSVIQRMEESGQPIDFNALLDRLSVQSSGGPPRGW  487



>ref|XP_006283593.1| hypothetical protein CARUB_v10004649mg [Capsella rubella]
 gb|EOA16491.1| hypothetical protein CARUB_v10004649mg [Capsella rubella]
Length=497

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 1/54 (2%)
 Frame = -2

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG-SQKGW  331
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFNA+LDRL+G SSGG  + GW
Sbjct  444  YGELIEKLVSMGFRADHVMAVIQRMEESGQPIDFNALLDRLSGQSSGGPPRGGW  497



>emb|CDY67879.1| BnaC07g50480D [Brassica napus]
Length=478

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFNA+LDRL+  SSGG  +GW
Sbjct  426  YGELIEKLVSMGFRGDHVMGVIQRMEESGQPIDFNALLDRLSVQSSGGPPRGW  478



>ref|XP_006412973.1| hypothetical protein EUTSA_v10024987mg [Eutrema salsugineum]
 gb|ESQ54426.1| hypothetical protein EUTSA_v10024987mg [Eutrema salsugineum]
Length=499

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 96/195 (49%), Gaps = 43/195 (22%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGM-TQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYG  694
            E +P++M MQ P++G   Q++ +   G P           P AP Q         GDGY 
Sbjct  333  EPLPSSMQMQQPYAGSPQQSIQAYGYGAP-----------PHAPQQTKMSYSPQTGDGYL  381

Query  693  VSGPHPSFAPGNAYVMYDSEGPR--------------GHPPQQPIFPQGAYPPSSFSLAN  556
             SGP PS   G A  MY  EG R              GH  Q P    G Y P       
Sbjct  382  PSGPPPS---GYASAMY--EGGRMQYPPAQPQQQQQQGHYMQGP--QGGGYAPQQHQAGG  434

Query  555  PPQPANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVL  376
                 N+      P  +R+   Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFNA+L
Sbjct  435  ----GNSGT----PPVLRSK--YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNALL  484

Query  375  DRLNGHSSGGSQKGW  331
            DRL+  SSGG  +GW
Sbjct  485  DRLSVPSSGGPPRGW  499



>gb|KFK35898.1| hypothetical protein AALP_AA4G050800 [Arabis alpina]
Length=484

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFNA+LDRL+  SSGG  +GW
Sbjct  432  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNALLDRLSVQSSGGPPRGW  484



>ref|XP_010540875.1| PREDICTED: extensin [Tarenaya hassleriana]
Length=492

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 73/143 (51%), Gaps = 35/143 (24%)
 Frame = -2

Query  744  PGQHLKPAFC-APGDGYGVSGPHPSFAPGNAYVMYDSEGPRGH----PPQQPIFPQGAYP  580
            P Q +K ++    G+GY  SG          Y MY+  G  G     PPQQ  FP G Y 
Sbjct  380  PPQQMKTSYSPQSGEGYVPSG----------YAMYEG-GEAGRMQYPPPQQTHFPPGGYA  428

Query  579  PSSFSLANPPQPANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQ  400
            P                     Q +R    Y EL+EKL SMG+R DH++ VIQRMEESGQ
Sbjct  429  PQQGGR----------------QFLRASSAYGELIEKLVSMGFRGDHVMAVIQRMEESGQ  472

Query  399  PVDFNAVLDRLNGHSSGGSQKGW  331
            P+DFNAVLDRL+  S    Q+GW
Sbjct  473  PIDFNAVLDRLSVQS---PQRGW  492



>ref|XP_010448000.1| PREDICTED: vacuolar protein-sorting protein BRO1-like [Camelina 
sativa]
Length=495

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 95/202 (47%), Gaps = 51/202 (25%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYGV  691
            E +P++M MQ P+SG  Q          YG G    P  PQ       P     GDGY  
Sbjct  323  ESLPSSMQMQSPYSGPPQQSM-----QAYGYGAPPPPQAPQQTKMSYSPQ---TGDGYLQ  374

Query  690  SGPHPSFAPGNAYVMYDS---------------------EGPRGHPPQQPIFPQGAYPPS  574
            SGP P  A G A  MY+                      +GP+G          G Y P 
Sbjct  375  SGPPPPSA-GYANAMYEGGRMQYTPPQPQQQQQQQTHYLQGPQG----------GGYAP-  422

Query  573  SFSLANPPQPANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPV  394
                  P Q    N    P   MR+   Y EL+EKL SMG+R DH++ VIQRMEESGQP+
Sbjct  423  -----QPHQAGGGNTGAPPV--MRSK--YGELIEKLVSMGFRGDHVMAVIQRMEESGQPI  473

Query  393  DFNAVLDRLNGHSSGG-SQKGW  331
            DFNA+LDRL+G SSGG  + GW
Sbjct  474  DFNALLDRLSGQSSGGPPRGGW  495



>ref|XP_010438481.1| PREDICTED: formin-like protein 5 [Camelina sativa]
Length=497

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 46/54 (85%), Gaps = 1/54 (2%)
 Frame = -2

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG-SQKGW  331
            Y EL+EKL SMG+R DH++ VIQRMEESGQP+DFNA+LDRL+G SSGG  + GW
Sbjct  444  YGELIEKLVSMGFRGDHVMAVIQRMEESGQPIDFNALLDRLSGQSSGGPPRGGW  497



>emb|CDY18985.1| BnaC01g20830D [Brassica napus]
Length=479

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 74/200 (37%), Positives = 94/200 (47%), Gaps = 51/200 (26%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYGV  691
            E +P++M MQ P++G  Q          YG G       PQAP Q         GDGY  
Sbjct  311  EPLPSSMQMQSPYAGPPQQSM-----QAYGYGAPP----PQAPQQTKMSYSPQTGDGYLP  361

Query  690  SGPHPSFAPGNAYVMYDS--------------------EGPRGHPPQQPIFPQGAYPPSS  571
            SGP P   PG    +Y+S                    +GP+G          G Y P  
Sbjct  362  SGPPP---PGYTNAIYESGRMQYPPPQPHQQQQQAHYMQGPQG----------GGYAPQQ  408

Query  570  FSLANPPQPANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVD  391
                      N+     PP  +R    Y EL+EKL SMG+R DH+I VIQRMEESGQP++
Sbjct  409  HQAGG----GNSGT---PPPVLRTK--YGELIEKLMSMGFRGDHVIAVIQRMEESGQPIE  459

Query  390  FNAVLDRLNGHSSGGSQKGW  331
            FNA+LD+L+  SSGG  +GW
Sbjct  460  FNALLDKLSVQSSGGPPRGW  479



>emb|CDX89188.1| BnaA01g17050D [Brassica napus]
Length=470

 Score = 84.3 bits (207),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 5/62 (8%)
 Frame = -2

Query  501  NPPP-----YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQK  337
             PPP     Y EL+EKL SMG+R DH++ VIQRMEESGQ +DFNA+LDRL+  SSGG  +
Sbjct  409  TPPPVSRSKYGELIEKLVSMGFRGDHVMAVIQRMEESGQAIDFNALLDRLSAQSSGGPPR  468

Query  336  GW  331
            GW
Sbjct  469  GW  470



>gb|EPS62243.1| hypothetical protein M569_12549, partial [Genlisea aurea]
Length=512

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 97/187 (52%), Gaps = 38/187 (20%)
 Frame = -2

Query  846  MQVPFSGMTQTVASRPEGMPYGSGVASRP--------VQPQAPGQHLKPAFCAPGDGYGV  691
            +QVPFS       S  E +PY  G + +P         Q Q+  QHLK            
Sbjct  348  VQVPFS-------SGSEVIPYSYGSSGKPPVQQQQQHQQHQSLAQHLKGGGGYGDGYGIP  400

Query  690  SGPH-PSFAPGNAYVMYDSEGPRG-----HPPQQPIFPQGAYPPSSFSLANPPQPANTNV  529
            SG   P   PGN+Y+++D E  R       PP  P + Q    PS      PP PA +  
Sbjct  401  SGQQRPPPQPGNSYMVFDGETGRTTTTHLQPP--PHYQQQG--PSYL----PPPPATSFA  452

Query  528  MVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLN-GHSS  352
                P+G     PYNEL+EKL  MGYR +H++ VIQR+EESGQ VDFN+VLDRLN G   
Sbjct  453  ----PRGH----PYNELIEKLIGMGYRGEHVVGVIQRLEESGQAVDFNSVLDRLNGGGGG  504

Query  351  GGSQKGW  331
            GGSQ+GW
Sbjct  505  GGSQRGW  511



>emb|CDX97433.1| BnaC08g12980D [Brassica napus]
Length=492

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -2

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            Y EL+EKL SMG+R DH++ VIQRMEESGQ +DFNA+LDRL+  SSGG  +GW
Sbjct  440  YGELIEKLVSMGFRGDHVMTVIQRMEESGQAIDFNALLDRLSVQSSGGPPRGW  492



>emb|CDY25250.1| BnaA02g22060D [Brassica napus]
Length=492

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -2

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            Y EL+EKL SMG+R DH++ VIQRMEESGQ +DFNA+LDRL+  SSGG  +GW
Sbjct  440  YGELIEKLVSMGFRGDHVMAVIQRMEESGQAIDFNALLDRLSVQSSGGPPRGW  492



>ref|XP_009109102.1| PREDICTED: formin-like protein 3 [Brassica rapa]
Length=500

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = -2

Query  489  YNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            Y EL+EKL SMG+R DH++ VIQRMEESGQ +DFNA+LDRL+  SSGG  +GW
Sbjct  448  YGELIEKLMSMGFRGDHVMAVIQRMEESGQAIDFNALLDRLSVQSSGGPPRGW  500



>ref|NP_001044280.1| Os01g0754500 [Oryza sativa Japonica Group]
 dbj|BAD87289.1| putative calcium-binding protein [Oryza sativa Japonica Group]
 dbj|BAF06194.1| Os01g0754500 [Oryza sativa Japonica Group]
 dbj|BAG93651.1| unnamed protein product [Oryza sativa Japonica Group]
Length=594

 Score = 81.6 bits (200),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 96/190 (51%), Gaps = 28/190 (15%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPV-QPQAPGQHLKP----AFCAPG  706
            E +P +M+MQ P++ +     SR E +PY  G    P  Q     Q L P    +F  P 
Sbjct  423  ETLPGSMAMQGPYNTVAPAAGSRSE-VPYSYGGPGMPPPQHNMQRQQLPPPSQGSFGPPS  481

Query  705  DGYGVSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQ--PANTN  532
             G G +GP P +AP  +   Y++                 YPPS  S A  PQ  PA  N
Sbjct  482  KG-GYAGP-PQYAPQGSSHGYNTAY--------------GYPPSGPSAAQAPQMPPAPGN  525

Query  531  VMVRPP---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNG  361
            V +  P   Q MR  P Y E++EK  +MGY  + ++NVIQRM ESGQP+DFN +LDRLN 
Sbjct  526  VGMSHPGSHQMMRGHP-YGEMIEKAITMGYPREQVMNVIQRMTESGQPMDFNTLLDRLNE  584

Query  360  HSSGGSQKGW  331
              SG   + W
Sbjct  585  AGSGAPPRAW  594



>gb|EEC71500.1| hypothetical protein OsI_03777 [Oryza sativa Indica Group]
Length=595

 Score = 81.6 bits (200),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 96/190 (51%), Gaps = 28/190 (15%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPV-QPQAPGQHLKP----AFCAPG  706
            E +P +M+MQ P++ +     SR E +PY  G    P  Q     Q L P    +F  P 
Sbjct  424  ETLPGSMAMQGPYNTVAPAAGSRSE-VPYSYGGPGMPPPQHNMQRQQLPPPSQGSFGPPS  482

Query  705  DGYGVSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQ--PANTN  532
             G G +GP P +AP  +   Y++                 YPPS  S A  PQ  PA  N
Sbjct  483  KG-GYAGP-PQYAPQGSSHGYNTAY--------------GYPPSGPSAAQAPQMPPAPGN  526

Query  531  VMVRPP---QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNG  361
            V +  P   Q MR  P Y E++EK  +MGY  + ++NVIQRM ESGQP+DFN +LDRLN 
Sbjct  527  VGMSHPGSHQMMRGHP-YGEMIEKAITMGYPREQVMNVIQRMTESGQPMDFNTLLDRLNE  585

Query  360  HSSGGSQKGW  331
              SG   + W
Sbjct  586  AGSGAPPRAW  595



>dbj|BAK01177.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=603

 Score = 79.0 bits (193),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 91/187 (49%), Gaps = 18/187 (10%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYGV  691
            E +P + +MQ P++ +  +  +  E + Y  G    P QP  P QH       P  G G 
Sbjct  428  ETMPGSAAMQGPYNTVPPSGGTHSE-VQYSYGGPGIPSQP--PPQHSMQRQQLPPPGQGS  484

Query  690  SGPHPS---FAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQ--PANTNVM  526
             GP PS   + P  A        P+GHP      P G YPPS  S A  PQ  P    V 
Sbjct  485  FGPAPSKGAYPPQYA--------PQGHPQGYNNTPYGGYPPSGPSAAQAPQMPPGGGGVS  536

Query  525  VRPP--QGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSS  352
               P    M    PY +++EK  +MGY  D ++NVIQRM ESGQ +DFNA+LDRLN   S
Sbjct  537  HPGPSHHHMMRGHPYGDMIEKAITMGYPRDQVLNVIQRMTESGQQIDFNALLDRLNESGS  596

Query  351  GGSQKGW  331
            G   + W
Sbjct  597  GAPPRAW  603



>ref|XP_008655245.1| PREDICTED: uncharacterized protein LOC100383096 isoform X1 [Zea 
mays]
 gb|AFW85062.1| putative DUF1421 domain family protein [Zea mays]
Length=584

 Score = 75.9 bits (185),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 67/177 (38%), Positives = 87/177 (49%), Gaps = 8/177 (5%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPV-QPQAPGQHLKPAFCAPGDGYG  694
            E +P N++MQ  ++    + A+RPE +PY  G A  P+ Q Q   QH       P    G
Sbjct  408  ETLPGNVAMQGSYNTAVPSGANRPE-LPYSYGGAGIPLSQSQPLPQHNMQRHQLPPSSQG  466

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQ-PANTNVMVRP  517
              GP PS     +Y       P+G+P  Q      AYPP+      P Q P     M  P
Sbjct  467  SFGPPPS---KGSYAGSPQYAPQGNP--QGYSTGYAYPPNGPPAVQPQQMPPGGVGMSHP  521

Query  516  PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG  346
               M    PY E++EK  +MGY  D ++NV QRM ESGQ +DFN +LDRLN   SG 
Sbjct  522  ASHMMRGHPYGEMMEKAITMGYPRDQVLNVTQRMAESGQSMDFNTLLDRLNEAGSGA  578



>ref|NP_001169238.1| uncharacterized protein LOC100383096 [Zea mays]
 gb|ACN32051.1| unknown [Zea mays]
Length=507

 Score = 75.5 bits (184),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 67/177 (38%), Positives = 87/177 (49%), Gaps = 8/177 (5%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPV-QPQAPGQHLKPAFCAPGDGYG  694
            E +P N++MQ  ++    + A+RPE +PY  G A  P+ Q Q   QH       P    G
Sbjct  331  ETLPGNVAMQGSYNTAVPSGANRPE-LPYSYGGAGIPLSQSQPLPQHNMQRHQLPPSSQG  389

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQGAYPPSSFSLANPPQ-PANTNVMVRP  517
              GP PS     +Y       P+G+P  Q      AYPP+      P Q P     M  P
Sbjct  390  SFGPPPS---KGSYAGSPQYAPQGNP--QGYSTGYAYPPNGPPAVQPQQMPPGGVGMSHP  444

Query  516  PQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGG  346
               M    PY E++EK  +MGY  D ++NV QRM ESGQ +DFN +LDRLN   SG 
Sbjct  445  ASHMMRGHPYGEMMEKAITMGYPRDQVLNVTQRMAESGQSMDFNTLLDRLNEAGSGA  501



>ref|XP_006644725.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X2 [Oryza brachyantha]
Length=586

 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 92/190 (48%), Gaps = 37/190 (19%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYG-SGVASRPVQPQAPGQHLKPAFCAPGDGYG  694
            E +P +M+MQ P++ +  +  SR E +PY  +G+         P QH       P    G
Sbjct  424  ETLPGSMAMQGPYNTVAPSGGSRSE-VPYSYAGIP--------PPQHNMQRQQLPPPNQG  474

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIF--PQG-----AYPPSSFSLANPPQ--PA  541
              GP PS            +G    PPQ P+    QG      YPPS  S    PQ  PA
Sbjct  475  SFGPPPS------------KGGYAGPPQYPLHGSSQGYNNAYGYPPSGPSAGQAPQMPPA  522

Query  540  NTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNG  361
                   P Q MR  P Y E++EK  +MGY  + ++NVIQRM ESGQP+DFN +LDRLN 
Sbjct  523  PG-----PHQMMRGHP-YGEMIEKAITMGYPREQVLNVIQRMTESGQPMDFNTLLDRLNE  576

Query  360  HSSGGSQKGW  331
              SG   + W
Sbjct  577  AGSGAHPRAW  586



>ref|XP_006644724.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X1 [Oryza brachyantha]
Length=587

 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 71/190 (37%), Positives = 92/190 (48%), Gaps = 37/190 (19%)
 Frame = -2

Query  870  EMVPNNMSMQVPFSGMTQTVASRPEGMPYG-SGVASRPVQPQAPGQHLKPAFCAPGDGYG  694
            E +P +M+MQ P++ +  +  SR E +PY  +G+         P QH       P    G
Sbjct  425  ETLPGSMAMQGPYNTVAPSGGSRSE-VPYSYAGIP--------PPQHNMQRQQLPPPNQG  475

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIF--PQG-----AYPPSSFSLANPPQ--PA  541
              GP PS            +G    PPQ P+    QG      YPPS  S    PQ  PA
Sbjct  476  SFGPPPS------------KGGYAGPPQYPLHGSSQGYNNAYGYPPSGPSAGQAPQMPPA  523

Query  540  NTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNG  361
                   P Q MR  P Y E++EK  +MGY  + ++NVIQRM ESGQP+DFN +LDRLN 
Sbjct  524  PG-----PHQMMRGHP-YGEMIEKAITMGYPREQVLNVIQRMTESGQPMDFNTLLDRLNE  577

Query  360  HSSGGSQKGW  331
              SG   + W
Sbjct  578  AGSGAHPRAW  587



>emb|CDM84126.1| unnamed protein product [Triticum aestivum]
Length=603

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 58/105 (55%), Gaps = 5/105 (5%)
 Frame = -2

Query  633  GPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP----QGMRNPPPYNELVEKL  466
             P+GHP Q      G YPP+  S A  PQ     V V  P      M    PY +++EK 
Sbjct  500  APQGHP-QGYNTSYGGYPPNDPSAAQAPQMPPGGVGVSHPGSSHHHMMRGHPYGDMIEKA  558

Query  465  ASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
             +MGY  D ++NVIQRM +SGQ +DFNA+LDRLN   SG   + W
Sbjct  559  ITMGYPRDQVLNVIQRMTDSGQQIDFNALLDRLNESGSGAPPRPW  603



>gb|EMT05386.1| hypothetical protein F775_26441 [Aegilops tauschii]
Length=606

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 56/105 (53%), Gaps = 4/105 (4%)
 Frame = -2

Query  633  GPRGHPPQQPIFPQGAYPPSSFSLANPPQPANTNVMVRPP----QGMRNPPPYNELVEKL  466
             P+GHP        G YPP+  S A  PQ       V  P      M    PY +++EK 
Sbjct  502  APQGHPQGGYNTSYGGYPPNGPSAAQAPQMPPGGAGVSHPGSSHHHMMRGHPYGDMIEKA  561

Query  465  ASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
             +MGY  D ++NVIQRM ESGQ +DFNA+LDRLN   SG   + W
Sbjct  562  NTMGYPRDQVLNVIQRMTESGQQIDFNALLDRLNESGSGAPPRPW  606



>ref|XP_004969990.1| PREDICTED: trithorax group protein osa-like [Setaria italica]
Length=590

 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -2

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            PY E++EK  +MGY  + ++NV QRM ESGQP+DFN +LDRLN   SG   + W
Sbjct  537  PYGEMIEKAITMGYPREQVLNVTQRMAESGQPMDFNTLLDRLNEAGSGAPPRAW  590



>ref|XP_009395702.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Musa acuminata subsp. malaccensis]
Length=581

 Score = 69.3 bits (168),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = -2

Query  507  MRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            MRN P Y +++EK   MGY  + +++++QRM E+GQP+DFN++LDRLNG ++G + + W
Sbjct  524  MRNHP-YGDMIEKAIGMGYDGNQVMSLVQRMAETGQPMDFNSLLDRLNGQAAGATPRAW  581



>gb|EMS50510.1| hypothetical protein TRIUR3_23019 [Triticum urartu]
Length=606

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -2

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            PY +++EK  +MGY  + ++NVIQRM ESGQ +DFNA+LDRLN   SG   + W
Sbjct  553  PYGDMIEKAITMGYPREQVLNVIQRMTESGQQIDFNALLDRLNESGSGAPPRPW  606



>ref|XP_002458505.1| hypothetical protein SORBIDRAFT_03g034890 [Sorghum bicolor]
 gb|EES03625.1| hypothetical protein SORBIDRAFT_03g034890 [Sorghum bicolor]
Length=587

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 86/182 (47%), Gaps = 18/182 (10%)
 Frame = -2

Query  873  SEMVPNNMSMQVPFSGMTQTVASRPEGMPYGSGVASRPVQPQAPGQHLKPAFCAPGDGYG  694
            +E +P N++MQ P++    + ASR E  PY  G    P     P  +++     P     
Sbjct  412  TETLPANVAMQGPYNTAAPSGASRSEP-PYSYGGPGIPPSQPPPQHNMQRHQLPPSSQSS  470

Query  693  VSGPHPSFAPGNAYVMYDSEGPRGHPPQQPIFPQG-----AYPPSSFSLANPPQ-PANTN  532
              GP PS     +Y       P+G+P       QG     AYPPS      P Q P    
Sbjct  471  F-GPPPS---KGSYASPTQYAPQGNP-------QGYNTGYAYPPSGPPAVQPQQMPPGGV  519

Query  531  VMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSS  352
             M  P   M    PY E++EK  +MGY  D ++NV QRM ESGQP+DFN +LDRLN   S
Sbjct  520  GMSHPGSHMMRGHPYGEMMEKAITMGYPRDQVLNVTQRMAESGQPMDFNTLLDRLNEAGS  579

Query  351  GG  346
            G 
Sbjct  580  GA  581



>ref|XP_009396506.1| PREDICTED: pinin-like [Musa acuminata subsp. malaccensis]
Length=512

 Score = 63.2 bits (152),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 55/90 (61%), Gaps = 4/90 (4%)
 Frame = -2

Query  591  GAYPPSS-FSLANPPQ--PANTNVMVRPPQGMRNPPPYNELVEKLASMGYRVDHIINVIQ  421
             +YPP++ F +A   Q  P+N+  +    +  RN   Y E++EK   MGY  + II  +Q
Sbjct  424  SSYPPNNNFPVARNQQIPPSNSAALPYDSRLTRNHS-YGEMIEKAVGMGYDRNQIIGAVQ  482

Query  420  RMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            RM ESGQP+DF+++LDRLNG ++    + W
Sbjct  483  RMVESGQPMDFHSLLDRLNGQAAAAPARAW  512



>ref|XP_008795992.1| PREDICTED: protein transport protein SEC31-like [Phoenix dactylifera]
Length=553

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -2

Query  504  RNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            +N  P +++VEK+A+MG+  D +   ++++ ESGQ VD N VLD+L        QKGW
Sbjct  493  KNRLPIDDVVEKVATMGFSRDQVRATVRKLTESGQSVDLNVVLDKLMNDEEIQPQKGW  550



>gb|KEH24794.1| DNA-binding protein, putative [Medicago truncatula]
Length=565

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 39/60 (65%), Gaps = 3/60 (5%)
 Frame = -2

Query  501  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGS---QKGW  331
            N  P +++VEK+A+MG+  DH+   ++++ E+GQ VD N VLD+L     GG    Q+GW
Sbjct  503  NRVPVDDIVEKVATMGFPRDHVRATVRKLTENGQAVDLNTVLDKLMNEGGGGDMQQQRGW  562



>ref|XP_001784568.1| predicted protein [Physcomitrella patens]
 gb|EDQ50633.1| predicted protein [Physcomitrella patens]
Length=378

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 67/125 (54%), Gaps = 18/125 (14%)
 Frame = -2

Query  660  NAYVMYDSEGPRGH----PPQ----QPIFP-QGAYPPSSFSLANPPQPANTNVMVRPPQG  508
             AY   D +GP+G+    PPQ    QP  P  G YP      A   QP++ +     P  
Sbjct  254  QAYPSQDRDGPQGYNQYAPPQYRMAQPGSPASGGYP--QLPTARSIQPSSLSTGGTAPVA  311

Query  507  MRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRL-NGHSSGGSQ---  340
              N    +E+++K+ASMG+  D +  +++++ E+G  VD N VLD+L NG SSGG++   
Sbjct  312  A-NRVSIDEVIDKVASMGFGRDQVRAIVRKLMENGTTVDLNVVLDKLMNGDSSGGNEGQQ  370

Query  339  --KGW  331
              KGW
Sbjct  371  PAKGW  375



>ref|XP_010940140.1| PREDICTED: protein diaphanous homolog 1-like [Elaeis guineensis]
Length=549

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = -2

Query  504  RNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            +N  P +++VEK+A+MG+  D +   ++++ E+GQ VD N VLD+L        QKGW
Sbjct  489  KNRLPIDDVVEKVATMGFSRDQVRATVRKLTENGQSVDLNVVLDKLMNDGEIQPQKGW  546



>ref|XP_006643803.1| PREDICTED: vegetative cell wall protein gp1-like [Oryza brachyantha]
Length=573

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = -2

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P +++VEK+A+MG+  + +   ++R+ E+GQ VD N VLD+L   S    QKGW
Sbjct  517  PVDDVVEKVATMGFSREQVRATVRRLTENGQNVDLNVVLDKLMNDSDVQPQKGW  570



>ref|XP_008801947.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein [Phoenix 
dactylifera]
Length=539

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -2

Query  501  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            N  P +++V+K+A+MG+  D +   ++R+ E+GQ VD N VLD+L        QKGW
Sbjct  480  NRMPIDDVVDKVATMGFSRDQVRAAVRRLTENGQSVDLNVVLDKLMNDGEIQPQKGW  536



>emb|CAJ44247.1| hypothetical protein [Cocos nucifera]
Length=120

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -2

Query  501  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            N  P +++V+K+ +MG+  D +   ++++ E+GQ VD N VLD+L        QKGW
Sbjct  56   NRMPIDDVVDKVVTMGFSRDQVRATVRKLTENGQSVDLNVVLDKLMNDGEIQPQKGW  112



>ref|XP_006655038.1| PREDICTED: vegetative cell wall protein gp1-like, partial [Oryza 
brachyantha]
Length=495

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -2

Query  501  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRL-NGHSSGGSQKGW  331
            N  P +++V+K+A+MG+  + +   ++++ ESGQ VD N VLD+L NG S    Q+GW
Sbjct  435  NRVPIDDVVDKVATMGFSREEVRAAVRQLTESGQNVDLNVVLDKLMNGSSDAQPQRGW  492



>ref|XP_001770189.1| predicted protein [Physcomitrella patens]
 gb|EDQ65023.1| predicted protein [Physcomitrella patens]
Length=403

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 40/60 (67%), Gaps = 6/60 (10%)
 Frame = -2

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRL-NGHSSGGSQ-----KGW  331
            P +E+++K+ASMG+  D +   ++++ E+G  VD N VLD+L NG SSG ++     KGW
Sbjct  341  PVDEVIDKVASMGFGRDQVRATVRKLTENGTSVDLNVVLDKLMNGDSSGRNESQQPAKGW  400



>ref|XP_006446566.1| hypothetical protein CICLE_v10014743mg [Citrus clementina]
 gb|ESR59806.1| hypothetical protein CICLE_v10014743mg [Citrus clementina]
Length=574

 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -2

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P +++V+K+ASMG+  DH+   +Q+M E+GQ VD N VLD+L         +GW
Sbjct  518  PIDDVVDKVASMGFPRDHVRATVQKMTENGQSVDLNKVLDKLMSDGEVQPPRGW  571



>ref|XP_006470271.1| PREDICTED: COPII coat assembly protein sec16-like [Citrus sinensis]
Length=574

 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -2

Query  501  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            N  P +++V+K+ASMG+  DH+   +Q+M E+GQ VD N VLD+L         +GW
Sbjct  515  NRVPIDDVVDKVASMGFPRDHVRATVQKMTENGQSVDLNKVLDKLMSDGEVQPPRGW  571



>ref|XP_011097415.1| PREDICTED: protein enabled-like [Sesamum indicum]
Length=543

 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -2

Query  510  GMRNPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            G  N  P +++V+K+ +MG+  D +   ++++ E+GQ VD N VLD+L     G +Q+GW
Sbjct  481  GSGNRVPIDDVVDKVTNMGFPRDQVRATVRKLTENGQSVDLNIVLDKLMNDGDGQAQRGW  540



>ref|XP_002300038.2| hypothetical protein POPTR_0001s34990g [Populus trichocarpa]
 gb|EEE84843.2| hypothetical protein POPTR_0001s34990g [Populus trichocarpa]
Length=337

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -2

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P +++V+K+ SMG+  +H+   ++++ E+GQ VD N VLD+L        Q+GW
Sbjct  281  PLDDVVDKVTSMGFPREHVEATVRKLTENGQSVDLNIVLDKLMNDGDVQPQRGW  334



>gb|KDO55180.1| hypothetical protein CISIN_1g0084162mg, partial [Citrus sinensis]
Length=462

 Score = 53.9 bits (128),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P +++V K+ASMG+  DH+   +Q+M E+GQ VD N VLD+L         +GW
Sbjct  406  PIDDVVAKVASMGFPRDHVRATVQKMTENGQSVDLNKVLDKLMSDGEVQPPRGW  459



>ref|XP_001758183.1| predicted protein [Physcomitrella patens]
 gb|EDQ77005.1| predicted protein [Physcomitrella patens]
Length=437

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 39/55 (71%), Gaps = 5/55 (9%)
 Frame = -2

Query  486  NELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRL-NGHSSGGSQ--KGW  331
            +E+++K+A MG+  D +  V++R+ E+GQ VD N VLD+L NG   GG+Q  KGW
Sbjct  381  DEVIDKVAVMGFSKDQVRAVVRRLTENGQSVDLNVVLDKLMNG--DGGAQPPKGW  433



>gb|KDO55178.1| hypothetical protein CISIN_1g0084162mg [Citrus sinensis]
Length=564

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P +++V K+ASMG+  DH+   +Q+M E+GQ VD N VLD+L         +GW
Sbjct  508  PIDDVVAKVASMGFPRDHVRATVQKMTENGQSVDLNKVLDKLMSDGEVQPPRGW  561



>gb|KDO55179.1| hypothetical protein CISIN_1g0084162mg [Citrus sinensis]
Length=566

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P +++V K+ASMG+  DH+   +Q+M E+GQ VD N VLD+L         +GW
Sbjct  510  PIDDVVAKVASMGFPRDHVRATVQKMTENGQSVDLNKVLDKLMSDGEVQPPRGW  563



>ref|XP_010108811.1| hypothetical protein L484_020546 [Morus notabilis]
 gb|EXC20326.1| hypothetical protein L484_020546 [Morus notabilis]
Length=591

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -2

Query  501  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            N  P +++++K+ +MG+  DH+   ++++ E+GQ VD N VLD+L     G   +GW
Sbjct  532  NRVPIDDVIDKVTTMGFPRDHVRATVRKLTENGQSVDLNVVLDKLMNEGEGQLPRGW  588



>ref|XP_009388841.1| PREDICTED: bromodomain-containing protein 4 [Musa acuminata subsp. 
malaccensis]
Length=538

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = -2

Query  486  NELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            +++VEK+A+MG+  D +   ++++ E+GQ VD N VLD+L        QKGW
Sbjct  484  DDVVEKVATMGFSRDQVRATVRKLTENGQSVDLNVVLDKLMNDGEIQPQKGW  535



>ref|NP_001042136.2| Os01g0169900 [Oryza sativa Japonica Group]
 dbj|BAD68319.1| vegetative cell wall protein gp1 -like [Oryza sativa Japonica 
Group]
 gb|EAY72703.1| hypothetical protein OsI_00570 [Oryza sativa Indica Group]
 gb|EAZ10703.1| hypothetical protein OsJ_00537 [Oryza sativa Japonica Group]
 dbj|BAH00414.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF04050.2| Os01g0169900 [Oryza sativa Japonica Group]
Length=580

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = -2

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRL-NGHSSGGSQKGW  331
            P +++VEK+A+MG+  + +   ++R+ E+GQ VD N VLD+L N       QKGW
Sbjct  523  PVDDVVEKVATMGFSREQVRATVRRLTENGQNVDLNVVLDKLMNDSDVQQPQKGW  577



>ref|XP_011047322.1| PREDICTED: vacuolar protein sorting-associated protein 37C [Populus 
euphratica]
Length=552

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -2

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P +++V+K+ +MG+  +H+   ++++ E+GQ VD N VLD+L        Q+GW
Sbjct  496  PLDDVVDKVTTMGFPREHVEATVRKLTENGQSVDLNVVLDKLMNDGDVQPQRGW  549



>ref|XP_002440684.1| hypothetical protein SORBIDRAFT_09g005090 [Sorghum bicolor]
 gb|EES19114.1| hypothetical protein SORBIDRAFT_09g005090 [Sorghum bicolor]
Length=582

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -2

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P ++++EK+A+MG+  + +   ++++ E+GQ VD N VLD+L   +    Q+ W
Sbjct  526  PIDDVIEKVATMGFSKEQVRATVRKLTENGQNVDLNVVLDKLMNDTDAQPQRSW  579



>ref|XP_007031556.1| Uncharacterized protein TCM_016944 [Theobroma cacao]
 gb|EOY02482.1| Uncharacterized protein TCM_016944 [Theobroma cacao]
Length=541

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -2

Query  501  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            N  P +++++K+ SMG+  DH+   ++++ E+GQ VD N VLD+L   S     +GW
Sbjct  482  NRVPVDDVIDKVTSMGFPRDHVRATVRKLTENGQSVDLNVVLDKLMNDSEVQPPRGW  538



>ref|XP_011620611.1| PREDICTED: altered inheritance of mitochondria protein 3 [Amborella 
trichopoda]
Length=555

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -2

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P +++V+K+ +MG+  D +   ++++ E+GQ VD N VLD+L        QKGW
Sbjct  499  PIDDVVDKVTNMGFSRDQVRATVRKLTENGQSVDLNVVLDKLMNDGEIQPQKGW  552



>gb|KHG02060.1| Myosin-2 [Gossypium arboreum]
Length=542

 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -2

Query  501  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            N  P +++++K+ +MG+  DH+   ++++ E+GQ VD N VLD+L   S     +GW
Sbjct  483  NRVPIDDVIDKVTTMGFPRDHVRATVRKLTENGQSVDLNVVLDKLMNDSDVQPPRGW  539



>gb|ERM98731.1| hypothetical protein AMTR_s00082p00053170 [Amborella trichopoda]
Length=695

 Score = 51.6 bits (122),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 35/57 (61%), Gaps = 0/57 (0%)
 Frame = -2

Query  501  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            N  P +++V+K+ +MG+  D +   ++++ E+GQ VD N VLD+L        QKGW
Sbjct  496  NRVPIDDVVDKVTNMGFSRDQVRATVRKLTENGQSVDLNVVLDKLMNDGEIQPQKGW  552



>gb|KJB75894.1| hypothetical protein B456_012G063600 [Gossypium raimondii]
Length=622

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = -2

Query  501  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            N  P +++++K+ +MG+  DH+   ++++ E+GQ VD N VLD+L   S     +GW
Sbjct  563  NRVPIDDVIDKVTTMGFPRDHVRATVRKLTENGQSVDLNVVLDKLMNDSDVQPPRGW  619



>ref|XP_002524656.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF37675.1| DNA binding protein, putative [Ricinus communis]
Length=568

 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = -2

Query  501  NPPPYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            N  P +++V+K+++MG+  +H+   ++++ E+GQ VD N VLD+L        Q+GW
Sbjct  509  NRVPIDDVVDKVSNMGFPREHVRATVRKLTENGQAVDLNTVLDKLMNDGEVQPQRGW  565



>ref|XP_009611188.1| PREDICTED: transcriptional regulator DEF1 isoform X2 [Nicotiana 
tomentosiformis]
Length=545

 Score = 50.8 bits (120),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P +++V+K+ +MG+  D +   ++R+ ESGQ VD N VLD+L         +GW
Sbjct  489  PIDDVVDKVTNMGFSRDQVRETVRRLTESGQAVDLNTVLDKLMNDGDVQPPRGW  542



>ref|XP_009611187.1| PREDICTED: transcriptional regulator DEF1 isoform X1 [Nicotiana 
tomentosiformis]
Length=551

 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = -2

Query  492  PYNELVEKLASMGYRVDHIINVIQRMEESGQPVDFNAVLDRLNGHSSGGSQKGW  331
            P +++V+K+ +MG+  D +   ++R+ ESGQ VD N VLD+L         +GW
Sbjct  495  PIDDVVDKVTNMGFSRDQVRETVRRLTESGQAVDLNTVLDKLMNDGDVQPPRGW  548



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1963610081719