BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13805

Length=991
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009614908.1|  PREDICTED: sugar transporter ERD6-like 7           426   2e-143   Nicotiana tomentosiformis
dbj|BAO96226.1|  sugar-porter family protein 7                          425   3e-143   Solanum lycopersicum
ref|XP_009777420.1|  PREDICTED: sugar transporter ERD6-like 7           424   1e-142   Nicotiana sylvestris
ref|XP_006358441.1|  PREDICTED: sugar transporter ERD6-like 7-like      423   2e-142   Solanum tuberosum [potatoes]
ref|NP_001233882.1|  st3 protein                                        422   1e-141   
gb|EYU43551.1|  hypothetical protein MIMGU_mgv1a005532mg                416   1e-139   Erythranthe guttata [common monkey flower]
gb|AJU57222.1|  sugar transporter ERD6-like 7                           410   3e-137   Camellia sinensis [black tea]
ref|XP_011079781.1|  PREDICTED: sugar transporter ERD6-like 7           409   2e-136   Sesamum indicum [beniseed]
ref|XP_008234933.1|  PREDICTED: sugar transporter ERD6-like 7           404   1e-134   
emb|CDP03586.1|  unnamed protein product                                402   1e-134   Coffea canephora [robusta coffee]
ref|XP_007050715.1|  Major facilitator superfamily protein isoform 1    403   3e-134   
ref|XP_010512799.1|  PREDICTED: sugar transporter ERD6-like 7           393   2e-133   
ref|XP_008386585.1|  PREDICTED: sugar transporter ERD6-like 7           400   3e-133   
ref|XP_010512800.1|  PREDICTED: sugar transporter ERD6-like 7           393   1e-132   
gb|KCW58969.1|  hypothetical protein EUGRSUZ_H01597                     390   2e-132   Eucalyptus grandis [rose gum]
ref|XP_004290698.1|  PREDICTED: sugar transporter ERD6-like 7           397   2e-132   Fragaria vesca subsp. vesca
ref|XP_010242565.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    397   3e-132   
ref|XP_004292608.2|  PREDICTED: sugar transporter ERD6-like 7           397   4e-132   Fragaria vesca subsp. vesca
ref|XP_010242564.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    397   4e-132   Nelumbo nucifera [Indian lotus]
gb|EPS59997.1|  hypothetical protein M569_14807                         395   9e-132   Genlisea aurea
ref|XP_010026273.1|  PREDICTED: sugar transporter ERD6-like 7           387   3e-131   Eucalyptus grandis [rose gum]
gb|KFK37554.1|  hypothetical protein AALP_AA4G271800                    394   5e-131   Arabis alpina [alpine rockcress]
ref|XP_004493632.1|  PREDICTED: sugar transporter ERD6-like 7-like      394   8e-131   Cicer arietinum [garbanzo]
gb|KJB23160.1|  hypothetical protein B456_004G084300                    394   9e-131   Gossypium raimondii
gb|KEH23690.1|  sugar porter (SP) family MFS transporter                393   1e-130   Medicago truncatula
ref|XP_010507821.1|  PREDICTED: sugar transporter ERD6-like 7           391   2e-130   
ref|XP_009103393.1|  PREDICTED: sugar transporter ERD6-like 7           392   2e-130   Brassica rapa
ref|XP_006444170.1|  hypothetical protein CICLE_v10019923mg             389   2e-130   
emb|CDY12861.1|  BnaC07g15720D                                          392   3e-130   Brassica napus [oilseed rape]
gb|KHG14417.1|  hypothetical protein F383_03945                         389   1e-129   Gossypium arboreum [tree cotton]
ref|XP_006409064.1|  hypothetical protein EUTSA_v10022677mg             390   1e-129   Eutrema salsugineum [saltwater cress]
gb|AAM61246.1|  putative sugar transporter                              390   1e-129   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566120.1|  sugar transporter ERD6-like 7                         390   1e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102177.1|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    390   1e-129   
emb|CDY01404.1|  BnaA07g11770D                                          390   2e-129   
emb|CDY39145.1|  BnaA07g01410D                                          390   2e-129   Brassica napus [oilseed rape]
ref|XP_002880340.1|  hypothetical protein ARALYDRAFT_483991             389   2e-129   
ref|XP_006444171.1|  hypothetical protein CICLE_v10019923mg             389   5e-129   Citrus clementina [clementine]
ref|XP_006444169.1|  hypothetical protein CICLE_v10019923mg             389   5e-129   
ref|XP_008386586.1|  PREDICTED: sugar transporter ERD6-like 7           389   7e-129   
emb|CDX82668.1|  BnaC07g01980D                                          387   2e-128   
ref|XP_010070279.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    387   2e-128   
ref|XP_010070277.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    387   4e-128   Eucalyptus grandis [rose gum]
ref|XP_010545075.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    383   6e-128   Tarenaya hassleriana [spider flower]
emb|CBI32306.3|  unnamed protein product                                385   7e-128   Vitis vinifera
ref|XP_002524779.1|  sugar transporter, putative                        386   9e-128   Ricinus communis
ref|XP_010070291.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    385   9e-128   Eucalyptus grandis [rose gum]
ref|XP_010070290.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    386   1e-127   Eucalyptus grandis [rose gum]
gb|KCW58947.1|  hypothetical protein EUGRSUZ_H01571                     385   2e-127   Eucalyptus grandis [rose gum]
ref|XP_011009474.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    382   7e-127   Populus euphratica
gb|KJB47011.1|  hypothetical protein B456_008G006300                    384   7e-127   Gossypium raimondii
ref|XP_002270927.2|  PREDICTED: sugar transporter ERD6-like 7           384   8e-127   Vitis vinifera
ref|XP_012092318.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    384   8e-127   Jatropha curcas
ref|XP_010545070.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    383   9e-127   
ref|XP_008368891.1|  PREDICTED: sugar transporter ERD6-like 7           383   1e-126   
ref|XP_011009473.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    383   2e-126   Populus euphratica
ref|XP_010667578.1|  PREDICTED: sugar transporter ERD6-like 7           382   5e-126   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008386584.1|  PREDICTED: sugar transporter ERD6-like 7           381   6e-126   
ref|XP_002302812.2|  sugar transporter family protein                   381   7e-126   Populus trichocarpa [western balsam poplar]
ref|XP_010070313.1|  PREDICTED: sugar transporter ERD6-like 7           379   5e-125   Eucalyptus grandis [rose gum]
ref|XP_008235073.1|  PREDICTED: sugar transporter ERD6-like 7           379   5e-125   Prunus mume [ume]
ref|XP_007200994.1|  hypothetical protein PRUPE_ppa005144mg             378   9e-125   Prunus persica
ref|XP_008234934.1|  PREDICTED: sugar transporter ERD6-like 7           377   2e-124   
ref|XP_004290697.1|  PREDICTED: sugar transporter ERD6-like 7           376   6e-124   Fragaria vesca subsp. vesca
gb|KEH23721.1|  sugar porter (SP) family MFS transporter                375   2e-123   Medicago truncatula
ref|XP_004140089.1|  PREDICTED: sugar transporter ERD6-like 7           374   3e-123   Cucumis sativus [cucumbers]
ref|XP_007162379.1|  hypothetical protein PHAVU_001G147100g             374   4e-123   Phaseolus vulgaris [French bean]
ref|XP_007201571.1|  hypothetical protein PRUPE_ppa018319mg             373   2e-122   
gb|KHN19852.1|  Sugar transporter ERD6-like 7                           372   3e-122   Glycine soja [wild soybean]
gb|KHG20787.1|  hypothetical protein F383_26710                         366   4e-121   Gossypium arboreum [tree cotton]
gb|KJB47013.1|  hypothetical protein B456_008G006300                    368   8e-121   Gossypium raimondii
ref|XP_010112685.1|  Sugar transporter ERD6-like 7                      365   5e-120   
ref|XP_008449464.1|  PREDICTED: sugar transporter ERD6-like 7           366   5e-120   Cucumis melo [Oriental melon]
ref|XP_002320384.1|  sugar transporter family protein                   365   6e-120   
ref|XP_003521224.1|  PREDICTED: sugar transporter ERD6-like 7-like      365   1e-119   Glycine max [soybeans]
ref|XP_010107672.1|  Sugar transporter ERD6-like 7                      362   8e-119   
ref|XP_007162380.1|  hypothetical protein PHAVU_001G147200g             363   8e-119   Phaseolus vulgaris [French bean]
ref|XP_004292610.1|  PREDICTED: sugar transporter ERD6-like 7           363   9e-119   Fragaria vesca subsp. vesca
ref|XP_003554233.1|  PREDICTED: sugar transporter ERD6-like 7-lik...    361   3e-118   Glycine max [soybeans]
gb|KHN45387.1|  Sugar transporter ERD6-like 7                           357   4e-117   Glycine soja [wild soybean]
ref|XP_011033659.1|  PREDICTED: sugar transporter ERD6-like 7           357   2e-116   Populus euphratica
ref|XP_010242562.1|  PREDICTED: sugar transporter ERD6-like 7           357   2e-116   Nelumbo nucifera [Indian lotus]
ref|XP_010070278.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    355   7e-116   
ref|XP_010279395.1|  PREDICTED: sugar transporter ERD6-like 16 is...    345   1e-111   Nelumbo nucifera [Indian lotus]
gb|KEH23691.1|  sugar porter (SP) family MFS transporter                343   3e-111   Medicago truncatula
ref|XP_010242566.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    340   3e-110   
ref|XP_007222121.1|  hypothetical protein PRUPE_ppa004636mg             340   1e-109   Prunus persica
ref|XP_006356995.1|  PREDICTED: sugar transporter ERD6-like 16-like     338   3e-109   Solanum tuberosum [potatoes]
gb|AJU57223.1|  sugar transporter ERD6-like 16                          337   3e-108   Camellia sinensis [black tea]
ref|XP_008223080.1|  PREDICTED: sugar transporter ERD6-like 16          337   3e-108   Prunus mume [ume]
emb|CBI26138.3|  unnamed protein product                                333   2e-107   Vitis vinifera
ref|XP_009603615.1|  PREDICTED: sugar transporter ERD6-like 16 is...    331   2e-107   Nicotiana tomentosiformis
ref|XP_008795113.1|  PREDICTED: sugar transporter ERD6-like 16 is...    333   3e-107   
ref|XP_011462680.1|  PREDICTED: sugar transporter ERD6-like 16 is...    330   5e-107   Fragaria vesca subsp. vesca
ref|XP_008795112.1|  PREDICTED: sugar transporter ERD6-like 16 is...    333   6e-107   Phoenix dactylifera
ref|XP_004229493.1|  PREDICTED: sugar transporter ERD6-like 16          332   1e-106   Solanum lycopersicum
ref|XP_002278197.1|  PREDICTED: sugar transporter ERD6-like 16 is...    332   1e-106   Vitis vinifera
gb|KJB28573.1|  hypothetical protein B456_005G056400                    331   2e-106   Gossypium raimondii
ref|XP_009603614.1|  PREDICTED: sugar transporter ERD6-like 16 is...    330   5e-106   Nicotiana tomentosiformis
ref|XP_004296777.1|  PREDICTED: sugar transporter ERD6-like 16 is...    330   1e-105   Fragaria vesca subsp. vesca
ref|XP_009352178.1|  PREDICTED: sugar transporter ERD6-like 16          330   1e-105   Pyrus x bretschneideri [bai li]
ref|XP_007035424.1|  Major facilitator superfamily protein              328   2e-105   Theobroma cacao [chocolate]
ref|XP_009774898.1|  PREDICTED: sugar transporter ERD6-like 16 is...    325   4e-105   Nicotiana sylvestris
ref|XP_006444168.1|  hypothetical protein CICLE_v10019918mg             328   5e-105   Citrus clementina [clementine]
ref|XP_011090877.1|  PREDICTED: sugar transporter ERD6-like 16          328   6e-105   Sesamum indicum [beniseed]
ref|XP_010024484.1|  PREDICTED: sugar transporter ERD6-like 16 is...    326   7e-105   Eucalyptus grandis [rose gum]
ref|XP_003609563.1|  Sugar transporter ERD6-like protein                328   7e-105   Medicago truncatula
ref|XP_010912096.1|  PREDICTED: sugar transporter ERD6-like 16          327   8e-105   Elaeis guineensis
ref|XP_010024483.1|  PREDICTED: sugar transporter ERD6-like 16 is...    327   2e-104   Eucalyptus grandis [rose gum]
ref|XP_008340870.1|  PREDICTED: sugar transporter ERD6-like 16          326   4e-104   
ref|XP_010660047.1|  PREDICTED: sugar transporter ERD6-like 8           325   4e-104   
gb|KDO74959.1|  hypothetical protein CISIN_1g018767mg                   320   7e-104   Citrus sinensis [apfelsine]
ref|XP_012092321.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    323   8e-104   
ref|XP_009774897.1|  PREDICTED: sugar transporter ERD6-like 16 is...    325   1e-103   Nicotiana sylvestris
gb|KJB72536.1|  hypothetical protein B456_011G183500                    324   1e-103   Gossypium raimondii
ref|XP_008438776.1|  PREDICTED: sugar transporter ERD6-like 16 is...    323   2e-103   Cucumis melo [Oriental melon]
gb|EYU43869.1|  hypothetical protein MIMGU_mgv1a018596mg                323   2e-103   Erythranthe guttata [common monkey flower]
ref|XP_006419726.1|  hypothetical protein CICLE_v10004839mg             320   3e-103   
ref|XP_008438774.1|  PREDICTED: sugar transporter ERD6-like 16 is...    323   3e-103   Cucumis melo [Oriental melon]
ref|XP_004508324.1|  PREDICTED: sugar transporter ERD6-like 16-like     323   3e-103   Cicer arietinum [garbanzo]
ref|XP_008438773.1|  PREDICTED: sugar transporter ERD6-like 16 is...    323   6e-103   Cucumis melo [Oriental melon]
ref|XP_010279404.1|  PREDICTED: sugar transporter ERD6-like 16 is...    320   3e-102   
ref|XP_008388978.1|  PREDICTED: sugar transporter ERD6-like 5           315   5e-102   
ref|XP_010043109.1|  PREDICTED: sugar transporter ERD6-like 5           320   7e-102   Eucalyptus grandis [rose gum]
ref|XP_008809152.1|  PREDICTED: sugar transporter ERD6-like 16          317   7e-102   
ref|XP_009782756.1|  PREDICTED: sugar transporter ERD6-like 5           317   1e-101   Nicotiana sylvestris
ref|XP_006419729.1|  hypothetical protein CICLE_v10004839mg             319   1e-101   Citrus clementina [clementine]
emb|CDO98940.1|  unnamed protein product                                319   1e-101   Coffea canephora [robusta coffee]
dbj|BAH01094.1|  unnamed protein product                                318   1e-101   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011651014.1|  PREDICTED: sugar transporter ERD6-like 16 is...    317   2e-101   Cucumis sativus [cucumbers]
gb|KHG12382.1|  hypothetical protein F383_10647                         319   2e-101   Gossypium arboreum [tree cotton]
ref|XP_009419855.1|  PREDICTED: sugar transporter ERD6-like 16 is...    318   2e-101   
ref|XP_003575758.2|  PREDICTED: sugar transporter ERD6-like 16          317   2e-101   
ref|XP_009419854.1|  PREDICTED: sugar transporter ERD6-like 16 is...    318   3e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007030780.1|  Major facilitator superfamily protein              318   4e-101   
ref|XP_004134178.1|  PREDICTED: sugar transporter ERD6-like 16 is...    317   5e-101   Cucumis sativus [cucumbers]
gb|KJB45167.1|  hypothetical protein B456_007G293200                    317   1e-100   Gossypium raimondii
ref|XP_008458507.1|  PREDICTED: sugar transporter ERD6-like 16          317   2e-100   Cucumis melo [Oriental melon]
ref|XP_008223079.1|  PREDICTED: sugar transporter ERD6-like 16          316   2e-100   
ref|XP_002512320.1|  sugar transporter, putative                        315   2e-100   
ref|XP_008359875.1|  PREDICTED: sugar transporter ERD6-like 5           315   4e-100   
ref|XP_009414205.1|  PREDICTED: sugar transporter ERD6-like 16          315   5e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009620983.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    311   7e-100   Nicotiana tomentosiformis
ref|XP_010649814.1|  PREDICTED: sugar transporter ERD6-like 16 is...    314   7e-100   
ref|XP_007205125.1|  hypothetical protein PRUPE_ppa004943mg             315   8e-100   
emb|CBI34326.3|  unnamed protein product                                325   9e-100   Vitis vinifera
ref|XP_003547222.2|  PREDICTED: sugar transporter ERD6-like 16-like     314   1e-99    Glycine max [soybeans]
ref|XP_007226898.1|  hypothetical protein PRUPE_ppa016361mg             315   1e-99    
ref|XP_008246533.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    314   1e-99    Prunus mume [ume]
ref|XP_006663074.1|  PREDICTED: sugar transporter ERD6-like 16-like     313   2e-99    Oryza brachyantha
ref|XP_002319570.2|  sugar transporter family protein                   313   2e-99    
ref|XP_008246532.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    314   2e-99    Prunus mume [ume]
ref|XP_011466327.1|  PREDICTED: sugar transporter ERD6-like 5           314   2e-99    Fragaria vesca subsp. vesca
ref|XP_002315546.2|  hypothetical protein POPTR_0010s02740g             313   2e-99    
ref|XP_010107671.1|  Sugar transporter ERD6-like 7                      309   2e-99    
ref|XP_010941736.1|  PREDICTED: sugar transporter ERD6-like 16          312   5e-99    Elaeis guineensis
ref|XP_002457558.1|  hypothetical protein SORBIDRAFT_03g009310          309   5e-99    
ref|XP_009620982.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    312   6e-99    Nicotiana tomentosiformis
ref|XP_002512323.1|  sugar transporter, putative                        312   7e-99    Ricinus communis
ref|XP_004153836.1|  PREDICTED: sugar transporter ERD6-like 16          312   1e-98    Cucumis sativus [cucumbers]
ref|XP_011011018.1|  PREDICTED: sugar transporter ERD6-like 16          311   1e-98    Populus euphratica
ref|XP_011023522.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    311   2e-98    Populus euphratica
ref|XP_007147846.1|  hypothetical protein PHAVU_006G159600g             312   2e-98    Phaseolus vulgaris [French bean]
ref|XP_012069445.1|  PREDICTED: sugar transporter ERD6-like 16 is...    308   4e-98    Jatropha curcas
gb|KCW85184.1|  hypothetical protein EUGRSUZ_B02014                     311   4e-98    Eucalyptus grandis [rose gum]
gb|KDO44993.1|  hypothetical protein CISIN_1g011956mg                   307   6e-98    Citrus sinensis [apfelsine]
ref|XP_006361887.1|  PREDICTED: sugar transporter ERD6-like 5-like      308   1e-97    Solanum tuberosum [potatoes]
ref|XP_004967879.1|  PREDICTED: sugar transporter ERD6-like 5-like      309   1e-97    Setaria italica
ref|XP_006433198.1|  hypothetical protein CICLE_v10001032mg             308   2e-97    Citrus clementina [clementine]
gb|KHN33102.1|  Sugar transporter ERD6-like 16                          308   2e-97    Glycine soja [wild soybean]
ref|XP_004230159.2|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    308   2e-97    
gb|KDO44992.1|  hypothetical protein CISIN_1g011956mg                   308   2e-97    Citrus sinensis [apfelsine]
ref|XP_011659911.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    303   2e-97    Cucumis sativus [cucumbers]
ref|XP_011090878.1|  PREDICTED: sugar transporter ERD6-like 16 is...    308   3e-97    Sesamum indicum [beniseed]
ref|XP_010912097.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    308   3e-97    Elaeis guineensis
ref|XP_003541649.1|  PREDICTED: sugar transporter ERD6-like 16-like     308   3e-97    Glycine max [soybeans]
ref|NP_001146190.1|  uncharacterized protein LOC100279760               308   4e-97    Zea mays [maize]
ref|XP_008366851.1|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    308   4e-97    
ref|XP_011623902.1|  PREDICTED: sugar transporter ERD6-like 7           307   5e-97    Amborella trichopoda
ref|XP_012069444.1|  PREDICTED: sugar transporter ERD6-like 16 is...    308   5e-97    Jatropha curcas
gb|ERN07483.1|  hypothetical protein AMTR_s00019p00256320               307   7e-97    Amborella trichopoda
ref|XP_010528859.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    306   8e-97    Tarenaya hassleriana [spider flower]
ref|XP_006594464.1|  PREDICTED: sugar transporter ERD6-like 16-li...    306   8e-97    
ref|XP_003580968.1|  PREDICTED: sugar transporter ERD6-like 5           306   9e-97    Brachypodium distachyon [annual false brome]
ref|XP_007030767.1|  Sugar transporter, putative                        306   9e-97    
gb|KEH36721.1|  sugar porter (SP) family MFS transporter                304   1e-96    Medicago truncatula
ref|XP_010674993.1|  PREDICTED: sugar transporter ERD6-like 5           306   1e-96    
ref|XP_003541648.2|  PREDICTED: sugar transporter ERD6-like 16-li...    307   1e-96    Glycine max [soybeans]
ref|XP_011659910.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    302   2e-96    Cucumis sativus [cucumbers]
gb|KFK35614.1|  hypothetical protein AALP_AA4G014000                    305   2e-96    Arabis alpina [alpine rockcress]
ref|XP_007050737.1|  Major facilitator superfamily protein              306   2e-96    
gb|KDP40049.1|  hypothetical protein JCGZ_02047                         306   3e-96    Jatropha curcas
ref|XP_004486078.1|  PREDICTED: sugar transporter ERD6-like 16-like     305   3e-96    Cicer arietinum [garbanzo]
ref|XP_006594463.1|  PREDICTED: sugar transporter ERD6-like 16-li...    307   4e-96    Glycine max [soybeans]
ref|XP_012089129.1|  PREDICTED: sugar transporter ERD6-like 5           305   4e-96    
ref|XP_010242567.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    302   5e-96    
ref|XP_006594462.1|  PREDICTED: sugar transporter ERD6-like 16-li...    307   5e-96    
ref|XP_004135636.2|  PREDICTED: sugar transporter ERD6-like 5 iso...    302   5e-96    Cucumis sativus [cucumbers]
gb|ERN07486.1|  hypothetical protein AMTR_s00019p00256520               300   7e-96    Amborella trichopoda
emb|CDX92578.1|  BnaA10g16170D                                          304   9e-96    
ref|XP_009591842.1|  PREDICTED: sugar transporter ERD6-like 8           296   1e-95    Nicotiana tomentosiformis
gb|EMT03312.1|  Sugar transporter ERD6-like protein 5                   305   1e-95    
gb|ABA95042.1|  Sugar transporter family protein, expressed             301   1e-95    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008450692.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    300   2e-95    Cucumis melo [Oriental melon]
ref|XP_003594043.1|  Sugar transporter ERD6-like protein                303   2e-95    Medicago truncatula
gb|AAM64736.1|  sugar transporter-like protein                          303   2e-95    Arabidopsis thaliana [mouse-ear cress]
ref|NP_568367.1|  sugar transporter ERD6-like 16                        303   2e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009120937.1|  PREDICTED: sugar transporter ERD6-like 16          303   2e-95    Brassica rapa
ref|XP_010511207.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    300   3e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010546910.1|  PREDICTED: sugar transporter ERD6-like 16          303   3e-95    Tarenaya hassleriana [spider flower]
ref|XP_010470369.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    302   4e-95    Camelina sativa [gold-of-pleasure]
ref|XP_008795118.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    298   4e-95    
gb|ABN09011.1|  General substrate transporter; Sugar transporter ...    302   4e-95    Medicago truncatula
gb|KFK26120.1|  hypothetical protein AALP_AA8G206400                    302   4e-95    Arabis alpina [alpine rockcress]
ref|XP_006845806.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    302   6e-95    Amborella trichopoda
ref|XP_011087867.1|  PREDICTED: sugar transporter ERD6-like 5           301   7e-95    Sesamum indicum [beniseed]
gb|KGN66112.1|  hypothetical protein Csa_1G571840                       303   7e-95    Cucumis sativus [cucumbers]
ref|XP_009417911.1|  PREDICTED: sugar transporter ERD6-like 5           301   8e-95    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010492922.1|  PREDICTED: sugar transporter ERD6-like 16          301   9e-95    Camelina sativa [gold-of-pleasure]
ref|XP_008795117.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    298   9e-95    
ref|XP_007147087.1|  hypothetical protein PHAVU_006G095200g             301   9e-95    Phaseolus vulgaris [French bean]
ref|XP_008450689.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    301   1e-94    
ref|XP_008450688.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    301   1e-94    
ref|XP_008795116.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    297   2e-94    
dbj|BAJ93725.1|  predicted protein                                      300   2e-94    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006845811.2|  PREDICTED: sugar transporter ERD6-like 16          301   2e-94    Amborella trichopoda
ref|XP_010511205.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    300   2e-94    Camelina sativa [gold-of-pleasure]
ref|XP_002894602.1|  hypothetical protein ARALYDRAFT_474748             300   3e-94    Arabidopsis lyrata subsp. lyrata
ref|XP_008795119.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    297   3e-94    
ref|XP_006287631.1|  hypothetical protein CARUB_v10000842mg             300   4e-94    Capsella rubella
ref|XP_010660046.1|  PREDICTED: sugar transporter ERD6-like 8 iso...    298   5e-94    
ref|XP_008795114.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    297   5e-94    
gb|EMS53450.1|  Sugar transporter ERD6-like 16                          298   6e-94    Triticum urartu
ref|XP_004494647.1|  PREDICTED: sugar transporter ERD6-like 5-like      300   6e-94    Cicer arietinum [garbanzo]
ref|XP_010660044.1|  PREDICTED: sugar transporter ERD6-like 8 iso...    299   7e-94    
ref|NP_187166.2|  sugar transporter ERD6-like 8                         298   8e-94    Arabidopsis thaliana [mouse-ear cress]
gb|AAF27021.1|AC009177_11  putative sugar transporter                   298   9e-94    Arabidopsis thaliana [mouse-ear cress]
gb|EYU27040.1|  hypothetical protein MIMGU_mgv1a022081mg                293   1e-93    Erythranthe guttata [common monkey flower]
gb|KHN43250.1|  Sugar transporter ERD6-like 5                           297   1e-93    Glycine soja [wild soybean]
ref|XP_008672347.1|  PREDICTED: hypothetical protein isoform X2         298   1e-93    
ref|XP_010660042.1|  PREDICTED: sugar transporter ERD6-like 8 iso...    298   2e-93    
ref|XP_002882396.1|  sugar transporter family protein                   298   2e-93    
ref|XP_006577261.1|  PREDICTED: sugar transporter ERD6-like 5-lik...    298   2e-93    Glycine max [soybeans]
gb|KCW85182.1|  hypothetical protein EUGRSUZ_B02013                     294   2e-93    Eucalyptus grandis [rose gum]
ref|XP_002263418.1|  PREDICTED: sugar transporter ERD6-like 5           298   3e-93    
gb|ACN26851.1|  unknown                                                 298   3e-93    Zea mays [maize]
ref|XP_003521722.1|  PREDICTED: sugar transporter ERD6-like 5-lik...    298   3e-93    Glycine max [soybeans]
ref|XP_010420663.1|  PREDICTED: sugar transporter ERD6-like 16 is...    298   3e-93    Camelina sativa [gold-of-pleasure]
ref|XP_008672346.1|  PREDICTED: hypothetical protein isoform X1         298   3e-93    Zea mays [maize]
ref|XP_010420662.1|  PREDICTED: sugar transporter ERD6-like 16 is...    298   3e-93    Camelina sativa [gold-of-pleasure]
ref|XP_002871845.1|  hypothetical protein ARALYDRAFT_488771             297   4e-93    
ref|XP_006301882.1|  hypothetical protein CARUB_v10022354mg             296   4e-93    Capsella rubella
ref|XP_006299027.1|  hypothetical protein CARUB_v10015164mg             297   4e-93    Capsella rubella
emb|CBI34338.3|  unnamed protein product                                298   4e-93    Vitis vinifera
ref|XP_010242560.1|  PREDICTED: sugar transporter ERD6-like 8 iso...    296   6e-93    Nelumbo nucifera [Indian lotus]
ref|NP_850964.1|  sugar transporter ERD6-like 5                         296   7e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003553740.2|  PREDICTED: sugar transporter ERD6-like 5-like      297   9e-93    
ref|XP_012089452.1|  PREDICTED: sugar transporter ERD6-like 5           295   1e-92    
ref|XP_010666329.1|  PREDICTED: sugar transporter ERD6-like 16          296   1e-92    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010454136.1|  PREDICTED: sugar transporter ERD6-like 16 is...    296   2e-92    
ref|XP_003520821.1|  PREDICTED: sugar transporter ERD6-like 5-like      296   2e-92    Glycine max [soybeans]
ref|XP_008450691.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    295   2e-92    
gb|KGN66110.1|  hypothetical protein Csa_1G571820                       294   2e-92    Cucumis sativus [cucumbers]
ref|XP_010043108.1|  PREDICTED: sugar transporter ERD6-like 5           295   3e-92    Eucalyptus grandis [rose gum]
ref|XP_010912098.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    295   3e-92    
ref|XP_006400440.1|  hypothetical protein EUTSA_v10013389mg             295   4e-92    Eutrema salsugineum [saltwater cress]
emb|CBI34327.3|  unnamed protein product                                298   4e-92    Vitis vinifera
ref|XP_009373955.1|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    295   5e-92    Pyrus x bretschneideri [bai li]
emb|CDY43482.1|  BnaA01g21370D                                          293   6e-92    Brassica napus [oilseed rape]
ref|XP_009758159.1|  PREDICTED: sugar transporter ERD6-like 8           286   6e-92    Nicotiana sylvestris
ref|XP_006651405.1|  PREDICTED: sugar transporter ERD6-like 16-like     292   8e-92    
ref|XP_010423926.1|  PREDICTED: sugar transporter ERD6-like 8 iso...    290   8e-92    
ref|XP_007147091.1|  hypothetical protein PHAVU_006G095600g             294   9e-92    Phaseolus vulgaris [French bean]
ref|XP_010660066.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    291   1e-91    Vitis vinifera
ref|XP_007030775.1|  Major facilitator superfamily protein, putative    289   1e-91    
ref|XP_010464026.1|  PREDICTED: sugar transporter ERD6-like 8           293   1e-91    Camelina sativa [gold-of-pleasure]
ref|XP_008674200.1|  PREDICTED: LOC100281158 isoform X1                 291   3e-91    
ref|XP_010546662.1|  PREDICTED: sugar transporter ERD6-like 8           292   3e-91    Tarenaya hassleriana [spider flower]
ref|XP_003626332.1|  Sugar transporter ERD6-like protein                293   3e-91    Medicago truncatula
ref|XP_009124970.1|  PREDICTED: sugar transporter ERD6-like 8           291   5e-91    
emb|CDY30026.1|  BnaC01g39820D                                          291   5e-91    
gb|KDP23565.1|  hypothetical protein JCGZ_23398                         289   5e-91    
ref|XP_009119491.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    291   5e-91    
ref|XP_003626331.1|  Sugar transporter ERD6, putative                   292   6e-91    
gb|KHG12383.1|  hypothetical protein F383_10647                         291   8e-91    
emb|CDP17977.1|  unnamed protein product                                291   9e-91    
ref|XP_010485917.1|  PREDICTED: sugar transporter ERD6-like 8           290   1e-90    
ref|XP_010660065.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    290   2e-90    
ref|XP_010660063.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    290   2e-90    
ref|XP_010660064.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    290   2e-90    
gb|ADP37168.1|  putative ERD6-like transporter                          290   3e-90    
gb|EAZ27016.1|  hypothetical protein OsJ_10945                          289   3e-90    
ref|XP_006471873.1|  PREDICTED: sugar transporter ERD6-like 5-lik...    289   4e-90    
gb|KDO44991.1|  hypothetical protein CISIN_1g011956mg                   289   4e-90    
ref|XP_010660061.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    290   4e-90    
ref|XP_010660062.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    290   4e-90    
gb|KCW85187.1|  hypothetical protein EUGRSUZ_B02017                     287   5e-90    
emb|CBI34328.3|  unnamed protein product                                290   5e-90    
gb|EEE59094.1|  hypothetical protein OsJ_10944                          287   5e-90    
ref|XP_010025135.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    287   5e-90    
ref|NP_001147549.1|  LOC100281158                                       290   5e-90    
ref|XP_006651406.1|  PREDICTED: sugar transporter ERD6-like 16-like     288   6e-90    
ref|NP_001050166.1|  Os03g0363600                                       290   9e-90    
ref|XP_012089453.1|  PREDICTED: sugar transporter ERD6-like 8           288   1e-89    
gb|ADE75821.1|  unknown                                                 289   1e-89    
ref|XP_008681387.1|  PREDICTED: hypothetical protein isoform X1         289   2e-89    
gb|KJB28575.1|  hypothetical protein B456_005G056400                    286   2e-89    
ref|XP_010660043.1|  PREDICTED: sugar transporter ERD6-like 8 iso...    288   2e-89    
ref|XP_004984297.1|  PREDICTED: sugar transporter ERD6-like 16-like     289   3e-89    
gb|EEC75308.1|  hypothetical protein OsI_11676                          288   3e-89    
ref|XP_010660072.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    284   4e-89    
ref|XP_010043118.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    286   4e-89    
ref|XP_010025134.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    287   4e-89    
gb|ADW40547.1|  vacuolar monosaccharide symporter 1                     287   5e-89    
ref|XP_008438775.1|  PREDICTED: sugar transporter ERD6-like 16 is...    285   1e-88    
ref|XP_004984296.1|  PREDICTED: sugar transporter ERD6-like 16-like     286   1e-88    
ref|NP_001050165.1|  Os03g0363500                                       287   1e-88    
ref|XP_010660071.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    285   3e-88    
ref|XP_010511206.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    284   3e-88    
gb|AHG94614.1|  sugar transporter ERD6-like protein                     284   4e-88    
ref|XP_003557831.1|  PREDICTED: sugar transporter ERD6-like 16          285   4e-88    
ref|XP_012085835.1|  PREDICTED: sugar transporter ERD6-like 16          283   4e-88    
ref|XP_010660053.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    283   8e-88    
ref|XP_010660049.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    283   8e-88    
emb|CBI34335.3|  unnamed protein product                                283   8e-88    
ref|XP_010660048.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    283   1e-87    
ref|XP_002512321.1|  sugar transporter, putative                        283   1e-87    
ref|XP_011648536.1|  PREDICTED: sugar transporter ERD6-like 5           281   1e-87    
gb|KCW76703.1|  hypothetical protein EUGRSUZ_D01063                     280   2e-87    
gb|KDP26380.1|  hypothetical protein JCGZ_17538                         283   2e-87    
ref|XP_004248997.1|  PREDICTED: sugar transporter ERD6-like 8           283   3e-87    
ref|XP_002516838.1|  sugar transporter, putative                        282   9e-87    
ref|XP_010228593.1|  PREDICTED: sugar transporter ERD6-like 16 is...    281   2e-86    
ref|XP_010649826.1|  PREDICTED: sugar transporter ERD6-like 16 is...    277   2e-86    
ref|XP_002512324.1|  sugar transporter, putative                        279   3e-86    
ref|XP_007030778.1|  Major facilitator superfamily protein, putative    279   3e-86    
ref|XP_010052629.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    280   4e-86    
gb|KHN37528.1|  Sugar transporter ERD6-like 16                          278   5e-86    
gb|ADP37160.1|  putative ERD6-like transporter                          278   5e-86    
gb|ADP37159.1|  putative ERD6-like transporter                          278   6e-86    
ref|XP_010052628.1|  PREDICTED: sugar transporter ERD6-like 5           278   6e-86    
ref|XP_006838267.2|  PREDICTED: sugar transporter ERD6-like 5           277   7e-86    
gb|AFK48468.1|  unknown                                                 268   1e-85    
ref|XP_010649828.1|  PREDICTED: sugar transporter ERD6-like 16 is...    275   2e-85    
gb|ERN00836.1|  hypothetical protein AMTR_s00103p00071860               277   2e-85    
gb|KJB72535.1|  hypothetical protein B456_011G183500                    276   2e-85    
ref|XP_010649823.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    277   3e-85    
gb|ABK25410.1|  unknown                                                 274   3e-85    
gb|EPS63288.1|  hypothetical protein M569_11497                         270   4e-85    
ref|XP_010052627.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    275   5e-85    
ref|XP_010043129.1|  PREDICTED: sugar transporter ERD6-like 5           276   6e-85    
gb|KCW85189.1|  hypothetical protein EUGRSUZ_B020192                    271   1e-84    
gb|ADP37161.1|  putative ERD6-like transporter                          276   1e-84    
ref|XP_010660054.1|  PREDICTED: sugar transporter ERD6-like 5           275   1e-84    
ref|XP_011651013.1|  PREDICTED: sugar transporter ERD6-like 16 is...    274   1e-84    
ref|XP_010052626.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    275   2e-84    
ref|XP_012089135.1|  PREDICTED: sugar transporter ERD6-like 5           275   2e-84    
ref|XP_002278654.3|  PREDICTED: sugar transporter ERD6-like 7 iso...    275   2e-84    
ref|XP_006471902.1|  PREDICTED: sugar transporter ERD6-like 5-like      272   3e-84    
ref|XP_010052632.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    274   3e-84    
ref|XP_010242561.1|  PREDICTED: sugar transporter ERD6-like 8 iso...    273   3e-84    
gb|KCW85193.1|  hypothetical protein EUGRSUZ_B02020                     271   7e-84    
gb|EEC80176.1|  hypothetical protein OsI_22030                          271   7e-84    
ref|XP_011466331.1|  PREDICTED: sugar transporter ERD6-like 3           273   9e-84    
ref|NP_001159247.1|  hypothetical protein                               270   2e-83    
ref|XP_009119480.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    272   3e-83    
ref|XP_010046270.1|  PREDICTED: sugar transporter ERD6-like 5           271   3e-83    
ref|XP_010470371.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    270   5e-83    
ref|XP_010043113.1|  PREDICTED: sugar transporter ERD6-like 10 is...    270   6e-83    
ref|XP_010043116.1|  PREDICTED: sugar transporter ERD6-like 10          271   6e-83    
ref|XP_010043112.1|  PREDICTED: sugar transporter ERD6-like 10 is...    270   6e-83    
ref|XP_008350755.1|  PREDICTED: sugar transporter ERD6-like 5           270   9e-83    
ref|XP_010043110.1|  PREDICTED: sugar transporter ERD6-like 10 is...    271   1e-82    
ref|XP_010043111.1|  PREDICTED: sugar transporter ERD6-like 10 is...    270   1e-82    
gb|KHG08578.1|  hypothetical protein F383_35417                         268   1e-82    
emb|CDP17979.1|  unnamed protein product                                268   2e-82    
tpg|DAA45486.1|  TPA: solute carrier family 2, facilitated glucos...    270   2e-82    
ref|XP_012089133.1|  PREDICTED: sugar transporter ERD6-like 5           269   2e-82    
ref|XP_010043119.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    267   2e-82    
gb|KDP23563.1|  hypothetical protein JCGZ_23396                         269   2e-82    
gb|KGN46180.1|  hypothetical protein Csa_6G067380                       268   3e-82    
ref|XP_011466344.1|  PREDICTED: sugar transporter ERD6-like 3 iso...    266   3e-82    
gb|KJB45165.1|  hypothetical protein B456_007G293100                    269   5e-82    
ref|XP_010043135.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    266   6e-82    
ref|XP_010043117.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    268   1e-81    
ref|XP_006433212.1|  hypothetical protein CICLE_v10003870mg             266   1e-81    
ref|XP_006471861.1|  PREDICTED: sugar transporter ERD6-like 5-like      264   2e-81    
emb|CDP17983.1|  unnamed protein product                                266   2e-81    
ref|XP_011466342.1|  PREDICTED: sugar transporter ERD6-like 3 iso...    266   2e-81    
ref|XP_011466343.1|  PREDICTED: sugar transporter ERD6-like 3 iso...    266   3e-81    
ref|XP_011466341.1|  PREDICTED: sugar transporter ERD6-like 3 iso...    266   3e-81    
ref|XP_006375783.1|  hypothetical protein POPTR_0013s02850g             265   5e-81    
ref|XP_010043133.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    266   6e-81    
ref|XP_002465229.1|  hypothetical protein SORBIDRAFT_01g034610          265   8e-81    
ref|XP_010043127.1|  PREDICTED: sugar transporter ERD6-like 10 is...    263   9e-81    
ref|XP_010043125.1|  PREDICTED: sugar transporter ERD6-like 10 is...    263   1e-80    
ref|XP_007147088.1|  hypothetical protein PHAVU_006G095300g             265   1e-80    
ref|XP_011623901.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    264   3e-80    
ref|XP_011468422.1|  PREDICTED: sugar transporter ERD6-like 3           261   3e-80    
ref|XP_010043124.1|  PREDICTED: sugar transporter ERD6-like 10 is...    264   3e-80    
ref|XP_010684721.1|  PREDICTED: sugar transporter ERD6-like 16 is...    263   4e-80    
ref|XP_010043123.1|  PREDICTED: sugar transporter ERD6-like 10 is...    263   6e-80    
ref|XP_010043132.1|  PREDICTED: sugar transporter ERD6-like 5           263   7e-80    
emb|CDP17980.1|  unnamed protein product                                262   7e-80    
ref|XP_010043122.1|  PREDICTED: sugar transporter ERD6-like 10 is...    263   9e-80    
ref|XP_010043121.1|  PREDICTED: sugar transporter ERD6-like 10 is...    263   1e-79    
ref|XP_010554959.1|  PREDICTED: sugar transporter ERD6-like 17          261   1e-79    
gb|KCW61732.1|  hypothetical protein EUGRSUZ_H044401                    258   2e-79    
ref|XP_008366941.1|  PREDICTED: sugar transporter ERD6-like 5           258   3e-79    
emb|CBI26146.3|  unnamed protein product                                262   3e-79    
ref|XP_010674995.1|  PREDICTED: sugar transporter ERD6-like 5           261   3e-79    
ref|XP_010026252.1|  PREDICTED: sugar transporter ERD6-like 7           251   3e-79    
ref|XP_010660057.1|  PREDICTED: sugar transporter ERD6-like 10 is...    261   4e-79    
gb|ADP37162.1|  putative ERD6-like transporter                          261   5e-79    
ref|XP_010660055.1|  PREDICTED: sugar transporter ERD6-like 10 is...    261   1e-78    
ref|XP_010111870.1|  Sugar transporter ERD6-like 5                      259   1e-78    
ref|XP_010507819.1|  PREDICTED: sugar transporter ERD6-like 7           249   1e-78    
ref|XP_010027219.1|  PREDICTED: sugar transporter ERD6-like 5           258   2e-78    
ref|XP_011048905.1|  PREDICTED: sugar transporter ERD6-like 5           258   4e-78    
ref|XP_012089451.1|  PREDICTED: uncharacterized protein LOC105647834    268   5e-78    
ref|XP_010660059.1|  PREDICTED: sugar transporter ERD6-like 3 iso...    258   7e-78    
ref|XP_010660058.1|  PREDICTED: sugar transporter ERD6-like 3 iso...    258   7e-78    
emb|CBI34330.3|  unnamed protein product                                258   8e-78    
gb|EMT05561.1|  Sugar transporter ERD6-like 16                          257   1e-77    
ref|XP_009119503.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    256   1e-77    
ref|XP_010468017.1|  PREDICTED: sugar transporter ERD6-like 10          253   2e-77    
ref|XP_011466330.1|  PREDICTED: sugar transporter ERD6-like 3           257   2e-77    
ref|XP_008388982.1|  PREDICTED: LOW QUALITY PROTEIN: sugar transp...    256   2e-77    
ref|XP_010105671.1|  Sugar transporter ERD6-like 16                     255   2e-77    
ref|XP_010528843.1|  PREDICTED: sugar transporter ERD6-like 3           256   2e-77    
tpg|DAA53930.1|  TPA: hypothetical protein ZEAMMB73_856317              248   2e-77    
gb|ADP37175.1|  putative ERD6-like transporter                          250   2e-77    
ref|XP_010046269.1|  PREDICTED: sugar transporter ERD6-like 5           256   3e-77    
emb|CAN63855.1|  hypothetical protein VITISV_008852                     258   3e-77    
ref|XP_010528848.1|  PREDICTED: sugar transporter ERD6-like 3 iso...    254   4e-77    
gb|KDO42695.1|  hypothetical protein CISIN_1g019756mg                   251   7e-77    
ref|XP_006382655.1|  sugar transporter family protein                   254   1e-76    
ref|XP_010528847.1|  PREDICTED: sugar transporter ERD6-like 3 iso...    254   1e-76    
ref|XP_006433218.1|  hypothetical protein CICLE_v10003224mg             252   1e-76    
ref|NP_001078111.1|  sugar transporter ERD6-like 10                     252   2e-76    
ref|XP_010528850.1|  PREDICTED: sugar transporter ERD6-like 3 iso...    253   2e-76    
ref|XP_010528849.1|  PREDICTED: sugar transporter ERD6-like 3 iso...    254   2e-76    
ref|XP_010025137.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    253   2e-76    
ref|XP_010550074.1|  PREDICTED: sugar transporter ERD6-like 3           254   2e-76    
ref|XP_010660069.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    253   3e-76    
emb|CDY06338.1|  BnaA09g48650D                                          248   3e-76    
gb|KCW58943.1|  hypothetical protein EUGRSUZ_H01565                     251   3e-76    
ref|XP_009373999.1|  PREDICTED: sugar transporter ERD6-like 5           253   3e-76    
ref|XP_010550039.1|  PREDICTED: sugar transporter ERD6-like 3           253   4e-76    
ref|XP_011466340.1|  PREDICTED: sugar transporter ERD6-like 3 iso...    250   6e-76    
ref|XP_003633684.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    253   6e-76    
gb|AAK82470.1|  AT3g05160/T12H1_13                                      246   7e-76    
ref|NP_566247.1|  sugar transporter ERD6-like 10                        252   8e-76    
ref|XP_011466333.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    255   8e-76    
ref|XP_010528845.1|  PREDICTED: sugar transporter ERD6-like 17 is...    251   8e-76    
gb|EMT14656.1|  Sugar transporter ERD6-like protein 7                   248   1e-75    
ref|XP_010528844.1|  PREDICTED: sugar transporter ERD6-like 17 is...    251   2e-75    
ref|XP_011048904.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    249   2e-75    
ref|XP_010052630.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    251   2e-75    
ref|XP_011048902.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    251   3e-75    
ref|XP_011048903.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    250   4e-75    
ref|XP_011466336.1|  PREDICTED: sugar transporter ERD6-like 3 iso...    250   5e-75    
ref|XP_011466338.1|  PREDICTED: sugar transporter ERD6-like 3 iso...    249   6e-75    
ref|XP_011466332.1|  PREDICTED: sugar transporter ERD6-like 17 is...    255   7e-75    
ref|XP_010674987.1|  PREDICTED: sugar transporter ERD6-like 5           249   7e-75    
emb|CBI34337.3|  unnamed protein product                                248   7e-75    
ref|XP_011048900.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    249   8e-75    
ref|XP_011048901.1|  PREDICTED: sugar transporter ERD6-like 5 iso...    249   9e-75    
ref|XP_010684722.1|  PREDICTED: sugar transporter ERD6-like 7 iso...    249   1e-74    
ref|XP_008388981.1|  PREDICTED: sugar transporter ERD6-like 17          249   1e-74    
emb|CDY12421.1|  BnaC08g09100D                                          244   2e-74    
gb|KCW76706.1|  hypothetical protein EUGRSUZ_D01065                     248   2e-74    
gb|KJB45159.1|  hypothetical protein B456_007G293000                    248   2e-74    
gb|ADP37158.1|  putative ERD6-like transporter                          248   4e-74    
gb|KCW61729.1|  hypothetical protein EUGRSUZ_H04439                     248   4e-74    
ref|XP_009118335.1|  PREDICTED: sugar transporter ERD6-like 3           247   6e-74    
ref|XP_006345308.1|  PREDICTED: sugar transporter ERD6-like 5-lik...    247   6e-74    
emb|CBI34333.3|  unnamed protein product                                260   1e-73    
emb|CDY17555.1|  BnaC01g26790D                                          245   1e-73    
emb|CDY22657.1|  BnaC08g42910D                                          246   2e-73    
ref|NP_566248.1|  Major facilitator superfamily protein                 246   2e-73    
emb|CDY54651.1|  BnaA05g36160D                                          246   2e-73    
ref|XP_010550028.1|  PREDICTED: sugar transporter ERD6                  247   3e-73    
ref|XP_010111875.1|  Sugar transporter ERD6-like 5                      244   3e-73    
ref|XP_006392490.1|  hypothetical protein EUTSA_v10023420mg             246   4e-73    
ref|XP_008356948.1|  PREDICTED: sugar transporter ERD6-like 5           240   4e-73    
ref|XP_011466345.1|  PREDICTED: sugar transporter ERD6-like 3           242   6e-73    
emb|CDY31121.1|  BnaA08g26710D                                          244   7e-73    
ref|XP_010424290.1|  PREDICTED: sugar transporter ERD6-like 11          244   7e-73    
ref|XP_010464029.1|  PREDICTED: sugar transporter ERD6-like 11          244   1e-72    
ref|XP_010546664.1|  PREDICTED: sugar transporter ERD6-like 18 is...    241   1e-72    
ref|XP_009147270.1|  PREDICTED: sugar transporter ERD6-like 11 is...    243   1e-72    
emb|CDX95022.1|  BnaC05g06490D                                          243   2e-72    
ref|XP_010551192.1|  PREDICTED: sugar transporter ERD6-like 3           243   2e-72    
gb|EMT10929.1|  Sugar transporter ERD6-like protein 16                  243   2e-72    
emb|CBI34329.3|  unnamed protein product                                238   2e-72    
ref|XP_009147269.1|  PREDICTED: sugar transporter ERD6-like 11 is...    243   2e-72    
emb|CDY27790.1|  BnaA05g31990D                                          243   2e-72    
ref|XP_010485923.1|  PREDICTED: sugar transporter ERD6-like 11          243   2e-72    
ref|XP_010674986.1|  PREDICTED: sugar transporter ERD6-like 5           243   3e-72    



>ref|XP_009614908.1| PREDICTED: sugar transporter ERD6-like 7 [Nicotiana tomentosiformis]
Length=483

 Score =   426 bits (1095),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 199/255 (78%), Positives = 230/255 (90%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++GH KEFE+AL++LRGK+ADISEEAAEIQDY+E LEKLPK  LFDLFQ+RY  S+ +GV
Sbjct  228  KIGHQKEFELALRRLRGKDADISEEAAEIQDYIETLEKLPKVNLFDLFQRRYLSSLIVGV  287

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFYT SIFES+GFPSD+GTIIYAI+QV +TA+GA LID+AGRKPLL
Sbjct  288  GLMVFQQFGGINGICFYTGSIFESSGFPSDVGTIIYAIIQVPITALGAVLIDRAGRKPLL  347

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+GL +GCILTG S+YLKG  IA   AP+LAVTGI+VYIGSFS+GMGAVPWV+MSEI
Sbjct  348  LVSATGLVIGCILTGTSFYLKGHEIAVKEAPILAVTGILVYIGSFSIGMGAVPWVVMSEI  407

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            +PIN+KG AGS ATLVNWFGAW CSYTFNFLM WNSFGTFILYA +N L+ILFVIK+VPE
Sbjct  408  YPINIKGAAGSLATLVNWFGAWACSYTFNFLMTWNSFGTFILYAAVNALSILFVIKIVPE  467

Query  263  TKGRTLEQIQATINA  219
            TKGRTLEQIQA+INA
Sbjct  468  TKGRTLEQIQASINA  482



>dbj|BAO96226.1| sugar-porter family protein 7, partial [Solanum lycopersicum]
Length=468

 Score =   425 bits (1093),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 198/255 (78%), Positives = 230/255 (90%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++GH KEFE+AL+KLRGK+ADISEEAAEI+DY+E LEKLPK  LFDLFQ+RYS S+ +GV
Sbjct  213  KIGHQKEFELALRKLRGKDADISEEAAEIKDYIETLEKLPKVNLFDLFQRRYSSSLIVGV  272

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFYT SIFES+GFPSDIGTIIYAI+QV +TA+GA LID+ GRKPLL
Sbjct  273  GLMVFQQFGGINGICFYTGSIFESSGFPSDIGTIIYAIIQVPITALGAALIDRTGRKPLL  332

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VS +GL +GCILTG+S+Y+KG  +A  AAP+LAVTGI+VYIGSFSVGMGAVPWV+MSEI
Sbjct  333  LVSGTGLVIGCILTGISFYMKGHEMAIKAAPILAVTGILVYIGSFSVGMGAVPWVVMSEI  392

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            +PIN+KG AGS ATLVNWFGAW CSYTFNFLM WNSFGTF+LYA +N L+ILFVIK+VPE
Sbjct  393  YPINIKGAAGSLATLVNWFGAWACSYTFNFLMTWNSFGTFVLYAAVNALSILFVIKIVPE  452

Query  263  TKGRTLEQIQATINA  219
            TKGRTLEQIQA INA
Sbjct  453  TKGRTLEQIQAAINA  467



>ref|XP_009777420.1| PREDICTED: sugar transporter ERD6-like 7 [Nicotiana sylvestris]
Length=483

 Score =   424 bits (1091),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 198/255 (78%), Positives = 229/255 (90%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++GH KEFE+AL++LRGK+ADISEEAAEIQDY+E LEKLPK  LFDLFQ+RY  S+ +GV
Sbjct  228  KIGHQKEFELALRRLRGKDADISEEAAEIQDYIETLEKLPKVNLFDLFQRRYLSSLIVGV  287

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFYT SIFES+GFPSD+GTIIYAI+QV +TA+GA LID+AGRKPLL
Sbjct  288  GLMVFQQFGGINGICFYTGSIFESSGFPSDVGTIIYAIIQVPITALGAVLIDRAGRKPLL  347

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+GL +GCILTG S+YLKG  IA    P+LAVTGI+VYIGSFS+GMGAVPWV+MSEI
Sbjct  348  LVSATGLVIGCILTGTSFYLKGHEIAVKGGPILAVTGILVYIGSFSIGMGAVPWVVMSEI  407

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            +PIN+KG AGS ATLVNWFGAW CSYTFNFLM WNSFGTFILYA +N L+ILFVIK+VPE
Sbjct  408  YPINIKGAAGSLATLVNWFGAWACSYTFNFLMTWNSFGTFILYAAVNALSILFVIKIVPE  467

Query  263  TKGRTLEQIQATINA  219
            TKGRTLEQIQA+INA
Sbjct  468  TKGRTLEQIQASINA  482



>ref|XP_006358441.1| PREDICTED: sugar transporter ERD6-like 7-like [Solanum tuberosum]
Length=480

 Score =   423 bits (1088),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 200/255 (78%), Positives = 230/255 (90%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G+ KEFE+AL+KLRGK+ADISEEAAEI+DY+E LEKLPK  LFDLFQ+RYS S+ +GV
Sbjct  225  KIGNQKEFELALRKLRGKDADISEEAAEIKDYIETLEKLPKVNLFDLFQRRYSSSLIVGV  284

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFYT SIFES+GFPSDIGTIIYAI+QV +TA+GA LID+AGRKPLL
Sbjct  285  GLMVFQQFGGINGICFYTGSIFESSGFPSDIGTIIYAIIQVPITALGAALIDRAGRKPLL  344

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VS +GL +GC+LTGVS+YLKG  IA   AP+LAVTGI+VYIGSFSVGMGAVPWV+MSEI
Sbjct  345  LVSGTGLVIGCVLTGVSFYLKGHEIAIKVAPILAVTGILVYIGSFSVGMGAVPWVVMSEI  404

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            +PIN+KG AGS ATLVNWFGAW CSYTFNFLM WNSFGTFILYA +N L+ILFVIK+VPE
Sbjct  405  YPINIKGAAGSLATLVNWFGAWACSYTFNFLMTWNSFGTFILYAAVNALSILFVIKIVPE  464

Query  263  TKGRTLEQIQATINA  219
            TKGRTLEQIQA INA
Sbjct  465  TKGRTLEQIQAAINA  479



>ref|NP_001233882.1| st3 protein [Solanum lycopersicum]
 emb|CAC00697.2| putative sugar transporter [Solanum lycopersicum]
Length=480

 Score =   422 bits (1084),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 197/255 (77%), Positives = 229/255 (90%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++GH KEFE+AL+KLRGK+ADISEEAAEI+DY+E LEKLPK  LFDLFQ+RYS S+ +GV
Sbjct  225  KIGHQKEFELALRKLRGKDADISEEAAEIKDYIETLEKLPKVNLFDLFQRRYSSSLIVGV  284

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFYT SIFES+GF SDIGTIIYAI+QV +TA+GA LID+ GRKPLL
Sbjct  285  GLMVFQQFGGINGICFYTGSIFESSGFSSDIGTIIYAIIQVPITALGAALIDRTGRKPLL  344

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VS +GL +GCILTG+S+Y+KG  +A  AAP+LAVTGI+VYIGSFSVGMGAVPWV+MSEI
Sbjct  345  LVSGTGLVIGCILTGISFYMKGHEMAIKAAPILAVTGILVYIGSFSVGMGAVPWVVMSEI  404

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            +PIN+KG AGS ATLVNWFGAW CSYTFNFLM WNSFGTF+LYA +N L+ILFVIK+VPE
Sbjct  405  YPINIKGAAGSLATLVNWFGAWACSYTFNFLMTWNSFGTFVLYAAVNALSILFVIKIVPE  464

Query  263  TKGRTLEQIQATINA  219
            TKGRTLEQIQA INA
Sbjct  465  TKGRTLEQIQAAINA  479



>gb|EYU43551.1| hypothetical protein MIMGU_mgv1a005532mg [Erythranthe guttata]
Length=480

 Score =   416 bits (1070),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 195/255 (76%), Positives = 225/255 (88%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KEFE +L++LRGKN DIS EAAEIQDY+E LE LPKAK+ DLFQ+RY RS+ IGV
Sbjct  225  KQGKRKEFEASLRRLRGKNCDISVEAAEIQDYIETLESLPKAKVLDLFQRRYLRSVTIGV  284

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+CQQ GGINGICFYTSSIFES+GFP+D+GTIIYAILQV++TA+GATLID+AGRKPLL
Sbjct  285  GLMVCQQFGGINGICFYTSSIFESSGFPADVGTIIYAILQVVITALGATLIDRAGRKPLL  344

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            VVS +GL LGC+LTG S+YLK   +A    P LAVTGI+VYIG+FSVGMGAVPWV+MSEI
Sbjct  345  VVSGAGLVLGCLLTGSSFYLKDQGLASEVTPALAVTGILVYIGAFSVGMGAVPWVVMSEI  404

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAGS ATLVNWFGAW  SYTFNFLM+W+S+GTF+LYA +N LAI+FVIKVVPE
Sbjct  405  FPINIKGVAGSLATLVNWFGAWAVSYTFNFLMSWSSYGTFVLYAAVNALAIVFVIKVVPE  464

Query  263  TKGRTLEQIQATINA  219
            TKGRTLEQIQ  INA
Sbjct  465  TKGRTLEQIQTAINA  479



>gb|AJU57222.1| sugar transporter ERD6-like 7 [Camellia sinensis]
Length=489

 Score =   410 bits (1055),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 193/254 (76%), Positives = 227/254 (89%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  K+FE ALQ+LRGK+ADISEEAAEIQDY+E L++LPKAKL DLFQ+RY RS+FIGV
Sbjct  235  KIGRQKDFEAALQRLRGKDADISEEAAEIQDYIETLQRLPKAKLLDLFQRRYLRSVFIGV  294

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+CQQLGGINGICFY +SIF++AGFPS  GTIIYA +QV +TA+GATLIDKAGRKPLL
Sbjct  295  GLMVCQQLGGINGICFYVASIFDTAGFPSSTGTIIYACIQVPITALGATLIDKAGRKPLL  354

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VS SG+ +GC LT +S+YL+   IA NA+P+LAVTGI+VYIG+FSVGMGAVPWVIMSEI
Sbjct  355  LVSGSGMVIGCALTAISFYLEVHEIAVNASPILAVTGILVYIGAFSVGMGAVPWVIMSEI  414

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPINVKGV GS ATLVNWF AWL SYTFN+LMAW+S+GTFILY  IN+LAILF++ VVPE
Sbjct  415  FPINVKGVGGSLATLVNWFIAWLVSYTFNYLMAWSSYGTFILYGAINLLAILFIVMVVPE  474

Query  263  TKGRTLEQIQATIN  222
            TKGRTLEQ+QA IN
Sbjct  475  TKGRTLEQLQAAIN  488



>ref|XP_011079781.1| PREDICTED: sugar transporter ERD6-like 7 [Sesamum indicum]
Length=485

 Score =   409 bits (1050),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 199/254 (78%), Positives = 228/254 (90%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G+ KEFE +L +LRGKNADIS EAAEIQDY+E LE+LPKA+L DLFQ+RY RS+ IGV
Sbjct  230  KKGNQKEFEASLGRLRGKNADISAEAAEIQDYIETLERLPKARLLDLFQRRYLRSVTIGV  289

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+CQQ GGING+CFYTSSIFES+GFP+DIGTIIYAILQVI+TA+GATLID+AGRKPLL
Sbjct  290  GLMVCQQFGGINGVCFYTSSIFESSGFPADIGTIIYAILQVIITALGATLIDRAGRKPLL  349

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            V+S +GL LGC+LT  S+YLK   +A  A P LAVTGI+VYIG+FS GMGAVPWV+MSEI
Sbjct  350  VISGAGLVLGCLLTASSFYLKEHGLALAAVPALAVTGILVYIGAFSAGMGAVPWVVMSEI  409

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAGSFATLVNWFGAW CSYTFNFLM+W+S+GTFILYA +N LAILFVIKVVPE
Sbjct  410  FPINIKGVAGSFATLVNWFGAWACSYTFNFLMSWSSYGTFILYAAVNALAILFVIKVVPE  469

Query  263  TKGRTLEQIQATIN  222
            TKGRTLEQIQA IN
Sbjct  470  TKGRTLEQIQAAIN  483



>ref|XP_008234933.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
Length=475

 Score =   404 bits (1037),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 189/254 (74%), Positives = 222/254 (87%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KEF+VALQKLRGK+AD+S EA EIQDY+E L++LPKAKL DLFQ+RYSRS+ IGV
Sbjct  221  KKGRHKEFKVALQKLRGKDADVSHEAEEIQDYIETLDRLPKAKLLDLFQRRYSRSVIIGV  280

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+CQQ GGING+CFY S IF+ AGF S IGTI YAILQV+VT +GA ++DKAGRKPL+
Sbjct  281  GLMVCQQFGGINGVCFYVSDIFDQAGFSSSIGTITYAILQVVVTGIGAAVMDKAGRKPLI  340

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSASG+ LGC+LT VS++LK   +A  A P+LAVTGI+VYIGSFS+GMGAVPWV+MSEI
Sbjct  341  LVSASGVVLGCLLTAVSFFLKVHELALTATPILAVTGILVYIGSFSIGMGAVPWVVMSEI  400

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS ATLVNWFGAWLCSYTFN+LM+W+S+GTFILYA IN LAILFVI +VPE
Sbjct  401  FPINIKGQAGSLATLVNWFGAWLCSYTFNYLMSWSSYGTFILYAAINALAILFVILMVPE  460

Query  263  TKGRTLEQIQATIN  222
            TKGRTLEQIQ  IN
Sbjct  461  TKGRTLEQIQGAIN  474



>emb|CDP03586.1| unnamed protein product [Coffea canephora]
Length=439

 Score =   402 bits (1034),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 190/253 (75%), Positives = 220/253 (87%), Gaps = 0/253 (0%)
 Frame = -3

Query  977  GHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGVGL  798
            G  +EFEVALQKLRG  ADISEEA EIQDY+E LE+LPKAK+ DLFQ+RY RS+ IGVGL
Sbjct  185  GRRREFEVALQKLRGSKADISEEAVEIQDYIETLERLPKAKIVDLFQRRYLRSVTIGVGL  244

Query  797  MICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLLVV  618
            M+ QQLGGING+CFYTSSIFE+AGF  D+GTI YAILQV++T +GATL+D+AGRKPLL+V
Sbjct  245  MVVQQLGGINGVCFYTSSIFETAGFNPDVGTITYAILQVVITGLGATLVDRAGRKPLLLV  304

Query  617  SASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFP  438
            S +GL +GC+LTG+S+YLK   +A    PVLAVTG++VYIGSFS GMGAVPWV+MSEIFP
Sbjct  305  SGAGLVIGCLLTGISFYLKVHELALKTVPVLAVTGVLVYIGSFSAGMGAVPWVVMSEIFP  364

Query  437  INVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETK  258
            IN+KGVAGS ATLVNWFGAWLCSYTFN+LM W+S GTFILYA IN L ILFV  VVPETK
Sbjct  365  INIKGVAGSLATLVNWFGAWLCSYTFNYLMTWSSPGTFILYAAINALGILFVTIVVPETK  424

Query  257  GRTLEQIQATINA  219
            GR+LEQIQ+ INA
Sbjct  425  GRSLEQIQSAINA  437



>ref|XP_007050715.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007050716.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX94872.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX94873.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=484

 Score =   403 bits (1035),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 187/255 (73%), Positives = 227/255 (89%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEFE ALQ LRGK+ADIS+EAA+I+DY+E L++LPKAK+ DLFQ+RY RS+ IGV
Sbjct  230  KIGREKEFEAALQDLRGKDADISKEAADIRDYIETLQRLPKAKMLDLFQRRYLRSVIIGV  289

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFY S+IFESAGF + +GTIIYAILQV++T + AT+IDKAGRKPLL
Sbjct  290  GLMVFQQFGGINGICFYVSNIFESAGFSASVGTIIYAILQVVITGLNATVIDKAGRKPLL  349

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VS++GL LGC+L+G+S+YLKG N+A N+ P+LAV GI++YIGSFS GMGAVPWV+MSEI
Sbjct  350  LVSSAGLVLGCMLSGISFYLKGHNLALNSVPILAVAGILIYIGSFSAGMGAVPWVVMSEI  409

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAGS ATLVNWFGAW  SYTFNFLM+W+S+GTFI+YA IN LAILFV+ VVPE
Sbjct  410  FPINIKGVAGSLATLVNWFGAWAVSYTFNFLMSWSSYGTFIIYAVINALAILFVVIVVPE  469

Query  263  TKGRTLEQIQATINA  219
            TKG+TLEQIQA INA
Sbjct  470  TKGKTLEQIQAAINA  484



>ref|XP_010512799.1| PREDICTED: sugar transporter ERD6-like 7 [Camelina sativa]
Length=278

 Score =   393 bits (1009),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 181/254 (71%), Positives = 219/254 (86%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G   EFE AL+KLRG+ ADIS+EAAEIQDY+E LE+LPKAK+ DLFQ+RY RS+ I  
Sbjct  24   KMGRDAEFEAALRKLRGEKADISQEAAEIQDYIETLERLPKAKMLDLFQRRYIRSVLIAF  83

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFYTSSIFE AGFP+ +G IIYA+LQV++TA+ A ++D+AGRKPLL
Sbjct  84   GLMVFQQFGGINGICFYTSSIFEQAGFPTRLGMIIYAVLQVVITALNAPIVDRAGRKPLL  143

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+GL +GC++T VS+YLK  N+A  A PVLAV GIMVYIGSFS GMGA+PWV+MSEI
Sbjct  144  LVSATGLVVGCLITAVSFYLKVHNLAQEAVPVLAVVGIMVYIGSFSAGMGAMPWVVMSEI  203

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAG  ATLVNWFGAW  SYTFNFLM+W+S+GTFI+YA IN LAI+FVI +VPE
Sbjct  204  FPINIKGVAGGMATLVNWFGAWAVSYTFNFLMSWSSYGTFIIYAAINALAIVFVIVIVPE  263

Query  263  TKGRTLEQIQATIN  222
            TKG+TLEQIQA +N
Sbjct  264  TKGKTLEQIQAVVN  277



>ref|XP_008386585.1| PREDICTED: sugar transporter ERD6-like 7 [Malus domestica]
Length=476

 Score =   400 bits (1027),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 185/254 (73%), Positives = 224/254 (88%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + GH K+FEVALQKLRGK+ADIS EAAEIQDY+  LE+LPKAKL D FQKRY RSI I V
Sbjct  223  KTGHQKDFEVALQKLRGKDADISHEAAEIQDYIATLERLPKAKLLDFFQKRYLRSIIIAV  282

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+CQQLGGING+CFYTS+IF+ AGF   +GTI +AILQV+VT +GA+++DKAGRKPL+
Sbjct  283  GLMVCQQLGGINGVCFYTSNIFKQAGFSPSVGTISFAILQVVVTGIGASVMDKAGRKPLI  342

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++SASGL LGC+LT +S++LK  ++A  A+P+LAVTGI+VYIGSF++GMGAVPWVIMSEI
Sbjct  343  LISASGLVLGCLLTAISFFLKVHDLAHKASPILAVTGILVYIGSFAIGMGAVPWVIMSEI  402

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS ATLVNWF AWLCSYTFN+LM+W+S+GTFILYA IN LAI+FV+ +VPE
Sbjct  403  FPINIKGQAGSLATLVNWFVAWLCSYTFNYLMSWSSYGTFILYAAINALAIVFVVSMVPE  462

Query  263  TKGRTLEQIQATIN  222
            TKG+TLEQIQ  IN
Sbjct  463  TKGKTLEQIQGAIN  476



>ref|XP_010512800.1| PREDICTED: sugar transporter ERD6-like 7 [Camelina sativa]
Length=336

 Score =   393 bits (1010),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 181/254 (71%), Positives = 219/254 (86%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G   EFE AL+KLRG+ ADIS+EAAEIQDY+E LE+LPKAK+ DLFQ+RY RS+ I  
Sbjct  82   KMGRDAEFEAALRKLRGEKADISQEAAEIQDYIETLERLPKAKMLDLFQRRYIRSVLIAF  141

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFYTSSIFE AGFP+ +G IIYA+LQV++TA+ A ++D+AGRKPLL
Sbjct  142  GLMVFQQFGGINGICFYTSSIFEQAGFPTRLGMIIYAVLQVVITALNAPIVDRAGRKPLL  201

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+GL +GC++T VS+YLK  N+A  A PVLAV GIMVYIGSFS GMGA+PWV+MSEI
Sbjct  202  LVSATGLVVGCLITAVSFYLKVHNLAQEAVPVLAVVGIMVYIGSFSAGMGAMPWVVMSEI  261

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAG  ATLVNWFGAW  SYTFNFLM+W+S+GTFI+YA IN LAI+FVI +VPE
Sbjct  262  FPINIKGVAGGMATLVNWFGAWAVSYTFNFLMSWSSYGTFIIYAAINALAIVFVIVIVPE  321

Query  263  TKGRTLEQIQATIN  222
            TKG+TLEQIQA +N
Sbjct  322  TKGKTLEQIQAVVN  335



>gb|KCW58969.1| hypothetical protein EUGRSUZ_H01597 [Eucalyptus grandis]
Length=259

 Score =   390 bits (1001),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 181/254 (71%), Positives = 218/254 (86%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + GH KEFE ALQKLRGK+ADISEEAAEIQDY+E L+ LPKA + DLF++RY  S+ IGV
Sbjct  4    KTGHEKEFEAALQKLRGKDADISEEAAEIQDYIETLQLLPKASILDLFRRRYLSSVIIGV  63

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGING+CFYTS+IFE AGF S +GTI YAILQVIVTA+GA L+D+AGRKPLL
Sbjct  64   GLMVVQQFGGINGVCFYTSNIFEEAGFSSSVGTITYAILQVIVTAIGAALVDRAGRKPLL  123

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++S +GL LGCI+  +S++LK  ++A +A P+LAVTGI++YI +FS GMGAVPWV+MSEI
Sbjct  124  LISGTGLVLGCIVPALSFFLKVHDLAADAVPILAVTGILLYIAAFSAGMGAVPWVVMSEI  183

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPINVKGVAG FATLVNWFGAW  SYTFN+LM+W+S+GTF+LYA IN   I+FVI VVPE
Sbjct  184  FPINVKGVAGGFATLVNWFGAWAVSYTFNYLMSWSSYGTFLLYAGINAAGIVFVITVVPE  243

Query  263  TKGRTLEQIQATIN  222
            TKGR+LEQIQA IN
Sbjct  244  TKGRSLEQIQAAIN  257



>ref|XP_004290698.1| PREDICTED: sugar transporter ERD6-like 7 [Fragaria vesca subsp. 
vesca]
Length=464

 Score =   397 bits (1020),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 188/254 (74%), Positives = 222/254 (87%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KEFEVALQKLRG++AD+S EAAEIQDY+  L++LPKAK+ DLFQ+RYSRS+ IGV
Sbjct  210  KTGKHKEFEVALQKLRGEDADVSHEAAEIQDYIATLDQLPKAKMLDLFQRRYSRSVIIGV  269

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+CQQ GGING+CFY SSIFE AGF S IGTI YAILQV+VT +GA ++DKAGRKPL+
Sbjct  270  GLMVCQQFGGINGVCFYVSSIFEQAGFSSSIGTITYAILQVVVTGIGAAIMDKAGRKPLI  329

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++SASGL LGC+LT +S++LK  + A  A   LAVTGI+VYIGSFS+GMGAVPWV+MSEI
Sbjct  330  LISASGLVLGCVLTAISFFLKVNDWALGAVGALAVTGILVYIGSFSIGMGAVPWVVMSEI  389

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS ATLVNWFGAWLCSYTFNFLM+W+S+GTFILYA IN LAI+FV+ VVPE
Sbjct  390  FPINIKGQAGSLATLVNWFGAWLCSYTFNFLMSWSSYGTFILYAAINGLAIVFVVFVVPE  449

Query  263  TKGRTLEQIQATIN  222
            TKG+TLEQIQA IN
Sbjct  450  TKGKTLEQIQAAIN  463



>ref|XP_010242565.1| PREDICTED: sugar transporter ERD6-like 7 isoform X2 [Nelumbo 
nucifera]
Length=458

 Score =   397 bits (1020),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 189/254 (74%), Positives = 221/254 (87%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G+ KEF+ AL++LRGK+ADIS EAAEIQDY+E L++LPKAK+ DLFQ+RY RS+ +GV
Sbjct  203  KMGYQKEFDAALRRLRGKDADISHEAAEIQDYIETLQQLPKAKILDLFQRRYLRSVIVGV  262

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFY S IF SAGFPSD+GTI YA LQV++TA+GA L+DKAGR+PLL
Sbjct  263  GLMVFQQFGGINGICFYVSQIFVSAGFPSDVGTITYACLQVVITALGAFLMDKAGRRPLL  322

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSASGL LGCILT +S+YLK   ++  + P LAVTGI+VYIGSFS GMGA PWVIMSEI
Sbjct  323  LVSASGLVLGCILTAISFYLKVHELSIKSVPALAVTGILVYIGSFSAGMGATPWVIMSEI  382

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPINVKG+AGS ATLVNWFGAW  SYTFNFLM+W+S+GTFILYA IN LAILFV KVVPE
Sbjct  383  FPINVKGIAGSLATLVNWFGAWAISYTFNFLMSWSSYGTFILYAAINGLAILFVAKVVPE  442

Query  263  TKGRTLEQIQATIN  222
            TKGRTLEQIQA IN
Sbjct  443  TKGRTLEQIQAAIN  456



>ref|XP_004292608.2| PREDICTED: sugar transporter ERD6-like 7 [Fragaria vesca subsp. 
vesca]
Length=476

 Score =   397 bits (1020),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 183/254 (72%), Positives = 225/254 (89%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G+ K+FE ALQKLRG++ADIS+EA EIQDY+  L++LPKAKL DLF++RYSRS+ I V
Sbjct  222  KTGNQKDFEDALQKLRGRDADISKEAEEIQDYIATLDRLPKAKLLDLFERRYSRSLIISV  281

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLMICQQLGGING+CFY S+I E AGF   +GTIIYA+LQV+VTA+GA ++DKAGRKPL+
Sbjct  282  GLMICQQLGGINGVCFYVSNILEQAGFSPSMGTIIYAVLQVVVTAIGAAIMDKAGRKPLI  341

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++SA+GL LGC LT +S+++K   ++  A P+LAVTGI+V+IGSFS+GMGAVPWVIMSEI
Sbjct  342  LISATGLLLGCSLTAISFFIKVHQLSPKAVPILAVTGILVFIGSFSIGMGAVPWVIMSEI  401

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGSFATLVNWFGAWLCSYTFNFLM W+S+GTFILYA INVLAI+F++ +VPE
Sbjct  402  FPINIKGQAGSFATLVNWFGAWLCSYTFNFLMTWSSYGTFILYAVINVLAIIFIVVMVPE  461

Query  263  TKGRTLEQIQATIN  222
            TKGRTLEQIQA+IN
Sbjct  462  TKGRTLEQIQASIN  475



>ref|XP_010242564.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Nelumbo 
nucifera]
Length=479

 Score =   397 bits (1021),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 189/254 (74%), Positives = 221/254 (87%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G+ KEF+ AL++LRGK+ADIS EAAEIQDY+E L++LPKAK+ DLFQ+RY RS+ +GV
Sbjct  224  KMGYQKEFDAALRRLRGKDADISHEAAEIQDYIETLQQLPKAKILDLFQRRYLRSVIVGV  283

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFY S IF SAGFPSD+GTI YA LQV++TA+GA L+DKAGR+PLL
Sbjct  284  GLMVFQQFGGINGICFYVSQIFVSAGFPSDVGTITYACLQVVITALGAFLMDKAGRRPLL  343

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSASGL LGCILT +S+YLK   ++  + P LAVTGI+VYIGSFS GMGA PWVIMSEI
Sbjct  344  LVSASGLVLGCILTAISFYLKVHELSIKSVPALAVTGILVYIGSFSAGMGATPWVIMSEI  403

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPINVKG+AGS ATLVNWFGAW  SYTFNFLM+W+S+GTFILYA IN LAILFV KVVPE
Sbjct  404  FPINVKGIAGSLATLVNWFGAWAISYTFNFLMSWSSYGTFILYAAINGLAILFVAKVVPE  463

Query  263  TKGRTLEQIQATIN  222
            TKGRTLEQIQA IN
Sbjct  464  TKGRTLEQIQAAIN  477



>gb|EPS59997.1| hypothetical protein M569_14807, partial [Genlisea aurea]
Length=454

 Score =   395 bits (1016),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 185/251 (74%), Positives = 222/251 (88%), Gaps = 0/251 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KEFE +L+KLRGKNAD+S EAAEIQ+YVE LE+LPKAK+ DLFQKRY RS+ IGV
Sbjct  204  KQGRQKEFEASLKKLRGKNADVSSEAAEIQEYVETLERLPKAKILDLFQKRYRRSVTIGV  263

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+CQQ GGING+CFYTSSIFESAGFP+++GTI YAI+QV++TA+GAT+ID+AGRKPL+
Sbjct  264  GLMVCQQFGGINGVCFYTSSIFESAGFPANVGTITYAIIQVVITALGATVIDRAGRKPLI  323

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++S +GL LGC+L   S+YLK    A  AAP LAV GI+VYIG+FSVGMGAVPWVIMSEI
Sbjct  324  IISGAGLILGCLLAASSFYLKEHGEAIGAAPTLAVAGILVYIGAFSVGMGAVPWVIMSEI  383

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAGS ATLVNWFGAW  S+TFNFLM+W+S+GTFILYA +N LAI+FVI++VPE
Sbjct  384  FPINIKGVAGSTATLVNWFGAWAVSFTFNFLMSWSSYGTFILYAAVNALAIVFVIQLVPE  443

Query  263  TKGRTLEQIQA  231
            TKG+TLEQIQA
Sbjct  444  TKGKTLEQIQA  454



>ref|XP_010026273.1| PREDICTED: sugar transporter ERD6-like 7, partial [Eucalyptus 
grandis]
Length=281

 Score =   387 bits (995),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 181/254 (71%), Positives = 218/254 (86%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + GH KEFE ALQKLRGK+ADISEEAAEIQDY+E L+ LPKA + DLF++RY  S+ IGV
Sbjct  26   KTGHEKEFEAALQKLRGKDADISEEAAEIQDYIETLQLLPKASILDLFRRRYLSSVIIGV  85

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGING+CFYTS+IFE AGF S +GTI YAILQVIVTA+GA L+D+AGRKPLL
Sbjct  86   GLMVVQQFGGINGVCFYTSNIFEEAGFSSSVGTITYAILQVIVTAIGAALVDRAGRKPLL  145

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++S +GL LGCI+  +S++LK  ++A +A P+LAVTGI++YI +FS GMGAVPWV+MSEI
Sbjct  146  LISGTGLVLGCIVPALSFFLKVHDLAADAVPILAVTGILLYIAAFSAGMGAVPWVVMSEI  205

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPINVKGVAG FATLVNWFGAW  SYTFN+LM+W+S+GTF+LYA IN   I+FVI VVPE
Sbjct  206  FPINVKGVAGGFATLVNWFGAWAVSYTFNYLMSWSSYGTFLLYAGINAAGIVFVITVVPE  265

Query  263  TKGRTLEQIQATIN  222
            TKGR+LEQIQA IN
Sbjct  266  TKGRSLEQIQAAIN  279



>gb|KFK37554.1| hypothetical protein AALP_AA4G271800 [Arabis alpina]
Length=468

 Score =   394 bits (1012),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 180/254 (71%), Positives = 220/254 (87%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G   EFE AL+KLRGKNADIS+EAAEIQDY+E LEKLPKAK+ DLFQ+RY RS+ I  
Sbjct  214  KMGRDTEFEAALRKLRGKNADISQEAAEIQDYIETLEKLPKAKMLDLFQRRYIRSVLIAF  273

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFYTSSIFE AGFP+ +G IIYA+LQV++TA+ A ++D+AGRKPLL
Sbjct  274  GLMVFQQFGGINGICFYTSSIFEQAGFPTSLGMIIYAVLQVVITALNAPIVDRAGRKPLL  333

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++SA+GL +GC++  VS+YLK  ++A +A PVLAV GIMVYIGSFS GMGA+PWV+MSEI
Sbjct  334  LLSATGLVIGCLIAAVSFYLKAHDMAHDAVPVLAVVGIMVYIGSFSAGMGAMPWVVMSEI  393

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAG  ATLVNWFGAW  SYTFNFLM+W+S+GTFI+YA +N LAI+FVI +VPE
Sbjct  394  FPINIKGVAGGMATLVNWFGAWAVSYTFNFLMSWSSYGTFIIYAVVNALAIVFVIAIVPE  453

Query  263  TKGRTLEQIQATIN  222
            TKG+TLEQIQA +N
Sbjct  454  TKGKTLEQIQALVN  467



>ref|XP_004493632.1| PREDICTED: sugar transporter ERD6-like 7-like [Cicer arietinum]
Length=473

 Score =   394 bits (1011),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 183/255 (72%), Positives = 219/255 (86%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  K+F  ALQ LRGK+ADIS+EA EIQDY+  L++LPK K+ DLFQ+RY RS+ IGV
Sbjct  219  KRGRAKDFVAALQILRGKDADISQEAEEIQDYITSLDRLPKPKVLDLFQRRYLRSLTIGV  278

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+CQQ GGING+CFYTSSIF+ AGFPS  G+IIYAILQ+++T VGA LIDKAGRKPLL
Sbjct  279  GLMVCQQFGGINGVCFYTSSIFDLAGFPSSTGSIIYAILQIVITGVGAALIDKAGRKPLL  338

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VS SGL  GCILT V++YLK  ++   A PVLAVTGI+VYIGSFS+GMGA+PWV+MSEI
Sbjct  339  LVSGSGLVAGCILTAVAFYLKVHDVGAGAVPVLAVTGILVYIGSFSIGMGAIPWVVMSEI  398

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FP+N+KG AGS ATLVNWFGAWLCSYTFNFLM+W+S+GTF+LYA IN LAILF+  VVPE
Sbjct  399  FPVNIKGQAGSIATLVNWFGAWLCSYTFNFLMSWSSYGTFVLYAAINSLAILFIAIVVPE  458

Query  263  TKGRTLEQIQATINA  219
            TKG++LEQ+QA INA
Sbjct  459  TKGKSLEQLQAAINA  473



>gb|KJB23160.1| hypothetical protein B456_004G084300 [Gossypium raimondii]
Length=480

 Score =   394 bits (1012),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 185/255 (73%), Positives = 220/255 (86%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++GH KEFE ALQ LRGK ADISEEAAEI+DY+E LE+LPKAK+ DLFQ+RY RS+ IGV
Sbjct  226  KIGHEKEFEAALQDLRGKGADISEEAAEIRDYIETLERLPKAKMLDLFQRRYFRSVIIGV  285

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFY S+IFESAG    I TI YAI+QV +TA+  T+IDKAGRKPLL
Sbjct  286  GLMVFQQFGGINGICFYLSNIFESAGVSPSIATITYAIIQVPITALNTTVIDKAGRKPLL  345

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VS++GL L CIL+G S+YLK  N+A ++ P+LAVTGI++YIGSFS GMGAVPWV+MSEI
Sbjct  346  LVSSTGLVLACILSGTSFYLKDHNLAPSSVPILAVTGILMYIGSFSAGMGAVPWVVMSEI  405

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG+AGS ATLVNWFGAW  SYTFNFLM+W+S+GTFI+YA IN +AI+FVI VVPE
Sbjct  406  FPINIKGIAGSLATLVNWFGAWAVSYTFNFLMSWSSYGTFIIYAAINAVAIVFVITVVPE  465

Query  263  TKGRTLEQIQATINA  219
            TKG+TLEQIQA INA
Sbjct  466  TKGKTLEQIQAAINA  480



>gb|KEH23690.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=477

 Score =   393 bits (1010),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 184/255 (72%), Positives = 219/255 (86%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + GH K+F  ALQ LRGK+ADISEEA EIQDY+  LE+L K K+ DLFQ+RY RS+ IGV
Sbjct  223  KRGHAKDFVAALQILRGKDADISEEAGEIQDYITSLEQLAKPKVLDLFQRRYLRSLTIGV  282

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+CQQLGGING+CFYTSSIF+ AGFPS  G+IIYAILQ+++T VGA LID+AGRKPLL
Sbjct  283  GLMVCQQLGGINGVCFYTSSIFDLAGFPSATGSIIYAILQIVITGVGAALIDRAGRKPLL  342

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VS SGL  GCI T V++YLK  ++A  A P LAVTGI+VYIGSFS+GMGA+PWV+MSEI
Sbjct  343  LVSGSGLVAGCIFTAVAFYLKVHDVAVGAVPALAVTGILVYIGSFSIGMGAIPWVVMSEI  402

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FP+N+KG AGS ATLVNWFGAWLCSYTFNFLM+W+S+GTF+LYA IN LAILF+  VVPE
Sbjct  403  FPVNIKGQAGSIATLVNWFGAWLCSYTFNFLMSWSSYGTFVLYAAINALAILFIAVVVPE  462

Query  263  TKGRTLEQIQATINA  219
            TKG++LEQ+QA INA
Sbjct  463  TKGKSLEQLQAAINA  477



>ref|XP_010507821.1| PREDICTED: sugar transporter ERD6-like 7 [Camelina sativa]
Length=437

 Score =   391 bits (1005),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 181/254 (71%), Positives = 219/254 (86%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G   EFE AL+KLRG+ ADIS+EAAEIQDY+E LE+LPKAK+ DLFQ+RY RS+ I  
Sbjct  183  KMGRDAEFEAALRKLRGEKADISQEAAEIQDYIETLERLPKAKMLDLFQRRYIRSVLIAF  242

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFYTSSIFE AGFP+ +G IIYA+LQV++TA+ A ++D+AGRKPLL
Sbjct  243  GLMVFQQFGGINGICFYTSSIFEQAGFPTRLGMIIYAVLQVVITALNAPIVDRAGRKPLL  302

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+GL +GC++T VS+YLK  N+A  A PVLAV GIMVYIGSFS GMGA+PWV+MSEI
Sbjct  303  LVSATGLVVGCLITAVSFYLKVHNLAQEAVPVLAVVGIMVYIGSFSAGMGAMPWVVMSEI  362

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAG  ATLVNWFGAW  SYTFNFLM+W+S+GTFI+YA IN LAI+FVI +VPE
Sbjct  363  FPINIKGVAGGMATLVNWFGAWAVSYTFNFLMSWSSYGTFIIYAAINALAIVFVIVIVPE  422

Query  263  TKGRTLEQIQATIN  222
            TKG+TLEQIQA +N
Sbjct  423  TKGKTLEQIQAVVN  436



>ref|XP_009103393.1| PREDICTED: sugar transporter ERD6-like 7 [Brassica rapa]
Length=468

 Score =   392 bits (1008),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 183/254 (72%), Positives = 216/254 (85%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G   EFE AL+KLRGK A+ISEEAAEIQDY+E LE+LPKAK  DLFQ+RY RS+FI  
Sbjct  214  KMGRDTEFEAALRKLRGKKANISEEAAEIQDYIETLERLPKAKALDLFQRRYIRSVFIAF  273

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFYTSSIFE AGFP  +G IIYA+LQV++TA+ A ++DKAGRKPLL
Sbjct  274  GLMVFQQFGGINGICFYTSSIFEQAGFPPRLGMIIYAVLQVVITALNAPIVDKAGRKPLL  333

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+GL +GC++T VS+YLK  ++A  A PVLAV GIMVYI SFS GMGA+PWV+MSEI
Sbjct  334  LVSATGLVIGCLITAVSFYLKAHDMAHKAVPVLAVVGIMVYIASFSAGMGAMPWVVMSEI  393

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAG  ATLVNWFGAW  SYTFNFLM+W+S+GTFI+YA IN LAI FVI VVPE
Sbjct  394  FPINIKGVAGGMATLVNWFGAWAVSYTFNFLMSWSSYGTFIIYAVINALAIFFVIAVVPE  453

Query  263  TKGRTLEQIQATIN  222
            TKG+TLEQIQA +N
Sbjct  454  TKGKTLEQIQAVVN  467



>ref|XP_006444170.1| hypothetical protein CICLE_v10019923mg [Citrus clementina]
 gb|ESR57410.1| hypothetical protein CICLE_v10019923mg [Citrus clementina]
Length=385

 Score =   389 bits (1000),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 186/255 (73%), Positives = 216/255 (85%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KEFE ALQKLRGK+ADI+ EAAEIQDY+E LE+LPKA + DLFQ+RY RS+ IGV
Sbjct  131  KTGKEKEFEAALQKLRGKDADITHEAAEIQDYIETLERLPKAGMLDLFQRRYLRSVTIGV  190

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFYTS+IFESAGF S +GTIIYAILQV+VT +   +ID+AGRKPLL
Sbjct  191  GLMVFQQFGGINGICFYTSTIFESAGFSSSVGTIIYAILQVVVTGLNTIVIDRAGRKPLL  250

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+GL LGC+L GVS++LK   +   + P LAVTGI++YI +FS GMGAVPWV+MSEI
Sbjct  251  LVSATGLVLGCLLVGVSFFLKDHELGLESVPALAVTGILLYIAAFSAGMGAVPWVVMSEI  310

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGV GS ATLVNWFGAWL SYTFNFLM W+S+GTFILYA IN L ILF+I VVPE
Sbjct  311  FPINIKGVGGSLATLVNWFGAWLVSYTFNFLMTWSSYGTFILYAAINALGILFMIIVVPE  370

Query  263  TKGRTLEQIQATINA  219
            TKGRTLEQIQA INA
Sbjct  371  TKGRTLEQIQAAINA  385



>emb|CDY12861.1| BnaC07g15720D [Brassica napus]
Length=466

 Score =   392 bits (1007),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 181/254 (71%), Positives = 219/254 (86%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G   EFE AL+KLRGK A+ISEEAAEIQDY+E LE+LPKAK+ DLFQ+RY RS+FI  
Sbjct  212  KMGRDTEFEAALRKLRGKKANISEEAAEIQDYIETLERLPKAKVLDLFQRRYIRSVFIAF  271

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFYTSSIFE AGFP+ +G IIYA+LQV++TA+ A ++DKAGRKPLL
Sbjct  272  GLMVFQQFGGINGICFYTSSIFEQAGFPTRLGMIIYAVLQVVITALNAPIVDKAGRKPLL  331

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+GL +GC++T VS+YLK  ++A  A P+LAV GIMVYI SFS GMGA+PWV+MSEI
Sbjct  332  LVSATGLVIGCLITAVSFYLKVHDMAHKAVPILAVVGIMVYIASFSAGMGAMPWVVMSEI  391

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAG  ATLVNWFGAW  SYTFNFLM+W+S+GTF++YA IN LAI+FVI VVPE
Sbjct  392  FPINIKGVAGGMATLVNWFGAWAVSYTFNFLMSWSSYGTFVIYAVINALAIVFVIAVVPE  451

Query  263  TKGRTLEQIQATIN  222
            TKG+TLEQIQA +N
Sbjct  452  TKGKTLEQIQAVVN  465



>gb|KHG14417.1| hypothetical protein F383_03945 [Gossypium arboreum]
Length=432

 Score =   389 bits (1000),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/255 (72%), Positives = 221/255 (87%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEFE ALQ LRGK+ +IS+EA EI+DY+E LE+LPKAK+ DLFQ+RY  S+ IGV
Sbjct  178  KIGREKEFEAALQDLRGKDTNISKEADEIRDYIETLERLPKAKMLDLFQRRYLSSVIIGV  237

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFY S+IFE+AGF + +GTIIYAILQV++T +  T+IDKAGRKPLL
Sbjct  238  GLMVFQQFGGINGICFYVSNIFETAGFSAAVGTIIYAILQVVITGLNTTVIDKAGRKPLL  297

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VS++GL LGCIL+GVS+YLK  N+A +A P+LAVTGI++YI +FS GMGAVPWVIMSEI
Sbjct  298  LVSSTGLVLGCILSGVSFYLKDHNLALDAVPILAVTGILIYISAFSAGMGAVPWVIMSEI  357

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAGS ATLVNWFGAW  SYTFNFLM+W+S+GTFILYA IN  AILFV+ +VPE
Sbjct  358  FPINIKGVAGSLATLVNWFGAWAVSYTFNFLMSWSSYGTFILYAAINAGAILFVVTLVPE  417

Query  263  TKGRTLEQIQATINA  219
            TKG+TLEQIQA INA
Sbjct  418  TKGKTLEQIQAAINA  432



>ref|XP_006409064.1| hypothetical protein EUTSA_v10022677mg [Eutrema salsugineum]
 gb|ESQ50517.1| hypothetical protein EUTSA_v10022677mg [Eutrema salsugineum]
Length=468

 Score =   390 bits (1003),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 181/254 (71%), Positives = 218/254 (86%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G   EFE AL+KLRGK ADIS+EAAEIQDY+E LE+LPKAK+ DLFQ+RY RS+ I  
Sbjct  214  KMGRDTEFEAALRKLRGKKADISQEAAEIQDYIETLERLPKAKMLDLFQRRYIRSVLIAF  273

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFYTSSIFE AGFP+ +G IIYA+LQV++TA+ A ++D+AGRKPLL
Sbjct  274  GLMVFQQFGGINGICFYTSSIFEQAGFPTRLGMIIYAVLQVVITALNAPIVDRAGRKPLL  333

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+GL +GC++  VS+YLK  ++A  A PVLAV GIMVYIGSFS GMGA+PWV+MSEI
Sbjct  334  LVSATGLVIGCLIAAVSFYLKVHDMAHEAVPVLAVVGIMVYIGSFSAGMGAMPWVVMSEI  393

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAG  ATLVNWFGAW  SYTFNFLM+W+S+GTFI+YA IN LAI+FVI VVPE
Sbjct  394  FPINIKGVAGGMATLVNWFGAWAVSYTFNFLMSWSSYGTFIIYAVINALAIVFVIAVVPE  453

Query  263  TKGRTLEQIQATIN  222
            TKG+TLEQIQA +N
Sbjct  454  TKGKTLEQIQALVN  467



>gb|AAM61246.1| putative sugar transporter [Arabidopsis thaliana]
Length=463

 Score =   390 bits (1002),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 180/254 (71%), Positives = 218/254 (86%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G   EFE AL+KLRGK ADISEEAAEIQDY+E LE+LPKAK+ DLFQ+RY RS+ I  
Sbjct  209  KVGRDTEFEAALRKLRGKKADISEEAAEIQDYIETLERLPKAKMLDLFQRRYIRSVLIAF  268

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFYTSSIFE AGFP+ +G IIYA+LQV++TA+ A ++D+AGRKPLL
Sbjct  269  GLMVFQQFGGINGICFYTSSIFEQAGFPTRLGMIIYAVLQVVITALNAPIVDRAGRKPLL  328

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+GL +GC++  VS+YLK  ++A  A PVLAV GIMVYIGSFS GMGA+PWV+MSEI
Sbjct  329  LVSATGLVIGCLIAAVSFYLKVHDMAHEAVPVLAVVGIMVYIGSFSAGMGAMPWVVMSEI  388

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAG  ATLVNWFGAW  SYTFNFLM+W+S+GTF++YA IN LAI+FVI +VPE
Sbjct  389  FPINIKGVAGGMATLVNWFGAWAVSYTFNFLMSWSSYGTFLIYAAINALAIVFVIAIVPE  448

Query  263  TKGRTLEQIQATIN  222
            TKG+TLEQIQA +N
Sbjct  449  TKGKTLEQIQAVVN  462



>ref|NP_566120.1| sugar transporter ERD6-like 7 [Arabidopsis thaliana]
 ref|NP_850483.1| sugar transporter ERD6-like 7 [Arabidopsis thaliana]
 sp|P93051.2|ERDL7_ARATH RecName: Full=Sugar transporter ERD6-like 7 [Arabidopsis thaliana]
 gb|AAD13706.2| putative sugar transporter [Arabidopsis thaliana]
 gb|AAM53273.1| putative putative sister-chromatide cohesion protein [Arabidopsis 
thaliana]
 gb|AAN15372.1| putative putative sister-chromatide cohesion protein [Arabidopsis 
thaliana]
 gb|AEC10924.1| sugar transporter ERD6-like 7 [Arabidopsis thaliana]
 gb|AEC10925.1| sugar transporter ERD6-like 7 [Arabidopsis thaliana]
Length=463

 Score =   390 bits (1002),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 180/254 (71%), Positives = 218/254 (86%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G   EFE AL+KLRGK ADISEEAAEIQDY+E LE+LPKAK+ DLFQ+RY RS+ I  
Sbjct  209  KVGRDTEFEAALRKLRGKKADISEEAAEIQDYIETLERLPKAKMLDLFQRRYIRSVLIAF  268

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFYTSSIFE AGFP+ +G IIYA+LQV++TA+ A ++D+AGRKPLL
Sbjct  269  GLMVFQQFGGINGICFYTSSIFEQAGFPTRLGMIIYAVLQVVITALNAPIVDRAGRKPLL  328

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+GL +GC++  VS+YLK  ++A  A PVLAV GIMVYIGSFS GMGA+PWV+MSEI
Sbjct  329  LVSATGLVIGCLIAAVSFYLKVHDMAHEAVPVLAVVGIMVYIGSFSAGMGAMPWVVMSEI  388

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAG  ATLVNWFGAW  SYTFNFLM+W+S+GTF++YA IN LAI+FVI +VPE
Sbjct  389  FPINIKGVAGGMATLVNWFGAWAVSYTFNFLMSWSSYGTFLIYAAINALAIVFVIAIVPE  448

Query  263  TKGRTLEQIQATIN  222
            TKG+TLEQIQA +N
Sbjct  449  TKGKTLEQIQAIVN  462



>ref|XP_009102177.1| PREDICTED: LOW QUALITY PROTEIN: sugar transporter ERD6-like 7 
[Brassica rapa]
Length=463

 Score =   390 bits (1002),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 179/254 (70%), Positives = 217/254 (85%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G   EFE AL+KLRGK AD+SEEAAEIQDY+E LE+LPKAK  DLFQ+RY RS+ I  
Sbjct  209  KMGRDTEFEAALRKLRGKKADVSEEAAEIQDYIETLERLPKAKALDLFQRRYIRSVLIAF  268

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFYTSSIFE AGFP+ +G IIYA+LQV++TA+ A ++D+AGRKPLL
Sbjct  269  GLMVFQQFGGINGICFYTSSIFEQAGFPTRLGMIIYAVLQVVITALNAPIVDRAGRKPLL  328

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+GL +GC++T VS+YLK  ++A  A PVLAV GIM+YI SFS GMGA+PWV+MSEI
Sbjct  329  LVSATGLVIGCLITAVSFYLKAHDMAHEAVPVLAVVGIMMYIASFSAGMGAMPWVVMSEI  388

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAG  ATLVNWFGAW  SYTFNFLM+W+S+GTFI+YA IN LAI+FVI VVPE
Sbjct  389  FPINIKGVAGGMATLVNWFGAWAVSYTFNFLMSWSSYGTFIIYAVINALAIVFVIAVVPE  448

Query  263  TKGRTLEQIQATIN  222
            TKG+TLE+IQA +N
Sbjct  449  TKGKTLEEIQAVVN  462



>emb|CDY01404.1| BnaA07g11770D [Brassica napus]
Length=468

 Score =   390 bits (1002),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 182/254 (72%), Positives = 216/254 (85%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G   EFE AL+KLRGK  +ISEEAAEIQDY+E LE+LPKAK  DLFQ+RY RS+FI  
Sbjct  214  KMGRDIEFEAALRKLRGKKVNISEEAAEIQDYIETLERLPKAKALDLFQRRYIRSVFIAF  273

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFYTSSIFE AGFP  +G IIYA+LQV++TA+ A ++DKAGRKPLL
Sbjct  274  GLMVFQQFGGINGICFYTSSIFEQAGFPPRLGMIIYAVLQVVITALNAPIVDKAGRKPLL  333

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+GL +GC++T VS+YLK  ++A  A PVLAV GIMVYI SFS GMGA+PWV+MSEI
Sbjct  334  LVSATGLVIGCLITAVSFYLKAHDMAHKAVPVLAVVGIMVYIASFSAGMGAMPWVVMSEI  393

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAG  ATLVNWFGAW  SYTFNFLM+W+S+GTFI+YA IN LAI+FVI VVPE
Sbjct  394  FPINIKGVAGGMATLVNWFGAWAVSYTFNFLMSWSSYGTFIIYAVINALAIVFVIAVVPE  453

Query  263  TKGRTLEQIQATIN  222
            TKG+TLEQIQA +N
Sbjct  454  TKGKTLEQIQAVVN  467



>emb|CDY39145.1| BnaA07g01410D [Brassica napus]
Length=463

 Score =   390 bits (1001),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 179/254 (70%), Positives = 217/254 (85%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G   EFE AL+KLRGK AD+SEEAAEIQDY+E LE+LPKAK  DLFQ+RY RS+ I  
Sbjct  209  KMGRDTEFEAALRKLRGKKADVSEEAAEIQDYIETLERLPKAKALDLFQRRYIRSVLIAF  268

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFYTSSIFE AGFP+ +G IIYA+LQV++TA+ A ++D+AGRKPLL
Sbjct  269  GLMVFQQFGGINGICFYTSSIFEQAGFPTRLGMIIYAVLQVVITALNAPIVDRAGRKPLL  328

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+GL +GC++T VS+YLK  ++A  A PVLAV GIM+YI SFS GMGA+PWV+MSEI
Sbjct  329  LVSATGLVIGCLITAVSFYLKAHDMAHEAVPVLAVVGIMMYIASFSAGMGAMPWVVMSEI  388

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAG  ATLVNWFGAW  SYTFNFLM+W+S+GTFI+YA IN LAI+FVI VVPE
Sbjct  389  FPINIKGVAGGMATLVNWFGAWAVSYTFNFLMSWSSYGTFIIYAVINALAIVFVIAVVPE  448

Query  263  TKGRTLEQIQATIN  222
            TKG+TLE+IQA +N
Sbjct  449  TKGKTLEEIQAVVN  462



>ref|XP_002880340.1| hypothetical protein ARALYDRAFT_483991 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56599.1| hypothetical protein ARALYDRAFT_483991 [Arabidopsis lyrata subsp. 
lyrata]
Length=464

 Score =   389 bits (1000),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 179/254 (70%), Positives = 218/254 (86%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G   EFE AL+KLRGK ADIS+EAAEIQDY+E LE+LPKAK+ DLFQ+RY RS+ I  
Sbjct  210  KMGRDTEFEAALRKLRGKKADISQEAAEIQDYIETLERLPKAKMLDLFQRRYIRSVLIAF  269

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFYTSSIFE AGFP+ +G IIYA+LQV++TA+ A ++D+AGRKPLL
Sbjct  270  GLMVFQQFGGINGICFYTSSIFEQAGFPTRLGMIIYAVLQVVITALNAPIVDRAGRKPLL  329

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+GL +GC++  VS+YLK  ++A  A PVLAV GIMVYIGSFS GMGA+PWV+MSEI
Sbjct  330  LVSATGLVIGCLIAAVSFYLKVHDMAPEAVPVLAVVGIMVYIGSFSAGMGAMPWVVMSEI  389

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAG  ATLVNWFGAW  SYTFNFLM+W+S+GTF++YA IN LAI+FVI +VPE
Sbjct  390  FPINIKGVAGGMATLVNWFGAWAVSYTFNFLMSWSSYGTFLIYAAINALAIVFVIAIVPE  449

Query  263  TKGRTLEQIQATIN  222
            TKG+TLEQIQA +N
Sbjct  450  TKGKTLEQIQAVVN  463



>ref|XP_006444171.1| hypothetical protein CICLE_v10019923mg [Citrus clementina]
 ref|XP_006479808.1| PREDICTED: sugar transporter ERD6-like 7-like [Citrus sinensis]
 gb|ESR57411.1| hypothetical protein CICLE_v10019923mg [Citrus clementina]
Length=478

 Score =   389 bits (1000),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 186/255 (73%), Positives = 216/255 (85%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KEFE ALQKLRGK+ADI+ EAAEIQDY+E LE+LPKA + DLFQ+RY RS+ IGV
Sbjct  224  KTGKEKEFEAALQKLRGKDADITHEAAEIQDYIETLERLPKAGMLDLFQRRYLRSVTIGV  283

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFYTS+IFESAGF S +GTIIYAILQV+VT +   +ID+AGRKPLL
Sbjct  284  GLMVFQQFGGINGICFYTSTIFESAGFSSSVGTIIYAILQVVVTGLNTIVIDRAGRKPLL  343

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+GL LGC+L GVS++LK   +   + P LAVTGI++YI +FS GMGAVPWV+MSEI
Sbjct  344  LVSATGLVLGCLLVGVSFFLKDHELGLESVPALAVTGILLYIAAFSAGMGAVPWVVMSEI  403

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGV GS ATLVNWFGAWL SYTFNFLM W+S+GTFILYA IN L ILF+I VVPE
Sbjct  404  FPINIKGVGGSLATLVNWFGAWLVSYTFNFLMTWSSYGTFILYAAINALGILFMIIVVPE  463

Query  263  TKGRTLEQIQATINA  219
            TKGRTLEQIQA INA
Sbjct  464  TKGRTLEQIQAAINA  478



>ref|XP_006444169.1| hypothetical protein CICLE_v10019923mg [Citrus clementina]
 gb|ESR57409.1| hypothetical protein CICLE_v10019923mg [Citrus clementina]
Length=483

 Score =   389 bits (1000),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 186/255 (73%), Positives = 216/255 (85%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KEFE ALQKLRGK+ADI+ EAAEIQDY+E LE+LPKA + DLFQ+RY RS+ IGV
Sbjct  229  KTGKEKEFEAALQKLRGKDADITHEAAEIQDYIETLERLPKAGMLDLFQRRYLRSVTIGV  288

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFYTS+IFESAGF S +GTIIYAILQV+VT +   +ID+AGRKPLL
Sbjct  289  GLMVFQQFGGINGICFYTSTIFESAGFSSSVGTIIYAILQVVVTGLNTIVIDRAGRKPLL  348

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+GL LGC+L GVS++LK   +   + P LAVTGI++YI +FS GMGAVPWV+MSEI
Sbjct  349  LVSATGLVLGCLLVGVSFFLKDHELGLESVPALAVTGILLYIAAFSAGMGAVPWVVMSEI  408

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGV GS ATLVNWFGAWL SYTFNFLM W+S+GTFILYA IN L ILF+I VVPE
Sbjct  409  FPINIKGVGGSLATLVNWFGAWLVSYTFNFLMTWSSYGTFILYAAINALGILFMIIVVPE  468

Query  263  TKGRTLEQIQATINA  219
            TKGRTLEQIQA INA
Sbjct  469  TKGRTLEQIQAAINA  483



>ref|XP_008386586.1| PREDICTED: sugar transporter ERD6-like 7 [Malus domestica]
Length=478

 Score =   389 bits (999),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 180/254 (71%), Positives = 217/254 (85%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KEFE+ALQKLRGK+ADIS+EAAEIQ+Y+  L++LP++KL DLFQ RY RS+ I V
Sbjct  224  KTGRRKEFELALQKLRGKDADISDEAAEIQEYIATLDRLPQSKLLDLFQTRYLRSVIIAV  283

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+CQQLGGING+CFY S IFE AGF  DIGTI YAILQV+VT +GA ++DKAGRKPL+
Sbjct  284  GLMVCQQLGGINGVCFYVSDIFEQAGFSPDIGTITYAILQVVVTGLGAAVMDKAGRKPLI  343

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            + SASGL LGC+L  +S++LK   +  +AAP+ AV GI+++IGSFS+GMGAVPWVIMSEI
Sbjct  344  LASASGLILGCVLVAISFFLKVHELVLDAAPIFAVAGILIFIGSFSIGMGAVPWVIMSEI  403

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS  TLVNW GAWLCSYTFNFLM+WNS+GTFILYA +NVLA+LFVI +VPE
Sbjct  404  FPINIKGQAGSLTTLVNWVGAWLCSYTFNFLMSWNSYGTFILYAVVNVLAVLFVIALVPE  463

Query  263  TKGRTLEQIQATIN  222
            TKG+TLEQIQ  IN
Sbjct  464  TKGKTLEQIQGEIN  477



>emb|CDX82668.1| BnaC07g01980D [Brassica napus]
Length=463

 Score =   387 bits (995),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 178/254 (70%), Positives = 216/254 (85%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G   EFE AL+KLRGK  D+SEEAAEIQDY+E LE+LPKAK  DLFQ+RY RS+ I  
Sbjct  209  KMGRDTEFEAALRKLRGKKTDVSEEAAEIQDYIETLERLPKAKALDLFQRRYIRSVLIAF  268

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFYTSSIFE AGFP+ +G IIYA+LQV++TA+ A ++D+AGRKPLL
Sbjct  269  GLMVFQQFGGINGICFYTSSIFEQAGFPTRLGMIIYAVLQVVITALNAPIVDRAGRKPLL  328

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+GL +GC++T VS+YLK  ++A  A PVLAV GIM+YI SFS GMGA+PWV+MSEI
Sbjct  329  LVSATGLVIGCLITAVSFYLKAHDLAHEAVPVLAVVGIMMYIASFSAGMGAMPWVVMSEI  388

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAG  ATLVNWFGAW  SYTFNFLM+W+S+GTFI+YA IN LAI+FVI VVPE
Sbjct  389  FPINIKGVAGGMATLVNWFGAWAVSYTFNFLMSWSSYGTFIIYAVINALAIVFVIAVVPE  448

Query  263  TKGRTLEQIQATIN  222
            TKG+TLE+IQA +N
Sbjct  449  TKGKTLEEIQAIVN  462



>ref|XP_010070279.1| PREDICTED: sugar transporter ERD6-like 7 isoform X3 [Eucalyptus 
grandis]
Length=459

 Score =   387 bits (994),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 180/254 (71%), Positives = 218/254 (86%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KEFE ALQKLRGK+ADISEEAAEIQDY+E L+ LPKA + DLFQ+RY  S+ IGV
Sbjct  204  KTGREKEFEAALQKLRGKDADISEEAAEIQDYIETLQLLPKASILDLFQRRYLSSVIIGV  263

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGING+CFYTS+IFE AGF S +GTI YAILQVIVTA+GA L+D+AGRKPLL
Sbjct  264  GLMVVQQFGGINGVCFYTSNIFEEAGFSSSVGTITYAILQVIVTAIGAALVDRAGRKPLL  323

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++S +GL LGCI+T +S++LK  ++A +A P+LAVTGI++YI +FS GMGAVPWV+MSEI
Sbjct  324  LISGTGLVLGCIVTALSFFLKVHDLAADAVPILAVTGILLYIAAFSAGMGAVPWVVMSEI  383

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAG FATLVNWFGAW  SYTFN+LM+W+S+GTF+LYA IN   ++FVI VVPE
Sbjct  384  FPINIKGVAGGFATLVNWFGAWAVSYTFNYLMSWSSYGTFLLYAVINAAGMVFVITVVPE  443

Query  263  TKGRTLEQIQATIN  222
            TKGR+LEQIQA IN
Sbjct  444  TKGRSLEQIQAAIN  457



>ref|XP_010070277.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Eucalyptus 
grandis]
 gb|KCW58937.1| hypothetical protein EUGRSUZ_H01560 [Eucalyptus grandis]
Length=481

 Score =   387 bits (994),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 180/254 (71%), Positives = 218/254 (86%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KEFE ALQKLRGK+ADISEEAAEIQDY+E L+ LPKA + DLFQ+RY  S+ IGV
Sbjct  226  KTGREKEFEAALQKLRGKDADISEEAAEIQDYIETLQLLPKASILDLFQRRYLSSVIIGV  285

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGING+CFYTS+IFE AGF S +GTI YAILQVIVTA+GA L+D+AGRKPLL
Sbjct  286  GLMVVQQFGGINGVCFYTSNIFEEAGFSSSVGTITYAILQVIVTAIGAALVDRAGRKPLL  345

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++S +GL LGCI+T +S++LK  ++A +A P+LAVTGI++YI +FS GMGAVPWV+MSEI
Sbjct  346  LISGTGLVLGCIVTALSFFLKVHDLAADAVPILAVTGILLYIAAFSAGMGAVPWVVMSEI  405

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAG FATLVNWFGAW  SYTFN+LM+W+S+GTF+LYA IN   ++FVI VVPE
Sbjct  406  FPINIKGVAGGFATLVNWFGAWAVSYTFNYLMSWSSYGTFLLYAVINAAGMVFVITVVPE  465

Query  263  TKGRTLEQIQATIN  222
            TKGR+LEQIQA IN
Sbjct  466  TKGRSLEQIQAAIN  479



>ref|XP_010545075.1| PREDICTED: sugar transporter ERD6-like 7 isoform X2 [Tarenaya 
hassleriana]
Length=385

 Score =   383 bits (984),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 177/254 (70%), Positives = 215/254 (85%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G   EFE AL+ LRGKNADIS EAAEIQ+Y+E LE+LPKAK+ DLFQ+RY RS+ IG 
Sbjct  131  KMGRHTEFEAALKSLRGKNADISHEAAEIQEYIETLERLPKAKMLDLFQRRYQRSVLIGF  190

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFY SSIFE AGFP+  GTIIYA+LQV++TA+ A ++D+AGRKPLL
Sbjct  191  GLMVVQQFGGINGICFYASSIFEQAGFPATTGTIIYAVLQVVITALNAPIVDRAGRKPLL  250

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VS +G+ +GC+L  VS+YLK   +A +A P+LAV GI+ YIGSFS G+GA+PWV+MSEI
Sbjct  251  LVSLTGVVIGCLLIAVSFYLKVHGMAPDAVPILAVVGILGYIGSFSAGLGAMPWVVMSEI  310

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAG  ATLVNWFGAW  SYTFNFLM+WNSFGTFI+YA INVL I+FVI +VPE
Sbjct  311  FPINIKGVAGGMATLVNWFGAWAVSYTFNFLMSWNSFGTFIIYAAINVLGIVFVITIVPE  370

Query  263  TKGRTLEQIQATIN  222
            TKG+TLEQIQA +N
Sbjct  371  TKGKTLEQIQAAVN  384



>emb|CBI32306.3| unnamed protein product [Vitis vinifera]
Length=437

 Score =   385 bits (988),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 191/255 (75%), Positives = 221/255 (87%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KEFE ALQ+LRGK+ADIS EAAEIQDY+E L++LPKAK+ DLFQ+RY  S+ IGV
Sbjct  183  KTGREKEFEAALQRLRGKDADISLEAAEIQDYIETLQQLPKAKIMDLFQRRYLPSVIIGV  242

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM  QQ GGINGICFY S+IFESAGF S +GTI YAILQVIVTA+GA LID+AGRKPLL
Sbjct  243  GLMFFQQFGGINGICFYVSNIFESAGFSSSVGTITYAILQVIVTAMGAALIDRAGRKPLL  302

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSASGL L C+L G+S+Y K   +A  AAP LAVTGI++YIGSFSVGMGAVPWV+MSEI
Sbjct  303  LVSASGLVLSCVLAGLSFYFKSHELALKAAPALAVTGILLYIGSFSVGMGAVPWVVMSEI  362

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAGS ATL+NWFGAW  SYTFN+LM+W+S+GTFI+Y  IN LAI+FV+KVVPE
Sbjct  363  FPINIKGVAGSLATLMNWFGAWAISYTFNYLMSWSSYGTFIIYGVINALAIVFVVKVVPE  422

Query  263  TKGRTLEQIQATINA  219
            TKGRTLEQIQATINA
Sbjct  423  TKGRTLEQIQATINA  437



>ref|XP_002524779.1| sugar transporter, putative [Ricinus communis]
 gb|EEF37622.1| sugar transporter, putative [Ricinus communis]
Length=481

 Score =   386 bits (992),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 181/255 (71%), Positives = 219/255 (86%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  K+FE AL+ LRGK+ DIS EA EI+DY+E LE+LPKAKL DLFQ+RY RS+ IGV
Sbjct  227  KMGREKQFETALKTLRGKDTDISHEADEIKDYIETLERLPKAKLLDLFQRRYLRSVTIGV  286

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGING+CFYTS+IFESAGF + IGTI YAI+QV+VTA+  T+IDKAGRKPLL
Sbjct  287  GLMVFQQFGGINGVCFYTSNIFESAGFSATIGTITYAIIQVVVTALNTTVIDKAGRKPLL  346

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+GL + C++TG S+YLK  ++A  A P LAVTGI++YIGSFS GMGAVPWV+MSEI
Sbjct  347  LVSATGLVIACLITGTSFYLKTNDLALKAVPALAVTGILLYIGSFSAGMGAVPWVVMSEI  406

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAGS ATL+NWFGAW  SYT+NFLM+W+S+GTFI+YA IN L I+FV KVVPE
Sbjct  407  FPINIKGVAGSLATLMNWFGAWTISYTYNFLMSWSSYGTFIIYAAINALGIVFVAKVVPE  466

Query  263  TKGRTLEQIQATINA  219
            TKGRTLEQIQA IN+
Sbjct  467  TKGRTLEQIQAAINS  481



>ref|XP_010070291.1| PREDICTED: sugar transporter ERD6-like 7 isoform X2 [Eucalyptus 
grandis]
Length=459

 Score =   385 bits (990),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 178/254 (70%), Positives = 218/254 (86%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + GH KEFE ALQKLRGK+ADIS+EAAEIQDY+E L+ LPKA + DLF++RY  S+ IGV
Sbjct  204  KTGHKKEFEAALQKLRGKDADISKEAAEIQDYIETLQLLPKASILDLFRRRYLSSVIIGV  263

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGING+CFYTS+IFE AGF S +GTI YAILQVIVTA+GA L+D+AGRKPLL
Sbjct  264  GLMVVQQFGGINGVCFYTSNIFEEAGFSSSVGTITYAILQVIVTAIGAALVDRAGRKPLL  323

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++S +GL LGCI+T +S++LK  ++A +A P+LAVTGI++YI +FS GMGAVPWV+MSEI
Sbjct  324  LISGTGLVLGCIVTALSFFLKVHDLAADAVPILAVTGILLYIAAFSAGMGAVPWVVMSEI  383

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAG FATLVNWFGAW  SYTFN+LM+W+S+GTF+LYA IN   ++FVI VVPE
Sbjct  384  FPINIKGVAGGFATLVNWFGAWAVSYTFNYLMSWSSYGTFLLYAVINAAGMVFVITVVPE  443

Query  263  TKGRTLEQIQATIN  222
            TKGR+LEQIQ  IN
Sbjct  444  TKGRSLEQIQTAIN  457



>ref|XP_010070290.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Eucalyptus 
grandis]
Length=481

 Score =   386 bits (991),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 178/254 (70%), Positives = 218/254 (86%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + GH KEFE ALQKLRGK+ADIS+EAAEIQDY+E L+ LPKA + DLF++RY  S+ IGV
Sbjct  226  KTGHKKEFEAALQKLRGKDADISKEAAEIQDYIETLQLLPKASILDLFRRRYLSSVIIGV  285

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGING+CFYTS+IFE AGF S +GTI YAILQVIVTA+GA L+D+AGRKPLL
Sbjct  286  GLMVVQQFGGINGVCFYTSNIFEEAGFSSSVGTITYAILQVIVTAIGAALVDRAGRKPLL  345

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++S +GL LGCI+T +S++LK  ++A +A P+LAVTGI++YI +FS GMGAVPWV+MSEI
Sbjct  346  LISGTGLVLGCIVTALSFFLKVHDLAADAVPILAVTGILLYIAAFSAGMGAVPWVVMSEI  405

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAG FATLVNWFGAW  SYTFN+LM+W+S+GTF+LYA IN   ++FVI VVPE
Sbjct  406  FPINIKGVAGGFATLVNWFGAWAVSYTFNYLMSWSSYGTFLLYAVINAAGMVFVITVVPE  465

Query  263  TKGRTLEQIQATIN  222
            TKGR+LEQIQ  IN
Sbjct  466  TKGRSLEQIQTAIN  479



>gb|KCW58947.1| hypothetical protein EUGRSUZ_H01571 [Eucalyptus grandis]
Length=484

 Score =   385 bits (990),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 178/254 (70%), Positives = 218/254 (86%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + GH KEFE ALQKLRGK+ADIS+EAAEIQDY+E L+ LPKA + DLF++RY  S+ IGV
Sbjct  229  KTGHKKEFEAALQKLRGKDADISKEAAEIQDYIETLQLLPKASILDLFRRRYLSSVIIGV  288

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGING+CFYTS+IFE AGF S +GTI YAILQVIVTA+GA L+D+AGRKPLL
Sbjct  289  GLMVVQQFGGINGVCFYTSNIFEEAGFSSSVGTITYAILQVIVTAIGAALVDRAGRKPLL  348

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++S +GL LGCI+T +S++LK  ++A +A P+LAVTGI++YI +FS GMGAVPWV+MSEI
Sbjct  349  LISGTGLVLGCIVTALSFFLKVHDLAADAVPILAVTGILLYIAAFSAGMGAVPWVVMSEI  408

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAG FATLVNWFGAW  SYTFN+LM+W+S+GTF+LYA IN   ++FVI VVPE
Sbjct  409  FPINIKGVAGGFATLVNWFGAWAVSYTFNYLMSWSSYGTFLLYAVINAAGMVFVITVVPE  468

Query  263  TKGRTLEQIQATIN  222
            TKGR+LEQIQ  IN
Sbjct  469  TKGRSLEQIQTAIN  482



>ref|XP_011009474.1| PREDICTED: sugar transporter ERD6-like 7 isoform X2 [Populus 
euphratica]
Length=437

 Score =   382 bits (982),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 181/255 (71%), Positives = 215/255 (84%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G   EF+ ALQKLRGK ADIS+EA EI++Y+E LE+LPKA+  DLFQ+RY RS+ IGV
Sbjct  183  KRGREDEFQTALQKLRGKEADISQEATEIKEYIETLERLPKARFLDLFQRRYLRSVIIGV  242

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGING+CFY S+IFESAGF   +GTIIYAILQV+VTA+  T+IDKAGRKPLL
Sbjct  243  GLMVFQQFGGINGVCFYVSNIFESAGFSPSLGTIIYAILQVVVTALNTTVIDKAGRKPLL  302

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSASGL LGCI+T  ++YLK   +A  + P L + GI++YIGSFS GMGAVPWVIMSEI
Sbjct  303  LVSASGLILGCIITATAFYLKVNELAIKSVPALTLIGILLYIGSFSAGMGAVPWVIMSEI  362

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAGS ATLVNWFGAW  SYT+N+LM+W+S+GTFILYA IN LAI+FV+ VVPE
Sbjct  363  FPINIKGVAGSLATLVNWFGAWAVSYTYNYLMSWSSYGTFILYAAINALAIVFVVTVVPE  422

Query  263  TKGRTLEQIQATINA  219
            TKGRTLEQIQA INA
Sbjct  423  TKGRTLEQIQAAINA  437



>gb|KJB47011.1| hypothetical protein B456_008G006300 [Gossypium raimondii]
 gb|KJB47012.1| hypothetical protein B456_008G006300 [Gossypium raimondii]
 gb|KJB47014.1| hypothetical protein B456_008G006300 [Gossypium raimondii]
Length=484

 Score =   384 bits (986),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 180/255 (71%), Positives = 219/255 (86%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEFE ALQ LRGK+ +IS+EA EI+DY+E LE+LPKAK+ DLFQ+RY  S+ IGV
Sbjct  230  KIGREKEFEAALQDLRGKDTNISKEADEIRDYIETLERLPKAKMMDLFQQRYLNSVIIGV  289

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFY S+IFE AGF + +GTIIYAILQV++T +  T+IDKAGRKPLL
Sbjct  290  GLMVFQQFGGINGICFYVSNIFEMAGFSAAVGTIIYAILQVVITGLNTTVIDKAGRKPLL  349

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VS++GL LGCIL+GVS+YL+  N+A +A P+LAVTGI++YI +FS GMGAVPWVIMSEI
Sbjct  350  LVSSTGLVLGCILSGVSFYLRDHNLALDAVPILAVTGILIYISAFSAGMGAVPWVIMSEI  409

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS ATLVNWFGAW  SYTFNFLM+W+++GTFILYA IN  AILFV+ +VPE
Sbjct  410  FPINIKGAAGSLATLVNWFGAWAVSYTFNFLMSWSAYGTFILYAAINAGAILFVVTLVPE  469

Query  263  TKGRTLEQIQATINA  219
            TKG+TLEQIQA INA
Sbjct  470  TKGKTLEQIQAAINA  484



>ref|XP_002270927.2| PREDICTED: sugar transporter ERD6-like 7 [Vitis vinifera]
 gb|ADP37173.1| putative ERD6-like transporter [Vitis vinifera]
Length=490

 Score =   384 bits (986),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 191/255 (75%), Positives = 221/255 (87%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KEFE ALQ+LRGK+ADIS EAAEIQDY+E L++LPKAK+ DLFQ+RY  S+ IGV
Sbjct  236  KTGREKEFEAALQRLRGKDADISLEAAEIQDYIETLQQLPKAKIMDLFQRRYLPSVIIGV  295

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM  QQ GGINGICFY S+IFESAGF S +GTI YAILQVIVTA+GA LID+AGRKPLL
Sbjct  296  GLMFFQQFGGINGICFYVSNIFESAGFSSSVGTITYAILQVIVTAMGAALIDRAGRKPLL  355

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSASGL L C+L G+S+Y K   +A  AAP LAVTGI++YIGSFSVGMGAVPWV+MSEI
Sbjct  356  LVSASGLVLSCVLAGLSFYFKSHELALKAAPALAVTGILLYIGSFSVGMGAVPWVVMSEI  415

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAGS ATL+NWFGAW  SYTFN+LM+W+S+GTFI+Y  IN LAI+FV+KVVPE
Sbjct  416  FPINIKGVAGSLATLMNWFGAWAISYTFNYLMSWSSYGTFIIYGVINALAIVFVVKVVPE  475

Query  263  TKGRTLEQIQATINA  219
            TKGRTLEQIQATINA
Sbjct  476  TKGRTLEQIQATINA  490



>ref|XP_012092318.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Jatropha 
curcas]
 ref|XP_012092319.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Jatropha 
curcas]
 ref|XP_012092320.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Jatropha 
curcas]
 gb|KDP21525.1| hypothetical protein JCGZ_21996 [Jatropha curcas]
Length=484

 Score =   384 bits (986),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 178/255 (70%), Positives = 218/255 (85%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  K+FE AL+ LRG++ADI++EA EI+DY+E LE+LPKAKL DLFQ+RY RS+ IGV
Sbjct  230  KMGRDKQFETALKTLRGEDADITQEADEIKDYIETLERLPKAKLLDLFQRRYLRSVIIGV  289

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGING+CFYTS+IFESAGF + IGTI YAI+QV+VT +  T+IDKAGRKPLL
Sbjct  290  GLMVFQQFGGINGVCFYTSNIFESAGFSATIGTIAYAIIQVVVTGLNTTVIDKAGRKPLL  349

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSASGL + C++TG+S+YLK   +A  + P LAVTGI++YIGSFS GMGAVPWV+MSEI
Sbjct  350  LVSASGLVISCLITGISFYLKDHEMALTSVPTLAVTGILLYIGSFSAGMGAVPWVVMSEI  409

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAGS ATL NWFGAW  SYT+NFL +W+S+GTF+LYA IN L I+F+ KVVPE
Sbjct  410  FPINIKGVAGSLATLTNWFGAWAISYTYNFLTSWSSYGTFVLYAAINALGIVFIAKVVPE  469

Query  263  TKGRTLEQIQATINA  219
            TKGRTLEQIQA INA
Sbjct  470  TKGRTLEQIQAAINA  484



>ref|XP_010545070.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010545071.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010545072.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010545074.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Tarenaya 
hassleriana]
Length=464

 Score =   383 bits (984),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 177/254 (70%), Positives = 215/254 (85%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G   EFE AL+ LRGKNADIS EAAEIQ+Y+E LE+LPKAK+ DLFQ+RY RS+ IG 
Sbjct  210  KMGRHTEFEAALKSLRGKNADISHEAAEIQEYIETLERLPKAKMLDLFQRRYQRSVLIGF  269

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFY SSIFE AGFP+  GTIIYA+LQV++TA+ A ++D+AGRKPLL
Sbjct  270  GLMVVQQFGGINGICFYASSIFEQAGFPATTGTIIYAVLQVVITALNAPIVDRAGRKPLL  329

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VS +G+ +GC+L  VS+YLK   +A +A P+LAV GI+ YIGSFS G+GA+PWV+MSEI
Sbjct  330  LVSLTGVVIGCLLIAVSFYLKVHGMAPDAVPILAVVGILGYIGSFSAGLGAMPWVVMSEI  389

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAG  ATLVNWFGAW  SYTFNFLM+WNSFGTFI+YA INVL I+FVI +VPE
Sbjct  390  FPINIKGVAGGMATLVNWFGAWAVSYTFNFLMSWNSFGTFIIYAAINVLGIVFVITIVPE  449

Query  263  TKGRTLEQIQATIN  222
            TKG+TLEQIQA +N
Sbjct  450  TKGKTLEQIQAAVN  463



>ref|XP_008368891.1| PREDICTED: sugar transporter ERD6-like 7 [Malus domestica]
Length=473

 Score =   383 bits (983),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 181/254 (71%), Positives = 216/254 (85%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  ++FE ALQKLRGK+ADIS EAAEIQDY+  L+ LPKAKL DLFQ+RY RS+ IG+
Sbjct  219  KTGRQEDFEAALQKLRGKDADISHEAAEIQDYIVTLDSLPKAKLLDLFQRRYWRSLIIGI  278

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+CQQLGGING+CFY S IFE AGF S IGTIIYAILQVIVT + A ++DKAGRKPL+
Sbjct  279  GLMVCQQLGGINGVCFYVSDIFEQAGFSSSIGTIIYAILQVIVTGIAAGVMDKAGRKPLI  338

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSASGL LG ++T VS+ LK   +A +A P+LAV GI+VYI +FS+GMGAVPWV+MSEI
Sbjct  339  LVSASGLVLGSLMTAVSFXLKVHELALDAVPILAVAGILVYIXAFSIGMGAVPWVVMSEI  398

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS ATLVNWFGAWLCSYTFN+L +W+S+GTFILYA IN LAILFV+ +VPE
Sbjct  399  FPINIKGQAGSLATLVNWFGAWLCSYTFNYLXSWSSYGTFILYAGINTLAILFVVSLVPE  458

Query  263  TKGRTLEQIQATIN  222
            TKG+TLEQIQ  +N
Sbjct  459  TKGKTLEQIQGAMN  472



>ref|XP_011009473.1| PREDICTED: sugar transporter ERD6-like 7 isoform X1 [Populus 
euphratica]
Length=478

 Score =   383 bits (983),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/255 (71%), Positives = 215/255 (84%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G   EF+ ALQKLRGK ADIS+EA EI++Y+E LE+LPKA+  DLFQ+RY RS+ IGV
Sbjct  224  KRGREDEFQTALQKLRGKEADISQEATEIKEYIETLERLPKARFLDLFQRRYLRSVIIGV  283

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGING+CFY S+IFESAGF   +GTIIYAILQV+VTA+  T+IDKAGRKPLL
Sbjct  284  GLMVFQQFGGINGVCFYVSNIFESAGFSPSLGTIIYAILQVVVTALNTTVIDKAGRKPLL  343

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSASGL LGCI+T  ++YLK   +A  + P L + GI++YIGSFS GMGAVPWVIMSEI
Sbjct  344  LVSASGLILGCIITATAFYLKVNELAIKSVPALTLIGILLYIGSFSAGMGAVPWVIMSEI  403

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAGS ATLVNWFGAW  SYT+N+LM+W+S+GTFILYA IN LAI+FV+ VVPE
Sbjct  404  FPINIKGVAGSLATLVNWFGAWAVSYTYNYLMSWSSYGTFILYAAINALAIVFVVTVVPE  463

Query  263  TKGRTLEQIQATINA  219
            TKGRTLEQIQA INA
Sbjct  464  TKGRTLEQIQAAINA  478



>ref|XP_010667578.1| PREDICTED: sugar transporter ERD6-like 7 [Beta vulgaris subsp. 
vulgaris]
Length=486

 Score =   382 bits (981),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 182/255 (71%), Positives = 215/255 (84%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KEFE ALQKLRG +ADI+ EAAEIQ+Y+E LE+LPKA +FDLFQ RY RS+ I V
Sbjct  232  KKGARKEFEAALQKLRGSDADINHEAAEIQNYIEELEQLPKASMFDLFQTRYLRSVTIAV  291

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFY S+IFE AGF   +GT+IYA+LQV++T +GATLIDKAGRKPLL
Sbjct  292  GLMVFQQFGGINGICFYVSNIFEMAGFSPSVGTVIYALLQVVITTMGATLIDKAGRKPLL  351

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA GL +GCILT +++Y K   ++  AAP+LA+TGI+VYI +FSVGMGAVPWV+MSEI
Sbjct  352  LVSAVGLVIGCILTAIAFYFKAHELSEKAAPILAITGILVYISAFSVGMGAVPWVVMSEI  411

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPINVKGVAGS ATLVNWFGAW  SYTFNFLM W+S GTFI+YA IN  AI+FV+ VVPE
Sbjct  412  FPINVKGVAGSLATLVNWFGAWAISYTFNFLMEWSSSGTFIIYAVINAAAIIFVVMVVPE  471

Query  263  TKGRTLEQIQATINA  219
            TKGR+LEQIQA INA
Sbjct  472  TKGRSLEQIQADINA  486



>ref|XP_008386584.1| PREDICTED: sugar transporter ERD6-like 7 [Malus domestica]
Length=473

 Score =   381 bits (979),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 184/254 (72%), Positives = 215/254 (85%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  K+FE ALQKLRGK+ADISEEA EI+DY+  L+ LPKAKL DLFQ+RY  S+ IGV
Sbjct  219  KIGRYKDFEDALQKLRGKDADISEEAEEIRDYIATLDSLPKAKLLDLFQRRYWSSLVIGV  278

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM CQQLGGING+CFY S IFE AGF S IGTI YAILQVIVTA+ A ++DKAGRKPL+
Sbjct  279  GLMFCQQLGGINGVCFYVSDIFEQAGFSSSIGTITYAILQVIVTAIAAGVMDKAGRKPLI  338

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+GL LG +LT VS++LK    A NA P+LAVTGI+VYIG+FS+GMGAVPWV+MSEI
Sbjct  339  LVSAAGLVLGXLLTAVSFFLKVHEWALNAVPILAVTGILVYIGAFSIGMGAVPWVVMSEI  398

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS ATLVNW  AWLCSYTFN+LM W+S+GTFILYA IN LAILFV+ +VPE
Sbjct  399  FPINIKGQAGSLATLVNWLCAWLCSYTFNYLMIWSSYGTFILYAGINALAILFVVALVPE  458

Query  263  TKGRTLEQIQATIN  222
            TKG+TLE IQA IN
Sbjct  459  TKGKTLEHIQAAIN  472



>ref|XP_002302812.2| sugar transporter family protein [Populus trichocarpa]
 gb|EEE82085.2| sugar transporter family protein [Populus trichocarpa]
Length=484

 Score =   381 bits (979),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 180/254 (71%), Positives = 215/254 (85%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  +EF+ ALQKLRGK ADI +EA EI+DY+E LE+LPKA+  DLFQ+RY RS+ IGV
Sbjct  230  KRGREEEFQTALQKLRGKEADIYQEATEIKDYIETLERLPKARFLDLFQRRYLRSVIIGV  289

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGING+CFY S+IFESAGF   +GTIIYAILQV+VTA+   +IDKAGRKPLL
Sbjct  290  GLMVFQQFGGINGVCFYVSNIFESAGFSPSLGTIIYAILQVVVTALNTIVIDKAGRKPLL  349

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSASGL LGC++T +S+YLK   +A  + P L +TGI++YIGSFS GMGAVPWVIMSEI
Sbjct  350  LVSASGLILGCLITAISFYLKVNELAVKSVPALTLTGILLYIGSFSAGMGAVPWVIMSEI  409

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAGS ATLVNWFGAW  SYT+N+LM+W+S+GTFILYA IN LAI+FV+ VVPE
Sbjct  410  FPINIKGVAGSLATLVNWFGAWAISYTYNYLMSWSSYGTFILYAAINALAIVFVVMVVPE  469

Query  263  TKGRTLEQIQATIN  222
            TKGRTLEQIQA IN
Sbjct  470  TKGRTLEQIQAAIN  483



>ref|XP_010070313.1| PREDICTED: sugar transporter ERD6-like 7 [Eucalyptus grandis]
 gb|KCW58972.1| hypothetical protein EUGRSUZ_H01602 [Eucalyptus grandis]
Length=479

 Score =   379 bits (973),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 178/254 (70%), Positives = 217/254 (85%), Gaps = 1/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KEFE ALQKLRG N DISEEAAEIQ+Y+E L++LPKA + DLFQ+RY  S+ IGV
Sbjct  225  KRGRQKEFEAALQKLRG-NTDISEEAAEIQEYIETLQRLPKASVLDLFQRRYLSSVIIGV  283

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGING+CFYTS+IFE AGF S +GTI YAILQVIVTA+GA L+D+AGRKPLL
Sbjct  284  GLMVVQQFGGINGVCFYTSNIFEEAGFSSSVGTITYAILQVIVTAIGAALVDRAGRKPLL  343

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++S +GL LGCI+T +S++LK  ++A +A P+LAVTGI++YI +FS GMGAVPWV+MSEI
Sbjct  344  LISGTGLVLGCIVTALSFFLKVHDLAADAVPILAVTGILLYIAAFSAGMGAVPWVVMSEI  403

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAG FATLVNWFGAW  SYTFN+LM+W+S+GTF+LYA IN   ++FVI VVPE
Sbjct  404  FPINIKGVAGGFATLVNWFGAWAVSYTFNYLMSWSSYGTFLLYAGINAAGMVFVITVVPE  463

Query  263  TKGRTLEQIQATIN  222
            TKGR+LEQIQA IN
Sbjct  464  TKGRSLEQIQAAIN  477



>ref|XP_008235073.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
Length=480

 Score =   379 bits (973),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 175/254 (69%), Positives = 215/254 (85%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  ++FEVALQKLRGK+AD+S EAAEIQ+Y+  L+ LP+AKL DLFQ+RY RS+ I V
Sbjct  226  KTGRQRDFEVALQKLRGKDADVSREAAEIQEYIASLDLLPQAKLLDLFQRRYLRSVIIAV  285

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+CQQLGGING+CFY S+IFE AGF   +GTI YAILQV+VT +GA ++DKAGRKPL+
Sbjct  286  GLMVCQQLGGINGVCFYVSNIFEQAGFSPRLGTITYAILQVVVTGLGAAVMDKAGRKPLI  345

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            + SASGL LGC+L   S++LK   +A  A+P+ AV GI+++IGSFSVGMGAVPWV+MSEI
Sbjct  346  LASASGLVLGCVLIATSFFLKVHGLALKASPIFAVAGILIFIGSFSVGMGAVPWVLMSEI  405

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS  TLVNW GAWLCSYTFNFLM+W+S+GTFILYA +NVL++LFVI +VPE
Sbjct  406  FPINIKGQAGSLTTLVNWLGAWLCSYTFNFLMSWSSYGTFILYAVVNVLSVLFVIVIVPE  465

Query  263  TKGRTLEQIQATIN  222
            TKG+TLEQIQ  IN
Sbjct  466  TKGKTLEQIQGAIN  479



>ref|XP_007200994.1| hypothetical protein PRUPE_ppa005144mg [Prunus persica]
 gb|EMJ02193.1| hypothetical protein PRUPE_ppa005144mg [Prunus persica]
Length=475

 Score =   378 bits (971),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 185/254 (73%), Positives = 221/254 (87%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  +EFE+ALQKLRGK+ADIS EAAEIQDY+  L++LPKAKL DLFQ+RY RS+ I V
Sbjct  221  KTGRQREFEMALQKLRGKDADISHEAAEIQDYILTLDRLPKAKLLDLFQRRYLRSVMIAV  280

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQLGGING+CFY S+IFE AGF S +GTI YAILQV+VTAV A+++DKAGRKPL+
Sbjct  281  GLMVFQQLGGINGVCFYVSNIFEQAGFSSSVGTITYAILQVVVTAVAASVMDKAGRKPLI  340

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSASGL LG +LT +S++LK   +A  A P+LAVTGI++YIGSFS+GMGAVPW++MSEI
Sbjct  341  LVSASGLVLGSLLTAISFFLKVHELALTATPILAVTGILIYIGSFSIGMGAVPWIVMSEI  400

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGSFATLVNW GAWLCSYTFNFLM+W+S+GTFILYA IN LAILFVI +VPE
Sbjct  401  FPINIKGQAGSFATLVNWLGAWLCSYTFNFLMSWSSYGTFILYAAINALAILFVILMVPE  460

Query  263  TKGRTLEQIQATIN  222
            TKG+TLEQIQ  IN
Sbjct  461  TKGKTLEQIQGDIN  474



>ref|XP_008234934.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
 ref|XP_008234935.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
 ref|XP_008234936.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
 ref|XP_008234938.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
 ref|XP_008234939.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
 ref|XP_008234940.1| PREDICTED: sugar transporter ERD6-like 7 [Prunus mume]
Length=475

 Score =   377 bits (968),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 184/254 (72%), Positives = 221/254 (87%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  +EFE+ALQKLRGK+ADIS EAAEIQDY+  L++LPKAKL DLFQ+RY RS+ I V
Sbjct  221  KTGRQREFEMALQKLRGKDADISHEAAEIQDYILTLDRLPKAKLLDLFQRRYLRSVMIAV  280

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQLGGING+CFY S+IFE AGF S +GTI YAILQV+VTAV A+++DKAGRKPL+
Sbjct  281  GLMVFQQLGGINGVCFYVSNIFEQAGFSSSVGTITYAILQVVVTAVAASVMDKAGRKPLI  340

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSASGL LG +LT +S++LK   +A  A P+LAVTGI++YIGSFS+GMGAVPW++MSEI
Sbjct  341  LVSASGLVLGSLLTAISFFLKVHELALTATPILAVTGILIYIGSFSIGMGAVPWIVMSEI  400

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGSF+TLVNW GAWLCSYTFNFLM+W+S+GTFILYA IN LAILFVI +VPE
Sbjct  401  FPINIKGQAGSFSTLVNWLGAWLCSYTFNFLMSWSSYGTFILYAAINALAILFVILMVPE  460

Query  263  TKGRTLEQIQATIN  222
            TKG+TLEQIQ  IN
Sbjct  461  TKGKTLEQIQGDIN  474



>ref|XP_004290697.1| PREDICTED: sugar transporter ERD6-like 7 [Fragaria vesca subsp. 
vesca]
 ref|XP_011458634.1| PREDICTED: sugar transporter ERD6-like 7 [Fragaria vesca subsp. 
vesca]
 ref|XP_011458635.1| PREDICTED: sugar transporter ERD6-like 7 [Fragaria vesca subsp. 
vesca]
Length=480

 Score =   376 bits (966),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 177/264 (67%), Positives = 217/264 (82%), Gaps = 3/264 (1%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G   +FEVALQKLRGK+ D+S EAAEIQDY+  L+ LPKAKL DLFQ+RY  ++ I V
Sbjct  220  KKGRHNDFEVALQKLRGKDVDVSHEAAEIQDYIATLDSLPKAKLLDLFQRRYLPAVLIAV  279

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
             LM+ QQLGGING+CFY S IFE AGF S +GTIIYAILQV+VT +GA+++DKAGRKPL+
Sbjct  280  FLMVFQQLGGINGVCFYVSDIFEQAGFSSTVGTIIYAILQVVVTGIGASIMDKAGRKPLI  339

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            + SASGL LGC++T ++++L    +A   APVLAVTGI+++IG+FS+GMGAVPW+IMSEI
Sbjct  340  LTSASGLLLGCVVTAIAFFLTAQELALTVAPVLAVTGILIFIGAFSIGMGAVPWIIMSEI  399

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS ATLVNWFGAWLCSYTFNFLM+W+++GTFILYA IN LAI FVI  VPE
Sbjct  400  FPINIKGQAGSLATLVNWFGAWLCSYTFNFLMSWSTYGTFILYAAINALAIFFVIFFVPE  459

Query  263  TKGRTLEQIQATINA*SRTRRHKN  192
            TKG+TLEQIQA I   S+ R  + 
Sbjct  460  TKGKTLEQIQAAI---SKERSEET  480



>gb|KEH23721.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=475

 Score =   375 bits (962),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 178/255 (70%), Positives = 212/255 (83%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  K+   ALQ LRGK+AD+S+EA EIQDY+  LE+L K    DLFQKRY RS+ IGV
Sbjct  221  KRGRAKDSVEALQILRGKDADVSQEAEEIQDYITSLERLAKPNGLDLFQKRYLRSLTIGV  280

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+CQQLGGING+CFYT SIF+ AGFPS  G+IIYAILQ+++T VGA LID+AGRKPLL
Sbjct  281  GLMVCQQLGGINGVCFYTGSIFDLAGFPSATGSIIYAILQIVITGVGAALIDRAGRKPLL  340

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VS SGL  GCI T V++YLK  ++A  A P LAVTGI+VYIGSFS+GMGA+PWV+MSEI
Sbjct  341  LVSGSGLVAGCIFTAVAFYLKVHDVAVGAVPALAVTGILVYIGSFSIGMGAIPWVVMSEI  400

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FP N+KG AGS ATLVNWFGAWLCSYTFNFLM W+ +GTFILYA IN LAILF++ VVPE
Sbjct  401  FPANIKGQAGSIATLVNWFGAWLCSYTFNFLMGWSFYGTFILYAAINALAILFIVLVVPE  460

Query  263  TKGRTLEQIQATINA  219
            TKG++LEQ+Q+ INA
Sbjct  461  TKGKSLEQLQSAINA  475



>ref|XP_004140089.1| PREDICTED: sugar transporter ERD6-like 7 [Cucumis sativus]
 gb|KGN47881.1| hypothetical protein Csa_6G409380 [Cucumis sativus]
Length=473

 Score =   374 bits (960),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 175/249 (70%), Positives = 212/249 (85%), Gaps = 0/249 (0%)
 Frame = -3

Query  968  KEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGVGLMIC  789
            KEFE ALQKLRG++ D+S+EAAEIQD+V  LE+LPK K+ DLFQ+ Y RS+ IGVGLM+C
Sbjct  224  KEFETALQKLRGEDVDVSQEAAEIQDFVTTLEQLPKPKVTDLFQRMYLRSVIIGVGLMVC  283

Query  788  QQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLLVVSAS  609
            QQ GGIN ICFY ++IFESAGF   IGTI YAILQV+VT +G  L+DKAGRKPL++VSAS
Sbjct  284  QQFGGINAICFYVANIFESAGFSVFIGTISYAILQVVVTGIGGLLMDKAGRKPLILVSAS  343

Query  608  GLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINV  429
            GL LGC+L  +++YLK  N+A  A P+L V G++VYIGSFS+GMGAVPWV+MSEIFPIN+
Sbjct  344  GLVLGCLLDAIAFYLKENNLAIQAVPLLTVAGVLVYIGSFSIGMGAVPWVVMSEIFPINI  403

Query  428  KGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRT  249
            KG+AGS ATL NWFGAW CSYTFNFLMAW+S+GTF++YA IN +AI FV+ +VPETKGR+
Sbjct  404  KGLAGSMATLTNWFGAWACSYTFNFLMAWSSYGTFLIYAVINAMAIGFVVLIVPETKGRS  463

Query  248  LEQIQATIN  222
            LEQIQA IN
Sbjct  464  LEQIQAAIN  472



>ref|XP_007162379.1| hypothetical protein PHAVU_001G147100g [Phaseolus vulgaris]
 gb|ESW34373.1| hypothetical protein PHAVU_001G147100g [Phaseolus vulgaris]
Length=473

 Score =   374 bits (960),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 173/255 (68%), Positives = 211/255 (83%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  K+FE ALQ LRGK+ DISEEA EIQDY+  LE+LPK++L +LF +RY  S+ IG+
Sbjct  219  KRGRKKDFEAALQTLRGKDTDISEEAEEIQDYITTLERLPKSRLLELFHRRYLLSLTIGI  278

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM CQQLGGING+CFY SSIFE AGF + IGTI YA LQV+VT +GA  IDKAGRKPLL
Sbjct  279  GLMFCQQLGGINGVCFYVSSIFEQAGFSTTIGTISYACLQVVVTGLGAVFIDKAGRKPLL  338

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++S SGL  GC+   V++YLK   +   A P LAVTG++VYIGSFS+GMGA+PWV+MSEI
Sbjct  339  ILSGSGLVAGCLFAAVAFYLKVHEVGVAAVPALAVTGVLVYIGSFSIGMGAIPWVVMSEI  398

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FP+N+KG+AGS ATL NWFGAWLCSYTFNFL++W+S+GTFILYA IN LAILF+I VVPE
Sbjct  399  FPVNIKGMAGSVATLTNWFGAWLCSYTFNFLISWSSYGTFILYAAINALAILFIIVVVPE  458

Query  263  TKGRTLEQIQATINA  219
            TKG++LEQ+QA IN+
Sbjct  459  TKGKSLEQLQAAINS  473



>ref|XP_007201571.1| hypothetical protein PRUPE_ppa018319mg [Prunus persica]
 gb|EMJ02770.1| hypothetical protein PRUPE_ppa018319mg [Prunus persica]
Length=494

 Score =   373 bits (957),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 178/268 (66%), Positives = 216/268 (81%), Gaps = 14/268 (5%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  K+FEVALQKLRGK+ADIS EAAEIQ+Y+  LE LP+AKL DLFQ+RY RS+ I V
Sbjct  226  KTGRQKDFEVALQKLRGKDADISHEAAEIQEYIASLELLPQAKLLDLFQRRYLRSVIIAV  285

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+CQQLGGING+CFY S+IFE AGF   +GTI YAILQV+VT +GA ++DKAGRKPL+
Sbjct  286  GLMVCQQLGGINGVCFYVSNIFEQAGFSPRLGTITYAILQVVVTGLGAAVMDKAGRKPLI  345

Query  623  VVSASGLALGCILTGVSYYLKGL--------------NIAGNAAPVLAVTGIMVYIGSFS  486
            +VSASGL LGC+L   S++LK                 +A  A+P+ AV GI+++IGSFS
Sbjct  346  LVSASGLVLGCVLIATSFFLKVYPTKDKKRALVKQVHGLALKASPIFAVAGILIFIGSFS  405

Query  485  VGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATI  306
            +GMGAVPWV+MSEIFPIN+KG AGS  TLVNW GAWLCSYTFNFLM+W+S+GTFILYA +
Sbjct  406  IGMGAVPWVLMSEIFPINIKGQAGSLTTLVNWLGAWLCSYTFNFLMSWSSYGTFILYAVV  465

Query  305  NVLAILFVIKVVPETKGRTLEQIQATIN  222
            NVL++LFVI +VPETKG+TLEQIQ  IN
Sbjct  466  NVLSVLFVIVIVPETKGKTLEQIQGAIN  493



>gb|KHN19852.1| Sugar transporter ERD6-like 7 [Glycine soja]
Length=478

 Score =   372 bits (955),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 176/262 (67%), Positives = 210/262 (80%), Gaps = 7/262 (3%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + GH K+F  ALQ LRGK+ADISEEA EIQDY+  LE+LPK+ L +LF +RY RS+ IG+
Sbjct  217  KRGHKKDFVAALQILRGKDADISEEAEEIQDYITSLEQLPKSSLLELFHRRYLRSVTIGI  276

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+CQQ GGINGICFY SSIFE AGF   IGTI YA LQ+++T +GA  IDKAGRKPLL
Sbjct  277  GLMVCQQFGGINGICFYASSIFEQAGFSPTIGTITYACLQIVITGLGAAFIDKAGRKPLL  336

Query  623  V-------VSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVP  465
            +       +S SGL  GCI   V++YLK   +   A P LAVTGI+VYIGSFS+GMGA+P
Sbjct  337  LASPKHKTLSGSGLVAGCIFAAVAFYLKVHEVGVEAVPALAVTGILVYIGSFSIGMGAIP  396

Query  464  WVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILF  285
            WV+MSEIFP+NVKG+AGS ATL NWFGAWLCSYTFNFLM+W+S+GTFILYA IN LAILF
Sbjct  397  WVVMSEIFPVNVKGLAGSVATLTNWFGAWLCSYTFNFLMSWSSYGTFILYAAINALAILF  456

Query  284  VIKVVPETKGRTLEQIQATINA  219
            +I  VPETKG++LEQ+QA IN+
Sbjct  457  IIVAVPETKGKSLEQLQADINS  478



>gb|KHG20787.1| hypothetical protein F383_26710 [Gossypium arboreum]
Length=384

 Score =   366 bits (939),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 176/255 (69%), Positives = 208/255 (82%), Gaps = 19/255 (7%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++GH KEFE ALQ LRGK ADISEEAAEI+DY+E LE+LPKAK+ DLFQ+RY RS+ IGV
Sbjct  149  KIGHEKEFEAALQDLRGKGADISEEAAEIRDYIETLERLPKAKMLDLFQRRYLRSVIIGV  208

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFY S+IFESA                   A+  T+IDKAGRKPLL
Sbjct  209  GLMVFQQFGGINGICFYLSNIFESA-------------------ALNTTVIDKAGRKPLL  249

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VS++GL L CIL+G S+YLK  N+A ++ P+LAVTGI++YIGSFS GMGAVPWV+MSEI
Sbjct  250  LVSSTGLVLACILSGTSFYLKDHNLAPSSVPILAVTGILMYIGSFSAGMGAVPWVVMSEI  309

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG+AGS ATLVNWFGAW  SYTFNFLM+W+S+GTFI+YA IN +AI+FVI VVPE
Sbjct  310  FPINIKGIAGSLATLVNWFGAWAVSYTFNFLMSWSSYGTFIIYAAINAVAIVFVITVVPE  369

Query  263  TKGRTLEQIQATINA  219
            TKGRTLEQIQA INA
Sbjct  370  TKGRTLEQIQAAINA  384



>gb|KJB47013.1| hypothetical protein B456_008G006300 [Gossypium raimondii]
Length=478

 Score =   368 bits (945),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 176/255 (69%), Positives = 213/255 (84%), Gaps = 6/255 (2%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEFE ALQ LRGK+ +IS+EA EI+DY+E LE+LPKAK+ DLFQ+RY  S+ IGV
Sbjct  230  KIGREKEFEAALQDLRGKDTNISKEADEIRDYIETLERLPKAKMMDLFQQRYLNSVIIGV  289

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFY S+IFE AGF + +GTIIYAILQV++T +  T+IDKAGRKPLL
Sbjct  290  GLMVFQQFGGINGICFYVSNIFEMAGFSAAVGTIIYAILQVVITGLNTTVIDKAGRKPLL  349

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VS++GL LGCIL+G        N+A +A P+LAVTGI++YI +FS GMGAVPWVIMSEI
Sbjct  350  LVSSTGLVLGCILSGDH------NLALDAVPILAVTGILIYISAFSAGMGAVPWVIMSEI  403

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS ATLVNWFGAW  SYTFNFLM+W+++GTFILYA IN  AILFV+ +VPE
Sbjct  404  FPINIKGAAGSLATLVNWFGAWAVSYTFNFLMSWSAYGTFILYAAINAGAILFVVTLVPE  463

Query  263  TKGRTLEQIQATINA  219
            TKG+TLEQIQA INA
Sbjct  464  TKGKTLEQIQAAINA  478



>ref|XP_010112685.1| Sugar transporter ERD6-like 7 [Morus notabilis]
 gb|EXC34643.1| Sugar transporter ERD6-like 7 [Morus notabilis]
Length=450

 Score =   365 bits (938),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 178/254 (70%), Positives = 207/254 (81%), Gaps = 20/254 (8%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KEFE +LQKLRGK+ADIS EAAEIQDY+  LE+LPKAKL DLFQKRY RSI IG+
Sbjct  216  KAGRHKEFEASLQKLRGKDADISHEAAEIQDYITTLEQLPKAKLLDLFQKRYLRSIIIGL  275

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+CQQ GGINGICFYTSSIFESAGF   +GTIIYAI+QV++T +GA ++DK GRKPLL
Sbjct  276  GLMVCQQFGGINGICFYTSSIFESAGFSPTLGTIIYAIIQVVITGLGAAVVDKVGRKPLL  335

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +  A  LAL                   A+P+LAVTGIM+YIGSFS GMGAVPW++MSEI
Sbjct  336  L--AHELAL------------------QASPILAVTGIMLYIGSFSAGMGAVPWIVMSEI  375

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS ATL+NWFGAWLCSY+FNFLMAW+S+GTFI+YA + VLAILF+I VVPE
Sbjct  376  FPINIKGQAGSLATLMNWFGAWLCSYSFNFLMAWSSYGTFIIYAAVYVLAILFIITVVPE  435

Query  263  TKGRTLEQIQATIN  222
            TKG+TLEQIQA IN
Sbjct  436  TKGKTLEQIQAAIN  449



>ref|XP_008449464.1| PREDICTED: sugar transporter ERD6-like 7 [Cucumis melo]
Length=473

 Score =   366 bits (939),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 169/249 (68%), Positives = 211/249 (85%), Gaps = 0/249 (0%)
 Frame = -3

Query  968  KEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGVGLMIC  789
            KEFE+AL+KLRG++ D+S+EAAEIQD+V  LE+LPK K+ DLFQ+ Y RS+ IGVGLM+C
Sbjct  224  KEFEMALRKLRGEDVDVSQEAAEIQDFVTTLEQLPKPKVTDLFQRMYLRSVIIGVGLMVC  283

Query  788  QQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLLVVSAS  609
            QQ GGIN ICFY ++IFESAGF   +GTI YAI+QV+VT +G  L+DKAGRKPLL+VSAS
Sbjct  284  QQFGGINSICFYVANIFESAGFSVFVGTISYAIIQVVVTGIGGLLMDKAGRKPLLLVSAS  343

Query  608  GLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINV  429
            GL LGC L  +++YL+   +A  AAP+L V G++VYIGSFS+GMG VPWV+MSEIFPIN+
Sbjct  344  GLVLGCTLDAIAFYLRENKLAIQAAPLLTVAGVLVYIGSFSIGMGPVPWVVMSEIFPINI  403

Query  428  KGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRT  249
            KG+AGS ATL NWFGAW CSYTFNFLMAW+S+GTF++YA +N +AI FV+ +VPETKG++
Sbjct  404  KGLAGSMATLTNWFGAWACSYTFNFLMAWSSYGTFLIYAVVNAMAIGFVVLIVPETKGKS  463

Query  248  LEQIQATIN  222
            LEQIQA IN
Sbjct  464  LEQIQAAIN  472



>ref|XP_002320384.1| sugar transporter family protein [Populus trichocarpa]
 gb|EEE98699.1| sugar transporter family protein [Populus trichocarpa]
Length=436

 Score =   365 bits (936),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 172/254 (68%), Positives = 207/254 (81%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KEFE  LQKLRG+ ADIS EA EI+DY+E LE+LPKAKL DLFQ+R   S+ IGV
Sbjct  183  KRGREKEFETTLQKLRGRAADISYEAIEIKDYIETLERLPKAKLLDLFQRRNLHSVLIGV  242

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGIN +CFY SSIFE AGF   +GTIIYAILQV+V A+  T+IDK GRKPLL
Sbjct  243  GLMVLQQFGGINAVCFYVSSIFEVAGFSPSVGTIIYAILQVVVVALNTTIIDKVGRKPLL  302

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSASGL + C++TG+S+YLK   +A  +AP+LAVTGI++YIG+FS GMG +PWVIMSEI
Sbjct  303  LVSASGLVIACLITGLSFYLKVHELALKSAPMLAVTGILLYIGTFSAGMGPIPWVIMSEI  362

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FP+N+KGV+GS ATLVNWF AW  S+TFNFLM+W+S+GTFILYA IN + I FV  +VPE
Sbjct  363  FPLNIKGVSGSLATLVNWFCAWAVSFTFNFLMSWSSYGTFILYAAINAMTIAFVALLVPE  422

Query  263  TKGRTLEQIQATIN  222
            TKGRTLEQIQA I 
Sbjct  423  TKGRTLEQIQAAIR  436



>ref|XP_003521224.1| PREDICTED: sugar transporter ERD6-like 7-like [Glycine max]
Length=471

 Score =   365 bits (937),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 176/255 (69%), Positives = 210/255 (82%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + GH K+F  ALQ LRGK+ADISEEA EIQDY+  LE+LPK+ L +LF +RY RS+ IG+
Sbjct  217  KRGHKKDFVAALQILRGKDADISEEAEEIQDYITSLEQLPKSSLLELFHRRYLRSVTIGI  276

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+CQQ GGINGICFY SSIFE AGF   IGTI YA LQ+++T +GA  IDKAGRKPLL
Sbjct  277  GLMVCQQFGGINGICFYASSIFEQAGFSPTIGTITYACLQIVITGLGAAFIDKAGRKPLL  336

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++S SGL  GCI   V++YLK   +   A P LAVTGI+VYIGSFS+GMGA+PWV+MSEI
Sbjct  337  LLSGSGLVAGCIFAAVAFYLKVHEVGVEAVPALAVTGILVYIGSFSIGMGAIPWVVMSEI  396

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FP+NVKG+AGS ATL NWFGAWLCSYTFNFLM+W+S+GTFILYA IN LAILF+I  VPE
Sbjct  397  FPVNVKGLAGSVATLTNWFGAWLCSYTFNFLMSWSSYGTFILYAAINALAILFIIVAVPE  456

Query  263  TKGRTLEQIQATINA  219
            TKG++LEQ+QA IN+
Sbjct  457  TKGKSLEQLQADINS  471



>ref|XP_010107672.1| Sugar transporter ERD6-like 7 [Morus notabilis]
 gb|EXC16583.1| Sugar transporter ERD6-like 7 [Morus notabilis]
Length=448

 Score =   362 bits (929),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 176/252 (70%), Positives = 205/252 (81%), Gaps = 20/252 (8%)
 Frame = -3

Query  977  GHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGVGL  798
            G  KEFE +LQKLRGK+ADIS EAAEIQDY+  LE+LPKAKL DLFQKRY RSI IG+GL
Sbjct  216  GRHKEFEASLQKLRGKDADISHEAAEIQDYITTLEQLPKAKLLDLFQKRYLRSIIIGLGL  275

Query  797  MICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLLVV  618
            M+CQQ GGINGICFYTSSIFESAGF   +GTIIYAI+QV+VT +GA ++D+ GRKPLL+ 
Sbjct  276  MVCQQFGGINGICFYTSSIFESAGFSPTLGTIIYAIIQVMVTGLGAAVVDRVGRKPLLL-  334

Query  617  SASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFP  438
             A  LAL                   A+P+LAVTGIM+YIGSFS GMGAVPW++MSEIFP
Sbjct  335  -AHELAL------------------QASPILAVTGIMLYIGSFSAGMGAVPWIVMSEIFP  375

Query  437  INVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETK  258
            IN+KG AGS ATL+NWFGAWLCSY+FNFLMAW+S+GTFI YA + V+AILF+I VVPETK
Sbjct  376  INIKGQAGSLATLMNWFGAWLCSYSFNFLMAWSSYGTFIFYAAVYVMAILFIITVVPETK  435

Query  257  GRTLEQIQATIN  222
            G+TLE+IQA IN
Sbjct  436  GKTLEEIQAAIN  447



>ref|XP_007162380.1| hypothetical protein PHAVU_001G147200g [Phaseolus vulgaris]
 gb|ESW34374.1| hypothetical protein PHAVU_001G147200g [Phaseolus vulgaris]
Length=472

 Score =   363 bits (931),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 175/255 (69%), Positives = 211/255 (83%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  K+FE ALQ LRGK+ADISEEA E+QDY+  LE+LPK++L +LF +RY RS+ IG+
Sbjct  218  KRGQQKDFEAALQILRGKDADISEEAKEVQDYITTLEQLPKSRLLELFHRRYLRSVTIGI  277

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+CQQ GGINGICFYTSSIFE AGF   IGTI YA LQ+++T +GA LIDKAGRKPLL
Sbjct  278  GLMVCQQFGGINGICFYTSSIFELAGFSPTIGTIAYACLQIVITGLGAALIDKAGRKPLL  337

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++S SGL  GCI   V++YLK   +   A P LAVTGI+VYIGSFS+GMGA+PWV+MSEI
Sbjct  338  LLSGSGLVAGCIFIAVAFYLKVYEVGAAAVPALAVTGILVYIGSFSIGMGAIPWVVMSEI  397

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FP+N+KG AGS ATL NWFGAWLCSYTFNFLM+ +S+GTFILYA IN LAILF+I  VPE
Sbjct  398  FPVNIKGQAGSLATLTNWFGAWLCSYTFNFLMSCSSYGTFILYAAINALAILFIIVAVPE  457

Query  263  TKGRTLEQIQATINA  219
            TKG++LEQ+QA IN+
Sbjct  458  TKGKSLEQLQAAINS  472



>ref|XP_004292610.1| PREDICTED: sugar transporter ERD6-like 7 [Fragaria vesca subsp. 
vesca]
Length=491

 Score =   363 bits (933),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 174/268 (65%), Positives = 217/268 (81%), Gaps = 4/268 (1%)
 Frame = -3

Query  977  GHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGVGL  798
            G  ++FEV LQKLRGK  D+S EAAEIQ+Y+  L  LP++KL DLFQKRY  S+   V L
Sbjct  222  GRHEDFEVVLQKLRGKEVDVSYEAAEIQNYIATLNSLPRSKLLDLFQKRYLPSVLTAVFL  281

Query  797  MICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLLVV  618
            M+ Q+LGGING+CFY S IFE AGF S +GTIIYAILQV+VT +GA+++DKAGRKPL++ 
Sbjct  282  MVFQELGGINGVCFYVSDIFEQAGFSSTVGTIIYAILQVVVTGIGASIMDKAGRKPLILS  341

Query  617  SASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFP  438
            SASGL LGC++T ++++L    +A   APVLAVTGI+++IG+FS+GMGAVPW IMSEIFP
Sbjct  342  SASGLLLGCVVTAIAFFLTAQELALTVAPVLAVTGILIFIGAFSIGMGAVPWTIMSEIFP  401

Query  437  INVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETK  258
            IN+KG AGS ATLVNWFGAWLCSYTFNFLM+W+++GTFILYA IN LAI+FVI  VPETK
Sbjct  402  INIKGQAGSLATLVNWFGAWLCSYTFNFLMSWSTYGTFILYAAINALAIVFVIFFVPETK  461

Query  257  GRTLEQIQATINA*SRTRRHKN-SRQDG  177
            G+TLE+IQA I   S+    +N  R++G
Sbjct  462  GKTLEEIQAAI---SKEGSEENIKRRNG  486



>ref|XP_003554233.1| PREDICTED: sugar transporter ERD6-like 7-like isoform 1 [Glycine 
max]
Length=466

 Score =   361 bits (927),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 174/255 (68%), Positives = 210/255 (82%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  K+F  ALQ LRG +ADISEEA EIQDY+  LE+LPK++L +LF +RY RS+ IG+
Sbjct  212  KRGREKDFVAALQILRGNDADISEEAEEIQDYITTLERLPKSRLLELFHRRYLRSVTIGI  271

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+CQQ GGINGICFYTSSIFE AGF   IGTI YA LQ+++T +GA LIDKAGRKPLL
Sbjct  272  GLMVCQQFGGINGICFYTSSIFELAGFSPTIGTITYACLQIVITGLGAALIDKAGRKPLL  331

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++S SGL  GC    V++YLK   +   A P LAVTGI+VYIGSFS+GMGA+PWV+MSEI
Sbjct  332  LLSGSGLVAGCTFVAVAFYLKVHEVGVEAVPALAVTGILVYIGSFSIGMGAIPWVVMSEI  391

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FP+N+KG+AGS ATLVNWFGAWLCSYTFNF M+W+S+GTFILYA IN LAILF+I  VPE
Sbjct  392  FPVNIKGLAGSVATLVNWFGAWLCSYTFNFFMSWSSYGTFILYAAINALAILFIIVAVPE  451

Query  263  TKGRTLEQIQATINA  219
            TKG++LEQ+QA IN+
Sbjct  452  TKGKSLEQLQADINS  466



>gb|KHN45387.1| Sugar transporter ERD6-like 7 [Glycine soja]
Length=437

 Score =   357 bits (917),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 173/255 (68%), Positives = 208/255 (82%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  K+F  ALQ LRG +ADISEEA EIQDY+  LE+LPK++L +LF +RY RS+ IG+
Sbjct  183  KRGREKDFVAALQILRGNDADISEEAEEIQDYITTLERLPKSRLLELFHRRYLRSVTIGI  242

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+CQQ GGINGICFYTSSIFE AGF   IGTI YA LQ+++T +GA LIDKAGRKPLL
Sbjct  243  GLMVCQQFGGINGICFYTSSIFELAGFSPTIGTITYACLQIVITGLGAALIDKAGRKPLL  302

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++S SGL  GC    V++YLK         P LAVTGI+VYIGSFS+GMGA+PWV+MSEI
Sbjct  303  LLSGSGLVAGCTFVAVAFYLKAHPNCEPYIPALAVTGILVYIGSFSIGMGAIPWVVMSEI  362

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FP+N+KG+AGS ATLVNWFGAWLCSYTFNF M+W+S+GTFILYA IN LAILF+I  VPE
Sbjct  363  FPVNIKGLAGSVATLVNWFGAWLCSYTFNFFMSWSSYGTFILYAAINALAILFIIVAVPE  422

Query  263  TKGRTLEQIQATINA  219
            TKG++LEQ+QA IN+
Sbjct  423  TKGKSLEQLQADINS  437



>ref|XP_011033659.1| PREDICTED: sugar transporter ERD6-like 7 [Populus euphratica]
Length=482

 Score =   357 bits (916),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/254 (67%), Positives = 204/254 (80%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KEFE  LQKLRG+ ADIS EA EI+DY E LE+LPKAKL DLFQ+R   S+ IGV
Sbjct  229  KRGREKEFETTLQKLRGRAADISYEAIEIKDYTETLERLPKAKLLDLFQRRNLHSVLIGV  288

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGIN +CFY SSIFE AGF   +GTIIYAILQV+V A+  T+IDK GRKPLL
Sbjct  289  GLMVLQQFGGINAVCFYASSIFEVAGFSPSLGTIIYAILQVVVVALNTTIIDKVGRKPLL  348

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            + SASGL + C++TG+S+YLK   +A  +AP+LAV GI+++IG+FS GMG +PWVIMSEI
Sbjct  349  LFSASGLVIACLITGLSFYLKVHELALKSAPMLAVIGILLFIGTFSAGMGPIPWVIMSEI  408

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FP+N+KGVAGS ATLVNWF AW  S+TFNFLM+W+S+GTFILYA IN + I FV  +VPE
Sbjct  409  FPLNIKGVAGSLATLVNWFCAWAVSFTFNFLMSWSSYGTFILYAAINAMTIAFVALLVPE  468

Query  263  TKGRTLEQIQATIN  222
            TKGRTLEQIQA I 
Sbjct  469  TKGRTLEQIQAAIR  482



>ref|XP_010242562.1| PREDICTED: sugar transporter ERD6-like 7 [Nelumbo nucifera]
Length=497

 Score =   357 bits (917),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 168/254 (66%), Positives = 211/254 (83%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  K+FE AL+KLRG+++DISEEA+EI DY+E L  LPKA LFDLFQ+RY   + +GV
Sbjct  242  KVGRQKDFEDALRKLRGRDSDISEEASEILDYIETLRFLPKANLFDLFQRRYLYPVIVGV  301

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFY S IFE+AGFPS+IGTIIYA +Q  +T  GA LID+AGR+PLL
Sbjct  302  GLMVFQQFGGINGICFYVSHIFEAAGFPSNIGTIIYACIQFPITGFGALLIDRAGRRPLL  361

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
             VSASGL +GC+L   S+Y+K   I+  + P+LA+ GIMVYI SFS+GMGAVPWVIMSE+
Sbjct  362  FVSASGLFVGCVLLSTSFYMKVHEISLGSVPILALIGIMVYIASFSMGMGAVPWVIMSEV  421

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG+ GS  TLVNW G+W+ S+TFNFLM+W+S+GTF LYA +N+LAILFV K+VPE
Sbjct  422  FPINIKGIGGSLVTLVNWSGSWVVSFTFNFLMSWSSYGTFGLYALVNLLAILFVSKLVPE  481

Query  263  TKGRTLEQIQATIN  222
            TKGRTLE+IQA++N
Sbjct  482  TKGRTLEEIQASMN  495



>ref|XP_010070278.1| PREDICTED: sugar transporter ERD6-like 7 isoform X2 [Eucalyptus 
grandis]
Length=463

 Score =   355 bits (911),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 169/254 (67%), Positives = 205/254 (81%), Gaps = 18/254 (7%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KEFE ALQKLRGK+ADISEEAAEIQDY+E L+ LPKA + DLFQ+RY  S+ IGV
Sbjct  226  KTGREKEFEAALQKLRGKDADISEEAAEIQDYIETLQLLPKASILDLFQRRYLSSVIIGV  285

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGING+CFYTS+IFE AGF S +GTI YAILQVIVTA+GA L+D+AGRKPLL
Sbjct  286  GLMVVQQFGGINGVCFYTSNIFEEAGFSSSVGTITYAILQVIVTAIGAALVDRAGRKPLL  345

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++S +GL LGCI+T +S++LK  ++A +A P+LAVTGI++YI +FS GMGAVPWV+MSEI
Sbjct  346  LISGTGLVLGCIVTALSFFLKVHDLAADAVPILAVTGILLYIAAFSAGMGAVPWVVMSEI  405

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAG FATLVNWFGAW  SYTFN+LM+W+S+GTF+                  E
Sbjct  406  FPINIKGVAGGFATLVNWFGAWAVSYTFNYLMSWSSYGTFL------------------E  447

Query  263  TKGRTLEQIQATIN  222
            TKGR+LEQIQA IN
Sbjct  448  TKGRSLEQIQAAIN  461



>ref|XP_010279395.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Nelumbo 
nucifera]
Length=478

 Score =   345 bits (884),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/254 (65%), Positives = 203/254 (80%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  +EFE+ALQKLRGK+AD+S+EAAEIQDY+E L+ LPKAK+ DLF++RY R + +GV
Sbjct  224  KVGRKREFEIALQKLRGKDADVSDEAAEIQDYIETLQLLPKAKMVDLFERRYIRPVIVGV  283

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQLGGINGI FY S  F  AG    +GTI YA LQV +T VGA L+DK+GR+PLL
Sbjct  284  GLMVFQQLGGINGIGFYASETFVEAGSSGKVGTIAYACLQVPITIVGAFLMDKSGRRPLL  343

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+G  LGC LTG+S+YLKG  +     P+LAV+G+++YIGSFS+GMGAVPWV+MSEI
Sbjct  344  IVSATGTFLGCFLTGISFYLKGHQLLHAWVPMLAVSGVLIYIGSFSIGMGAVPWVMMSEI  403

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS  TLVNW GAW  SYTFN LM  +S GTF+ YA    L +LFV KVVPE
Sbjct  404  FPINIKGAAGSLVTLVNWLGAWAVSYTFNLLMNLSSSGTFLFYAGFCALTVLFVAKVVPE  463

Query  263  TKGRTLEQIQATIN  222
            TKGRTLE+IQA++N
Sbjct  464  TKGRTLEEIQASMN  477



>gb|KEH23691.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=457

 Score =   343 bits (880),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 167/255 (65%), Positives = 199/255 (78%), Gaps = 20/255 (8%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + GH K+F  ALQ LRGK+ADISEEA EIQDY+  LE+L K K+ DLFQ+RY RS+ IGV
Sbjct  223  KRGHAKDFVAALQILRGKDADISEEAGEIQDYITSLEQLAKPKVLDLFQRRYLRSLTIGV  282

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+CQQLGGING+CFYTSSIF+ AGFPS  G+IIYAILQ+++T VGA LID+AGRKPLL
Sbjct  283  GLMVCQQLGGINGVCFYTSSIFDLAGFPSATGSIIYAILQIVITGVGAALIDRAGRKPLL  342

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VS SGL  GCI T V++YLK  ++A  A P LAVTGI+                    I
Sbjct  343  LVSGSGLVAGCIFTAVAFYLKVHDVAVGAVPALAVTGIL--------------------I  382

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FP+N+KG AGS ATLVNWFGAWLCSYTFNFLM+W+S+GTF+LYA IN LAILF+  VVPE
Sbjct  383  FPVNIKGQAGSIATLVNWFGAWLCSYTFNFLMSWSSYGTFVLYAAINALAILFIAVVVPE  442

Query  263  TKGRTLEQIQATINA  219
            TKG++LEQ+QA INA
Sbjct  443  TKGKSLEQLQAAINA  457



>ref|XP_010242566.1| PREDICTED: sugar transporter ERD6-like 7 isoform X3 [Nelumbo 
nucifera]
Length=452

 Score =   340 bits (873),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 172/254 (68%), Positives = 198/254 (78%), Gaps = 27/254 (11%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G+ KEF+ AL++LRGK+ADIS EAAEIQ                           +GV
Sbjct  224  KMGYQKEFDAALRRLRGKDADISHEAAEIQ---------------------------VGV  256

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGICFY S IF SAGFPSD+GTI YA LQV++TA+GA L+DKAGR+PLL
Sbjct  257  GLMVFQQFGGINGICFYVSQIFVSAGFPSDVGTITYACLQVVITALGAFLMDKAGRRPLL  316

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSASGL LGCILT +S+YLK   ++  + P LAVTGI+VYIGSFS GMGA PWVIMSEI
Sbjct  317  LVSASGLVLGCILTAISFYLKVHELSIKSVPALAVTGILVYIGSFSAGMGATPWVIMSEI  376

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPINVKG+AGS ATLVNWFGAW  SYTFNFLM+W+S+GTFILYA IN LAILFV KVVPE
Sbjct  377  FPINVKGIAGSLATLVNWFGAWAISYTFNFLMSWSSYGTFILYAAINGLAILFVAKVVPE  436

Query  263  TKGRTLEQIQATIN  222
            TKGRTLEQIQA IN
Sbjct  437  TKGRTLEQIQAAIN  450



>ref|XP_007222121.1| hypothetical protein PRUPE_ppa004636mg [Prunus persica]
 gb|EMJ23320.1| hypothetical protein PRUPE_ppa004636mg [Prunus persica]
Length=499

 Score =   340 bits (872),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/263 (61%), Positives = 207/263 (79%), Gaps = 1/263 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++GH KEF++ALQ+LRGK+ADIS+E AEIQ+Y+  L+ LPKAKL DLF+  + RS+ IGV
Sbjct  235  KIGHEKEFQIALQRLRGKHADISDEMAEIQEYIFTLQSLPKAKLLDLFKSEHIRSVIIGV  294

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGI FY S  FE AG  S  GTI YA +QV +T VGATLIDK+GR+PL+
Sbjct  295  GLMVFQQFGGINGIGFYASQTFEEAGISSKTGTIAYACVQVPITMVGATLIDKSGRRPLI  354

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+G  LGC L G S++LKG  +  +  P++AV+G++ YI SFS+GMGAVPWVIMSEI
Sbjct  355  MVSATGTFLGCFLAGTSFFLKGYGLLLDWVPIIAVSGVLTYIASFSIGMGAVPWVIMSEI  414

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPI+VKG AGS   LVNW GAW  SYT+NFLM+W+S GT+ +Y+  ++L ILFV K+VPE
Sbjct  415  FPIHVKGAAGSLVVLVNWLGAWAISYTYNFLMSWSSSGTYYIYSGFSLLTILFVAKLVPE  474

Query  263  TKGRTLEQIQATINA*SRTRRHK  195
            TKG+TLE+IQ+ IN+  R+RR  
Sbjct  475  TKGKTLEEIQSCINS-GRSRRQD  496



>ref|XP_006356995.1| PREDICTED: sugar transporter ERD6-like 16-like [Solanum tuberosum]
 ref|XP_006358532.1| PREDICTED: sugar transporter ERD6-like 16-like [Solanum tuberosum]
Length=472

 Score =   338 bits (868),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 168/256 (66%), Positives = 204/256 (80%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEFEVAL+KLRGK+AD+S EAAEIQ YV+ L+ LPK ++FDLF  +Y RS+ IGV
Sbjct  217  KVGLEKEFEVALRKLRGKDADVSREAAEIQAYVDTLQSLPKTRIFDLFSSKYIRSVIIGV  276

Query  803  GLMICQQLGGINGICFYTSSIFESAGFP-SDIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ  GINGI FY S  FESAG   S+IGTI YA++QV +T VGA L+D++GR+PL
Sbjct  277  GLMVFQQFIGINGIGFYASQTFESAGLSNSNIGTIAYAVVQVPITIVGAFLMDRSGRRPL  336

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSA+G  LGC LTG S+YLKG +I     P+LAV+G++VYI +FS+GMGAVPWVIMSE
Sbjct  337  LMVSATGTFLGCFLTGASFYLKGNDILLEWVPILAVSGVLVYISAFSIGMGAVPWVIMSE  396

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPI+VK  AGS   LVNW GAW  SYTF FLMAW S GTF+LYA  +VL ILFV KVVP
Sbjct  397  IFPIHVKSAAGSLVVLVNWLGAWAVSYTFGFLMAWTSTGTFMLYAGFSVLTILFVAKVVP  456

Query  266  ETKGRTLEQIQATINA  219
            ETKG+TLE+IQA IN+
Sbjct  457  ETKGKTLEEIQAIINS  472



>gb|AJU57223.1| sugar transporter ERD6-like 16 [Camellia sinensis]
Length=490

 Score =   337 bits (863),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 162/255 (64%), Positives = 204/255 (80%), Gaps = 1/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEFE ALQ+LRG +AD+S EAAEIQ Y++ L+ LPKA L DLF ++Y RS+ IGV
Sbjct  231  KVGLEKEFEAALQRLRGNDADVSREAAEIQTYIKTLQSLPKAGLLDLFDRKYIRSVIIGV  290

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ GGINGI FY S  F +AG  S +IGT+ YAI+QV +T VGA L+DK+GR+PL
Sbjct  291  GLMVFQQFGGINGISFYASQTFVAAGLSSGNIGTVAYAIIQVPITIVGAVLMDKSGRRPL  350

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSA+G  LGC LTG S++LKG ++     P+LAV+G+++YI +FS+GMGAVPWVIMSE
Sbjct  351  LMVSATGTFLGCFLTGASFFLKGQSLLLGWVPILAVSGVLIYISAFSIGMGAVPWVIMSE  410

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPI+VKGVAGS   LVNW GAW  SYTFNFLM+W+S GTF+LY+    L +LFV KVVP
Sbjct  411  IFPIHVKGVAGSLVVLVNWLGAWAVSYTFNFLMSWSSTGTFLLYSVFCALTVLFVAKVVP  470

Query  266  ETKGRTLEQIQATIN  222
            ETKG+TLE+IQA+IN
Sbjct  471  ETKGKTLEEIQASIN  485



>ref|XP_008223080.1| PREDICTED: sugar transporter ERD6-like 16 [Prunus mume]
Length=499

 Score =   337 bits (863),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 160/263 (61%), Positives = 204/263 (78%), Gaps = 1/263 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++GH KEF+ ALQ LRGK+ADIS+E AEIQ+Y+  L+ LPKAKL DLF+ ++ R + IGV
Sbjct  235  KIGHEKEFQTALQILRGKHADISDEMAEIQEYIVTLQSLPKAKLLDLFKSKHIRPVIIGV  294

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGI FY S  FE AG  S  GTI YA +QV +T VGATLIDK+GR+PL+
Sbjct  295  GLMVFQQFGGINGIGFYASQTFEEAGISSKTGTIAYACVQVPITMVGATLIDKSGRRPLI  354

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+G  LGC L G S++LKG  +  +  P++AV+G++ YI SFS+GMGAVPWVIMSEI
Sbjct  355  MVSATGTFLGCFLAGTSFFLKGYGLLLDWVPIIAVSGVLTYIASFSIGMGAVPWVIMSEI  414

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPI+VKG AGS   LVNW GAW  SYT+NFLM+W+S GT+ +Y   ++L ILFV K+VPE
Sbjct  415  FPIHVKGAAGSLVVLVNWLGAWAISYTYNFLMSWSSSGTYYIYTGFSLLTILFVAKLVPE  474

Query  263  TKGRTLEQIQATINA*SRTRRHK  195
            TKG+TLE+IQ+ IN+  R+RR  
Sbjct  475  TKGKTLEEIQSCINS-DRSRRQD  496



>emb|CBI26138.3| unnamed protein product [Vitis vinifera]
 gb|ADP37170.1| putative ERD6-like transporter [Vitis vinifera]
Length=438

 Score =   333 bits (853),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 163/256 (64%), Positives = 202/256 (79%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEFEVAL++LRGK+AD+S+EAAEIQ Y+E L+  PKAK+ DLFQ +Y RS+ IGV
Sbjct  183  KVGREKEFEVALRRLRGKDADVSKEAAEIQVYIENLQSFPKAKMLDLFQTKYIRSLIIGV  242

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSD-IGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ GGINGI FY S  F SAG  S  IGTI YA +QV +T VGA L+DK+GR+PL
Sbjct  243  GLMVFQQFGGINGIGFYVSETFVSAGLSSSKIGTIAYACIQVPITIVGAILMDKSGRRPL  302

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSASG  LGC LTG S++LK   +  +  PVLA+ G+++YI SFS+GMGAVPWVIMSE
Sbjct  303  LMVSASGTFLGCFLTGASFFLKSNAMLLDWVPVLAIGGVLLYIASFSIGMGAVPWVIMSE  362

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPINVKG AGS   LVNW GAW+ SYTFNFLM+W+  GTF +YA  + + ILFV K+VP
Sbjct  363  IFPINVKGAAGSLVVLVNWLGAWVVSYTFNFLMSWSPTGTFSIYAGFSAMTILFVAKIVP  422

Query  266  ETKGRTLEQIQATINA  219
            ETKG+TLE+IQA I++
Sbjct  423  ETKGKTLEEIQACIDS  438



>ref|XP_009603615.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Nicotiana 
tomentosiformis]
Length=386

 Score =   331 bits (848),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 165/256 (64%), Positives = 204/256 (80%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEFEVAL+KLRGK+ADIS EAAEIQ YV+ L+ LPKA++ DLF  +Y RS+ IG+
Sbjct  131  KVGLEKEFEVALRKLRGKDADISLEAAEIQAYVDTLQSLPKARILDLFGSKYIRSVIIGI  190

Query  803  GLMICQQLGGINGICFYTSSIFESAGFP-SDIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ  GINGI FY S  FESAG   S+IGTI YAI+QV +T VGA L+D++GR+PL
Sbjct  191  GLMVFQQFIGINGIGFYASQTFESAGLKNSNIGTIAYAIVQVPITVVGAFLMDRSGRRPL  250

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSA+G  +GC +TG S+YLKG  I     P+LAV+G++VYI +FS+GMGAVPWVIMSE
Sbjct  251  LMVSATGTFIGCFMTGASFYLKGNGILLEWVPILAVSGVLVYISAFSIGMGAVPWVIMSE  310

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPI+VK  AGS   LVNW GAW  S+TF+FLMAW++ GTF+LYA   VL ILFV KVVP
Sbjct  311  IFPIHVKSAAGSLVVLVNWLGAWAVSFTFSFLMAWSATGTFMLYAGFCVLTILFVAKVVP  370

Query  266  ETKGRTLEQIQATINA  219
            ETKG+TLE+IQA IN+
Sbjct  371  ETKGKTLEEIQAIINS  386



>ref|XP_008795113.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Phoenix 
dactylifera]
Length=461

 Score =   333 bits (853),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 158/256 (62%), Positives = 207/256 (81%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  K+FEVALQ+LRGK+ADIS+EAAEIQ+ +E L+ LPKA+  DLFQ +Y RS+ IGV
Sbjct  204  KVGRQKDFEVALQRLRGKDADISQEAAEIQENIETLQILPKARFQDLFQSKYVRSVIIGV  263

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQLGGINGI FY S  F SAGF S  +GTI++  +QV +T +GA L+D++GRKPL
Sbjct  264  GLMMFQQLGGINGIGFYASETFVSAGFSSGTLGTILFGSIQVPITILGAILMDRSGRKPL  323

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            ++VSA+G  +GC +TGVS+YLKG  +     P+LA+ GI+VYIG+FS+GMGAVPWVIMSE
Sbjct  324  IMVSATGTLIGCFVTGVSFYLKGQGMHAEWVPILALAGIIVYIGAFSIGMGAVPWVIMSE  383

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KG+ G   TLVNWFG+W  SY+FNFLM+W+S GTF +++  +   ILFV +VVP
Sbjct  384  IFPINIKGIGGGLVTLVNWFGSWAISYSFNFLMSWSSAGTFFIFSAASAATILFVARVVP  443

Query  266  ETKGRTLEQIQATINA  219
            ETKGRTLE+IQA++N+
Sbjct  444  ETKGRTLEEIQASLNS  459



>ref|XP_011462680.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=404

 Score =   330 bits (847),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 157/264 (59%), Positives = 204/264 (77%), Gaps = 3/264 (1%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++GH KEF+VALQ+LRGK ADIS+E AEI++Y+  L+ LPK+++ DLFQ +Y RS+ IGV
Sbjct  141  KIGHEKEFQVALQRLRGKYADISDETAEIKEYILTLQSLPKSRVLDLFQSKYVRSVIIGV  200

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGI FY S  FE AG  S IGTI YA +QV +T VGA LIDK+GR+PL+
Sbjct  201  GLMVFQQFGGINGIGFYASQTFEEAGISSKIGTIAYACVQVPITVVGAMLIDKSGRRPLI  260

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+G  LGC L G S++LK   +  +  P +AV+G+++YI  FS+GMGAVPWVIMSEI
Sbjct  261  MVSATGTFLGCFLAGTSFFLKEYGLLLHWVPTIAVSGVLIYIAFFSIGMGAVPWVIMSEI  320

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPI+VKG AGS   LVNW GAW  SYT+NFLM W+S+ T+ +Y+  ++L ILFV K+VPE
Sbjct  321  FPIHVKGAAGSLVVLVNWLGAWGVSYTYNFLMRWSSYRTYYMYSGFSLLTILFVAKLVPE  380

Query  263  TKGRTLEQIQATINA*SRTRRHKN  192
            TKG+TLE+IQA IN+    RR ++
Sbjct  381  TKGKTLEEIQACINS---DRREQD  401



>ref|XP_008795112.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Phoenix 
dactylifera]
Length=483

 Score =   333 bits (853),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 158/256 (62%), Positives = 207/256 (81%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  K+FEVALQ+LRGK+ADIS+EAAEIQ+ +E L+ LPKA+  DLFQ +Y RS+ IGV
Sbjct  226  KVGRQKDFEVALQRLRGKDADISQEAAEIQENIETLQILPKARFQDLFQSKYVRSVIIGV  285

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQLGGINGI FY S  F SAGF S  +GTI++  +QV +T +GA L+D++GRKPL
Sbjct  286  GLMMFQQLGGINGIGFYASETFVSAGFSSGTLGTILFGSIQVPITILGAILMDRSGRKPL  345

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            ++VSA+G  +GC +TGVS+YLKG  +     P+LA+ GI+VYIG+FS+GMGAVPWVIMSE
Sbjct  346  IMVSATGTLIGCFVTGVSFYLKGQGMHAEWVPILALAGIIVYIGAFSIGMGAVPWVIMSE  405

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KG+ G   TLVNWFG+W  SY+FNFLM+W+S GTF +++  +   ILFV +VVP
Sbjct  406  IFPINIKGIGGGLVTLVNWFGSWAISYSFNFLMSWSSAGTFFIFSAASAATILFVARVVP  465

Query  266  ETKGRTLEQIQATINA  219
            ETKGRTLE+IQA++N+
Sbjct  466  ETKGRTLEEIQASLNS  481



>ref|XP_004229493.1| PREDICTED: sugar transporter ERD6-like 16 [Solanum lycopersicum]
Length=468

 Score =   332 bits (850),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/256 (64%), Positives = 203/256 (79%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEFEVAL+KLRGK+AD++ EAAEIQ YV+ L+ +PK ++FDLF  +Y RS+ IGV
Sbjct  213  KVGLEKEFEVALRKLRGKDADVTREAAEIQAYVDTLQSIPKTQIFDLFGSKYIRSVIIGV  272

Query  803  GLMICQQLGGINGICFYTSSIFESAGFP-SDIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ  GINGI FY S  FESAG   S++GTI YA++QV +T +GA L+D++GR+PL
Sbjct  273  GLMVFQQFVGINGIGFYASQTFESAGLSNSNVGTIAYAVVQVPITILGAFLMDRSGRRPL  332

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSA+G  +GC LTG S+YLKG +I     P+LAV+G++VYI +FS+GMGAVPWVIMSE
Sbjct  333  LMVSATGTFVGCFLTGASFYLKGNDILLEWVPILAVSGVLVYISAFSIGMGAVPWVIMSE  392

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPI VK  AGS   LVNW GAW  SYTF FLMAW S GTF+LYA  +VL ILFV KVVP
Sbjct  393  IFPIQVKSAAGSLVVLVNWLGAWAVSYTFGFLMAWTSTGTFMLYAGFSVLTILFVAKVVP  452

Query  266  ETKGRTLEQIQATINA  219
            ETKG+TLE+IQA IN+
Sbjct  453  ETKGKTLEEIQAIINS  468



>ref|XP_002278197.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Vitis vinifera]
Length=492

 Score =   332 bits (852),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/256 (64%), Positives = 202/256 (79%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEFEVAL++LRGK+AD+S+EAAEIQ Y+E L+  PKAK+ DLFQ +Y RS+ IGV
Sbjct  237  KVGREKEFEVALRRLRGKDADVSKEAAEIQVYIENLQSFPKAKMLDLFQTKYIRSLIIGV  296

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSD-IGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ GGINGI FY S  F SAG  S  IGTI YA +QV +T VGA L+DK+GR+PL
Sbjct  297  GLMVFQQFGGINGIGFYVSETFVSAGLSSSKIGTIAYACIQVPITIVGAILMDKSGRRPL  356

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSASG  LGC LTG S++LK   +  +  PVLA+ G+++YI SFS+GMGAVPWVIMSE
Sbjct  357  LMVSASGTFLGCFLTGASFFLKSNAMLLDWVPVLAIGGVLLYIASFSIGMGAVPWVIMSE  416

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPINVKG AGS   LVNW GAW+ SYTFNFLM+W+  GTF +YA  + + ILFV K+VP
Sbjct  417  IFPINVKGAAGSLVVLVNWLGAWVVSYTFNFLMSWSPTGTFSIYAGFSAMTILFVAKIVP  476

Query  266  ETKGRTLEQIQATINA  219
            ETKG+TLE+IQA I++
Sbjct  477  ETKGKTLEEIQACIDS  492



>gb|KJB28573.1| hypothetical protein B456_005G056400 [Gossypium raimondii]
Length=480

 Score =   331 bits (849),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/256 (61%), Positives = 201/256 (79%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF+VAL+KLRGK+ADI++EAAEIQ Y+E L+ LPK ++ DLFQ +Y RS+ IGV
Sbjct  225  KVGQNKEFQVALRKLRGKDADITQEAAEIQMYIETLQSLPKTRMLDLFQPKYIRSVMIGV  284

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
             LM+ QQ GGINGI FY S  F SAG  S   GTI YA +QV +T VGA L+DK+GR+PL
Sbjct  285  ALMVFQQFGGINGISFYASETFASAGLSSGKAGTIAYACVQVPITVVGAMLMDKSGRRPL  344

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            ++VSA+G  LGC ++G S+YLK  N+     P+LAV G+++Y+ SFS+GMGAVPWVIMSE
Sbjct  345  IMVSAAGTFLGCFMSGTSFYLKEHNLLPEWVPILAVGGVLIYVASFSIGMGAVPWVIMSE  404

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KGVAGS   LVNW GAW  SYTFNFLM+W+S GTF +Y+  +++ IL+V K VP
Sbjct  405  IFPINIKGVAGSLVVLVNWLGAWAVSYTFNFLMSWSSSGTFFIYSGFSLMTILYVAKFVP  464

Query  266  ETKGRTLEQIQATINA  219
            ETKG+TLE+IQA IN+
Sbjct  465  ETKGKTLEEIQACINS  480



>ref|XP_009603614.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Nicotiana 
tomentosiformis]
Length=481

 Score =   330 bits (847),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 165/256 (64%), Positives = 204/256 (80%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEFEVAL+KLRGK+ADIS EAAEIQ YV+ L+ LPKA++ DLF  +Y RS+ IG+
Sbjct  226  KVGLEKEFEVALRKLRGKDADISLEAAEIQAYVDTLQSLPKARILDLFGSKYIRSVIIGI  285

Query  803  GLMICQQLGGINGICFYTSSIFESAGFP-SDIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ  GINGI FY S  FESAG   S+IGTI YAI+QV +T VGA L+D++GR+PL
Sbjct  286  GLMVFQQFIGINGIGFYASQTFESAGLKNSNIGTIAYAIVQVPITVVGAFLMDRSGRRPL  345

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSA+G  +GC +TG S+YLKG  I     P+LAV+G++VYI +FS+GMGAVPWVIMSE
Sbjct  346  LMVSATGTFIGCFMTGASFYLKGNGILLEWVPILAVSGVLVYISAFSIGMGAVPWVIMSE  405

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPI+VK  AGS   LVNW GAW  S+TF+FLMAW++ GTF+LYA   VL ILFV KVVP
Sbjct  406  IFPIHVKSAAGSLVVLVNWLGAWAVSFTFSFLMAWSATGTFMLYAGFCVLTILFVAKVVP  465

Query  266  ETKGRTLEQIQATINA  219
            ETKG+TLE+IQA IN+
Sbjct  466  ETKGKTLEEIQAIINS  481



>ref|XP_004296777.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=490

 Score =   330 bits (846),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/264 (59%), Positives = 204/264 (77%), Gaps = 3/264 (1%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++GH KEF+VALQ+LRGK ADIS+E AEI++Y+  L+ LPK+++ DLFQ +Y RS+ IGV
Sbjct  227  KIGHEKEFQVALQRLRGKYADISDETAEIKEYILTLQSLPKSRVLDLFQSKYVRSVIIGV  286

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGI FY S  FE AG  S IGTI YA +QV +T VGA LIDK+GR+PL+
Sbjct  287  GLMVFQQFGGINGIGFYASQTFEEAGISSKIGTIAYACVQVPITVVGAMLIDKSGRRPLI  346

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+G  LGC L G S++LK   +  +  P +AV+G+++YI  FS+GMGAVPWVIMSEI
Sbjct  347  MVSATGTFLGCFLAGTSFFLKEYGLLLHWVPTIAVSGVLIYIAFFSIGMGAVPWVIMSEI  406

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPI+VKG AGS   LVNW GAW  SYT+NFLM W+S+ T+ +Y+  ++L ILFV K+VPE
Sbjct  407  FPIHVKGAAGSLVVLVNWLGAWGVSYTYNFLMRWSSYRTYYMYSGFSLLTILFVAKLVPE  466

Query  263  TKGRTLEQIQATINA*SRTRRHKN  192
            TKG+TLE+IQA IN+    RR ++
Sbjct  467  TKGKTLEEIQACINS---DRREQD  487



>ref|XP_009352178.1| PREDICTED: sugar transporter ERD6-like 16 [Pyrus x bretschneideri]
Length=496

 Score =   330 bits (845),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 156/255 (61%), Positives = 201/255 (79%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF+VALQ+LRGK+ADIS+E  EIQ+Y+  L+ LPKAK+ DLFQ +Y R++ IGV
Sbjct  233  KIGREKEFQVALQRLRGKDADISDEMDEIQEYIATLQSLPKAKMLDLFQSKYIRAVIIGV  292

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGI FY S  FE AG  S IGTI YA +QV +T VGA LIDK+GR+PL+
Sbjct  293  GLMVFQQFGGINGIGFYASQTFEEAGISSKIGTIAYACVQVPITVVGAALIDKSGRRPLI  352

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+G  LGC L G S++LKG  +  N  P++AV+G+++YI SFS+GMGAVPWVIMSE+
Sbjct  353  MVSATGTFLGCFLAGTSFFLKGNGLLLNWVPIIAVSGVLIYIASFSLGMGAVPWVIMSEV  412

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPI+VKG AGS   LVNW GAW  SYT+NFLM+W+S  T+ +YA  ++L I+ V K+VPE
Sbjct  413  FPIHVKGAAGSLVVLVNWLGAWAVSYTYNFLMSWSSSRTYYIYAGFSLLTIICVAKLVPE  472

Query  263  TKGRTLEQIQATINA  219
            TKG+TLE+IQA IN+
Sbjct  473  TKGKTLEEIQACINS  487



>ref|XP_007035424.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY06350.1| Major facilitator superfamily protein [Theobroma cacao]
Length=479

 Score =   328 bits (842),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/256 (61%), Positives = 200/256 (78%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++GH KEF+VAL+KLRGK+ADI++EAAEIQ Y+E L+ LPK ++ DLFQ +Y  S+ IGV
Sbjct  224  KVGHSKEFQVALRKLRGKDADITQEAAEIQVYIETLQSLPKTRISDLFQPKYFGSVIIGV  283

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSD-IGTIIYAILQVIVTAVGATLIDKAGRKPL  627
             LM+ QQ GGINGI FY S  F SAG  S+  GTI YA +QV +T  GA L+D++GR+PL
Sbjct  284  ALMVFQQFGGINGITFYASETFASAGLSSEKTGTIAYACVQVPITIAGAMLMDRSGRRPL  343

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            ++VSA+G  LGC L G S+YLK  ++     P+LAV G+++YI SFS+GMGAVPWVIMSE
Sbjct  344  IMVSATGTFLGCFLAGTSFYLKDHSLLPEWVPILAVGGVLIYIASFSIGMGAVPWVIMSE  403

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPINVKGVAGS   LVNW GAW  SYTFNFLM+W+  GTF +Y+  +V+ +LFV K VP
Sbjct  404  IFPINVKGVAGSLVVLVNWLGAWAVSYTFNFLMSWSPSGTFFVYSGFSVMTVLFVAKFVP  463

Query  266  ETKGRTLEQIQATINA  219
            ETKG+TLE+IQA+IN+
Sbjct  464  ETKGKTLEEIQASINS  479



>ref|XP_009774898.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Nicotiana 
sylvestris]
 ref|XP_009774899.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Nicotiana 
sylvestris]
Length=393

 Score =   325 bits (833),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 163/264 (62%), Positives = 205/264 (78%), Gaps = 3/264 (1%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEFE+AL+KLRGK+ADIS EAAEIQ YV+ L+ LPKA++ DLF  +Y RS+ IG+
Sbjct  131  KVGLEKEFEMALRKLRGKDADISLEAAEIQAYVDTLQSLPKARILDLFGSKYIRSVMIGI  190

Query  803  GLMICQQLGGINGICFYTSSIFESAGFP-SDIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ  GINGI FY S  FESAG   S+IGTI YAI+QV +T VGA L+D++GR+PL
Sbjct  191  GLMVFQQFIGINGIGFYASQTFESAGLKNSNIGTIAYAIVQVPITVVGAFLMDRSGRRPL  250

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSA+G  +GC + G S+YLKG  I     P+LAV+G++VYI +FS+GMGAVPWVIMSE
Sbjct  251  LMVSATGTFVGCFMAGASFYLKGNGILLEWVPILAVSGVLVYISAFSIGMGAVPWVIMSE  310

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            +FPI+VK   GS   LVNW GAW  S+TF+FLM+W++ GTF+LYA   VL ILFV KVVP
Sbjct  311  VFPIHVKSAGGSLVVLVNWLGAWAVSFTFSFLMSWSATGTFMLYAGFCVLTILFVAKVVP  370

Query  266  ETKGRTLEQIQATINA*SRTRRHK  195
            ETKG+TLE+IQA IN  SRT   +
Sbjct  371  ETKGKTLEEIQAIIN--SRTWETR  392



>ref|XP_006444168.1| hypothetical protein CICLE_v10019918mg [Citrus clementina]
 ref|XP_006479807.1| PREDICTED: sugar transporter ERD6-like 7-like [Citrus sinensis]
 gb|ESR57408.1| hypothetical protein CICLE_v10019918mg [Citrus clementina]
 gb|KDO87481.1| hypothetical protein CISIN_1g011565mg [Citrus sinensis]
Length=483

 Score =   328 bits (840),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 160/254 (63%), Positives = 202/254 (80%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  +EFE ALQKLRGK+ADIS+EA EIQ+Y+E LE+LPKA+L DLFQKRY  S+ IGV
Sbjct  229  KIGKHEEFEAALQKLRGKDADISQEATEIQEYIETLERLPKARLLDLFQKRYLHSVTIGV  288

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGIN I FY ++IF++AG     GTI YA+LQV+VT     +ID+AGRKPLL
Sbjct  289  GLMVIQQFGGINAIAFYAANIFQTAGLSPSTGTISYALLQVVVTFFNIIMIDRAGRKPLL  348

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            + +A+GL LGC+L   +++LK   +A  + P L + G++VYIGSFS GMGA PWV+MSEI
Sbjct  349  LFAATGLLLGCLLLAAAFFLKTYGLALESVPALTLAGVLVYIGSFSSGMGATPWVLMSEI  408

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGV GS  TLVNWFGAW  SYTFNFL  W+S+GTF+LYA +N+L I+F+  VVPE
Sbjct  409  FPINIKGVGGSLTTLVNWFGAWAISYTFNFLETWSSYGTFLLYAAVNILGIVFITTVVPE  468

Query  263  TKGRTLEQIQATIN  222
            TKGRTLE+IQAT+N
Sbjct  469  TKGRTLEEIQATMN  482



>ref|XP_011090877.1| PREDICTED: sugar transporter ERD6-like 16 [Sesamum indicum]
Length=484

 Score =   328 bits (840),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 158/256 (62%), Positives = 203/256 (79%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEFEVAL+KLRGK+AD+S EAAEIQ  ++ L  LPK ++ DLF  +Y R + +GV
Sbjct  229  KVGRQKEFEVALRKLRGKDADVSCEAAEIQASIDGLLDLPKVRMLDLFDPKYIRPVIVGV  288

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ GGINGI FY++  F +AGF S  +GTI YAI+QV +T +GA L+DK+GR+PL
Sbjct  289  GLMVFQQFGGINGIGFYSTETFVAAGFSSGKVGTIAYAIIQVPITVLGAMLMDKSGRRPL  348

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L VSA+G+ LGCILTG S++ KG  +     P+LAV+G++VYI +FS+GMG VPWVIMSE
Sbjct  349  LTVSATGMFLGCILTGASFFFKGQALLLEWVPILAVSGVLVYIATFSIGMGPVPWVIMSE  408

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPI+VKGVAGS   LVNW GAW  SYTFNFLM+W+S GTF++YA  +VL + FV KVVP
Sbjct  409  IFPIHVKGVAGSLVVLVNWLGAWAVSYTFNFLMSWSSTGTFLMYAGFSVLTVAFVAKVVP  468

Query  266  ETKGRTLEQIQATINA  219
            ETKG+TLE+IQA+IN+
Sbjct  469  ETKGKTLEEIQASINS  484



>ref|XP_010024484.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Eucalyptus 
grandis]
Length=440

 Score =   326 bits (836),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 158/259 (61%), Positives = 198/259 (76%), Gaps = 1/259 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF  ALQKLRGK ADIS E AEIQ Y+  L+ LPKA++ DLFQ++Y RSI IGV
Sbjct  176  KVGREKEFHSALQKLRGKGADISREVAEIQVYIATLQSLPKARMVDLFQRKYIRSIIIGV  235

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ  GINGI FY S  F SAG  S   GTI YA +QV +T +GA L+DK+GR+PL
Sbjct  236  GLMVSQQFSGINGISFYVSETFASAGLSSGTTGTIAYACVQVPITLIGAVLVDKSGRRPL  295

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            ++VSA+G  LGC L G S++LK  N+     P++AVTG++++I SFS+GMGAVPW+IMSE
Sbjct  296  IMVSATGTFLGCFLAGSSFFLKAHNMFPEFVPLMAVTGVLIFIASFSIGMGAVPWLIMSE  355

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPI++KG AGS   LVNW GAW  SYTFNFLM W++ GTF +Y+  +VL ILFV K+VP
Sbjct  356  IFPIDIKGAAGSLVVLVNWLGAWAISYTFNFLMNWSNSGTFFIYSGFSVLTILFVAKLVP  415

Query  266  ETKGRTLEQIQATINA*SR  210
            ETKG+TLE+IQA IN+ SR
Sbjct  416  ETKGKTLEEIQACINSDSR  434



>ref|XP_003609563.1| Sugar transporter ERD6-like protein [Medicago truncatula]
 gb|AES91760.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=490

 Score =   328 bits (840),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 156/256 (61%), Positives = 199/256 (78%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF+VAL++LRGKN DIS EA EI DY+E L+ LPK KL DLFQ +++RS+ IGV
Sbjct  233  KVGREKEFQVALRRLRGKNVDISNEADEILDYIETLQNLPKVKLLDLFQNKHARSVVIGV  292

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+CQQ  GINGI FYTS  F +AG  S  IGTI YA +QV  T +GA L+DK+GR+PL
Sbjct  293  GLMVCQQSVGINGIGFYTSETFVAAGLSSGKIGTIAYACMQVPFTILGAILMDKSGRRPL  352

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            +  SASG  LGC +TG++++LK  N+     P+LAV GI++Y+ +FS+GMG VPWVIMSE
Sbjct  353  ITASASGTFLGCFMTGIAFFLKDQNLLLELVPILAVAGILIYVAAFSIGMGPVPWVIMSE  412

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPI+VKG AGS   L+NW GAW+ SYTFNFLM+W+S GT  LYA  ++L ILFV K+VP
Sbjct  413  IFPIHVKGTAGSLVVLINWLGAWVVSYTFNFLMSWSSPGTLFLYAGCSLLTILFVAKLVP  472

Query  266  ETKGRTLEQIQATINA  219
            ETKG+TLE+IQA +N+
Sbjct  473  ETKGKTLEEIQACLNS  488



>ref|XP_010912096.1| PREDICTED: sugar transporter ERD6-like 16 [Elaeis guineensis]
Length=483

 Score =   327 bits (839),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 155/255 (61%), Positives = 206/255 (81%), Gaps = 1/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  ++ EVALQ+LRGK+A+IS+EAAEIQ+ +E L+ LPKA+  DLFQ +Y RS+ +GV
Sbjct  226  KVGRQRDSEVALQRLRGKDANISQEAAEIQENIETLQILPKARFQDLFQSKYIRSVIVGV  285

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQLGGING  FY S+IF SAGF S  +GTI++  +Q+ +T +GA L+D++GRKPL
Sbjct  286  GLMVFQQLGGINGFGFYASNIFISAGFSSGRLGTILFGSIQIPITILGAFLMDRSGRKPL  345

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            ++VSA+G  +GC  TGVS+YLKG  +     P+LA+ GI+VYIGSFS+GMGAVPWVIMSE
Sbjct  346  IMVSATGTLIGCFATGVSFYLKGQGMHAEWVPILALAGIIVYIGSFSIGMGAVPWVIMSE  405

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KG+AG   TLVNWFG+W  SYTFNFLM+W+S GTF +++  +   ILFV +VVP
Sbjct  406  IFPINIKGIAGGLVTLVNWFGSWAVSYTFNFLMSWSSAGTFFIFSAASAATILFVARVVP  465

Query  266  ETKGRTLEQIQATIN  222
            ETKGRTLE+IQ+++N
Sbjct  466  ETKGRTLEEIQSSLN  480



>ref|XP_010024483.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Eucalyptus 
grandis]
 gb|KCW60928.1| hypothetical protein EUGRSUZ_H03662 [Eucalyptus grandis]
Length=497

 Score =   327 bits (837),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/259 (61%), Positives = 198/259 (76%), Gaps = 1/259 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF  ALQKLRGK ADIS E AEIQ Y+  L+ LPKA++ DLFQ++Y RSI IGV
Sbjct  233  KVGREKEFHSALQKLRGKGADISREVAEIQVYIATLQSLPKARMVDLFQRKYIRSIIIGV  292

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ  GINGI FY S  F SAG  S   GTI YA +QV +T +GA L+DK+GR+PL
Sbjct  293  GLMVSQQFSGINGISFYVSETFASAGLSSGTTGTIAYACVQVPITLIGAVLVDKSGRRPL  352

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            ++VSA+G  LGC L G S++LK  N+     P++AVTG++++I SFS+GMGAVPW+IMSE
Sbjct  353  IMVSATGTFLGCFLAGSSFFLKAHNMFPEFVPLMAVTGVLIFIASFSIGMGAVPWLIMSE  412

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPI++KG AGS   LVNW GAW  SYTFNFLM W++ GTF +Y+  +VL ILFV K+VP
Sbjct  413  IFPIDIKGAAGSLVVLVNWLGAWAISYTFNFLMNWSNSGTFFIYSGFSVLTILFVAKLVP  472

Query  266  ETKGRTLEQIQATINA*SR  210
            ETKG+TLE+IQA IN+ SR
Sbjct  473  ETKGKTLEEIQACINSDSR  491



>ref|XP_008340870.1| PREDICTED: sugar transporter ERD6-like 16 [Malus domestica]
Length=496

 Score =   326 bits (836),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 152/255 (60%), Positives = 200/255 (78%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF+VALQ+LRGK+A+IS+E  EIQ+Y+  L+ LPK  + DLFQ +Y R++ IGV
Sbjct  233  KIGREKEFQVALQRLRGKDABISDEMDEIQEYIATLQSLPKXNMLDLFQSKYIRAVIIGV  292

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGI FY S  FE AG  S IGTI YA +QV +T VGA LIDK+GR+PL+
Sbjct  293  GLMVFQQFGGINGIGFYASQTFEEAGISSKIGTIAYACVQVPITVVGAALIDKSGRRPLI  352

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+G  LGC L G S++LKG  +  +  P++AV+G+++YI SFS+GMGAVPWVIMSE+
Sbjct  353  MVSATGTFLGCFLAGTSFFLKGNGLLLDWVPIIAVSGVLIYIASFSLGMGAVPWVIMSEV  412

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPI+VKG AGS   L+NW GAW  SYT+NFLM+W+S  T+ +YA  ++L I+FV K+VPE
Sbjct  413  FPIHVKGAAGSLVVLMNWLGAWAVSYTYNFLMSWSSSRTYYIYAGFSLLTIIFVAKLVPE  472

Query  263  TKGRTLEQIQATINA  219
            TKG+TLE+IQA IN+
Sbjct  473  TKGKTLEEIQACINS  487



>ref|XP_010660047.1| PREDICTED: sugar transporter ERD6-like 8 [Vitis vinifera]
Length=471

 Score =   325 bits (833),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 155/254 (61%), Positives = 199/254 (78%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G+ KEF+++LQKLRG +ADISEE AEIQ+Y+   E LPK  + DL  K+  RS+ +GV
Sbjct  218  KVGNEKEFKLSLQKLRGADADISEEVAEIQEYIVTHELLPKVTIMDLLGKQNIRSVVVGV  277

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGI FY   IF SAG P ++G I+YA LQVIVTA G +LID+ GR+PLL
Sbjct  278  GLMVFQQFGGINGIVFYAGQIFVSAGVPPNVGGILYACLQVIVTAFGGSLIDRLGRRPLL  337

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA G+ LGC+LTG S+ LK   +A N  P+LAVTGI+VYIG +SVG+GA+PWVIMSEI
Sbjct  338  IVSAYGMLLGCLLTGTSFLLKAHQLATNLVPILAVTGILVYIGFYSVGLGAIPWVIMSEI  397

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FP+++KG AGS  TLVNW G+W  SYTFNFLM W+S GTF  YA +   A++F++ +VPE
Sbjct  398  FPLHIKGTAGSLVTLVNWCGSWAVSYTFNFLMNWSSHGTFFGYAFVCAAAVVFIVMLVPE  457

Query  263  TKGRTLEQIQATIN  222
            TKGRTLE+IQA++N
Sbjct  458  TKGRTLEEIQASMN  471



>gb|KDO74959.1| hypothetical protein CISIN_1g018767mg [Citrus sinensis]
Length=350

 Score =   320 bits (821),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 158/255 (62%), Positives = 198/255 (78%), Gaps = 1/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF+VAL+KLRGK+ADI+ EAAEIQ Y+  L  LPKA + DLF+ +Y RS+ IGV
Sbjct  94   KVGLDKEFQVALRKLRGKDADITREAAEIQVYILTLRSLPKASIRDLFKSKYIRSVIIGV  153

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
             LM+ QQ  GINGI FYTS  F  AG  S  +GTI+YA +QV +T VGA L+DK+GR+PL
Sbjct  154  SLMVLQQFVGINGIGFYTSETFVQAGLSSGKLGTILYACVQVPITVVGAFLMDKSGRRPL  213

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            +++SA+G  LGC L G S++LKG N+  +  PVLAV GI++YI  FS+G GAVPWVIMSE
Sbjct  214  IMISAAGTFLGCFLAGTSFFLKGQNMFLDWVPVLAVGGILIYIAFFSIGFGAVPWVIMSE  273

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KGVAGS   LVNW GAW  SYTFNFLM+W+S GTF +Y+  +V+ +LFV K VP
Sbjct  274  IFPINIKGVAGSLVVLVNWSGAWAVSYTFNFLMSWSSSGTFFIYSAFSVITVLFVAKFVP  333

Query  266  ETKGRTLEQIQATIN  222
            ETKG+TLEQIQA+IN
Sbjct  334  ETKGKTLEQIQASIN  348



>ref|XP_012092321.1| PREDICTED: sugar transporter ERD6-like 7 isoform X2 [Jatropha 
curcas]
Length=446

 Score =   323 bits (829),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 157/255 (62%), Positives = 189/255 (74%), Gaps = 38/255 (15%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  K+FE AL+ LRG++ADI++EA EI+DY+E LE+LPKAKL DLFQ+RY RS+ IGV
Sbjct  230  KMGRDKQFETALKTLRGEDADITQEADEIKDYIETLERLPKAKLLDLFQRRYLRSVIIGV  289

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGING+CFYTS+IFESAGF + IGTI YAI+QV+VT +  T+IDKAGRKPLL
Sbjct  290  GLMVFQQFGGINGVCFYTSNIFESAGFSATIGTIAYAIIQVVVTGLNTTVIDKAGRKPLL  349

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
                                                  ++YIGSFS GMGAVPWV+MSEI
Sbjct  350  --------------------------------------LLYIGSFSAGMGAVPWVVMSEI  371

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KGVAGS ATL NWFGAW  SYT+NFL +W+S+GTF+LYA IN L I+F+ KVVPE
Sbjct  372  FPINIKGVAGSLATLTNWFGAWAISYTYNFLTSWSSYGTFVLYAAINALGIVFIAKVVPE  431

Query  263  TKGRTLEQIQATINA  219
            TKGRTLEQIQA INA
Sbjct  432  TKGRTLEQIQAAINA  446



>ref|XP_009774897.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Nicotiana 
sylvestris]
Length=488

 Score =   325 bits (832),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 163/264 (62%), Positives = 205/264 (78%), Gaps = 3/264 (1%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEFE+AL+KLRGK+ADIS EAAEIQ YV+ L+ LPKA++ DLF  +Y RS+ IG+
Sbjct  226  KVGLEKEFEMALRKLRGKDADISLEAAEIQAYVDTLQSLPKARILDLFGSKYIRSVMIGI  285

Query  803  GLMICQQLGGINGICFYTSSIFESAGFP-SDIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ  GINGI FY S  FESAG   S+IGTI YAI+QV +T VGA L+D++GR+PL
Sbjct  286  GLMVFQQFIGINGIGFYASQTFESAGLKNSNIGTIAYAIVQVPITVVGAFLMDRSGRRPL  345

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSA+G  +GC + G S+YLKG  I     P+LAV+G++VYI +FS+GMGAVPWVIMSE
Sbjct  346  LMVSATGTFVGCFMAGASFYLKGNGILLEWVPILAVSGVLVYISAFSIGMGAVPWVIMSE  405

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            +FPI+VK   GS   LVNW GAW  S+TF+FLM+W++ GTF+LYA   VL ILFV KVVP
Sbjct  406  VFPIHVKSAGGSLVVLVNWLGAWAVSFTFSFLMSWSATGTFMLYAGFCVLTILFVAKVVP  465

Query  266  ETKGRTLEQIQATINA*SRTRRHK  195
            ETKG+TLE+IQA IN  SRT   +
Sbjct  466  ETKGKTLEEIQAIIN--SRTWETR  487



>gb|KJB72536.1| hypothetical protein B456_011G183500 [Gossypium raimondii]
Length=482

 Score =   324 bits (831),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/256 (59%), Positives = 198/256 (77%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF  AL+KLRGK+ADI+EEA EIQ+Y+E L+ LPK  ++DLFQK+Y  S+ IGV
Sbjct  225  KVGDQKEFHAALRKLRGKDADITEEAEEIQEYIETLQSLPKTTIWDLFQKQYINSVIIGV  284

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
             LM+ QQ GGING+ FY S  F  AG  S   GT+ YA +QV +T +GA L+DK+GR+PL
Sbjct  285  ALMVFQQFGGINGVSFYASQTFALAGLSSAKAGTVAYACVQVPITFLGAMLMDKSGRRPL  344

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            ++VS++G  LGC L G S+Y K  ++     P+LAV G+++Y+GSFS+G+GA PWVIMSE
Sbjct  345  IMVSSAGTFLGCFLAGTSFYFKEHDLLPEWRPILAVAGVLIYVGSFSIGLGAAPWVIMSE  404

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPINVKGVAGS   LVNW GAW  SYTFNF+M W+S+GTF +Y+ +++L ILFV+K VP
Sbjct  405  IFPINVKGVAGSLVVLVNWLGAWAVSYTFNFMMTWSSYGTFYIYSGVSILTILFVVKFVP  464

Query  266  ETKGRTLEQIQATINA  219
            ETKG+TLE+IQA IN+
Sbjct  465  ETKGKTLEEIQACINS  480



>ref|XP_008438776.1| PREDICTED: sugar transporter ERD6-like 16 isoform X4 [Cucumis 
melo]
Length=452

 Score =   323 bits (828),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 157/257 (61%), Positives = 198/257 (77%), Gaps = 3/257 (1%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF  ALQ+LRGKN +IS EA EIQDY+E +  LPK KL DLFQ  Y R + IGV
Sbjct  187  KVGEEKEFLSALQRLRGKNVNISAEAIEIQDYIETMRSLPKVKLVDLFQSIYVRPLMIGV  246

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS--DIGTIIYAILQVIVTAVGATLIDKAGRKP  630
            GLM+ QQ GGINGI F+ S  F SAG PS   IGTI YA +QV +T VG  L+DK+GR+P
Sbjct  247  GLMMFQQFGGINGIGFFASETFASAG-PSAGKIGTIAYACIQVPITVVGVILMDKSGRRP  305

Query  629  LLVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMS  450
            L++VSA+G +LGC L G S++LKG  +  +  PVL V G+++YI  FS+GMGAVPWVIMS
Sbjct  306  LIMVSAAGTSLGCFLAGASFFLKGRGLLLDFVPVLVVAGVLIYIAFFSIGMGAVPWVIMS  365

Query  449  EIFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVV  270
            EIFPINVKGV GS   LVNW GAW+ S+TFNF + W+S+GTF +Y+ I+++ ILFV+K+V
Sbjct  366  EIFPINVKGVGGSIVVLVNWLGAWIVSFTFNFFITWSSYGTFFIYSLISLMTILFVMKLV  425

Query  269  PETKGRTLEQIQATINA  219
            PETKGRTLE+IQA+IN+
Sbjct  426  PETKGRTLEEIQASINS  442



>gb|EYU43869.1| hypothetical protein MIMGU_mgv1a018596mg [Erythranthe guttata]
Length=480

 Score =   323 bits (829),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/256 (61%), Positives = 203/256 (79%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEFE+AL+KLRG +AD+S+EA+EIQ  +  ++ LPK  + DLF+ RY R + +GV
Sbjct  225  KVGLCKEFELALRKLRGADADVSQEASEIQASIYSMQDLPKVGVLDLFEARYMRPLIVGV  284

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ GGINGI FY+S  F +AGF S  IGTI YAI+QV +T VGA L+DK+GR+PL
Sbjct  285  GLMVFQQFGGINGIGFYSSETFVAAGFSSGKIGTIAYAIIQVPITMVGAVLMDKSGRRPL  344

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSASG  +GCILTG S+YLKG  +     P+LAV+G++V++ +FS+GMGAVPWVIMSE
Sbjct  345  LMVSASGTFIGCILTGASFYLKGQALLLEWVPILAVSGVLVFVAAFSIGMGAVPWVIMSE  404

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPI+VKGVAGS   LVNW GAW  SYTFNFLM+W+S GTF +YA +  + ++FV KVVP
Sbjct  405  IFPIHVKGVAGSLVVLVNWLGAWAVSYTFNFLMSWSSTGTFSIYAGVCAMTVVFVAKVVP  464

Query  266  ETKGRTLEQIQATINA  219
            ETKG+TLE+IQA+ N+
Sbjct  465  ETKGKTLEEIQASFNS  480



>ref|XP_006419726.1| hypothetical protein CICLE_v10004839mg [Citrus clementina]
 gb|ESR32966.1| hypothetical protein CICLE_v10004839mg [Citrus clementina]
Length=387

 Score =   320 bits (821),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 158/255 (62%), Positives = 198/255 (78%), Gaps = 1/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF+VAL+KLRGK+ADI+ EAAEIQ Y+  L  LPKA + DLF+ +Y RS+ IGV
Sbjct  131  KVGLDKEFQVALRKLRGKDADITREAAEIQVYILTLRSLPKASIRDLFKSKYIRSVIIGV  190

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
             LM+ QQ  GINGI FYTS  F  AG  S  +GTI+YA +QV +T VGA L+DK+GR+PL
Sbjct  191  SLMVLQQFVGINGIGFYTSETFVQAGLSSGKLGTILYACVQVPITVVGAFLMDKSGRRPL  250

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            +++SA+G  LGC L G S++LKG N+  +  PVLAV GI++YI  FS+G GAVPWVIMSE
Sbjct  251  IMISAAGTFLGCFLAGTSFFLKGQNMFLDWVPVLAVGGILIYIAFFSIGFGAVPWVIMSE  310

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KGVAGS   LVNW GAW  SYTFNFLM+W+S GTF +Y+  +V+ +LFV K VP
Sbjct  311  IFPINIKGVAGSLVVLVNWSGAWAVSYTFNFLMSWSSSGTFFIYSAFSVITVLFVAKFVP  370

Query  266  ETKGRTLEQIQATIN  222
            ETKG+TLEQIQA+IN
Sbjct  371  ETKGKTLEQIQASIN  385



>ref|XP_008438774.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Cucumis 
melo]
Length=474

 Score =   323 bits (828),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 157/257 (61%), Positives = 198/257 (77%), Gaps = 3/257 (1%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF  ALQ+LRGKN +IS EA EIQDY+E +  LPK KL DLFQ  Y R + IGV
Sbjct  209  KVGEEKEFLSALQRLRGKNVNISAEAIEIQDYIETMRSLPKVKLVDLFQSIYVRPLMIGV  268

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS--DIGTIIYAILQVIVTAVGATLIDKAGRKP  630
            GLM+ QQ GGINGI F+ S  F SAG PS   IGTI YA +QV +T VG  L+DK+GR+P
Sbjct  269  GLMMFQQFGGINGIGFFASETFASAG-PSAGKIGTIAYACIQVPITVVGVILMDKSGRRP  327

Query  629  LLVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMS  450
            L++VSA+G +LGC L G S++LKG  +  +  PVL V G+++YI  FS+GMGAVPWVIMS
Sbjct  328  LIMVSAAGTSLGCFLAGASFFLKGRGLLLDFVPVLVVAGVLIYIAFFSIGMGAVPWVIMS  387

Query  449  EIFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVV  270
            EIFPINVKGV GS   LVNW GAW+ S+TFNF + W+S+GTF +Y+ I+++ ILFV+K+V
Sbjct  388  EIFPINVKGVGGSIVVLVNWLGAWIVSFTFNFFITWSSYGTFFIYSLISLMTILFVMKLV  447

Query  269  PETKGRTLEQIQATINA  219
            PETKGRTLE+IQA+IN+
Sbjct  448  PETKGRTLEEIQASINS  464



>ref|XP_004508324.1| PREDICTED: sugar transporter ERD6-like 16-like [Cicer arietinum]
Length=488

 Score =   323 bits (829),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/256 (60%), Positives = 201/256 (79%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF+VAL++LRGKN DIS EA EI DY+E LE LPK KL DLF+ +++RS+ IGV
Sbjct  233  KVGLEKEFQVALRRLRGKNVDISNEADEILDYIETLECLPKTKLLDLFENKHARSVVIGV  292

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+CQQ  GINGI FYT+  F++AG  S  +GTI YA +QV  T +GA L+DK+GR+PL
Sbjct  293  GLMVCQQSVGINGIGFYTAETFKAAGLSSGKVGTIAYACMQVPFTVLGAILMDKSGRRPL  352

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            ++VSASG  LGC +TG++++LK  N+     P+LAV G+++Y+ +FS+G+G VPWVIMSE
Sbjct  353  IMVSASGTFLGCFMTGIAFFLKDQNLMLEWVPILAVAGVLIYVAAFSIGLGPVPWVIMSE  412

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPI+VKG AGS   L+NW GAW+ SYTFN LM+W+S GT  LYA  ++L ILFV K+VP
Sbjct  413  IFPIHVKGTAGSLVVLINWLGAWIVSYTFNLLMSWSSPGTLFLYAGCSLLTILFVAKLVP  472

Query  266  ETKGRTLEQIQATINA  219
            ETKG+TLE+IQA IN+
Sbjct  473  ETKGKTLEEIQACINS  488



>ref|XP_008438773.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Cucumis 
melo]
Length=496

 Score =   323 bits (828),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 157/257 (61%), Positives = 198/257 (77%), Gaps = 3/257 (1%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF  ALQ+LRGKN +IS EA EIQDY+E +  LPK KL DLFQ  Y R + IGV
Sbjct  231  KVGEEKEFLSALQRLRGKNVNISAEAIEIQDYIETMRSLPKVKLVDLFQSIYVRPLMIGV  290

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS--DIGTIIYAILQVIVTAVGATLIDKAGRKP  630
            GLM+ QQ GGINGI F+ S  F SAG PS   IGTI YA +QV +T VG  L+DK+GR+P
Sbjct  291  GLMMFQQFGGINGIGFFASETFASAG-PSAGKIGTIAYACIQVPITVVGVILMDKSGRRP  349

Query  629  LLVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMS  450
            L++VSA+G +LGC L G S++LKG  +  +  PVL V G+++YI  FS+GMGAVPWVIMS
Sbjct  350  LIMVSAAGTSLGCFLAGASFFLKGRGLLLDFVPVLVVAGVLIYIAFFSIGMGAVPWVIMS  409

Query  449  EIFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVV  270
            EIFPINVKGV GS   LVNW GAW+ S+TFNF + W+S+GTF +Y+ I+++ ILFV+K+V
Sbjct  410  EIFPINVKGVGGSIVVLVNWLGAWIVSFTFNFFITWSSYGTFFIYSLISLMTILFVMKLV  469

Query  269  PETKGRTLEQIQATINA  219
            PETKGRTLE+IQA+IN+
Sbjct  470  PETKGRTLEEIQASINS  486



>ref|XP_010279404.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Nelumbo 
nucifera]
Length=462

 Score =   320 bits (820),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 155/254 (61%), Positives = 195/254 (77%), Gaps = 16/254 (6%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  +EFE+ALQKLRGK+AD+S+EAAEIQDY+E L+ LPKAK+ DLF++RY R + +GV
Sbjct  224  KVGRKREFEIALQKLRGKDADVSDEAAEIQDYIETLQLLPKAKMVDLFERRYIRPVIVGV  283

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQLGG +G                 +GTI YA LQV +T VGA L+DK+GR+PLL
Sbjct  284  GLMVFQQLGGSSG----------------KVGTIAYACLQVPITIVGAFLMDKSGRRPLL  327

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+G  LGC LTG+S+YLKG  +     P+LAV+G+++YIGSFS+GMGAVPWV+MSEI
Sbjct  328  IVSATGTFLGCFLTGISFYLKGHQLLHAWVPMLAVSGVLIYIGSFSIGMGAVPWVMMSEI  387

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS  TLVNW GAW  SYTFN LM  +S GTF+ YA    L +LFV KVVPE
Sbjct  388  FPINIKGAAGSLVTLVNWLGAWAVSYTFNLLMNLSSSGTFLFYAGFCALTVLFVAKVVPE  447

Query  263  TKGRTLEQIQATIN  222
            TKGRTLE+IQA++N
Sbjct  448  TKGRTLEEIQASMN  461



>ref|XP_008388978.1| PREDICTED: sugar transporter ERD6-like 5 [Malus domestica]
Length=332

 Score =   315 bits (807),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 144/254 (57%), Positives = 199/254 (78%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KE E ALQ LRG+N++ S+E AEI+DY E L++L +A++ DLFQ+RY+ S+ +GV
Sbjct  74   KIGKWKECEAALQXLRGENSNTSQEVAEIRDYTETLKRLSEARILDLFQRRYAYSLIVGV  133

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+NGI FY S+IF SAGF   +GTI    +QV +TA+G  L+DKAGR+PLL
Sbjct  134  GLMVLQQFGGVNGIAFYASTIFISAGFSDSVGTIAMVAVQVPMTALGVILMDKAGRRPLL  193

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VS++G  LGC+L G+S+ L+ L       P+LA+ G++V+ GSFS+GMG +PWVIMSEI
Sbjct  194  LVSSAGTCLGCLLVGLSFSLQNLQQWKQITPILALVGVLVFTGSFSLGMGGIPWVIMSEI  253

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS  TLV+W G+W+ SYTFNFLM W+S GTF L+++++ + +LFV K+VPE
Sbjct  254  FPINMKGSAGSLITLVSWLGSWIVSYTFNFLMDWSSAGTFFLFSSVSAVTVLFVAKLVPE  313

Query  263  TKGRTLEQIQATIN  222
            TKGRTLE+IQ ++N
Sbjct  314  TKGRTLEEIQTSLN  327



>ref|XP_010043109.1| PREDICTED: sugar transporter ERD6-like 5 [Eucalyptus grandis]
 gb|KCW85183.1| hypothetical protein EUGRSUZ_B02014 [Eucalyptus grandis]
Length=482

 Score =   320 bits (819),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 147/254 (58%), Positives = 200/254 (79%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KE E AL +LRGKNADIS+EAAEI +Y E L++L +A++ DLFQ++Y+ S+ +GV
Sbjct  227  KTGRNKECEAALLRLRGKNADISQEAAEIWEYTETLQRLSEARILDLFQRKYAYSLIVGV  286

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+NGI FY S IF SAGF   +GTI   ++Q+ +TA+G  L+DK+GR+PLL
Sbjct  287  GLMVLQQFGGVNGIAFYASFIFISAGFSGSVGTIAMVVVQIPMTALGVLLMDKSGRRPLL  346

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+G  LGC++TG S+Y + L +     P+LA+ G++VY GSFS+GMG +PWVIMSEI
Sbjct  347  LVSAAGTCLGCLMTGFSFYFQDLQVWKAFTPILALVGVLVYTGSFSLGMGGIPWVIMSEI  406

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS  T+V+W G+W+ SYTFNF+M W+S GTF ++++I  L +LFV K+VPE
Sbjct  407  FPINMKGSAGSLVTVVSWLGSWIISYTFNFMMDWSSAGTFFIFSSICGLTVLFVAKLVPE  466

Query  263  TKGRTLEQIQATIN  222
            TKGRTLE+IQAT+N
Sbjct  467  TKGRTLEEIQATMN  480



>ref|XP_008809152.1| PREDICTED: sugar transporter ERD6-like 16 [Phoenix dactylifera]
Length=414

 Score =   317 bits (813),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 203/256 (79%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  +E EVAL++L GK+ADIS+EAA+IQ+YVE L  LP+ ++ +LFQK Y RS+ +G 
Sbjct  157  KVGRDRESEVALRRLCGKDADISQEAADIQEYVETLRSLPETRISELFQKTYLRSVIVGA  216

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ GG+NGI FY S IF SAGF S ++GTI+   +QV +T +GA L+DK+GR+PL
Sbjct  217  GLMVFQQFGGVNGITFYASEIFVSAGFASGNLGTILLGCIQVPITIMGALLMDKSGRRPL  276

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSASG  L    T VS++LK   I  +  P+LA+ GI+ ++GSFS+GMGA+PW+IMSE
Sbjct  277  LMVSASGTCLSAFTTAVSFHLKDRGICMDWVPLLALAGILGFLGSFSIGMGAIPWIIMSE  336

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KGVAGS  TLVNWFG+W+ SY FNFLM+W+S GTF++++ I   ++LFV K+VP
Sbjct  337  IFPINIKGVAGSLVTLVNWFGSWVVSYAFNFLMSWSSSGTFLIFSAICATSVLFVAKLVP  396

Query  266  ETKGRTLEQIQATINA  219
            ETKGRTLE+IQA++N+
Sbjct  397  ETKGRTLEEIQASMNS  412



>ref|XP_009782756.1| PREDICTED: sugar transporter ERD6-like 5 [Nicotiana sylvestris]
Length=421

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/255 (58%), Positives = 202/255 (79%), Gaps = 1/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KE E +LQ+LRGK+A+ISEEAAEI+DY E L+KL +AK+ DLFQK+Y+ S+ +GV
Sbjct  166  KAGQWKECEASLQRLRGKDANISEEAAEIKDYTETLQKLSEAKMIDLFQKKYAHSLIVGV  225

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+N I +Y SSIFESAGF   IG+I   I+Q+ +  +G  L+DK+GR+PLL
Sbjct  226  GLMVLQQFGGVNAIAYYASSIFESAGFSGRIGSIAMVIVQIPMQVLGVLLMDKSGRRPLL  285

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+G  LGC L G+S+ L+ L +   ++P LA+ GI+V+ GSFS+GMG +PWVIMSEI
Sbjct  286  LVSAAGTCLGCFLVGLSFLLQDLQLW-KSSPFLALVGILVFTGSFSLGMGGIPWVIMSEI  344

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPINVKG+AGS  T+VNWFG+W+ SY+FNFLM W+S GTF +++ +  L ++FV K+VPE
Sbjct  345  FPINVKGLAGSIVTVVNWFGSWIVSYSFNFLMLWSSEGTFFIFSAVCGLTVMFVAKLVPE  404

Query  263  TKGRTLEQIQATINA  219
            TKGRTLE+IQ ++N+
Sbjct  405  TKGRTLEEIQLSMNS  419



>ref|XP_006419729.1| hypothetical protein CICLE_v10004839mg [Citrus clementina]
 ref|XP_006489198.1| PREDICTED: sugar transporter ERD6-like 16-like [Citrus sinensis]
 gb|ESR32969.1| hypothetical protein CICLE_v10004839mg [Citrus clementina]
Length=490

 Score =   319 bits (818),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/255 (62%), Positives = 198/255 (78%), Gaps = 1/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF+VAL+KLRGK+ADI+ EAAEIQ Y+  L  LPKA + DLF+ +Y RS+ IGV
Sbjct  234  KVGLDKEFQVALRKLRGKDADITREAAEIQVYILTLRSLPKASIRDLFKSKYIRSVIIGV  293

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
             LM+ QQ  GINGI FYTS  F  AG  S  +GTI+YA +QV +T VGA L+DK+GR+PL
Sbjct  294  SLMVLQQFVGINGIGFYTSETFVQAGLSSGKLGTILYACVQVPITVVGAFLMDKSGRRPL  353

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            +++SA+G  LGC L G S++LKG N+  +  PVLAV GI++YI  FS+G GAVPWVIMSE
Sbjct  354  IMISAAGTFLGCFLAGTSFFLKGQNMFLDWVPVLAVGGILIYIAFFSIGFGAVPWVIMSE  413

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KGVAGS   LVNW GAW  SYTFNFLM+W+S GTF +Y+  +V+ +LFV K VP
Sbjct  414  IFPINIKGVAGSLVVLVNWSGAWAVSYTFNFLMSWSSSGTFFIYSAFSVITVLFVAKFVP  473

Query  266  ETKGRTLEQIQATIN  222
            ETKG+TLEQIQA+IN
Sbjct  474  ETKGKTLEQIQASIN  488



>emb|CDO98940.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   319 bits (818),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/255 (61%), Positives = 196/255 (77%), Gaps = 1/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
             +G  K+F VAL++LRGK+ADI+ EAAEI+ Y   L  LPK+++ DLF ++Y RS+ IGV
Sbjct  233  NVGREKDFLVALRRLRGKDADITREAAEIEAYNVTLRSLPKSRMLDLFDRKYIRSVIIGV  292

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ  GINGI FY S  F  AG  S   GT  YAI+QV++T VGA L+DK+GR+PL
Sbjct  293  GLMVFQQFIGINGISFYASETFAEAGLSSGKTGTAAYAIVQVLLTVVGALLMDKSGRRPL  352

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSASG  +GC LTG S+YLKG N+     P+LAV+G+++YI +FS+GMGAVPWVIMSE
Sbjct  353  LMVSASGTFIGCFLTGASFYLKGQNLLLEWVPLLAVSGVLIYIAAFSIGMGAVPWVIMSE  412

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPINVKG AGS   LVNW GAW  S+TFNFLM+W+S GTF +YA   VL +LFV + VP
Sbjct  413  IFPINVKGAAGSLVVLVNWIGAWAVSFTFNFLMSWSSTGTFFIYAGFCVLTVLFVARFVP  472

Query  266  ETKGRTLEQIQATIN  222
            ETKG+TLE++QA+IN
Sbjct  473  ETKGKTLEEVQASIN  487



>dbj|BAH01094.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE52442.1| hypothetical protein OsJ_34588 [Oryza sativa Japonica Group]
Length=462

 Score =   318 bits (816),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/256 (58%), Positives = 203/256 (79%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEFE+ALQ+LRGK+AD+S EAAEI++++E +E LPKA + DLF + Y R + +GV
Sbjct  205  KVGRQKEFEIALQRLRGKDADVSIEAAEIKEFIETIENLPKAGVQDLFNRAYIRPVIVGV  264

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ  GINGI FY S  F SAGF S D+GTI+   +Q  +TAVGA L+D++GR+PL
Sbjct  265  GLMVFQQFVGINGILFYASETFVSAGFASGDLGTILMGCIQAPITAVGALLMDRSGRRPL  324

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L++S SGL +G +++ VS+YLK   +     P++A+TGI+VYI S+S+GMGAVPWVIMSE
Sbjct  325  LLISTSGLLIGSLMSAVSFYLKIHGLFLEQVPIIALTGILVYIASYSIGMGAVPWVIMSE  384

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KG+ GSF TLVNW G+W  S+ FNF M+W+S GTF L+A +  +AILF++K+VP
Sbjct  385  IFPINIKGIGGSFVTLVNWSGSWAVSFAFNFFMSWSSSGTFFLFALVCAVAILFIVKIVP  444

Query  266  ETKGRTLEQIQATINA  219
            ETKG+TLE+IQA++N+
Sbjct  445  ETKGKTLEEIQASMNS  460



>ref|XP_011651014.1| PREDICTED: sugar transporter ERD6-like 16 isoform X3 [Cucumis 
sativus]
Length=438

 Score =   317 bits (813),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/257 (60%), Positives = 196/257 (76%), Gaps = 3/257 (1%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF  ALQ+LRGKN +IS EA EIQ Y+E +  LPK KL DLFQ  Y R + IGV
Sbjct  182  KVGEEKEFLSALQRLRGKNVNISAEAVEIQSYIETMRSLPKIKLVDLFQTIYIRPLMIGV  241

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS--DIGTIIYAILQVIVTAVGATLIDKAGRKP  630
            GLM+ QQ GGINGI F+ S  F SAG PS   IGTI YA +QV +T VG  L+DK+GR+P
Sbjct  242  GLMMFQQFGGINGIGFFASETFASAG-PSAGKIGTIAYACIQVPITVVGVILMDKSGRRP  300

Query  629  LLVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMS  450
            L++VSA+G +LGC L G S++LKG  +  +  P+L V G+++YI  FS+GMGAVPWVIMS
Sbjct  301  LIMVSAAGTSLGCFLAGASFFLKGRGLLLDFVPMLVVAGVLIYIAFFSIGMGAVPWVIMS  360

Query  449  EIFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVV  270
            EIFPINVKGV GS   LVNW GAW+ S+TFNF + W+S+GTF +Y+ I+++ ILFVIK+V
Sbjct  361  EIFPINVKGVGGSIVVLVNWLGAWIVSFTFNFFITWSSYGTFFIYSLISLMTILFVIKLV  420

Query  269  PETKGRTLEQIQATINA  219
            PETKGRTLE+IQ +IN+
Sbjct  421  PETKGRTLEEIQTSINS  437



>gb|KHG12382.1| hypothetical protein F383_10647 [Gossypium arboreum]
Length=493

 Score =   319 bits (818),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/264 (58%), Positives = 200/264 (76%), Gaps = 1/264 (0%)
 Frame = -3

Query  989  WQ-RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIF  813
            WQ ++G  KE E +LQ LRG NADIS EA+EI+DY E L++L ++ +FDLFQK Y+ S+ 
Sbjct  225  WQAKIGKWKECEASLQCLRGNNADISNEASEIKDYTEQLQRLSESSVFDLFQKEYAWSLI  284

Query  812  IGVGLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRK  633
            +GVGLM+ QQ GG+NGI FY SSIF SAGF   +G I   ++QV +T +G  L+DK+GR+
Sbjct  285  VGVGLMVLQQFGGVNGIAFYASSIFISAGFSGSVGMIAMVVVQVPMTTLGVLLLDKSGRR  344

Query  632  PLLVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIM  453
            PLL+VSA+G  LGC L G+S+ L+ L       P+L++ G++VY GSFS+GMG +PWVIM
Sbjct  345  PLLLVSAAGTCLGCFLVGLSFLLQDLQQWKEVTPILSLVGVLVYTGSFSLGMGGIPWVIM  404

Query  452  SEIFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKV  273
            SEIFPIN+KG AGS  TLV+W G+W+ S+ FNFLM W+S GTF ++ATI  L +LFV K+
Sbjct  405  SEIFPINMKGSAGSLVTLVSWLGSWIISFAFNFLMKWSSTGTFFIFATICGLTVLFVAKL  464

Query  272  VPETKGRTLEQIQATINA*SRTRR  201
            VPETKGRTLE+IQA++N  S  RR
Sbjct  465  VPETKGRTLEEIQASMNPVSLERR  488



>ref|XP_009419855.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=465

 Score =   318 bits (815),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/256 (59%), Positives = 199/256 (78%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G+ KEF  ALQKLRG++ADI++EA EIQ+Y+E L+ LPKA + DLFQ  Y RS+ +GV
Sbjct  208  KVGNQKEFTAALQKLRGEDADITQEAEEIQEYIEDLQTLPKAGIQDLFQSIYIRSVIVGV  267

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ+GGING+ FY S IF SAGF S  +GTI+   +QV +T VGA L+D++GR PL
Sbjct  268  GLMVFQQIGGINGVGFYASKIFVSAGFSSGKLGTILMGSIQVPITIVGALLMDRSGRIPL  327

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSASG  +GC +TG S+YLK   I     P LA+ GI+VY+G+FS+GMGAVPWVIMSE
Sbjct  328  LMVSASGTFIGCFITGTSFYLKAQGIYMEWVPTLALCGILVYVGAFSIGMGAVPWVIMSE  387

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            +FPIN+KG+ GS  TLVNWFG+W  SY FNFLM+W+S GTF +++  N   I+FV  VVP
Sbjct  388  VFPINIKGIGGSLVTLVNWFGSWAVSYAFNFLMSWSSAGTFFIFSAANAATIVFVAMVVP  447

Query  266  ETKGRTLEQIQATINA  219
            ETKGR+LE+IQ ++N+
Sbjct  448  ETKGRSLEEIQESLNS  463



>ref|XP_003575758.2| PREDICTED: sugar transporter ERD6-like 16 [Brachypodium distachyon]
Length=440

 Score =   317 bits (812),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/255 (58%), Positives = 201/255 (79%), Gaps = 1/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEFE+ALQ+LRGK+AD+S EAAEI++++E +E LPKA + DLF + Y R + IGV
Sbjct  183  KVGRQKEFEIALQRLRGKDADVSLEAAEIKEFIETIENLPKAGIQDLFSRSYIRPVIIGV  242

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ  GINGI FY S  F SAGF S ++GTI+   +Q  +TA+GA L+D++GR+PL
Sbjct  243  GLMVFQQFVGINGILFYASETFVSAGFTSGNLGTILMGCIQAPITALGALLMDRSGRRPL  302

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L++S SGL +G +++G+S+YLK   I     PV+A+TGI+VYI SFS+GMG+VPWVIMSE
Sbjct  303  LLISTSGLLVGSLMSGISFYLKTHGIFAEQVPVIALTGILVYIASFSLGMGSVPWVIMSE  362

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KG+ GSF TLVNWFG+   S+ FNF M+W+S GTF  +A +  +AILF++KVVP
Sbjct  363  IFPINMKGIGGSFVTLVNWFGSLAVSFAFNFFMSWSSSGTFFFFAFVCAMAILFIVKVVP  422

Query  266  ETKGRTLEQIQATIN  222
            ETKG+TLE+IQ +IN
Sbjct  423  ETKGKTLEEIQVSIN  437



>ref|XP_009419854.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=481

 Score =   318 bits (815),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 152/256 (59%), Positives = 199/256 (78%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G+ KEF  ALQKLRG++ADI++EA EIQ+Y+E L+ LPKA + DLFQ  Y RS+ +GV
Sbjct  224  KVGNQKEFTAALQKLRGEDADITQEAEEIQEYIEDLQTLPKAGIQDLFQSIYIRSVIVGV  283

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ+GGING+ FY S IF SAGF S  +GTI+   +QV +T VGA L+D++GR PL
Sbjct  284  GLMVFQQIGGINGVGFYASKIFVSAGFSSGKLGTILMGSIQVPITIVGALLMDRSGRIPL  343

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSASG  +GC +TG S+YLK   I     P LA+ GI+VY+G+FS+GMGAVPWVIMSE
Sbjct  344  LMVSASGTFIGCFITGTSFYLKAQGIYMEWVPTLALCGILVYVGAFSIGMGAVPWVIMSE  403

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            +FPIN+KG+ GS  TLVNWFG+W  SY FNFLM+W+S GTF +++  N   I+FV  VVP
Sbjct  404  VFPINIKGIGGSLVTLVNWFGSWAVSYAFNFLMSWSSAGTFFIFSAANAATIVFVAMVVP  463

Query  266  ETKGRTLEQIQATINA  219
            ETKGR+LE+IQ ++N+
Sbjct  464  ETKGRSLEEIQESLNS  479



>ref|XP_007030780.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY11282.1| Major facilitator superfamily protein [Theobroma cacao]
Length=486

 Score =   318 bits (815),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 147/260 (57%), Positives = 201/260 (77%), Gaps = 0/260 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KE E ALQ+LRG NADIS+EA+EI+DY E L++L +A +FDLFQ++Y+ S+ +GV
Sbjct  227  KIGKWKECEAALQRLRGDNADISDEASEIRDYTEQLQQLSEASIFDLFQRKYAWSLMVGV  286

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+NGI FY S+IF SAGF   +G I   ++Q+ +TA+   L+DK+GR+PLL
Sbjct  287  GLMVLQQFGGVNGIAFYASAIFISAGFSGSVGMIAMVVVQIPMTALAVVLMDKSGRRPLL  346

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+G  LGC L G+S++L+ L       P+L++ G++VY GSFS+GMG +PWVIMSEI
Sbjct  347  LVSAAGTCLGCFLVGLSFFLQDLQQWKEGTPILSLVGVLVYTGSFSLGMGGIPWVIMSEI  406

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS  TLV+W G+W+ S+ FNFL+ W+S GTF ++A+I  L +LFV K+VPE
Sbjct  407  FPINMKGSAGSLVTLVSWLGSWIISFAFNFLLKWSSAGTFFIFASICGLTVLFVAKLVPE  466

Query  263  TKGRTLEQIQATINA*SRTR  204
            TKGRTLE+IQA+IN  S  R
Sbjct  467  TKGRTLEEIQASINPVSLER  486



>ref|XP_004134178.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Cucumis 
sativus]
 gb|KGN57056.1| hypothetical protein Csa_3G150850 [Cucumis sativus]
Length=482

 Score =   317 bits (813),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 155/257 (60%), Positives = 196/257 (76%), Gaps = 3/257 (1%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF  ALQ+LRGKN +IS EA EIQ Y+E +  LPK KL DLFQ  Y R + IGV
Sbjct  226  KVGEEKEFLSALQRLRGKNVNISAEAVEIQSYIETMRSLPKIKLVDLFQTIYIRPLMIGV  285

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS--DIGTIIYAILQVIVTAVGATLIDKAGRKP  630
            GLM+ QQ GGINGI F+ S  F SAG PS   IGTI YA +QV +T VG  L+DK+GR+P
Sbjct  286  GLMMFQQFGGINGIGFFASETFASAG-PSAGKIGTIAYACIQVPITVVGVILMDKSGRRP  344

Query  629  LLVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMS  450
            L++VSA+G +LGC L G S++LKG  +  +  P+L V G+++YI  FS+GMGAVPWVIMS
Sbjct  345  LIMVSAAGTSLGCFLAGASFFLKGRGLLLDFVPMLVVAGVLIYIAFFSIGMGAVPWVIMS  404

Query  449  EIFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVV  270
            EIFPINVKGV GS   LVNW GAW+ S+TFNF + W+S+GTF +Y+ I+++ ILFVIK+V
Sbjct  405  EIFPINVKGVGGSIVVLVNWLGAWIVSFTFNFFITWSSYGTFFIYSLISLMTILFVIKLV  464

Query  269  PETKGRTLEQIQATINA  219
            PETKGRTLE+IQ +IN+
Sbjct  465  PETKGRTLEEIQTSINS  481



>gb|KJB45167.1| hypothetical protein B456_007G293200 [Gossypium raimondii]
Length=487

 Score =   317 bits (811),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 151/263 (57%), Positives = 199/263 (76%), Gaps = 1/263 (0%)
 Frame = -3

Query  989  WQ-RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIF  813
            WQ ++G  KE E +LQ LRG NADIS EA+EI+DY E L++L ++ +FDLFQK Y+ S+ 
Sbjct  225  WQAKIGKWKECEASLQCLRGNNADISNEASEIKDYTEQLQRLSESSVFDLFQKDYAWSLI  284

Query  812  IGVGLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRK  633
            +GVGLM+ QQ GG+NGI FY SSIF SAGF   +G I   ++QV +T +G  L+DK+GR+
Sbjct  285  VGVGLMVLQQFGGVNGIAFYASSIFISAGFSGSVGMIAMVVVQVPMTTLGVLLLDKSGRR  344

Query  632  PLLVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIM  453
            PLL+VSA+G  LGC L G+S+ L+ L       P+L++ G++VY GSFS+GMG +PWVIM
Sbjct  345  PLLLVSAAGTCLGCFLVGLSFLLQDLQQWKEVTPILSLVGVLVYTGSFSLGMGGIPWVIM  404

Query  452  SEIFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKV  273
            SEIFPIN+KG AGS  TLV+W G+W+ S+ FNFLM W+S GTF ++ATI  L +LFV K+
Sbjct  405  SEIFPINMKGSAGSLVTLVSWLGSWIISFAFNFLMKWSSTGTFFIFATICGLTVLFVAKL  464

Query  272  VPETKGRTLEQIQATINA*SRTR  204
            VPETKGRTLE+IQA++N  S  R
Sbjct  465  VPETKGRTLEEIQASMNPVSLER  487



>ref|XP_008458507.1| PREDICTED: sugar transporter ERD6-like 16 [Cucumis melo]
 ref|XP_008458508.1| PREDICTED: sugar transporter ERD6-like 16 [Cucumis melo]
 ref|XP_008458509.1| PREDICTED: sugar transporter ERD6-like 16 [Cucumis melo]
Length=494

 Score =   317 bits (811),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/262 (61%), Positives = 198/262 (76%), Gaps = 4/262 (2%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G+ + F VALQ+LRGK ADIS+EA EI++Y E L+ LPKAKL DLFQ +Y R + IGV
Sbjct  230  KVGNERGFLVALQQLRGKAADISDEATEIREYNETLQSLPKAKLVDLFQSKYIRPVIIGV  289

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ GGINGI FY S  F  AG  S   GTI YA LQ+ +T VGA L+DK+GRKPL
Sbjct  290  GLMVFQQFGGINGIGFYASETFALAGPSSRKTGTISYACLQIPITVVGAMLMDKSGRKPL  349

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            ++VSA G  LGC L G+S++LKG  +     P+LA+ G++ YI SFS+GMGAVPWVIMSE
Sbjct  350  IMVSAGGTFLGCFLAGISFFLKGHGLLLEWIPILAILGVLTYIASFSIGMGAVPWVIMSE  409

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPI+VKG AGS   LVNW GAW  SYTFNFLM+W+  GTF +Y+  ++L I+FV K+VP
Sbjct  410  IFPIHVKGAAGSLVVLVNWLGAWAVSYTFNFLMSWSPSGTFFVYSGFSLLTIVFVAKLVP  469

Query  266  ETKGRTLEQIQATINA*SRTRR  201
            ETKG+TLE+IQATIN    TR+
Sbjct  470  ETKGKTLEEIQATINP---TRK  488



>ref|XP_008223079.1| PREDICTED: sugar transporter ERD6-like 16 [Prunus mume]
Length=490

 Score =   316 bits (810),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 150/258 (58%), Positives = 196/258 (76%), Gaps = 0/258 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEFEVALQ LRG NADIS+E  EIQ+++  L  LPKA + DLFQ R  R++ IGV
Sbjct  230  KVGRDKEFEVALQTLRGNNADISDEMTEIQEFIATLNSLPKASILDLFQSRNIRAVIIGV  289

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ  GING+ FY S  FESAG  S IGTI YA LQV +T VGA L+DK GR+ L+
Sbjct  290  GLMVFQQFAGINGVQFYASETFESAGVSSKIGTIAYACLQVPITLVGALLMDKTGRRVLV  349

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+G+ +GC+L G S+ LKG  +  +  P++A++G+++Y+  FS+GMGA PWVIMSEI
Sbjct  350  MVSAAGMFVGCMLAGTSFSLKGQGLLLDWVPIIAMSGVLIYVAFFSIGMGAGPWVIMSEI  409

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPI++KGV GS   LVNW GAW+ SYT+NFLM W+S GT+ LY+ + +L ILFV K+VPE
Sbjct  410  FPIDIKGVGGSLVVLVNWSGAWIVSYTYNFLMRWSSPGTYFLYSAVCLLTILFVAKIVPE  469

Query  263  TKGRTLEQIQATINA*SR  210
            TKG+TLE+IQA++N   R
Sbjct  470  TKGKTLEEIQASLNPDRR  487



>ref|XP_002512320.1| sugar transporter, putative [Ricinus communis]
 gb|EEF49772.1| sugar transporter, putative [Ricinus communis]
Length=455

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/253 (57%), Positives = 197/253 (78%), Gaps = 0/253 (0%)
 Frame = -3

Query  980  LGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGVG  801
            +G   E E +LQ+LRG NADIS+E ++IQ+ + ++ +LPK  + DLF +R  R + +GVG
Sbjct  203  VGRQHESESSLQRLRGANADISQEESDIQESLALIRRLPKVTVLDLFHRRNIRFVIVGVG  262

Query  800  LMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLLV  621
            LM  QQ GG+NGI FY + IF SAG P  +G+I+Y+ LQV++TA  A+L+D+AGR+PLL+
Sbjct  263  LMAFQQFGGVNGIIFYANQIFASAGVPPSVGSILYSGLQVLMTAFAASLVDRAGRRPLLI  322

Query  620  VSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIF  441
            VSA+GL L   L G S++LKG ++A    P+LA+TG+M YI  FS+GMGA+PWV+MSE+F
Sbjct  323  VSATGLLLSNALIGTSFFLKGNHLALELVPILAITGVMFYIAFFSLGMGAIPWVLMSELF  382

Query  440  PINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPET  261
            P+++KG+AGS  TLVNWFGAW  S+TFNFLM W+SFGTF LYA I +  I F++K+VPET
Sbjct  383  PLHLKGIAGSLVTLVNWFGAWFISFTFNFLMGWSSFGTFFLYACICLCNIFFIVKMVPET  442

Query  260  KGRTLEQIQATIN  222
            KGRTLE+IQA++N
Sbjct  443  KGRTLEEIQASVN  455



>ref|XP_008359875.1| PREDICTED: sugar transporter ERD6-like 5 [Malus domestica]
Length=486

 Score =   315 bits (808),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 144/254 (57%), Positives = 199/254 (78%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KE E ALQ LRG+N++ S+E AEI+DY E L++L +A++ DLFQ+RY+ S+ +GV
Sbjct  228  KIGKWKECEAALQXLRGENSNTSQEVAEIRDYTETLKRLSEARILDLFQRRYAYSLIVGV  287

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+NGI FY S+IF SAGF   +GTI    +QV +TA+G  L+DKAGR+PLL
Sbjct  288  GLMVLQQFGGVNGIAFYASTIFISAGFSDSVGTIAMVAVQVPMTALGVILMDKAGRRPLL  347

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VS++G  LGC+L G+S+ L+ L       P+LA+ G++V+ GSFS+GMG +PWVIMSEI
Sbjct  348  LVSSAGTCLGCLLVGLSFSLQNLQQWKQITPILALVGVLVFTGSFSLGMGGIPWVIMSEI  407

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS  TLV+W G+W+ SYTFNFLM W+S GTF L+++++ + +LFV K+VPE
Sbjct  408  FPINMKGSAGSLITLVSWLGSWIVSYTFNFLMDWSSAGTFFLFSSVSAVTVLFVAKLVPE  467

Query  263  TKGRTLEQIQATIN  222
            TKGRTLE+IQ ++N
Sbjct  468  TKGRTLEEIQTSLN  481



>ref|XP_009414205.1| PREDICTED: sugar transporter ERD6-like 16 [Musa acuminata subsp. 
malaccensis]
Length=481

 Score =   315 bits (807),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 150/256 (59%), Positives = 198/256 (77%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++ H KE   ALQKLRGK+ADI++E AEIQ+ +E L+ LP+A   DLFQ RY RS+ + V
Sbjct  224  KVEHQKESISALQKLRGKDADITQETAEIQECIENLQTLPRAGFQDLFQSRYIRSVIVSV  283

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ GGING+ FY S IF SAGF S + GTI+   +QV +T VGA L+D+ GR PL
Sbjct  284  GLMVFQQTGGINGVGFYASQIFVSAGFSSGNFGTILMGCIQVPITIVGAILMDRCGRIPL  343

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSASG ++GC +TG+S+YLKG  I  +  P LA++GI+VY+GS+S+GMGAVPWV+MSE
Sbjct  344  LMVSASGSSVGCFITGISFYLKGQGIYMDCVPTLALSGILVYLGSYSIGMGAVPWVMMSE  403

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFP+N+KGV GS  TLV+WFG+W  SY FNFLM+W+S GTF L++      +LFV +VVP
Sbjct  404  IFPLNIKGVGGSLVTLVSWFGSWAVSYAFNFLMSWSSAGTFFLFSAAGAATLLFVARVVP  463

Query  266  ETKGRTLEQIQATINA  219
            ETKGR+LE+IQ ++N+
Sbjct  464  ETKGRSLEEIQESLNS  479



>ref|XP_009620983.1| PREDICTED: sugar transporter ERD6-like 5 isoform X2 [Nicotiana 
tomentosiformis]
Length=389

 Score =   311 bits (798),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 145/254 (57%), Positives = 200/254 (79%), Gaps = 1/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KE E +LQ+LRGK+A+IS+EA EI+DY E ++KL +AK+ DLFQK+Y+ S+ +GV
Sbjct  131  KAGKWKECEASLQRLRGKDANISKEATEIKDYTETIQKLSEAKMIDLFQKKYAHSLIVGV  190

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+N I +Y SSIFESAGF   IG+I   ++Q+ +  +G  L+DK+GR+PLL
Sbjct  191  GLMVLQQFGGVNAIAYYASSIFESAGFSGRIGSIAMVVVQIPMQVLGVLLMDKSGRRPLL  250

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+G  LGC L G+S+ L+ L +   ++P LA+ GI+V+ GSFS+GMG +PWVIMSEI
Sbjct  251  LVSAAGTCLGCFLVGLSFLLQDLQLW-KSSPFLALVGILVFTGSFSLGMGGIPWVIMSEI  309

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPINVKG+AGS  T+VNWFG+W+ SY+FNFLM W+S GTF +++ +  L I+FV K+VPE
Sbjct  310  FPINVKGLAGSLVTVVNWFGSWIVSYSFNFLMLWSSEGTFFIFSAVCGLTIMFVAKLVPE  369

Query  263  TKGRTLEQIQATIN  222
            TKGRTLE+IQ ++N
Sbjct  370  TKGRTLEEIQLSMN  383



>ref|XP_010649814.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Vitis vinifera]
Length=474

 Score =   314 bits (805),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 158/256 (62%), Positives = 192/256 (75%), Gaps = 19/256 (7%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEFEVAL++LRGK+AD+S+EAAEIQ Y+E L+  PKAK+ DLFQ +Y RS+ IGV
Sbjct  237  KVGREKEFEVALRRLRGKDADVSKEAAEIQVYIENLQSFPKAKMLDLFQTKYIRSLIIGV  296

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSD-IGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ GGINGI FY S  F SAG  S  IGTI YA +QV +T VGA L+DK+GR+PL
Sbjct  297  GLMVFQQFGGINGIGFYVSETFVSAGLSSSKIGTIAYACIQVPITIVGAILMDKSGRRPL  356

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSASG  LGC LTG S++LK                  +YI SFS+GMGAVPWVIMSE
Sbjct  357  LMVSASGTFLGCFLTGASFFLK------------------LYIASFSIGMGAVPWVIMSE  398

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPINVKG AGS   LVNW GAW+ SYTFNFLM+W+  GTF +YA  + + ILFV K+VP
Sbjct  399  IFPINVKGAAGSLVVLVNWLGAWVVSYTFNFLMSWSPTGTFSIYAGFSAMTILFVAKIVP  458

Query  266  ETKGRTLEQIQATINA  219
            ETKG+TLE+IQA I++
Sbjct  459  ETKGKTLEEIQACIDS  474



>ref|XP_007205125.1| hypothetical protein PRUPE_ppa004943mg [Prunus persica]
 gb|EMJ06324.1| hypothetical protein PRUPE_ppa004943mg [Prunus persica]
Length=484

 Score =   315 bits (806),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 146/260 (56%), Positives = 198/260 (76%), Gaps = 0/260 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  K+ E ALQ LRGKNADIS+E +EI+DY E L++  +A + DLFQ+RY+ S+ +GV
Sbjct  225  KIGQEKKCEDALQNLRGKNADISQEKSEIRDYTETLKRPSEASILDLFQRRYAYSVIVGV  284

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+NGI FY S+IF SAGF   IGTI    +Q+ +T +G  L+DK+GR+PLL
Sbjct  285  GLMVLQQFGGVNGIAFYASTIFISAGFSDSIGTIAMVAVQIPMTGLGVILMDKSGRRPLL  344

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VS++G  LGC+L G+S+ L+ L    +  P+LA+ GI+V+ GSFS+GMG +PWVIMSEI
Sbjct  345  LVSSTGTCLGCLLVGLSFLLQNLQQWKHVTPILALVGILVFTGSFSLGMGGIPWVIMSEI  404

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS  TLV+W G+W+ SY FNFLM WNS GTF +++ ++ + ILFV K+VPE
Sbjct  405  FPINMKGSAGSLVTLVSWLGSWIVSYAFNFLMDWNSAGTFFMFSCVSGVTILFVAKLVPE  464

Query  263  TKGRTLEQIQATINA*SRTR  204
            TKGRTLE+IQ ++N  S  R
Sbjct  465  TKGRTLEEIQTSMNRFSEKR  484



>emb|CBI34326.3| unnamed protein product [Vitis vinifera]
Length=874

 Score =   325 bits (832),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 155/254 (61%), Positives = 199/254 (78%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G+ KEF+++LQKLRG +ADISEE AEIQ+Y+   E LPK  + DL  K+  RS+ +GV
Sbjct  621  KVGNEKEFKLSLQKLRGADADISEEVAEIQEYIVTHELLPKVTIMDLLGKQNIRSVVVGV  680

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GGINGI FY   IF SAG P ++G I+YA LQVIVTA G +LID+ GR+PLL
Sbjct  681  GLMVFQQFGGINGIVFYAGQIFVSAGVPPNVGGILYACLQVIVTAFGGSLIDRLGRRPLL  740

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA G+ LGC+LTG S+ LK   +A N  P+LAVTGI+VYIG +SVG+GA+PWVIMSEI
Sbjct  741  IVSAYGMLLGCLLTGTSFLLKAHQLATNLVPILAVTGILVYIGFYSVGLGAIPWVIMSEI  800

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FP+++KG AGS  TLVNW G+W  SYTFNFLM W+S GTF  YA +   A++F++ +VPE
Sbjct  801  FPLHIKGTAGSLVTLVNWCGSWAVSYTFNFLMNWSSHGTFFGYAFVCAAAVVFIVMLVPE  860

Query  263  TKGRTLEQIQATIN  222
            TKGRTLE+IQA++N
Sbjct  861  TKGRTLEEIQASMN  874



>ref|XP_003547222.2| PREDICTED: sugar transporter ERD6-like 16-like [Glycine max]
Length=482

 Score =   314 bits (805),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/256 (59%), Positives = 199/256 (78%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF++AL +LRGK+ADIS+EAAEI DY+E LE LPK KL DL Q +Y RS+ IGV
Sbjct  225  KVGREKEFQLALSRLRGKHADISDEAAEILDYIETLESLPKTKLLDLLQSKYVRSVVIGV  284

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM CQQ  GINGI FYT+ IF +AG  S   GTI YA +Q+  T  GA L+DK+GR+PL
Sbjct  285  GLMACQQSVGINGIGFYTAEIFVAAGLSSGKAGTIAYACIQIPFTLSGAILMDKSGRRPL  344

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            ++VSA+G  LGC++ G++++LK  N+     P+LAV G+++YI +FS+G+G+VPWVIMSE
Sbjct  345  VMVSAAGTFLGCLIAGIAFFLKDQNLLLEWVPILAVAGVLIYIAAFSIGLGSVPWVIMSE  404

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFP+++KG AGS   LV W GAW+ SYTFNFLM+W+S GT  LYA  ++L ILFV K+VP
Sbjct  405  IFPLHLKGTAGSLVVLVAWLGAWVVSYTFNFLMSWSSPGTLFLYAGCSLLTILFVAKLVP  464

Query  266  ETKGRTLEQIQATINA  219
            ETKG+TLE+IQA +++
Sbjct  465  ETKGKTLEEIQACLSS  480



>ref|XP_007226898.1| hypothetical protein PRUPE_ppa016361mg [Prunus persica]
 gb|EMJ28097.1| hypothetical protein PRUPE_ppa016361mg [Prunus persica]
Length=490

 Score =   315 bits (806),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 150/258 (58%), Positives = 196/258 (76%), Gaps = 0/258 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEFEVALQ LRG NADIS+E  EIQ+++  +  LPKA + DLFQ R  R++ IGV
Sbjct  230  KVGRDKEFEVALQTLRGNNADISDEMTEIQEFIATVNSLPKASILDLFQSRNIRAVIIGV  289

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ  GING+ FY S  F+SAG  S IGTI YA LQV +T VGA L+DK GR+ L+
Sbjct  290  GLMVFQQFAGINGVQFYASETFKSAGVSSKIGTIAYACLQVPITLVGALLMDKTGRRVLV  349

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+G+ +GC+L G S+ LKG  +  +  P++AV+G+++Y+  FS+GMGA PWVIMSEI
Sbjct  350  MVSAAGMFVGCMLAGTSFSLKGQGLLLDWVPIIAVSGVLIYVAFFSIGMGAGPWVIMSEI  409

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPI++KGV GS   LVNW GAW+ SYT+NFLM W+S GT+ LY+ + +L ILFV KVVPE
Sbjct  410  FPIDIKGVGGSLVVLVNWSGAWIVSYTYNFLMRWSSPGTYFLYSAVCLLTILFVAKVVPE  469

Query  263  TKGRTLEQIQATINA*SR  210
            TKG+TLE+IQA++N   R
Sbjct  470  TKGKTLEEIQASLNPDRR  487



>ref|XP_008246533.1| PREDICTED: sugar transporter ERD6-like 5 isoform X2 [Prunus mume]
Length=482

 Score =   314 bits (805),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/260 (56%), Positives = 197/260 (76%), Gaps = 0/260 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  K+ E ALQ LRGKNADIS+E +EI+DY E L++L +A + DLFQ+RY  S+ +GV
Sbjct  223  KIGQEKKCEDALQNLRGKNADISQEKSEIRDYTETLKRLSEASILDLFQRRYVYSLIVGV  282

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+NGI FY S+IF SAGF   IGT+    +Q+ +T +G  L+DK+GR+PLL
Sbjct  283  GLMVLQQFGGVNGIAFYASTIFISAGFSDSIGTLAMVAVQIPMTGLGVILMDKSGRRPLL  342

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VS++G  LGC+L G+S+ L+ L       P+LA+ G++V+ GSFS+GMG +PWVIMSEI
Sbjct  343  LVSSTGTCLGCLLVGLSFLLQNLQQWKQVTPILALVGVLVFTGSFSLGMGGIPWVIMSEI  402

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS  TLV+W G+W+ SY FNFLM WNS GTF +++ ++ + ILFV K+VPE
Sbjct  403  FPINMKGSAGSLVTLVSWLGSWIVSYAFNFLMDWNSAGTFFMFSCVSGVTILFVAKLVPE  462

Query  263  TKGRTLEQIQATINA*SRTR  204
            TKGRTLE+IQ ++N  S  R
Sbjct  463  TKGRTLEEIQTSMNRFSEKR  482



>ref|XP_006663074.1| PREDICTED: sugar transporter ERD6-like 16-like [Oryza brachyantha]
Length=463

 Score =   313 bits (802),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/256 (57%), Positives = 201/256 (79%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEFE+ALQ+LRGK+AD+S EAAEI++++E +E LPKA + DLF + Y R   +GV
Sbjct  205  KVGRQKEFEIALQRLRGKDADVSIEAAEIKEFIETIENLPKAGVQDLFNRAYIRPAIVGV  264

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ  GINGI FY S  F SAGF S D+GTI+   +Q  +TAVGA L+D++GR+PL
Sbjct  265  GLMVFQQFVGINGILFYASETFVSAGFASGDLGTILMGCIQAPITAVGALLMDRSGRRPL  324

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L++S SGL +G +++ +S+YLK   +     P++A+TGI++YI S+S+GMGAVPWVIMSE
Sbjct  325  LLISTSGLLIGSLMSAISFYLKIHGLFLEQVPIIALTGILIYIASYSIGMGAVPWVIMSE  384

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KG+ GSF TLVNW G+W  S+ FNF M+W+S GTF ++A +  +AILF++K VP
Sbjct  385  IFPINIKGIGGSFVTLVNWSGSWAVSFAFNFFMSWSSSGTFFVFALVCAVAILFIVKAVP  444

Query  266  ETKGRTLEQIQATINA  219
            ETKG+TLE+IQA++N+
Sbjct  445  ETKGKTLEEIQASMNS  460



>ref|XP_002319570.2| sugar transporter family protein [Populus trichocarpa]
 gb|EEE95493.2| sugar transporter family protein [Populus trichocarpa]
Length=477

 Score =   313 bits (803),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/260 (57%), Positives = 198/260 (76%), Gaps = 0/260 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G GKE EVALQ LRG NADIS+EAAEI+DY E + +L +A +F+LFQ +Y+ S+ +GV
Sbjct  218  KIGQGKECEVALQCLRGHNADISDEAAEIRDYTETILQLSEASIFELFQWKYAHSLIVGV  277

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+NGI FY SSIF SAGF   IG I   ++Q+ +TA+G  L+D +GR+PLL
Sbjct  278  GLMVLQQFGGVNGIAFYASSIFISAGFSGSIGMIAMVVVQIPMTALGVVLMDISGRRPLL  337

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+G  LGC L  +S+ L+ LN +   +P LA+ G+++Y GSFS+GMG +PWVIMSE+
Sbjct  338  MVSAAGTCLGCFLAALSFLLQYLNKSVAVSPFLALFGVLIYTGSFSLGMGGIPWVIMSEV  397

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN KG AGS  TLV+W G+W+ SY FNFLM W+S GTF +++ I  L +LFV K+VPE
Sbjct  398  FPINTKGSAGSLVTLVSWLGSWIISYAFNFLMDWSSAGTFFIFSCICGLTVLFVAKLVPE  457

Query  263  TKGRTLEQIQATINA*SRTR  204
            TKGRTLE+IQA++N  S  R
Sbjct  458  TKGRTLEEIQASMNPLSAKR  477



>ref|XP_008246532.1| PREDICTED: sugar transporter ERD6-like 5 isoform X1 [Prunus mume]
Length=495

 Score =   314 bits (804),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/260 (56%), Positives = 197/260 (76%), Gaps = 0/260 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  K+ E ALQ LRGKNADIS+E +EI+DY E L++L +A + DLFQ+RY  S+ +GV
Sbjct  236  KIGQEKKCEDALQNLRGKNADISQEKSEIRDYTETLKRLSEASILDLFQRRYVYSLIVGV  295

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+NGI FY S+IF SAGF   IGT+    +Q+ +T +G  L+DK+GR+PLL
Sbjct  296  GLMVLQQFGGVNGIAFYASTIFISAGFSDSIGTLAMVAVQIPMTGLGVILMDKSGRRPLL  355

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VS++G  LGC+L G+S+ L+ L       P+LA+ G++V+ GSFS+GMG +PWVIMSEI
Sbjct  356  LVSSTGTCLGCLLVGLSFLLQNLQQWKQVTPILALVGVLVFTGSFSLGMGGIPWVIMSEI  415

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS  TLV+W G+W+ SY FNFLM WNS GTF +++ ++ + ILFV K+VPE
Sbjct  416  FPINMKGSAGSLVTLVSWLGSWIVSYAFNFLMDWNSAGTFFMFSCVSGVTILFVAKLVPE  475

Query  263  TKGRTLEQIQATINA*SRTR  204
            TKGRTLE+IQ ++N  S  R
Sbjct  476  TKGRTLEEIQTSMNRFSEKR  495



>ref|XP_011466327.1| PREDICTED: sugar transporter ERD6-like 5 [Fragaria vesca subsp. 
vesca]
Length=492

 Score =   314 bits (804),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/260 (56%), Positives = 196/260 (75%), Gaps = 0/260 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KE E ALQ LRGKNAD S EAAEI+DY E L++L +  + D+FQ+RY+ S+ +GV
Sbjct  233  KIGQEKESEAALQHLRGKNADTSGEAAEIRDYTETLKRLSEPSILDIFQRRYAHSLLVGV  292

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+NGI FY S+IF SAGF   IGTI    +Q+ +TA+G  L+DK+GR+PLL
Sbjct  293  GLMVLQQFGGVNGIAFYASTIFISAGFSDSIGTIAMVGVQIPMTALGVVLMDKSGRRPLL  352

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VS++G  LGC+  G+S+ L+ L       PV A+ G++VY GSFS+GMG +PWVIMSEI
Sbjct  353  LVSSAGTCLGCLFVGLSFLLQDLQGWSQVTPVFALVGVLVYTGSFSLGMGGIPWVIMSEI  412

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS  T+V+W G+W+ SY FNFLM WNS GTF ++++I  + ++FV K+VPE
Sbjct  413  FPINMKGSAGSLVTVVSWLGSWIVSYAFNFLMDWNSAGTFFMFSSICGVTVIFVAKLVPE  472

Query  263  TKGRTLEQIQATINA*SRTR  204
            TKGRTLE+IQA++N  S  R
Sbjct  473  TKGRTLEEIQASMNPFSVKR  492



>ref|XP_002315546.2| hypothetical protein POPTR_0010s02740g [Populus trichocarpa]
 gb|EEF01717.2| hypothetical protein POPTR_0010s02740g [Populus trichocarpa]
Length=488

 Score =   313 bits (803),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 198/256 (77%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF VALQKLRGK+AD++ EAAEIQ Y+E L+ LPKAKL +LF+ +Y RS+ IGV
Sbjct  233  KVGLQKEFRVALQKLRGKDADVTREAAEIQVYLENLQALPKAKLLNLFESKYIRSVIIGV  292

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
             LM+ QQ GGINGI FY S  F SAG  S  IGTI YA +Q+ +T +GA L+DK+GR+PL
Sbjct  293  ALMVFQQFGGINGIGFYASETFASAGLSSAKIGTIAYACIQIPITMLGAILMDKSGRRPL  352

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            +++S++G  LG  L G S++LKG  +     P+L + G+++Y+ +FS+GMGAVPWVIMSE
Sbjct  353  MMISSTGTFLGSFLAGTSFFLKGQGLLLEWVPILTIAGVLIYVSAFSIGMGAVPWVIMSE  412

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KG+AGS   LVNW GAW  S+TFNFLM W+S GTF++Y+  +VL +L+V K VP
Sbjct  413  IFPINIKGIAGSLVVLVNWSGAWAVSFTFNFLMDWSSSGTFLVYSGFSVLTVLYVAKFVP  472

Query  266  ETKGRTLEQIQATINA  219
            ETKG+TLE+IQ +IN+
Sbjct  473  ETKGKTLEEIQKSINS  488



>ref|XP_010107671.1| Sugar transporter ERD6-like 7 [Morus notabilis]
 gb|EXC16582.1| Sugar transporter ERD6-like 7 [Morus notabilis]
Length=362

 Score =   309 bits (792),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 178/226 (79%), Gaps = 20/226 (9%)
 Frame = -3

Query  899  IQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGVGLMICQQLGGINGICFYTSSIFESAGFP  720
            +QDY+  LE+LPKA + DLFQ+RY RS+ IG+GLM+CQQ GGIN ICFYTSSIFESAGF 
Sbjct  156  LQDYITTLEQLPKANMLDLFQRRYLRSLNIGLGLMVCQQFGGINAICFYTSSIFESAGFS  215

Query  719  SDIGTIIYAILQVIVTAVGATLIDKAGRKPLLVVSASGLALGCILTGVSYYLKGLNIAGN  540
            S +GTIIYAILQ++VT + A +IDK GRKPLL+V                      +A  
Sbjct  216  SKLGTIIYAILQLVVTGLSAAVIDKVGRKPLLLVH--------------------ELALQ  255

Query  539  AAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTF  360
            A+P+LAV GI++YIGS+SVGMGAVPWV+MSEIF IN+KG AGS ATL+NWFGAW  SY+F
Sbjct  256  ASPILAVIGILLYIGSYSVGMGAVPWVMMSEIFSINIKGQAGSLATLMNWFGAWFYSYSF  315

Query  359  NFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTLEQIQATIN  222
            NFLMAW+S+GTFILYA IN LAILF+I VVPETKG+TLEQIQA IN
Sbjct  316  NFLMAWSSYGTFILYAAINALAILFIITVVPETKGKTLEQIQAAIN  361



>ref|XP_010941736.1| PREDICTED: sugar transporter ERD6-like 16 [Elaeis guineensis]
Length=473

 Score =   312 bits (800),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 199/256 (78%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  +E EVALQ LRGK+ADIS+EAA+IQ+YVE L  LP+ ++ +LFQ+ Y RS+ +GV
Sbjct  216  KVGRDRESEVALQSLRGKDADISQEAADIQEYVETLRSLPETRILELFQRTYIRSVIVGV  275

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM  QQ GG+NGI FY + IF SAGF S ++GTI+   +QV +T +GA L+DK+GR+PL
Sbjct  276  GLMAFQQFGGVNGITFYATEIFVSAGFASGNLGTILLGSIQVPITTMGAFLMDKSGRRPL  335

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSASG  L      +S+YLK   I  +  P+LA+TGI+ ++GSFS+GMGA+PWVIMSE
Sbjct  336  LMVSASGTCLSAFTIAISFYLKDKGIYMDWVPLLALTGILGFLGSFSIGMGAIPWVIMSE  395

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KGVAGS  TLVNWF +W  SY FNFL++W+S GTF ++A     +++FV KVVP
Sbjct  396  IFPINIKGVAGSLVTLVNWFASWAVSYAFNFLVSWSSSGTFFVFAAFCATSVVFVAKVVP  455

Query  266  ETKGRTLEQIQATINA  219
            ETKGRTLE+IQA++N+
Sbjct  456  ETKGRTLEEIQASMNS  471



>ref|XP_002457558.1| hypothetical protein SORBIDRAFT_03g009310 [Sorghum bicolor]
 gb|EES02678.1| hypothetical protein SORBIDRAFT_03g009310 [Sorghum bicolor]
Length=389

 Score =   309 bits (792),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 145/256 (57%), Positives = 197/256 (77%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            R GH   FE ALQKLRGK  DIS+EA EI+D+ E L++LP++K+FDLF+K Y R++ +GV
Sbjct  126  RFGHPGAFEAALQKLRGKATDISDEATEIKDFTEKLQQLPESKMFDLFRKDYIRAVTVGV  185

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ GG+N ICFY S IF SAGF S + G +    +Q+ +T +G  L+DKAGR+PL
Sbjct  186  GLMVLQQFGGVNAICFYASEIFVSAGFSSGNTGMLAMVAVQIPMTGLGVLLMDKAGRRPL  245

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSA+G  LGC+L G+S+  K  +   +   VLA+ GI+++ GSFS+GMG +PWVIMSE
Sbjct  246  LMVSAAGTCLGCLLVGLSFLAKEHHWGKDLNLVLALAGILIFGGSFSLGMGGIPWVIMSE  305

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KG AGS  TLV+W G+W+ SY FNFL+ WNS+GTF ++A+I  L ++FV ++VP
Sbjct  306  IFPINMKGAAGSLVTLVSWLGSWIVSYAFNFLLVWNSYGTFFIFASICGLTVVFVERLVP  365

Query  266  ETKGRTLEQIQATINA  219
            ETKGRTLE+IQA++N+
Sbjct  366  ETKGRTLEEIQASMNS  381



>ref|XP_009620982.1| PREDICTED: sugar transporter ERD6-like 5 isoform X1 [Nicotiana 
tomentosiformis]
Length=470

 Score =   312 bits (799),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 145/254 (57%), Positives = 200/254 (79%), Gaps = 1/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KE E +LQ+LRGK+A+IS+EA EI+DY E ++KL +AK+ DLFQK+Y+ S+ +GV
Sbjct  212  KAGKWKECEASLQRLRGKDANISKEATEIKDYTETIQKLSEAKMIDLFQKKYAHSLIVGV  271

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+N I +Y SSIFESAGF   IG+I   ++Q+ +  +G  L+DK+GR+PLL
Sbjct  272  GLMVLQQFGGVNAIAYYASSIFESAGFSGRIGSIAMVVVQIPMQVLGVLLMDKSGRRPLL  331

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+G  LGC L G+S+ L+ L +   ++P LA+ GI+V+ GSFS+GMG +PWVIMSEI
Sbjct  332  LVSAAGTCLGCFLVGLSFLLQDLQLW-KSSPFLALVGILVFTGSFSLGMGGIPWVIMSEI  390

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPINVKG+AGS  T+VNWFG+W+ SY+FNFLM W+S GTF +++ +  L I+FV K+VPE
Sbjct  391  FPINVKGLAGSLVTVVNWFGSWIVSYSFNFLMLWSSEGTFFIFSAVCGLTIMFVAKLVPE  450

Query  263  TKGRTLEQIQATIN  222
            TKGRTLE+IQ ++N
Sbjct  451  TKGRTLEEIQLSMN  464



>ref|XP_002512323.1| sugar transporter, putative [Ricinus communis]
 gb|EEF49775.1| sugar transporter, putative [Ricinus communis]
Length=488

 Score =   312 bits (800),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 145/254 (57%), Positives = 199/254 (78%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KE E ALQ+LRG N DIS EAA+I+DY E L++  +A +F+LFQ +Y+ S+ +GV
Sbjct  229  KIGRLKECEAALQRLRGGNTDISGEAADIRDYTEFLQQHSEASIFELFQWKYAHSLIVGV  288

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+NG+ FY SSIF SAGF   IGTI   ++QV +TA+G  L+D +GR+PLL
Sbjct  289  GLMVLQQFGGVNGVAFYASSIFISAGFSGSIGTIAMVVVQVPMTALGVLLMDISGRRPLL  348

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+G  LGC+L  +S+ L+ L+   N +P LA+TG+++Y GSFS+GMG +PWVIMSE+
Sbjct  349  LVSAAGTCLGCLLAAMSFLLQDLHTWMNFSPFLALTGVLIYTGSFSLGMGGIPWVIMSEV  408

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS  TLV+W G+W+ SY FNFLM W+S GTF+++++I  L +LFV K+VPE
Sbjct  409  FPINMKGSAGSLVTLVSWLGSWIISYAFNFLMTWSSAGTFLIFSSICGLTVLFVAKLVPE  468

Query  263  TKGRTLEQIQATIN  222
            TKGRTLE+IQA++N
Sbjct  469  TKGRTLEEIQASMN  482



>ref|XP_004153836.1| PREDICTED: sugar transporter ERD6-like 16 [Cucumis sativus]
 ref|XP_011656657.1| PREDICTED: sugar transporter ERD6-like 16 [Cucumis sativus]
Length=494

 Score =   312 bits (799),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 158/263 (60%), Positives = 197/263 (75%), Gaps = 6/263 (2%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G+ + F VALQ+LRGK+ADIS+EA EI++Y E L+ LPKAKL DLFQ +Y R + IGV
Sbjct  230  KVGNERGFLVALQRLRGKDADISDEATEIREYNETLQSLPKAKLLDLFQSKYIRPVIIGV  289

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSD--IGTIIYAILQVIVTAVGATLIDKAGRKP  630
            GLM+ QQ GGINGI FY S  F  AG PS    GTI YA LQ+ +T VGA L+DK+GRKP
Sbjct  290  GLMVFQQFGGINGIGFYVSETFALAG-PSSRKSGTISYACLQIPITIVGAMLMDKSGRKP  348

Query  629  LLVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMS  450
            L++VSA G  LGC L GVS++LK   +     P+L + G++ YI  FS+GMGAVPWVIMS
Sbjct  349  LIMVSAGGTFLGCFLAGVSFFLKSHGLLLEWIPILTIFGVLTYIAFFSIGMGAVPWVIMS  408

Query  449  EIFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVV  270
            EIFPI+VKG AGS   LVNW GAW  SYTFNFLM+W+  GTF +Y+  ++L I+FV K+V
Sbjct  409  EIFPIHVKGAAGSLVVLVNWLGAWAVSYTFNFLMSWSPSGTFFVYSCFSLLTIVFVAKLV  468

Query  269  PETKGRTLEQIQATINA*SRTRR  201
            PETKG+TLE+IQATIN    TR+
Sbjct  469  PETKGKTLEEIQATINP---TRK  488



>ref|XP_011011018.1| PREDICTED: sugar transporter ERD6-like 16 [Populus euphratica]
Length=488

 Score =   311 bits (798),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 198/256 (77%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF VALQKLRGK+AD++ EAAEIQ Y+E L+ LPKAKL +LF+ ++ RS+ IGV
Sbjct  233  KVGLQKEFRVALQKLRGKDADVTREAAEIQVYLENLQALPKAKLLNLFESKHIRSVIIGV  292

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
             LM+ QQ GGINGI FY S  F SAG  S  IGTI YA +Q+ +T +GA L+DK+GR+PL
Sbjct  293  ALMVFQQFGGINGIGFYASETFASAGLSSAKIGTIAYACIQIPITMLGAILMDKSGRRPL  352

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            +++S++G  LG  L G+S++LKG     +  P+LA+ G+++Y+ +FS+GMGAVPWVIMSE
Sbjct  353  MMISSTGTFLGSFLAGISFFLKGHGWLLDWVPILAIAGVLIYVSAFSIGMGAVPWVIMSE  412

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KG+AGS   LVNW GAW  S+TFNFLM W+S GTF +Y+  +VL  L+V K VP
Sbjct  413  IFPINIKGIAGSLVVLVNWSGAWAVSFTFNFLMDWSSSGTFFVYSGFSVLTFLYVAKFVP  472

Query  266  ETKGRTLEQIQATINA  219
            ETKG+TLE+IQ +IN+
Sbjct  473  ETKGKTLEEIQKSINS  488



>ref|XP_011023522.1| PREDICTED: sugar transporter ERD6-like 5 isoform X1 [Populus 
euphratica]
Length=477

 Score =   311 bits (796),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/260 (57%), Positives = 198/260 (76%), Gaps = 0/260 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G G+E EVALQ LRG NADIS+EAAEI+DY E + +L +A +F+LFQ +Y+ S+ +GV
Sbjct  218  KIGRGRECEVALQCLRGHNADISDEAAEIRDYTETVLQLSEASIFELFQWKYAHSLIVGV  277

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+NGI FY SSIF SAGF   IG I   ++Q+ +TA+G  L+D +GR+PLL
Sbjct  278  GLMVLQQFGGVNGIAFYASSIFISAGFSGSIGMIAMVVVQIPMTALGVVLMDISGRRPLL  337

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+G  LGC L  +S+ L+ LN +   +P LA+ G+++Y GSFS+GMG +PWVIMSE+
Sbjct  338  MVSAAGTCLGCFLAALSFLLQYLNKSVAVSPFLALFGVLIYTGSFSLGMGGIPWVIMSEV  397

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS  TLV+W G+W+ SY FNFLM W+S GTF + + I  L +LFV K+VPE
Sbjct  398  FPINMKGSAGSLVTLVSWLGSWIISYAFNFLMDWSSAGTFFILSCICGLTVLFVAKLVPE  457

Query  263  TKGRTLEQIQATINA*SRTR  204
            TKGRTLE+IQA++N  S  R
Sbjct  458  TKGRTLEEIQASMNPLSAKR  477



>ref|XP_007147846.1| hypothetical protein PHAVU_006G159600g [Phaseolus vulgaris]
 gb|ESW19840.1| hypothetical protein PHAVU_006G159600g [Phaseolus vulgaris]
Length=523

 Score =   312 bits (799),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/256 (59%), Positives = 195/256 (76%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF++AL+ LRGK+ DIS EAAEI DY+E    LPK KL DLFQ++Y RS+ IGV
Sbjct  268  KVGREKEFQLALRSLRGKDVDISHEAAEILDYIETFNSLPKTKLLDLFQRKYVRSLVIGV  327

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM CQQ  GINGI FYT+  F +AG  S   GTI Y  +Q+  T +GA L+D++GR+PL
Sbjct  328  GLMACQQSVGINGIGFYTAETFVAAGLSSGKAGTIAYGCMQIPFTILGAILMDRSGRRPL  387

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            ++VSASG  LGC + GV+++LK  ++     P+LAVTG+++YI +FS+GMG VPWVIMSE
Sbjct  388  IMVSASGTFLGCFIAGVAFFLKDQSLLLEWVPILAVTGVLIYIAAFSIGMGPVPWVIMSE  447

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPINVKG AGS   L+NW GAW+ SYTFNFLM+W+S GT  LYA  ++L I+FV K+VP
Sbjct  448  IFPINVKGTAGSLVVLLNWLGAWIVSYTFNFLMSWSSPGTLFLYAGSSLLTIVFVAKLVP  507

Query  266  ETKGRTLEQIQATINA  219
            ETKG+TLE+IQ  I++
Sbjct  508  ETKGKTLEEIQDCISS  523



>ref|XP_012069445.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Jatropha 
curcas]
Length=408

 Score =   308 bits (788),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 153/256 (60%), Positives = 198/256 (77%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  +EF+VALQKLRGK+ADI+ E  EIQD +E+LE LPKA+  DLFQ++Y R IFIGV
Sbjct  153  KVGRDREFKVALQKLRGKDADITREEDEIQDSIEILEALPKARFLDLFQRQYIRVIFIGV  212

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
             +MICQQ  GING+ FY S IF +AG  S  +GTI YA +QV +T  GA L+DK+GRKPL
Sbjct  213  AIMICQQFVGINGVGFYVSQIFVTAGLSSGTLGTIAYACIQVPITIAGAMLMDKSGRKPL  272

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            ++VSA+G  LG  + G S+ LK L++     P+LAV G++V+I +FS+GMGAVPW+IMSE
Sbjct  273  IMVSAAGTFLGSSMVGTSFLLKSLSLLLGWVPILAVAGVLVFISAFSIGMGAVPWLIMSE  332

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KGV GS   LVNW GAW+ SYTFNFL++W+S GTF LY+  +++ ILFV K VP
Sbjct  333  IFPINIKGVGGSLVVLVNWLGAWIVSYTFNFLISWSSSGTFFLYSGFSLMTILFVAKFVP  392

Query  266  ETKGRTLEQIQATINA  219
            ETKG+TLE+IQ  IN+
Sbjct  393  ETKGKTLEEIQECINS  408



>gb|KCW85184.1| hypothetical protein EUGRSUZ_B02014 [Eucalyptus grandis]
Length=495

 Score =   311 bits (796),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 147/267 (55%), Positives = 200/267 (75%), Gaps = 13/267 (5%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KE E AL +LRGKNADIS+EAAEI +Y E L++L +A++ DLFQ++Y+ S+ +GV
Sbjct  227  KTGRNKECEAALLRLRGKNADISQEAAEIWEYTETLQRLSEARILDLFQRKYAYSLIVGV  286

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+NGI FY S IF SAGF   +GTI   ++Q+ +TA+G  L+DK+GR+PLL
Sbjct  287  GLMVLQQFGGVNGIAFYASFIFISAGFSGSVGTIAMVVVQIPMTALGVLLMDKSGRRPLL  346

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIM-------------VYIGSFSV  483
            +VSA+G  LGC++TG S+Y + L +     P+LA+ G++             VY GSFS+
Sbjct  347  LVSAAGTCLGCLMTGFSFYFQDLQVWKAFTPILALVGVLVLQINCARYIYHGVYTGSFSL  406

Query  482  GMGAVPWVIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATIN  303
            GMG +PWVIMSEIFPIN+KG AGS  T+V+W G+W+ SYTFNF+M W+S GTF ++++I 
Sbjct  407  GMGGIPWVIMSEIFPINMKGSAGSLVTVVSWLGSWIISYTFNFMMDWSSAGTFFIFSSIC  466

Query  302  VLAILFVIKVVPETKGRTLEQIQATIN  222
             L +LFV K+VPETKGRTLE+IQAT+N
Sbjct  467  GLTVLFVAKLVPETKGRTLEEIQATMN  493



>gb|KDO44993.1| hypothetical protein CISIN_1g011956mg [Citrus sinensis]
Length=396

 Score =   307 bits (786),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 144/254 (57%), Positives = 193/254 (76%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G G E E ALQ+LRG +ADISEEAAEI++Y E LE+L +  + +LFQ++Y+ S+ +GV
Sbjct  140  KTGKGIESEAALQRLRGADADISEEAAEIREYTETLERLSEGGILELFQRKYAHSLIVGV  199

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+NGI FY SSIF SAGF   IG I   ++Q+ +T +G  L+DK+GR+PLL
Sbjct  200  GLMVLQQFGGVNGIAFYASSIFISAGFSGSIGMIAMVVIQIPMTLLGVLLMDKSGRRPLL  259

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+G  LGC+L  +S+  + L     A P LA+ G++VY GSFS+GMG +PWVIMSE+
Sbjct  260  LVSAAGTCLGCLLAALSFLFQDLQQWIKATPFLALVGVLVYTGSFSLGMGGIPWVIMSEV  319

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS  TLV+W G+W+ S+TFNFLM W+S GTF  ++ I  L +LFV K+VPE
Sbjct  320  FPINMKGSAGSLVTLVSWLGSWIISFTFNFLMKWSSTGTFFAFSAICSLTVLFVAKLVPE  379

Query  263  TKGRTLEQIQATIN  222
            TKGRTLE+IQA++N
Sbjct  380  TKGRTLEEIQASMN  393



>ref|XP_006361887.1| PREDICTED: sugar transporter ERD6-like 5-like [Solanum tuberosum]
Length=465

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/252 (57%), Positives = 198/252 (79%), Gaps = 1/252 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KE E +LQ+LRGK+A+ISEEAAEI++Y E L+KL +AKL DLF K+Y+ S+ +GV
Sbjct  213  KAGQWKECEASLQRLRGKDANISEEAAEIKEYTETLQKLSEAKLIDLFHKKYAHSLIVGV  272

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+N I +Y SSIFESAGF   IG+I   ++Q+ +  +G  L+DK+GR+PLL
Sbjct  273  GLMVLQQFGGVNAIAYYASSIFESAGFSGRIGSIAMVVVQIPMQVLGVLLMDKSGRRPLL  332

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+G  LGC L G S+ L+ L +   ++P LA+ GI+V+ GSFS+GMG +PWVIMSEI
Sbjct  333  MVSAAGTCLGCFLLGSSFLLQDLQLW-KSSPFLALVGILVFTGSFSLGMGGIPWVIMSEI  391

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPINVKG+AGS  T++NWFG+W+ SY+FNFLM W+S GTF +++ +  + ++FV K+VPE
Sbjct  392  FPINVKGLAGSLVTVINWFGSWIVSYSFNFLMLWSSEGTFFIFSAVCGVTVMFVAKLVPE  451

Query  263  TKGRTLEQIQAT  228
            TKGRTLE+IQ++
Sbjct  452  TKGRTLEEIQSS  463



>ref|XP_004967879.1| PREDICTED: sugar transporter ERD6-like 5-like [Setaria italica]
Length=483

 Score =   309 bits (791),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/256 (56%), Positives = 195/256 (76%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            R GH   FE ALQKLRGK  DIS+EA EI+D+ E L+ LP++K+ DLFQK Y R++ +GV
Sbjct  221  RFGHPGAFEAALQKLRGKGTDISDEALEIKDFTEKLQHLPESKMLDLFQKAYIRAVTVGV  280

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ GG+N ICFY S IF SAGF S + G +    +Q+ +T +G  L+DKAGR+PL
Sbjct  281  GLMVLQQFGGVNAICFYASEIFVSAGFSSGNTGMLAMVAVQIPMTGLGVLLMDKAGRRPL  340

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSA+G  LGC+L G+S+  K  +   +   +LA+ GI+++ GSFS+GMG +PWVIMSE
Sbjct  341  LMVSAAGTCLGCLLVGLSFLAKEHHWGKDLNILLALAGILIFTGSFSLGMGGIPWVIMSE  400

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KG AGS  TLV+W G+W+ SY FNFL+ WNS+GTF ++AT+  L ++FV ++VP
Sbjct  401  IFPINMKGAAGSLVTLVSWLGSWIISYAFNFLLVWNSYGTFFIFATVCGLTVVFVERLVP  460

Query  266  ETKGRTLEQIQATINA  219
            ETKGRTLE+IQA++N+
Sbjct  461  ETKGRTLEEIQASMNS  476



>ref|XP_006433198.1| hypothetical protein CICLE_v10001032mg [Citrus clementina]
 ref|XP_006471872.1| PREDICTED: sugar transporter ERD6-like 5-like isoform X1 [Citrus 
sinensis]
 gb|ESR46438.1| hypothetical protein CICLE_v10001032mg [Citrus clementina]
Length=474

 Score =   308 bits (789),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/254 (57%), Positives = 193/254 (76%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G G E E ALQ+LRG +ADISEEAAEI++Y E LE+L +  + +LFQ++Y+ S+ +GV
Sbjct  218  KTGKGIESEAALQRLRGADADISEEAAEIREYTETLERLSEGGILELFQRKYAHSLIVGV  277

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+NGI FY SSIF SAGF   IG I   ++Q+ +T +G  L+DK+GR+PLL
Sbjct  278  GLMVLQQFGGVNGIAFYASSIFISAGFSGSIGMIAMVVIQIPMTLLGVLLMDKSGRRPLL  337

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+G  LGC+L  +S+  + L     A P LA+ G++VY GSFS+GMG +PWVIMSE+
Sbjct  338  LVSAAGTCLGCLLAALSFLFQDLQQWIKATPFLALVGVLVYTGSFSLGMGGIPWVIMSEV  397

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS  TLV+W G+W+ S+TFNFLM W+S GTF  ++ I  L +LFV K+VPE
Sbjct  398  FPINMKGSAGSLVTLVSWLGSWIISFTFNFLMKWSSTGTFFAFSAICSLTVLFVAKLVPE  457

Query  263  TKGRTLEQIQATIN  222
            TKGRTLE+IQA++N
Sbjct  458  TKGRTLEEIQASMN  471



>gb|KHN33102.1| Sugar transporter ERD6-like 16 [Glycine soja]
Length=487

 Score =   308 bits (790),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/261 (57%), Positives = 199/261 (76%), Gaps = 6/261 (2%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF++AL +LRGK+ADIS+EAAEI DY+E LE LPK KL DL Q +Y RS+ IGV
Sbjct  225  KVGREKEFQLALSRLRGKHADISDEAAEILDYIETLESLPKTKLLDLLQSKYVRSVVIGV  284

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM CQQ  GINGI FYT+ IF +AG  S   GTI YA +Q+  T  GA L+DK+GR+PL
Sbjct  285  GLMACQQSVGINGIGFYTAEIFVAAGLSSGKAGTIAYACIQIPFTLSGAILMDKSGRRPL  344

Query  626  LVVSASGLALGCILTGVSYYLKG-----LNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPW  462
            ++VSA+G  LGC++ G++++LK       N+     P+LAV G+++YI +FS+G+G+VPW
Sbjct  345  VMVSAAGTFLGCLIAGIAFFLKASLKLDQNLLLEWVPILAVAGVLIYIAAFSIGLGSVPW  404

Query  461  VIMSEIFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFV  282
            VIMSEIFP+++KG AGS   LV W GAW+ SYTFNFLM+W+S GT  LYA  ++L ILFV
Sbjct  405  VIMSEIFPLHLKGTAGSLVVLVAWLGAWVVSYTFNFLMSWSSPGTLFLYAGCSLLTILFV  464

Query  281  IKVVPETKGRTLEQIQATINA  219
             K+VPETKG+TLE+IQA +++
Sbjct  465  AKLVPETKGKTLEEIQACLSS  485



>ref|XP_004230159.2| PREDICTED: LOW QUALITY PROTEIN: sugar transporter ERD6-like 5 
[Solanum lycopersicum]
Length=484

 Score =   308 bits (790),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/254 (56%), Positives = 199/254 (78%), Gaps = 1/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KE E +LQ+LRGK+A+ISEEAAEI++Y E L+KL +AKL DLF K+Y+ S+ +GV
Sbjct  213  KAGQWKECEASLQRLRGKDANISEEAAEIKEYTETLQKLSEAKLIDLFHKKYAHSLIVGV  272

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+N I +Y SSIFESAGF   +G+I   ++Q+ +  +G  L+DK+GR+PLL
Sbjct  273  GLMVLQQFGGVNAIAYYASSIFESAGFSGRVGSIAMVVVQIPMQVLGVLLMDKSGRRPLL  332

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+G  LGC L G S+ L+ L +   ++P LA+ GI+V+ GSFS+GMG +PWVIMSEI
Sbjct  333  MVSAAGTCLGCFLVGSSFLLQDLQLW-KSSPFLALVGILVFTGSFSLGMGGIPWVIMSEI  391

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPINVKG+AGS  T++NWFG+W+ SY+FNFLM W+S GTF +++ +  + ++FV K+VPE
Sbjct  392  FPINVKGLAGSLVTVINWFGSWIVSYSFNFLMLWSSEGTFFIFSAVCGVTVMFVAKLVPE  451

Query  263  TKGRTLEQIQATIN  222
            TKGRTLE+IQ+++ 
Sbjct  452  TKGRTLEEIQSSMT  465



>gb|KDO44992.1| hypothetical protein CISIN_1g011956mg [Citrus sinensis]
Length=474

 Score =   308 bits (789),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/254 (57%), Positives = 193/254 (76%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G G E E ALQ+LRG +ADISEEAAEI++Y E LE+L +  + +LFQ++Y+ S+ +GV
Sbjct  218  KTGKGIESEAALQRLRGADADISEEAAEIREYTETLERLSEGGILELFQRKYAHSLIVGV  277

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+NGI FY SSIF SAGF   IG I   ++Q+ +T +G  L+DK+GR+PLL
Sbjct  278  GLMVLQQFGGVNGIAFYASSIFISAGFSGSIGMIAMVVIQIPMTLLGVLLMDKSGRRPLL  337

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+G  LGC+L  +S+  + L     A P LA+ G++VY GSFS+GMG +PWVIMSE+
Sbjct  338  LVSAAGTCLGCLLAALSFLFQDLQQWIKATPFLALVGVLVYTGSFSLGMGGIPWVIMSEV  397

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS  TLV+W G+W+ S+TFNFLM W+S GTF  ++ I  L +LFV K+VPE
Sbjct  398  FPINMKGSAGSLVTLVSWLGSWIISFTFNFLMKWSSTGTFFAFSAICSLTVLFVAKLVPE  457

Query  263  TKGRTLEQIQATIN  222
            TKGRTLE+IQA++N
Sbjct  458  TKGRTLEEIQASMN  471



>ref|XP_011659911.1| PREDICTED: sugar transporter ERD6-like 5 isoform X3 [Cucumis 
sativus]
Length=337

 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 138/252 (55%), Positives = 195/252 (77%), Gaps = 0/252 (0%)
 Frame = -3

Query  977  GHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGVGL  798
            G G + E ALQ+LRGK  DIS E  EIQ+Y E+L++LP+  + DLFQ++Y+RS+F+G+GL
Sbjct  80   GQGLDCEDALQRLRGKTKDISTEVLEIQEYTELLKQLPEPSVLDLFQRQYARSLFVGLGL  139

Query  797  MICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLLVV  618
            M+ QQ GG+NGI FY +S+F SAGF  +IGTI  A +Q+ +TA+G  L+D +GR+PLL++
Sbjct  140  MVLQQFGGVNGIAFYVTSLFTSAGFSGNIGTIALASVQIPMTALGVVLMDVSGRRPLLMI  199

Query  617  SASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFP  438
            SA+G  LG +   +S+  K L +  + +P++A+ G++VY GSFS+GMGA+PWVIMSEIFP
Sbjct  200  SAAGTCLGSLCLALSFLFKDLQLWQSGSPMMALAGVLVYSGSFSLGMGAIPWVIMSEIFP  259

Query  437  INVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETK  258
            IN+KG+AGS  TLV+W G+W+ SY+FNFL+ W+S G F ++++I    +LFV K VPETK
Sbjct  260  INMKGLAGSLVTLVSWLGSWIVSYSFNFLLNWSSTGIFFIFSSICGFTVLFVAKFVPETK  319

Query  257  GRTLEQIQATIN  222
            GRTLE+IQA +N
Sbjct  320  GRTLEEIQAAMN  331



>ref|XP_011090878.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Sesamum 
indicum]
Length=485

 Score =   308 bits (789),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/264 (56%), Positives = 199/264 (75%), Gaps = 1/264 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  K+F++AL+KLRGK+ADIS EAA+IQ  +  LE LPK  + DLF  +Y+R+I I V
Sbjct  217  KVGRRKDFDLALRKLRGKDADISHEAADIQAGIAHLEDLPKVGVRDLFDAKYTRAIIIAV  276

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GL + QQ GGINGI FY+  I   AGF  + G I YAI+QV +T +GATL+DK+GR+PLL
Sbjct  277  GLFVFQQFGGINGINFYSGEILAEAGFSREKGQIAYAIIQVPITLIGATLMDKSGRRPLL  336

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+G+  G  L G ++YLK   +     P+LA++G+++YI +FS+GMGAVPWVIM EI
Sbjct  337  MVSATGMGFGSFLIGAAFYLKAHALLLEWVPMLAISGVLLYIATFSIGMGAVPWVIMGEI  396

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPI +KG+AGS   LV+W  AWL SYTFNFLM WN+ GTF +YA  ++L +LFV KVVPE
Sbjct  397  FPIYIKGIAGSLVCLVHWSVAWLISYTFNFLMTWNAIGTFWIYAGFSMLTVLFVAKVVPE  456

Query  263  TKGRTLEQIQATINA*SRTRRHKN  192
            TKG+TLE+IQA ++A  RT +++N
Sbjct  457  TKGKTLEEIQAALSA-HRTAKNRN  479



>ref|XP_010912097.1| PREDICTED: sugar transporter ERD6-like 5 isoform X1 [Elaeis guineensis]
Length=480

 Score =   308 bits (788),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/261 (56%), Positives = 199/261 (76%), Gaps = 1/261 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++GH  +FE ALQ LRGK+ DIS+EA EI+++ E L+ LP+A++ DLFQK+Y  S+ +GV
Sbjct  219  KVGHHDKFEAALQSLRGKDTDISQEAEEIKEFTESLQSLPQARMLDLFQKKYLHSVIVGV  278

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ  G+N +CFY S IF SAGF S + GTI   I+QV +TA+G  L+DK+GR+P+
Sbjct  279  GLMVFQQFTGVNAVCFYASQIFVSAGFSSGNTGTIAMVIVQVPMTALGVFLLDKSGRRPI  338

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSA+G  +GC L  +S+ L+           LA+TG++V+ GSFS+G+GA+PWVIMSE
Sbjct  339  LMVSAAGTCVGCFLVAMSFSLQEHEWPKEINIALALTGMLVFTGSFSLGLGAIPWVIMSE  398

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KG AGS  TLVNW G+W+ SYTFNFL+ W+S GTF L+A+I  L +LFV ++VP
Sbjct  399  IFPINMKGSAGSLVTLVNWLGSWIISYTFNFLITWSSAGTFFLFASICGLTVLFVERLVP  458

Query  266  ETKGRTLEQIQATINA*SRTR  204
            ETKGRTLE+IQA++N+ S  +
Sbjct  459  ETKGRTLEEIQASLNSFSSDK  479



>ref|XP_003541649.1| PREDICTED: sugar transporter ERD6-like 16-like [Glycine max]
Length=481

 Score =   308 bits (788),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/256 (58%), Positives = 196/256 (77%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF++AL +LRGK+ADIS+EAAEI DY+E L+ LPK KL DLFQ +Y  S+ IGV
Sbjct  226  KVGREKEFQLALSRLRGKDADISDEAAEILDYIETLQSLPKTKLLDLFQSKYVHSVVIGV  285

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM CQQ  GINGI FYT+ IF +AG  S   GTI YA +Q+  T +GA L+DK+GR+PL
Sbjct  286  GLMACQQSVGINGIGFYTAEIFVAAGLSSGKAGTIAYACIQIPFTLLGAILMDKSGRRPL  345

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            ++VSA+G  LGC +   +++LK  ++     P+LA  G+++YI +FS+G+G+VPWVIMSE
Sbjct  346  VMVSAAGTFLGCFVAAFAFFLKDQSLLPEWVPILAFAGVLIYIAAFSIGLGSVPWVIMSE  405

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPI++KG AGS   LV W GAW+ SYTFNFLM+W+S GT  LYA  ++L ILFV K+VP
Sbjct  406  IFPIHLKGTAGSLVVLVAWLGAWVVSYTFNFLMSWSSPGTLFLYAGCSLLTILFVAKLVP  465

Query  266  ETKGRTLEQIQATINA  219
            ETKG+TLE+IQA I++
Sbjct  466  ETKGKTLEEIQACISS  481



>ref|NP_001146190.1| uncharacterized protein LOC100279760 [Zea mays]
 gb|ACL53431.1| unknown [Zea mays]
Length=485

 Score =   308 bits (788),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/256 (57%), Positives = 195/256 (76%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            R GH   FE ALQKLRGK  DIS+EA  I+D+ E L++LPK+K+ DLFQK Y R++ +GV
Sbjct  222  RFGHPGAFEAALQKLRGKGTDISDEATGIKDFTEKLQQLPKSKMLDLFQKDYIRAVTVGV  281

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ GG+N ICFY S IF SAGF S + G +    +Q+ +T +G  L+DKAGR+PL
Sbjct  282  GLMVLQQFGGVNAICFYASEIFVSAGFSSGNTGMLAMVAVQIPMTGLGVILMDKAGRRPL  341

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSA+G  LGC+L G+S+  K  +   +   VLA+ GI+++ GSFS+GMG +PWVIMSE
Sbjct  342  LMVSAAGTCLGCLLVGLSFLAKEHHWGKDLNLVLALAGILIFGGSFSLGMGGIPWVIMSE  401

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KG AGS  TLV+W G+W+ SY FNFL+ WNS+GTF ++A+I  L ++FV ++VP
Sbjct  402  IFPINMKGAAGSLVTLVSWLGSWIVSYAFNFLLVWNSYGTFFIFASICGLTVVFVEQLVP  461

Query  266  ETKGRTLEQIQATINA  219
            ETKGRTLE+IQA++N+
Sbjct  462  ETKGRTLEEIQASMNS  477



>ref|XP_008366851.1| PREDICTED: LOW QUALITY PROTEIN: sugar transporter ERD6-like 5 
[Malus domestica]
Length=493

 Score =   308 bits (788),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 142/254 (56%), Positives = 195/254 (77%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KE E ALQ LR +N+  S+E AEI+DY E L++L +A++ DLFQ+RY+ S+ +GV
Sbjct  235  KIGKWKECEXALQXLRXENSXTSQEVAEIRDYTETLKRLSEARILDLFQRRYAYSLXVGV  294

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM  QQ GG+NGI FY S+IF SAGF   +GTI    +QV +TA+G  L+DKAGR+PLL
Sbjct  295  GLMXLQQFGGVNGIAFYASTIFISAGFSDSVGTIAMVAVQVPMTALGVILMDKAGRRPLL  354

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VS++G  LGC+L G+S+ L+ L       P+LA+ G++V+ GSFS+GMG +PWVIMSEI
Sbjct  355  LVSSAGTCLGCLLVGLSFSLQNLQQWKQITPILALVGVLVFTGSFSLGMGGIPWVIMSEI  414

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS  TLV+W G+W+ SY FNFLM W+S GTF L+++++ + +LFV K+VPE
Sbjct  415  FPINMKGSAGSLITLVSWLGSWIVSYXFNFLMDWSSAGTFFLFSSVSAVTVLFVAKLVPE  474

Query  263  TKGRTLEQIQATIN  222
            TKGRTLE+IQ ++N
Sbjct  475  TKGRTLEEIQTSLN  488



>ref|XP_011623902.1| PREDICTED: sugar transporter ERD6-like 7 [Amborella trichopoda]
Length=484

 Score =   307 bits (787),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 194/255 (76%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEFE AL++LRGK+ADISEEAAEI+DY+  +E LPK KL DLFQ++Y+  + +G+
Sbjct  218  KVGKQKEFEEALRRLRGKDADISEEAAEIEDYIRTIESLPKVKLLDLFQRKYAYPLIVGI  277

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GL+  QQ GGINGI FY +  FE AG    +GTI  A +QV+VTAVGATL+DK GR+PLL
Sbjct  278  GLIALQQFGGINGIIFYAAETFEEAGSSGTVGTISIACIQVLVTAVGATLMDKCGRRPLL  337

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VS SG   GC+L+ +S++L+  +   + +P+LA+ GI+VYI +FSVG GA+PWV+MSEI
Sbjct  338  LVSISGACFGCLLSAISFFLQSQDYLTDFSPILALCGILVYIAAFSVGWGAIPWVLMSEI  397

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPINVKG AGS  +L++WFG W  S  +NF M+W+   T+ ++  I    +LFV K+VPE
Sbjct  398  FPINVKGTAGSLVSLMHWFGGWFMSLMYNFFMSWSKTATYTVFTAICGGTVLFVAKLVPE  457

Query  263  TKGRTLEQIQATINA  219
            TKGRTLE+IQA++++
Sbjct  458  TKGRTLEEIQASMDS  472



>ref|XP_012069444.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Jatropha 
curcas]
Length=490

 Score =   308 bits (788),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 153/256 (60%), Positives = 198/256 (77%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  +EF+VALQKLRGK+ADI+ E  EIQD +E+LE LPKA+  DLFQ++Y R IFIGV
Sbjct  235  KVGRDREFKVALQKLRGKDADITREEDEIQDSIEILEALPKARFLDLFQRQYIRVIFIGV  294

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
             +MICQQ  GING+ FY S IF +AG  S  +GTI YA +QV +T  GA L+DK+GRKPL
Sbjct  295  AIMICQQFVGINGVGFYVSQIFVTAGLSSGTLGTIAYACIQVPITIAGAMLMDKSGRKPL  354

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            ++VSA+G  LG  + G S+ LK L++     P+LAV G++V+I +FS+GMGAVPW+IMSE
Sbjct  355  IMVSAAGTFLGSSMVGTSFLLKSLSLLLGWVPILAVAGVLVFISAFSIGMGAVPWLIMSE  414

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KGV GS   LVNW GAW+ SYTFNFL++W+S GTF LY+  +++ ILFV K VP
Sbjct  415  IFPINIKGVGGSLVVLVNWLGAWIVSYTFNFLISWSSSGTFFLYSGFSLMTILFVAKFVP  474

Query  266  ETKGRTLEQIQATINA  219
            ETKG+TLE+IQ  IN+
Sbjct  475  ETKGKTLEEIQECINS  490



>gb|ERN07483.1| hypothetical protein AMTR_s00019p00256320 [Amborella trichopoda]
Length=494

 Score =   307 bits (787),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 194/255 (76%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEFE AL++LRGK+ADISEEAAEI+DY+  +E LPK KL DLFQ++Y+  + +G+
Sbjct  228  KVGKQKEFEEALRRLRGKDADISEEAAEIEDYIRTIESLPKVKLLDLFQRKYAYPLIVGI  287

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GL+  QQ GGINGI FY +  FE AG    +GTI  A +QV+VTAVGATL+DK GR+PLL
Sbjct  288  GLIALQQFGGINGIIFYAAETFEEAGSSGTVGTISIACIQVLVTAVGATLMDKCGRRPLL  347

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VS SG   GC+L+ +S++L+  +   + +P+LA+ GI+VYI +FSVG GA+PWV+MSEI
Sbjct  348  LVSISGACFGCLLSAISFFLQSQDYLTDFSPILALCGILVYIAAFSVGWGAIPWVLMSEI  407

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPINVKG AGS  +L++WFG W  S  +NF M+W+   T+ ++  I    +LFV K+VPE
Sbjct  408  FPINVKGTAGSLVSLMHWFGGWFMSLMYNFFMSWSKTATYTVFTAICGGTVLFVAKLVPE  467

Query  263  TKGRTLEQIQATINA  219
            TKGRTLE+IQA++++
Sbjct  468  TKGRTLEEIQASMDS  482



>ref|XP_010528859.1| PREDICTED: sugar transporter ERD6-like 5 isoform X1 [Tarenaya 
hassleriana]
Length=475

 Score =   306 bits (785),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 138/255 (54%), Positives = 195/255 (76%), Gaps = 0/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G   +FE+ALQ+LRG+ ADIS E+ EI+ Y E L++LPK  + DLFQ+RY+ S+ +GV
Sbjct  218  KVGKWGDFEIALQRLRGEFADISSESDEIKGYTEALDRLPKGSMLDLFQRRYAGSVIVGV  277

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+NG+ FY SSIF SAGF S +G I   ++Q+ +T +G  L DK+GR+PLL
Sbjct  278  GLMVLQQFGGVNGVSFYASSIFISAGFSSSLGMIAMVLVQIPMTILGVILTDKSGRRPLL  337

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+G  +GC+L G S++L+GL +     P LA+ G+++Y GSFS+GMG +PWVIMSEI
Sbjct  338  LVSATGTCIGCLLVGTSFFLQGLMLLKETTPFLALLGVLMYTGSFSLGMGGIPWVIMSEI  397

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPI++KG AGS  T+V+W G+W+ S+ FNFLM WNS GTF ++A      ++FV K+VPE
Sbjct  398  FPIHMKGSAGSLVTVVSWLGSWIVSFAFNFLMNWNSSGTFFIFAAFCGFTVIFVAKLVPE  457

Query  263  TKGRTLEQIQATINA  219
            TKGRTLE+IQ+++N+
Sbjct  458  TKGRTLEEIQSSMNS  472



>ref|XP_006594464.1| PREDICTED: sugar transporter ERD6-like 16-like isoform X4 [Glycine 
max]
 ref|XP_006594465.1| PREDICTED: sugar transporter ERD6-like 16-like isoform X5 [Glycine 
max]
Length=479

 Score =   306 bits (785),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 147/255 (58%), Positives = 195/255 (76%), Gaps = 1/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF++AL++LRGK+ DIS+EAAEI D +E L  LPK KL DLFQ ++ RS+ IGV
Sbjct  224  KVGREKEFQLALRRLRGKDVDISDEAAEILDSIETLRSLPKIKLLDLFQSKHVRSVVIGV  283

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+CQQ  GINGI FYT+  F +AG  S   GTI YA LQV  T +GA L+DK+GR+PL
Sbjct  284  GLMVCQQFVGINGIGFYTAETFIAAGLSSGKAGTIAYACLQVPFTVLGAILMDKSGRRPL  343

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            ++VSA+G  LGC +  ++++LK  ++    AP+ AV G+++YI ++S+G+G VPWVIMSE
Sbjct  344  MMVSATGTFLGCFIAAIAFFLKDQSLMLECAPIFAVAGVLIYIAAYSIGVGPVPWVIMSE  403

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPI+VKG+AGS   L NW GAW+ SYTFN LM+W+S GT  LYA  ++L ILFV K+VP
Sbjct  404  IFPIHVKGIAGSLVVLANWLGAWIVSYTFNSLMSWSSPGTLFLYAGSSLLTILFVTKLVP  463

Query  266  ETKGRTLEQIQATIN  222
            ETKG+TLE+IQA I+
Sbjct  464  ETKGKTLEEIQAWIS  478



>ref|XP_003580968.1| PREDICTED: sugar transporter ERD6-like 5 [Brachypodium distachyon]
Length=475

 Score =   306 bits (785),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 144/249 (58%), Positives = 195/249 (78%), Gaps = 1/249 (0%)
 Frame = -3

Query  962  FEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGVGLMICQQ  783
            FE ALQKLRGK  DISEEAAEI+D+ E L+ LP++K+ DLFQK Y  ++ +GVGLM+ QQ
Sbjct  214  FEKALQKLRGKGTDISEEAAEIKDFTEKLQLLPRSKMLDLFQKDYMHAVTVGVGLMVFQQ  273

Query  782  LGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPLLVVSASG  606
             GG+N ICFY+S IF SAGF S + G +   ++Q+ +TA+G  L+DKAGR+PLL+ SA+G
Sbjct  274  FGGVNAICFYSSEIFVSAGFSSGNTGMLAMVVVQIPMTALGTLLLDKAGRRPLLMASAAG  333

Query  605  LALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINVK  426
              LGC+L G+S+  K  + A +   VLA+ GI+V+ GSFS+GMG +PWVIMSEIFPI++K
Sbjct  334  TCLGCLLVGLSFLSKEYHWAKDLNVVLALAGILVFTGSFSLGMGGIPWVIMSEIFPIHMK  393

Query  425  GVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRTL  246
            G AGS  TLVNW G+W+ SY FNFL+ W+S+GTF ++A+I  L ++FV ++VPETKGRTL
Sbjct  394  GSAGSLVTLVNWLGSWIISYAFNFLLLWSSYGTFFMFASICGLTVVFVERLVPETKGRTL  453

Query  245  EQIQATINA  219
            E+IQA++N+
Sbjct  454  EEIQASMNS  462



>ref|XP_007030767.1| Sugar transporter, putative [Theobroma cacao]
 gb|EOY11269.1| Sugar transporter, putative [Theobroma cacao]
Length=471

 Score =   306 bits (784),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 193/253 (76%), Gaps = 0/253 (0%)
 Frame = -3

Query  980  LGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGVG  801
            +G+  EF  ALQ L G NAD+S E AEIQD + +L+ LPKA   DLF+KR    + IGVG
Sbjct  219  VGYQNEFHAALQMLHGHNADVSGEEAEIQDSLAILQHLPKATAKDLFRKRNLHLVIIGVG  278

Query  800  LMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLLV  621
            LM+ QQ  G NGI FY   IF SAG P ++G+I+YA LQ+I+ A+GA +IDKAGR+PLL+
Sbjct  279  LMVFQQFSGYNGIVFYADQIFTSAGVPPNVGSILYACLQIIILALGAVIIDKAGRRPLLM  338

Query  620  VSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIF  441
            +SASG+ LG +LTG S+YLK  ++A + APV  + GIMV +GS+ +G+G +PW++MSEIF
Sbjct  339  ISASGMLLGSLLTGASFYLKEHHMASDLAPVFTIIGIMVDMGSYCLGLGGIPWIVMSEIF  398

Query  440  PINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPET  261
            PI++KG+AGS  TLV+W G+W+ SY+FNFLM W+  G F ++AT   +A++F+ K+VPET
Sbjct  399  PIHIKGIAGSLVTLVSWGGSWVVSYSFNFLMIWSPHGAFFVFATFCAVAMVFIFKLVPET  458

Query  260  KGRTLEQIQATIN  222
            KGRTLE+IQA+++
Sbjct  459  KGRTLEEIQASVD  471



>gb|KEH36721.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=396

 Score =   304 bits (778),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/256 (59%), Positives = 192/256 (75%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF++AL+KLRGK+ DIS+EA EI D +E L+ LPK K  DLFQ +Y RS+ IGV
Sbjct  141  KVGREKEFQLALRKLRGKDIDISDEANEILDNIETLQSLPKTKFLDLFQSKYVRSVIIGV  200

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM  QQ  GINGI FYT+  F +AG  S   GTI YA +QV  T +GA L+DK+GRKPL
Sbjct  201  GLMAFQQSVGINGIGFYTAETFVAAGLSSAKAGTIAYACIQVPFTLLGAILMDKSGRKPL  260

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            + VSASG  LGC +TGV+++ K  ++     P LAV G+++YI +FS+G+G+VPWV+MSE
Sbjct  261  ITVSASGTFLGCFITGVAFFFKNQSLWLEWVPTLAVAGVLIYIAAFSIGLGSVPWVMMSE  320

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            +FPINVKG AGS   LV W GAW+ SYTFNFLM+W+S GT   YA  ++L ILFV KVVP
Sbjct  321  VFPINVKGTAGSLVVLVAWLGAWIVSYTFNFLMSWSSPGTMFFYAGCSLLTILFVAKVVP  380

Query  266  ETKGRTLEQIQATINA  219
            ETKG+TLE+IQA I++
Sbjct  381  ETKGKTLEEIQACISS  396



>ref|XP_010674993.1| PREDICTED: sugar transporter ERD6-like 5 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010674994.1| PREDICTED: sugar transporter ERD6-like 5 [Beta vulgaris subsp. 
vulgaris]
Length=471

 Score =   306 bits (784),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/249 (58%), Positives = 193/249 (78%), Gaps = 0/249 (0%)
 Frame = -3

Query  968  KEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGVGLMIC  789
            ++ E  L+ LRG+NAD S EAAEI++Y E L+ L KAKL DLFQ+ Y+RS+ +GVGLM+ 
Sbjct  218  EDCEDVLKYLRGQNADTSVEAAEIREYTETLQHLSKAKLLDLFQREYTRSLIVGVGLMVF  277

Query  788  QQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLLVVSAS  609
            QQ GG+NGI FY SSIFESAGF   +GTI    +QV +T +G  L+DK+GR+PLL++SA+
Sbjct  278  QQFGGVNGIAFYASSIFESAGFSGRVGTIAMVTVQVPMTVLGMLLMDKSGRRPLLMISAT  337

Query  608  GLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFPINV  429
            G  LGC LTG+S+ L+ L++    AP LA+ G++V+  SFS+GMG VPWVIMSEIFPINV
Sbjct  338  GTCLGCFLTGLSFLLQDLHMWTTEAPFLALVGVLVFTASFSLGMGGVPWVIMSEIFPINV  397

Query  428  KGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETKGRT  249
            KG+AGS  T+VNW G+W+ S+ FNFLM+W+S GTF +++ I    ++FV  +VPETKGRT
Sbjct  398  KGLAGSLVTVVNWLGSWMISFAFNFLMSWSSPGTFFIFSVICGSTVVFVALLVPETKGRT  457

Query  248  LEQIQATIN  222
            LE+IQA++N
Sbjct  458  LEEIQASMN  466



>ref|XP_003541648.2| PREDICTED: sugar transporter ERD6-like 16-like isoform X1 [Glycine 
max]
Length=500

 Score =   307 bits (786),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/255 (58%), Positives = 195/255 (76%), Gaps = 1/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF++AL++LRGK+ DIS+EAAEI D +E L  LPK KL DLFQ ++ RS+ IGV
Sbjct  245  KVGREKEFQLALRRLRGKDVDISDEAAEILDSIETLRSLPKIKLLDLFQSKHVRSVVIGV  304

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+CQQ  GINGI FYT+  F +AG  S   GTI YA LQV  T +GA L+DK+GR+PL
Sbjct  305  GLMVCQQFVGINGIGFYTAETFIAAGLSSGKAGTIAYACLQVPFTVLGAILMDKSGRRPL  364

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            ++VSA+G  LGC +  ++++LK  ++    AP+ AV G+++YI ++S+G+G VPWVIMSE
Sbjct  365  MMVSATGTFLGCFIAAIAFFLKDQSLMLECAPIFAVAGVLIYIAAYSIGVGPVPWVIMSE  424

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPI+VKG+AGS   L NW GAW+ SYTFN LM+W+S GT  LYA  ++L ILFV K+VP
Sbjct  425  IFPIHVKGIAGSLVVLANWLGAWIVSYTFNSLMSWSSPGTLFLYAGSSLLTILFVTKLVP  484

Query  266  ETKGRTLEQIQATIN  222
            ETKG+TLE+IQA I+
Sbjct  485  ETKGKTLEEIQAWIS  499



>ref|XP_011659910.1| PREDICTED: sugar transporter ERD6-like 5 isoform X2 [Cucumis 
sativus]
Length=371

 Score =   302 bits (774),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/252 (55%), Positives = 195/252 (77%), Gaps = 0/252 (0%)
 Frame = -3

Query  977  GHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGVGL  798
            G G + E ALQ+LRGK  DIS E  EIQ+Y E+L++LP+  + DLFQ++Y+RS+F+G+GL
Sbjct  114  GQGLDCEDALQRLRGKTKDISTEVLEIQEYTELLKQLPEPSVLDLFQRQYARSLFVGLGL  173

Query  797  MICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLLVV  618
            M+ QQ GG+NGI FY +S+F SAGF  +IGTI  A +Q+ +TA+G  L+D +GR+PLL++
Sbjct  174  MVLQQFGGVNGIAFYVTSLFTSAGFSGNIGTIALASVQIPMTALGVVLMDVSGRRPLLMI  233

Query  617  SASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFP  438
            SA+G  LG +   +S+  K L +  + +P++A+ G++VY GSFS+GMGA+PWVIMSEIFP
Sbjct  234  SAAGTCLGSLCLALSFLFKDLQLWQSGSPMMALAGVLVYSGSFSLGMGAIPWVIMSEIFP  293

Query  437  INVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETK  258
            IN+KG+AGS  TLV+W G+W+ SY+FNFL+ W+S G F ++++I    +LFV K VPETK
Sbjct  294  INMKGLAGSLVTLVSWLGSWIVSYSFNFLLNWSSTGIFFIFSSICGFTVLFVAKFVPETK  353

Query  257  GRTLEQIQATIN  222
            GRTLE+IQA +N
Sbjct  354  GRTLEEIQAAMN  365



>gb|KFK35614.1| hypothetical protein AALP_AA4G014000 [Arabis alpina]
Length=469

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 196/254 (77%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  +EFE+ALQ+LRGK+ADIS E++EI+DY + L +L    +FDLFQ +Y++ + +GV
Sbjct  212  KIGRWEEFEIALQRLRGKSADISNESSEIKDYTQRLSQLSGGSIFDLFQPQYAKFLLVGV  271

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+NGI FY SSIF SAGF S+IG I   ++Q+ +TA+G  L+DK+GRKPLL
Sbjct  272  GLMVLQQFGGVNGIAFYASSIFVSAGFSSEIGMIAMVVVQIPMTALGVILMDKSGRKPLL  331

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++SA G  +GC L G+S+ +KG+  +      LA+ G++VY GSFS+GMG +PWVIMSEI
Sbjct  332  LISAIGTCIGCFLVGLSFLIKGVTPSSEGTSYLALVGVLVYTGSFSLGMGGIPWVIMSEI  391

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPI++KG AGS  T+V+W G+W+ S+ FNFLM+W+  GTF ++AT+  L ++FV K+VPE
Sbjct  392  FPIDIKGSAGSLVTVVSWLGSWIVSFAFNFLMSWSPSGTFYVFATVCGLTVIFVQKLVPE  451

Query  263  TKGRTLEQIQATIN  222
            TKGRTLE+IQ+ I 
Sbjct  452  TKGRTLEEIQSLIG  465



>ref|XP_007050737.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOX94894.1| Major facilitator superfamily protein [Theobroma cacao]
Length=484

 Score =   306 bits (783),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/256 (56%), Positives = 191/256 (75%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G+ KEF  AL+ L G +ADIS EAAEIQDY++ LE  PKA + DLFQ++Y +S+ IGV
Sbjct  229  KAGYRKEFYNALRSLHGDDADISHEAAEIQDYLQTLEHQPKASMLDLFQRKYKQSVIIGV  288

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ GG+NG+ FY S  F SAGF S  IG I +A +Q+ +TA GA L+D  GRKPL
Sbjct  289  GLMMFQQFGGVNGVGFYASETFTSAGFASGKIGIIAFACVQIPITAGGAFLVDNCGRKPL  348

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VS++G  LGC L  +S+ +K  N+     P+  + G+++++GSFS+GMGAVPWV+MSE
Sbjct  349  LLVSSTGTFLGCFLAAISFLMKEHNLLQEWIPLFVLCGMLIFMGSFSIGMGAVPWVLMSE  408

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KG AGS   L++WFGAW  SYTFNFLM W+  GTF LY+ +   ++LFV KVVP
Sbjct  409  IFPINIKGAAGSLVNLIHWFGAWAVSYTFNFLMDWSPSGTFFLYSGVCAASVLFVAKVVP  468

Query  266  ETKGRTLEQIQATINA  219
            ETKGR LE+IQA++N+
Sbjct  469  ETKGRALEEIQASMNS  484



>gb|KDP40049.1| hypothetical protein JCGZ_02047 [Jatropha curcas]
Length=490

 Score =   306 bits (783),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/256 (59%), Positives = 197/256 (77%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  +EF+VALQKLRGK+ADI+ E  EIQD +E+LE LPKA+  DLFQ++Y R IFIGV
Sbjct  235  KVGRDREFKVALQKLRGKDADITREEDEIQDSIEILEALPKARFLDLFQRQYIRVIFIGV  294

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
             +MICQQ  GING+ FY S IF +AG  S  +GTI YA +QV +T  GA L+DK+GRKPL
Sbjct  295  AIMICQQFVGINGVGFYVSQIFVTAGLSSGTLGTIAYACIQVPITIAGAMLMDKSGRKPL  354

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            ++VSA+G  LG  + G S+ LK L++     P+LAV G++V+I +FS+GMGAVPW+IMSE
Sbjct  355  IMVSAAGTFLGSSMVGTSFLLKSLSLLLGWVPILAVAGVLVFISAFSIGMGAVPWLIMSE  414

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KGV GS   LVNW GAW+ SYTFNFL++W+S G F LY+  +++ ILFV K VP
Sbjct  415  IFPINIKGVGGSLVVLVNWLGAWIVSYTFNFLISWSSSGNFFLYSGFSLMTILFVAKFVP  474

Query  266  ETKGRTLEQIQATINA  219
            ETKG+TLE+IQ  IN+
Sbjct  475  ETKGKTLEEIQECINS  490



>ref|XP_004486078.1| PREDICTED: sugar transporter ERD6-like 16-like [Cicer arietinum]
Length=486

 Score =   305 bits (782),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 150/256 (59%), Positives = 194/256 (76%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF++AL+KLRGKN DIS EA+EI DY+E L+ LPK+K+ DLFQ +Y RS+ IGV
Sbjct  231  KVGREKEFQLALRKLRGKNVDISHEASEILDYIETLQSLPKSKMLDLFQSKYVRSVVIGV  290

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM  QQ  GINGI FYT+  F +AG  S   GTI YA +QV  T +GA L+DK+GRKPL
Sbjct  291  GLMAFQQSVGINGIGFYTAETFVAAGLSSPKAGTIAYACIQVPFTMLGAILMDKSGRKPL  350

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            + VSASG  LGC +TG++++LK  ++     P LAV G+++YI +FS+G+G+VPWV+MSE
Sbjct  351  ITVSASGTFLGCFITGIAFFLKNQSLLLEWVPTLAVAGVLIYIAAFSIGLGSVPWVMMSE  410

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            +F INVKG  GS   LV W GAW+ SYTFNFLM+W+S  T  LYA  ++L ILFV KVVP
Sbjct  411  VFHINVKGSGGSLVVLVAWLGAWVVSYTFNFLMSWSSPSTMFLYAGCSLLTILFVAKVVP  470

Query  266  ETKGRTLEQIQATINA  219
            ETKG+TLE+IQA I++
Sbjct  471  ETKGKTLEEIQAYISS  486



>ref|XP_006594463.1| PREDICTED: sugar transporter ERD6-like 16-like isoform X3 [Glycine 
max]
Length=564

 Score =   307 bits (787),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 147/255 (58%), Positives = 195/255 (76%), Gaps = 1/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF++AL++LRGK+ DIS+EAAEI D +E L  LPK KL DLFQ ++ RS+ IGV
Sbjct  309  KVGREKEFQLALRRLRGKDVDISDEAAEILDSIETLRSLPKIKLLDLFQSKHVRSVVIGV  368

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+CQQ  GINGI FYT+  F +AG  S   GTI YA LQV  T +GA L+DK+GR+PL
Sbjct  369  GLMVCQQFVGINGIGFYTAETFIAAGLSSGKAGTIAYACLQVPFTVLGAILMDKSGRRPL  428

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            ++VSA+G  LGC +  ++++LK  ++    AP+ AV G+++YI ++S+G+G VPWVIMSE
Sbjct  429  MMVSATGTFLGCFIAAIAFFLKDQSLMLECAPIFAVAGVLIYIAAYSIGVGPVPWVIMSE  488

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPI+VKG+AGS   L NW GAW+ SYTFN LM+W+S GT  LYA  ++L ILFV K+VP
Sbjct  489  IFPIHVKGIAGSLVVLANWLGAWIVSYTFNSLMSWSSPGTLFLYAGSSLLTILFVTKLVP  548

Query  266  ETKGRTLEQIQATIN  222
            ETKG+TLE+IQA I+
Sbjct  549  ETKGKTLEEIQAWIS  563



>ref|XP_012089129.1| PREDICTED: sugar transporter ERD6-like 5 [Jatropha curcas]
 gb|KDP23561.1| hypothetical protein JCGZ_23394 [Jatropha curcas]
Length=485

 Score =   305 bits (781),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 141/252 (56%), Positives = 195/252 (77%), Gaps = 0/252 (0%)
 Frame = -3

Query  977  GHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGVGL  798
            G  KE E+ALQ LRG+NADIS+EAAEI+DY E L++  +  +F+LFQ +Y+ S+ +GVGL
Sbjct  228  GRWKECELALQHLRGENADISDEAAEIRDYTETLQRHSEGGIFELFQWKYAHSLIVGVGL  287

Query  797  MICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLLVV  618
            M+ QQ GG+NGI FY SSIF +AGF   +GTI   ++Q+ +TA+G  L+D +GR+PLL++
Sbjct  288  MVLQQFGGVNGIAFYASSIFVAAGFSGSVGTIAMVVVQIPMTALGVILMDISGRRPLLMI  347

Query  617  SASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFP  438
            SA+G  LGC L  +S+ L+ L+     +P LA+ G+++Y GSFS+GMG +PWVIMSE+FP
Sbjct  348  SAAGTCLGCFLAALSFLLQDLHKWTAFSPFLALVGVLIYTGSFSLGMGGIPWVIMSEVFP  407

Query  437  INVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETK  258
            IN+KG AGS  TLV+W G+W+ SY FNFLM W+S GTF ++++I  L +LFV K+VPETK
Sbjct  408  INMKGPAGSLVTLVSWLGSWIISYAFNFLMDWSSTGTFFIFSSICGLTVLFVAKLVPETK  467

Query  257  GRTLEQIQATIN  222
            GRTLE+IQA++N
Sbjct  468  GRTLEEIQASLN  479



>ref|XP_010242567.1| PREDICTED: sugar transporter ERD6-like 5 isoform X4 [Nelumbo 
nucifera]
Length=392

 Score =   302 bits (773),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 143/261 (55%), Positives = 197/261 (75%), Gaps = 1/261 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KE E ALQ+LRGK+ADIS+E+AEI+DY E L++L +A++ DLFQ +Y+ S+ +GV
Sbjct  131  KVGQAKESEAALQRLRGKHADISQESAEIRDYTEALQRLSEARILDLFQWKYAHSLIVGV  190

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ GG+NGI FY S+IF SAGF S +IGTI  A +Q+ +T  G  L+DK+GR+ L
Sbjct  191  GLMVLQQFGGVNGIAFYASAIFVSAGFSSGNIGTIFMAAVQIPMTTFGVLLMDKSGRRKL  250

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSA+G  LGC L G S++L+          ++A+ G++VY GSFS+GMG +PWVIMSE
Sbjct  251  LMVSAAGTCLGCFLVGTSFFLQDNQWWKEGTSIMALIGVLVYTGSFSLGMGGIPWVIMSE  310

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+K  AGS  TLV+W G+W+ SY FNFLM W+S GTF ++++I  L ++FV  +VP
Sbjct  311  IFPINMKSSAGSLVTLVSWLGSWIVSYAFNFLMKWSSSGTFFMFSSICGLTVVFVAYLVP  370

Query  266  ETKGRTLEQIQATINA*SRTR  204
            ETKGRTLE+IQA++N  S  +
Sbjct  371  ETKGRTLEEIQASMNPFSSEK  391



>ref|XP_006594462.1| PREDICTED: sugar transporter ERD6-like 16-like isoform X2 [Glycine 
max]
Length=570

 Score =   307 bits (787),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 147/255 (58%), Positives = 195/255 (76%), Gaps = 1/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF++AL++LRGK+ DIS+EAAEI D +E L  LPK KL DLFQ ++ RS+ IGV
Sbjct  315  KVGREKEFQLALRRLRGKDVDISDEAAEILDSIETLRSLPKIKLLDLFQSKHVRSVVIGV  374

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+CQQ  GINGI FYT+  F +AG  S   GTI YA LQV  T +GA L+DK+GR+PL
Sbjct  375  GLMVCQQFVGINGIGFYTAETFIAAGLSSGKAGTIAYACLQVPFTVLGAILMDKSGRRPL  434

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            ++VSA+G  LGC +  ++++LK  ++    AP+ AV G+++YI ++S+G+G VPWVIMSE
Sbjct  435  MMVSATGTFLGCFIAAIAFFLKDQSLMLECAPIFAVAGVLIYIAAYSIGVGPVPWVIMSE  494

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPI+VKG+AGS   L NW GAW+ SYTFN LM+W+S GT  LYA  ++L ILFV K+VP
Sbjct  495  IFPIHVKGIAGSLVVLANWLGAWIVSYTFNSLMSWSSPGTLFLYAGSSLLTILFVTKLVP  554

Query  266  ETKGRTLEQIQATIN  222
            ETKG+TLE+IQA I+
Sbjct  555  ETKGKTLEEIQAWIS  569



>ref|XP_004135636.2| PREDICTED: sugar transporter ERD6-like 5 isoform X1 [Cucumis 
sativus]
Length=412

 Score =   302 bits (774),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/252 (55%), Positives = 195/252 (77%), Gaps = 0/252 (0%)
 Frame = -3

Query  977  GHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGVGL  798
            G G + E ALQ+LRGK  DIS E  EIQ+Y E+L++LP+  + DLFQ++Y+RS+F+G+GL
Sbjct  155  GQGLDCEDALQRLRGKTKDISTEVLEIQEYTELLKQLPEPSVLDLFQRQYARSLFVGLGL  214

Query  797  MICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLLVV  618
            M+ QQ GG+NGI FY +S+F SAGF  +IGTI  A +Q+ +TA+G  L+D +GR+PLL++
Sbjct  215  MVLQQFGGVNGIAFYVTSLFTSAGFSGNIGTIALASVQIPMTALGVVLMDVSGRRPLLMI  274

Query  617  SASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFP  438
            SA+G  LG +   +S+  K L +  + +P++A+ G++VY GSFS+GMGA+PWVIMSEIFP
Sbjct  275  SAAGTCLGSLCLALSFLFKDLQLWQSGSPMMALAGVLVYSGSFSLGMGAIPWVIMSEIFP  334

Query  437  INVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETK  258
            IN+KG+AGS  TLV+W G+W+ SY+FNFL+ W+S G F ++++I    +LFV K VPETK
Sbjct  335  INMKGLAGSLVTLVSWLGSWIVSYSFNFLLNWSSTGIFFIFSSICGFTVLFVAKFVPETK  394

Query  257  GRTLEQIQATIN  222
            GRTLE+IQA +N
Sbjct  395  GRTLEEIQAAMN  406



>gb|ERN07486.1| hypothetical protein AMTR_s00019p00256520, partial [Amborella 
trichopoda]
Length=360

 Score =   300 bits (769),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 142/260 (55%), Positives = 197/260 (76%), Gaps = 1/260 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G   EFEVALQ LRGK ADISEEAAEIQDY+ ++E LP+ KL DLFQ++Y+  + +GV
Sbjct  93   KVGSHNEFEVALQTLRGKGADISEEAAEIQDYITIIEGLPQGKLQDLFQRKYTHPLIVGV  152

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSD-IGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GL+  QQ GGINGI FY S  F SAGF S  +GTI  A +QV +T +   L+DK GR+PL
Sbjct  153  GLIALQQFGGINGIAFYASETFVSAGFSSGAVGTIAMATIQVPLTGLVTLLMDKFGRRPL  212

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L++SASG  LG +L  +S+ L+  +     AP+LA+TG++VYI +FS+GMGA+PWV+M+E
Sbjct  213  LMISASGTCLGSLLAALSFVLQDQDNTFEFAPILALTGLLVYIAAFSLGMGAIPWVMMAE  272

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            +FP+NVKG AGS  +LV+WFG+W+ SY++NF M+W+  GTF +++ +  + +LFV K+VP
Sbjct  273  VFPLNVKGTAGSLVSLVHWFGSWIMSYSYNFFMSWSKAGTFFMFSGVCGVTVLFVAKLVP  332

Query  266  ETKGRTLEQIQATINA*SRT  207
            ETKGRTLE+IQA++   S +
Sbjct  333  ETKGRTLEEIQASMEHSSHS  352



>emb|CDX92578.1| BnaA10g16170D [Brassica napus]
Length=485

 Score =   304 bits (779),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 149/253 (59%), Positives = 189/253 (75%), Gaps = 1/253 (0%)
 Frame = -3

Query  977  GHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGVGL  798
            G  KEF VALQKLRG++ DI+ EA EIQ  ++ LE LPKA++ DL  K+YSRS+ IGV L
Sbjct  230  GREKEFRVALQKLRGRDTDITNEAEEIQASIQALEILPKARIQDLVSKKYSRSVIIGVSL  289

Query  797  MICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPLLV  621
            M+ QQ  GINGI FY S  F  AG  S  +GTI  A +QV +T +G  LIDK GR+PL++
Sbjct  290  MVFQQFVGINGIGFYASETFVKAGLSSGKLGTIAIACVQVPITVLGTVLIDKCGRRPLIM  349

Query  620  VSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIF  441
            +S+ G+ LGCILTG S++LKG ++     P LAV G+++YI +FS+GMG VPWVIMSEIF
Sbjct  350  ISSGGIFLGCILTGTSFFLKGQSLLLEWVPFLAVGGVLIYIAAFSIGMGPVPWVIMSEIF  409

Query  440  PINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPET  261
            PINVKG+AGS   LVNW GAW  SYTFNFLM+W+S GTF +Y+    + I+FV K+VPET
Sbjct  410  PINVKGIAGSLVVLVNWSGAWAVSYTFNFLMSWSSPGTFYMYSAFAAMTIIFVAKMVPET  469

Query  260  KGRTLEQIQATIN  222
            KG+TLE+IQA+I 
Sbjct  470  KGKTLEEIQASIR  482



>ref|XP_009591842.1| PREDICTED: sugar transporter ERD6-like 8 [Nicotiana tomentosiformis]
Length=255

 Score =   296 bits (758),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 190/253 (75%), Gaps = 0/253 (0%)
 Frame = -3

Query  977  GHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGVGL  798
            G  +EFE AL+KLRGK+ADIS E + IQ+Y+ +L+ LPK    +LF +   R++ I VGL
Sbjct  3    GEEEEFEAALRKLRGKHADISYERSTIQEYLTILQTLPKVTFVNLFDRSNYRAVIISVGL  62

Query  797  MICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLLVV  618
            M  QQ  GINGI FY++ IF+SAGF   +GTI++ ILQV VTA GA LID+ GR+PLL++
Sbjct  63   MAFQQFVGINGIVFYSTEIFKSAGFNPSLGTILFGILQVGVTAGGALLIDRTGRRPLLMM  122

Query  617  SASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFP  438
            SASGL LG +L   S++ K  ++A    P LA+ G++VYI  FS+GMGA PW+IMSE+FP
Sbjct  123  SASGLLLGNLLIAFSFFFKAHSVALTLVPNLAILGVLVYIAFFSIGMGAGPWLIMSEVFP  182

Query  437  INVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETK  258
            ++VKG+ G   TL+NWFG+W+ SYTFNFLM W+S GTF LYA + +LA +F+ K++PETK
Sbjct  183  LHVKGLGGGLVTLMNWFGSWVISYTFNFLMLWSSHGTFFLYAFVCLLATIFIYKMIPETK  242

Query  257  GRTLEQIQATINA  219
            GR LE+I A++N+
Sbjct  243  GRRLEEIHASLNS  255



>gb|EMT03312.1| Sugar transporter ERD6-like protein 5 [Aegilops tauschii]
Length=533

 Score =   305 bits (782),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/256 (56%), Positives = 197/256 (77%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++GH    E ALQKLRGK  DISEEAA+I+D+ E L+ LP++K+ DLFQK Y  ++ +GV
Sbjct  265  KIGHSGALEEALQKLRGKETDISEEAADIKDFTEKLQHLPQSKMLDLFQKDYIHAVTVGV  324

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ GG+N ICFY S IF SAGF S + G +    +Q+ +TA+G  L+DKAGR+PL
Sbjct  325  GLMVLQQFGGVNAICFYASEIFVSAGFSSGNTGMLAMVAVQIPMTALGVLLLDKAGRRPL  384

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSA+G  LGC+L G+S+  K  + A +    LA+TGI+++ GSFS+GMG +PWVIMSE
Sbjct  385  LMVSAAGTCLGCLLVGLSFLSKEHHWAKDLNVALALTGILIFSGSFSLGMGGIPWVIMSE  444

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPI++KG AGS  TLV+W G+W+ SY FNFL+ W+S+GTF ++A+I  L ++FV ++VP
Sbjct  445  IFPIHMKGSAGSRVTLVSWLGSWIVSYAFNFLLLWSSYGTFFMFASICGLTVVFVERLVP  504

Query  266  ETKGRTLEQIQATINA  219
            ETKGRTLE+IQA++N+
Sbjct  505  ETKGRTLEEIQASMNS  520



>gb|ABA95042.1| Sugar transporter family protein, expressed [Oryza sativa Japonica 
Group]
Length=402

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/256 (56%), Positives = 193/256 (75%), Gaps = 19/256 (7%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEFE+ALQ+LRGK+AD+S EAAEI++++E +E LPKA + DLF + Y R + +GV
Sbjct  163  KVGRQKEFEIALQRLRGKDADVSIEAAEIKEFIETIENLPKAGVQDLFNRAYIRPVIVGV  222

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ  GINGI FY S  F SAGF S D+GTI+   +Q  +TAVGA L+D++GR+PL
Sbjct  223  GLMVFQQFVGINGILFYASETFVSAGFASGDLGTILMGCIQAPITAVGALLMDRSGRRPL  282

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L++S SGL +G +++ VS+YLK                  VYI S+S+GMGAVPWVIMSE
Sbjct  283  LLISTSGLLIGSLMSAVSFYLK------------------VYIASYSIGMGAVPWVIMSE  324

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KG+ GSF TLVNW G+W  S+ FNF M+W+S GTF L+A +  +AILF++K+VP
Sbjct  325  IFPINIKGIGGSFVTLVNWSGSWAVSFAFNFFMSWSSSGTFFLFALVCAVAILFIVKIVP  384

Query  266  ETKGRTLEQIQATINA  219
            ETKG+TLE+IQA++N+
Sbjct  385  ETKGKTLEEIQASMNS  400



>ref|XP_008450692.1| PREDICTED: sugar transporter ERD6-like 5 isoform X4 [Cucumis 
melo]
Length=371

 Score =   300 bits (768),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/252 (54%), Positives = 194/252 (77%), Gaps = 0/252 (0%)
 Frame = -3

Query  977  GHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGVGL  798
            G G + E ALQ+LRGKN DIS E  EIQ+Y E+L++LP+  + DLFQ++Y+RS+ +G+GL
Sbjct  114  GQGLDCEDALQRLRGKNKDISAEVLEIQEYTELLKQLPEPSVLDLFQRQYARSLIVGLGL  173

Query  797  MICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLLVV  618
            M+ QQ GG+NGI FY +S+F SAGF  +IGTI  A +Q+ +TA+G  L+D +GR+PLL++
Sbjct  174  MVLQQFGGVNGIAFYVTSLFTSAGFSGNIGTIALAAVQIPMTALGVVLMDVSGRRPLLMI  233

Query  617  SASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFP  438
            SA+G  LG +   +S+  K L +  + +P++A+ G++V+ GSFS+GMGA+PWVIMSEIFP
Sbjct  234  SAAGTCLGSLCLALSFLFKDLQLWRSGSPMMALAGVLVFSGSFSLGMGAIPWVIMSEIFP  293

Query  437  INVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETK  258
            IN+KG+AGS  TLV+W G+W+ SY+FNFL  W+S G F ++++I    +LFV K VPETK
Sbjct  294  INMKGLAGSLVTLVSWLGSWIVSYSFNFLFNWSSTGIFFIFSSICGFTVLFVAKFVPETK  353

Query  257  GRTLEQIQATIN  222
            GRTLE+IQA +N
Sbjct  354  GRTLEEIQAAMN  365



>ref|XP_003594043.1| Sugar transporter ERD6-like protein [Medicago truncatula]
 gb|AES64294.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=485

 Score =   303 bits (777),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/256 (59%), Positives = 192/256 (75%), Gaps = 1/256 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF++AL+KLRGK+ DIS+EA EI D +E L+ LPK K  DLFQ +Y RS+ IGV
Sbjct  230  KVGREKEFQLALRKLRGKDIDISDEANEILDNIETLQSLPKTKFLDLFQSKYVRSVIIGV  289

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM  QQ  GINGI FYT+  F +AG  S   GTI YA +QV  T +GA L+DK+GRKPL
Sbjct  290  GLMAFQQSVGINGIGFYTAETFVAAGLSSAKAGTIAYACIQVPFTLLGAILMDKSGRKPL  349

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            + VSASG  LGC +TGV+++ K  ++     P LAV G+++YI +FS+G+G+VPWV+MSE
Sbjct  350  ITVSASGTFLGCFITGVAFFFKNQSLWLEWVPTLAVAGVLIYIAAFSIGLGSVPWVMMSE  409

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            +FPINVKG AGS   LV W GAW+ SYTFNFLM+W+S GT   YA  ++L ILFV KVVP
Sbjct  410  VFPINVKGTAGSLVVLVAWLGAWIVSYTFNFLMSWSSPGTMFFYAGCSLLTILFVAKVVP  469

Query  266  ETKGRTLEQIQATINA  219
            ETKG+TLE+IQA I++
Sbjct  470  ETKGKTLEEIQACISS  485



>gb|AAM64736.1| sugar transporter-like protein [Arabidopsis thaliana]
Length=482

 Score =   303 bits (777),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/255 (60%), Positives = 189/255 (74%), Gaps = 1/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + GH KEF VALQKLRGK+ADI+ EA  IQ  ++ LE LPKA++ DL  K+Y RS+ IGV
Sbjct  225  KAGHEKEFRVALQKLRGKDADITNEADGIQVSIQALEILPKARIQDLVSKKYGRSVIIGV  284

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
             LM+ QQ  GINGI FY S  F  AGF S  +GTI  A +QV +T +G  LIDK+GR+PL
Sbjct  285  SLMVFQQFVGINGIGFYASETFVKAGFTSGKLGTIAIACVQVPITVLGTILIDKSGRRPL  344

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            +++SA G+ LGCILTG S+ LKG ++     P LAV G+++Y+ +FS+GMG VPWVIMSE
Sbjct  345  IMISAGGIFLGCILTGTSFLLKGQSLLLEWVPSLAVGGVLIYVAAFSIGMGPVPWVIMSE  404

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPINVKG+AGS   LVNW GAW  SYTFNFLM+W+S GTF LY+      I+FV K+VP
Sbjct  405  IFPINVKGIAGSLVVLVNWSGAWAVSYTFNFLMSWSSPGTFYLYSAFAAATIIFVAKMVP  464

Query  266  ETKGRTLEQIQATIN  222
            ETKG+TLE+IQA I 
Sbjct  465  ETKGKTLEEIQACIR  479



>ref|NP_568367.1| sugar transporter ERD6-like 16 [Arabidopsis thaliana]
 sp|Q8LBI9.2|EDL16_ARATH RecName: Full=Sugar transporter ERD6-like 16 [Arabidopsis thaliana]
 gb|AAL36051.1| AT5g18840/F17K4_90 [Arabidopsis thaliana]
 gb|AAN18269.1| At5g18840/F17K4_90 [Arabidopsis thaliana]
 gb|AED92620.1| sugar transporter ERD6-like 16 [Arabidopsis thaliana]
Length=482

 Score =   303 bits (777),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/255 (60%), Positives = 189/255 (74%), Gaps = 1/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + GH KEF VALQKLRGK+ADI+ EA  IQ  ++ LE LPKA++ DL  K+Y RS+ IGV
Sbjct  225  KAGHEKEFRVALQKLRGKDADITNEADGIQVSIQALEILPKARIQDLVSKKYGRSVIIGV  284

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
             LM+ QQ  GINGI FY S  F  AGF S  +GTI  A +QV +T +G  LIDK+GR+PL
Sbjct  285  SLMVFQQFVGINGIGFYASETFVKAGFTSGKLGTIAIACVQVPITVLGTILIDKSGRRPL  344

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            +++SA G+ LGCILTG S+ LKG ++     P LAV G+++Y+ +FS+GMG VPWVIMSE
Sbjct  345  IMISAGGIFLGCILTGTSFLLKGQSLLLEWVPSLAVGGVLIYVAAFSIGMGPVPWVIMSE  404

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPINVKG+AGS   LVNW GAW  SYTFNFLM+W+S GTF LY+      I+FV K+VP
Sbjct  405  IFPINVKGIAGSLVVLVNWSGAWAVSYTFNFLMSWSSPGTFYLYSAFAAATIIFVAKMVP  464

Query  266  ETKGRTLEQIQATIN  222
            ETKG+TLE+IQA I 
Sbjct  465  ETKGKTLEEIQACIR  479



>ref|XP_009120937.1| PREDICTED: sugar transporter ERD6-like 16 [Brassica rapa]
Length=485

 Score =   303 bits (776),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/255 (58%), Positives = 189/255 (74%), Gaps = 1/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KEF  ALQKLRG++ DI+ EA EIQ  ++ LE LPKA++ DL  K+YSRS+ IGV
Sbjct  228  KAGREKEFRAALQKLRGRDTDITNEAEEIQASIQALEILPKARIQDLVSKKYSRSVIIGV  287

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
             LM+ QQ  GINGI FY S  F  AG  S  +GTI  A +QV +T +G  LIDK GR+PL
Sbjct  288  SLMVFQQFVGINGIGFYASETFVKAGLSSGKLGTIAIACVQVPITVLGTVLIDKCGRRPL  347

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            +++S+ G+ LGCILTG S++LKG ++     P LAV G+++YI +FS+GMG VPWVIMSE
Sbjct  348  IMISSGGIFLGCILTGTSFFLKGQSLLLEWVPFLAVGGVLIYIAAFSIGMGPVPWVIMSE  407

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPINVKG+AGS   LVNW GAW  SYTFNFLM+W+S GTF +Y+    + I+FV K+VP
Sbjct  408  IFPINVKGIAGSLVVLVNWSGAWAVSYTFNFLMSWSSPGTFYMYSAFAAMTIIFVAKMVP  467

Query  266  ETKGRTLEQIQATIN  222
            ETKG+TLE+IQA+I 
Sbjct  468  ETKGKTLEEIQASIR  482



>ref|XP_010511207.1| PREDICTED: sugar transporter ERD6-like 5 isoform X3 [Camelina 
sativa]
Length=388

 Score =   300 bits (767),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 137/254 (54%), Positives = 196/254 (77%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  +EFE+ALQ+LRG+ AD S E++EI+DY + L  L K  L DL Q RY++S+F+GV
Sbjct  131  KVGTWEEFEIALQRLRGECADTSYESSEIKDYTKRLTDLSKGSLVDLIQPRYAKSLFVGV  190

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+NGI FY SSIFESAGF S IG I   ++Q+ +T +G  L+DK+GR+PLL
Sbjct  191  GLMVLQQFGGVNGIAFYASSIFESAGFSSKIGMIAMVVVQIPMTTIGVLLMDKSGRRPLL  250

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++SA+G  +GC L G+S+ L+ +++       +A+TG+++Y GSFS+GMG +PWVIMSEI
Sbjct  251  LISATGTCIGCFLVGLSFSLQVVSLFSGETSYIALTGVLMYTGSFSLGMGGIPWVIMSEI  310

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPI++KG AGS  T+V+W G+W+ S+TFNFLM W+  GTF ++AT+  + ++FV K+VPE
Sbjct  311  FPIDIKGPAGSLVTVVSWIGSWIISFTFNFLMNWSPAGTFYVFATVCGVTVIFVAKLVPE  370

Query  263  TKGRTLEQIQATIN  222
            TKGRTLE+IQ++I 
Sbjct  371  TKGRTLEEIQSSIG  384



>ref|XP_010546910.1| PREDICTED: sugar transporter ERD6-like 16 [Tarenaya hassleriana]
Length=494

 Score =   303 bits (776),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 149/255 (58%), Positives = 190/255 (75%), Gaps = 1/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KEF +ALQKLRG+ ADI+ EAAEIQ  +E LE LPKA++ DL  K+Y R + IGV
Sbjct  235  KVGREKEFHIALQKLRGREADITREAAEIQVSIEALEILPKARIRDLASKKYVRPVIIGV  294

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
             LM+ QQ  GINGI FY S  F  AG  S  +GTI  A +Q+ +T +G  LIDK+GR+PL
Sbjct  295  ALMVFQQFVGINGIGFYASETFVQAGLSSGKLGTIAIACVQIPITVLGTILIDKSGRRPL  354

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            +++SA+GL  GC+LTG S+YLKG  +     PVLAV G+++YI +FS+GMG VPWVIMSE
Sbjct  355  IMISAAGLFAGCVLTGTSFYLKGQGLLLEWVPVLAVGGVLIYIAAFSIGMGPVPWVIMSE  414

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPINVKG+AGS   LVNW GAW  SYTFNFLM+W+S  TF +Y+   ++ ILFV K+VP
Sbjct  415  IFPINVKGIAGSLVVLVNWSGAWAVSYTFNFLMSWSSPCTFYMYSAFALMTILFVGKMVP  474

Query  266  ETKGRTLEQIQATIN  222
            ETKG+TLE+IQA + 
Sbjct  475  ETKGKTLEEIQACLR  489



>ref|XP_010470369.1| PREDICTED: sugar transporter ERD6-like 5 isoform X1 [Camelina 
sativa]
Length=470

 Score =   302 bits (773),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 137/254 (54%), Positives = 197/254 (78%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  +EFE+ALQ+LRG++AD S E++EI+DY + L  L +  L DLFQ RY++S+F+GV
Sbjct  213  KVGRWEEFEIALQRLRGESADTSYESSEIKDYTKRLTDLSEGSLVDLFQPRYAKSLFVGV  272

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+NGI FY SSIFESAGF S IG I   ++Q+ +T +G  L+DK+GR+PLL
Sbjct  273  GLMVLQQFGGVNGIAFYASSIFESAGFSSKIGMIAMVVVQIPMTTIGVLLMDKSGRRPLL  332

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++SA+G  +GC L G+S+ L+ +++       +A+TG+++Y GSFS+GMG +PWVIMSEI
Sbjct  333  LISATGTCIGCFLIGLSFSLQVVSLFSGETSYIALTGVLMYTGSFSLGMGGIPWVIMSEI  392

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPI++KG AGS  T+V+W G+W+ S+TFNFLM W+  GTF ++AT+  + ++FV K+VPE
Sbjct  393  FPIDIKGPAGSLVTVVSWIGSWIISFTFNFLMNWSPTGTFYVFATVCGVTVIFVAKLVPE  452

Query  263  TKGRTLEQIQATIN  222
            TKGRTLE+IQ +I 
Sbjct  453  TKGRTLEEIQYSIG  466



>ref|XP_008795118.1| PREDICTED: sugar transporter ERD6-like 5 isoform X4 [Phoenix 
dactylifera]
Length=350

 Score =   298 bits (763),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/261 (55%), Positives = 195/261 (75%), Gaps = 1/261 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++GH  +FE ALQ LRGK  DIS+EA EI+++ + L+ LP+A + DLFQK+Y  S+ +GV
Sbjct  89   KVGHHNKFEAALQSLRGKYTDISQEAEEIREFTKSLQSLPQANMLDLFQKKYLYSVTVGV  148

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ GG+N ICFY S IF SAGF S + GTI   I+Q+ +T +G  L+DK+GR+P+
Sbjct  149  GLMVFQQFGGVNAICFYASEIFVSAGFSSGNTGTIAMVIVQIPMTTLGVLLLDKSGRRPI  208

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSA+G  +GC L  +S+ L+           LA+TGI+V+ GSFS+GMG +PWVIMSE
Sbjct  209  LMVSAAGTCVGCFLVAMSFLLQEHEWPKEINTALALTGILVFAGSFSLGMGGIPWVIMSE  268

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KG AGS  TLVNW G+ + SYTFNFL+ W+S GTF ++A+I  L +LFV ++VP
Sbjct  269  IFPINMKGSAGSLVTLVNWLGSGIVSYTFNFLITWSSAGTFFIFASICGLTVLFVERLVP  328

Query  266  ETKGRTLEQIQATINA*SRTR  204
            ETKGRTLE+IQA++N+ S  +
Sbjct  329  ETKGRTLEEIQASMNSFSSDK  349



>gb|ABN09011.1| General substrate transporter; Sugar transporter superfamily 
[Medicago truncatula]
 gb|AES82549.2| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=481

 Score =   302 bits (774),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 144/254 (57%), Positives = 193/254 (76%), Gaps = 2/254 (1%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  +  E  LQ LRGKN DISEEA EI+++ E  ++  +A +F LFQ +Y +S+ +GV
Sbjct  208  KVGRLERSESTLQHLRGKNVDISEEATEIREFTEASQQQTEANIFGLFQLQYLKSLTVGV  267

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GL+I QQ GG+N I FY SSIF SAGF   IGTI   ++Q+ +TA+G  L+DK+GR+PLL
Sbjct  268  GLIILQQFGGVNAIAFYASSIFVSAGFSRSIGTIAMVVVQIPMTALGVILMDKSGRRPLL  327

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++SASG  LGC L  +S+YL+ L+     +P+LA+ G++VY GSFS+GMG +PWVIMSEI
Sbjct  328  LISASGTCLGCFLVSLSFYLQDLH--KEFSPILALVGVLVYTGSFSLGMGGIPWVIMSEI  385

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPINVKG AGSF T V+W  +W+ SY FNFLM+WNS GTF +++TI  L ILFV K+VPE
Sbjct  386  FPINVKGSAGSFVTFVHWLCSWIVSYAFNFLMSWNSAGTFFIFSTICGLTILFVAKLVPE  445

Query  263  TKGRTLEQIQATIN  222
            TKGRTLE++QA++N
Sbjct  446  TKGRTLEEVQASLN  459



>gb|KFK26120.1| hypothetical protein AALP_AA8G206400 [Arabis alpina]
Length=485

 Score =   302 bits (774),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 148/255 (58%), Positives = 189/255 (74%), Gaps = 1/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + GH KEF VALQKLRG++ADI+ EA +IQ  V+ LE LPKA++ DL  K+YSRS+ IGV
Sbjct  228  KAGHEKEFRVALQKLRGRDADITNEAEQIQASVQALEILPKARIQDLVSKKYSRSVIIGV  287

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
             LM+ QQ  GINGI FY S  F  AG  S   GTI  A +QV +T +G  LIDK GR+PL
Sbjct  288  SLMVFQQFVGINGIGFYASETFVKAGLSSGKFGTIAMACVQVPITVLGTVLIDKCGRRPL  347

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            +++SA G+ LGCILTG +++L+G ++     P+L V G+++Y+ +FS+GMG VPWVIMSE
Sbjct  348  IMISAGGIFLGCILTGTAFFLEGQSLLLEWVPILVVGGVLIYVAAFSIGMGPVPWVIMSE  407

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPINVKG+AGS   LVNW GAW  SYTFNFLM+W+S GTF +Y+      I+FV K+VP
Sbjct  408  IFPINVKGIAGSIVVLVNWSGAWAVSYTFNFLMSWSSPGTFYVYSAFAATTIIFVAKMVP  467

Query  266  ETKGRTLEQIQATIN  222
            ETKG+TLE+IQA I 
Sbjct  468  ETKGKTLEEIQACIR  482



>ref|XP_006845806.1| PREDICTED: sugar transporter ERD6-like 5 isoform X1 [Amborella 
trichopoda]
 gb|ERN07481.1| hypothetical protein AMTR_s00019p00256160 [Amborella trichopoda]
Length=493

 Score =   302 bits (774),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 134/254 (53%), Positives = 191/254 (75%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            +LG  +EFEVAL++LRGK ADISEEA EI++Y++ ++ LP+  L DLFQ++Y+  + +G 
Sbjct  230  KLGRQQEFEVALRRLRGKEADISEEAVEIEEYIKTIDSLPQVTLIDLFQRKYAHPLIVGA  289

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GL+  QQ GG NGI FY S  F SAGF S +GTI  A +QV +TAVGA L+D  GR+PLL
Sbjct  290  GLIALQQFGGCNGIGFYASETFVSAGFSSTVGTIAMASIQVPITAVGALLMDNCGRRPLL  349

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++SA+G  +GC+L  +S+ L+  +     +P+LA++GI+V+  SFS+GMG +PWV+MSEI
Sbjct  350  LISATGTCMGCLLVAISFVLEAHDSLTKLSPILALSGILVFSASFSIGMGGIPWVLMSEI  409

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPINVKG AGS   LV+WFG+W  ++ +NF M+W+  GTF  ++ ++   +LFV K+VPE
Sbjct  410  FPINVKGTAGSLVNLVHWFGSWAMTFAYNFFMSWSRAGTFFAFSAVSAATVLFVAKLVPE  469

Query  263  TKGRTLEQIQATIN  222
            TKGRTLE+IQA+++
Sbjct  470  TKGRTLEEIQASMD  483



>ref|XP_011087867.1| PREDICTED: sugar transporter ERD6-like 5 [Sesamum indicum]
 ref|XP_011087877.1| PREDICTED: sugar transporter ERD6-like 5 [Sesamum indicum]
Length=479

 Score =   301 bits (772),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 195/253 (77%), Gaps = 1/253 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G     E +L +LRGKNA+I EEAAEI+DY   LE+L  ++L DLFQ++Y+ S+ +GV
Sbjct  221  KIGQWDGSEASLVRLRGKNANIFEEAAEIRDYTRTLEQLKDSRLIDLFQRKYAHSLIVGV  280

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+N I +Y S+IF SAGF   +GT    I+QV +T +G  L+DK+GR+PLL
Sbjct  281  GLMVLQQFGGVNAIAYYASAIFSSAGFSYRVGTTAMVIVQVPLTIIGTLLMDKSGRRPLL  340

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VS +G  LGC L G+SY L+ L +  +++P LA+ G++V+ GSFS+GMG +PWVIMSEI
Sbjct  341  LVSVAGTCLGCFLIGLSYLLQDLKLW-DSSPSLALVGVLVFTGSFSLGMGGIPWVIMSEI  399

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPINVKG+AGS  T+VNWFG+W+ +Y+FNFL  W+S GTF ++AT+  L I+F I++VPE
Sbjct  400  FPINVKGLAGSLVTVVNWFGSWIITYSFNFLAQWSSAGTFFIFATVCGLTIIFTIRLVPE  459

Query  263  TKGRTLEQIQATI  225
            TKGRTLE+IQA++
Sbjct  460  TKGRTLEEIQASM  472



>gb|KGN66112.1| hypothetical protein Csa_1G571840 [Cucumis sativus]
Length=536

 Score =   303 bits (777),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 138/252 (55%), Positives = 195/252 (77%), Gaps = 0/252 (0%)
 Frame = -3

Query  977  GHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGVGL  798
            G G + E ALQ+LRGK  DIS E  EIQ+Y E+L++LP+  + DLFQ++Y+RS+F+G+GL
Sbjct  279  GQGLDCEDALQRLRGKTKDISTEVLEIQEYTELLKQLPEPSVLDLFQRQYARSLFVGLGL  338

Query  797  MICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLLVV  618
            M+ QQ GG+NGI FY +S+F SAGF  +IGTI  A +Q+ +TA+G  L+D +GR+PLL++
Sbjct  339  MVLQQFGGVNGIAFYVTSLFTSAGFSGNIGTIALASVQIPMTALGVVLMDVSGRRPLLMI  398

Query  617  SASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFP  438
            SA+G  LG +   +S+  K L +  + +P++A+ G++VY GSFS+GMGA+PWVIMSEIFP
Sbjct  399  SAAGTCLGSLCLALSFLFKDLQLWQSGSPMMALAGVLVYSGSFSLGMGAIPWVIMSEIFP  458

Query  437  INVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETK  258
            IN+KG+AGS  TLV+W G+W+ SY+FNFL+ W+S G F ++++I    +LFV K VPETK
Sbjct  459  INMKGLAGSLVTLVSWLGSWIVSYSFNFLLNWSSTGIFFIFSSICGFTVLFVAKFVPETK  518

Query  257  GRTLEQIQATIN  222
            GRTLE+IQA +N
Sbjct  519  GRTLEEIQAAMN  530



>ref|XP_009417911.1| PREDICTED: sugar transporter ERD6-like 5 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009417912.1| PREDICTED: sugar transporter ERD6-like 5 [Musa acuminata subsp. 
malaccensis]
Length=469

 Score =   301 bits (771),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 193/254 (76%), Gaps = 1/254 (0%)
 Frame = -3

Query  980  LGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGVG  801
            +G   EFE  L++LRG+++D+S+EA EI ++   L+KLP++ + DLFQK+Y  +I +GVG
Sbjct  212  VGKDHEFEAGLKRLRGEHSDVSQEAEEIMEFTVNLQKLPQSGMLDLFQKKYLHAIIVGVG  271

Query  800  LMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            LM+ QQ GG+N ICFY S IF SAGF S D G I  A +Q+ +T +G  L+D++GR+PLL
Sbjct  272  LMVLQQFGGVNAICFYASEIFVSAGFSSGDTGMIAMAAVQIPMTTLGVLLMDRSGRRPLL  331

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++SA+G  +GC L G+S+ LKG   +     VLA+ GI+ Y GSFS+GMG +PWVIMSEI
Sbjct  332  MISAAGTCIGCFLVGISFMLKGHEFSKELNTVLALAGILTYTGSFSLGMGGIPWVIMSEI  391

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FP+N+KG AGS  TLV+W G+W+ SYTFNFLM W+S GTF ++A+I  L +LFV ++VPE
Sbjct  392  FPLNMKGTAGSLVTLVSWVGSWIISYTFNFLMMWSSAGTFFIFASICGLTVLFVERLVPE  451

Query  263  TKGRTLEQIQATIN  222
            TKGRTLE+IQA+++
Sbjct  452  TKGRTLEEIQASMS  465



>ref|XP_010492922.1| PREDICTED: sugar transporter ERD6-like 16 [Camelina sativa]
Length=482

 Score =   301 bits (772),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 148/255 (58%), Positives = 189/255 (74%), Gaps = 1/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KEF +ALQKLRGK+ DI+ EA  IQ  ++ LE LPKA++ DL  K+Y RS+ IGV
Sbjct  225  KAGREKEFRIALQKLRGKDTDIANEAEGIQVSIQALEILPKARIQDLVSKKYGRSVIIGV  284

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
             LM+ QQ  GINGI FY S  F  AGF S  +GTI  A +QV +T +G  LIDK GR+PL
Sbjct  285  SLMVFQQFVGINGIGFYASETFVKAGFSSGKLGTIAIACVQVPITVLGTILIDKTGRRPL  344

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            +++SA G+ LGCILTG S++LKG N+  +  P+LAV G+++Y+ +FS+GMG VPWVIMSE
Sbjct  345  IMISAGGIFLGCILTGTSFFLKGQNLLLDWVPMLAVGGVLIYVAAFSIGMGPVPWVIMSE  404

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPINVKG+AGS   LVNW GAW  SYTFNFLM+W+S GTF +Y+    + I+FV K+VP
Sbjct  405  IFPINVKGIAGSLVVLVNWSGAWAVSYTFNFLMSWSSPGTFYIYSAFAAMTIIFVAKMVP  464

Query  266  ETKGRTLEQIQATIN  222
            ETKG+TLE+IQ  I 
Sbjct  465  ETKGKTLEEIQTCIR  479



>ref|XP_008795117.1| PREDICTED: sugar transporter ERD6-like 5 isoform X3 [Phoenix 
dactylifera]
Length=370

 Score =   298 bits (762),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 143/261 (55%), Positives = 195/261 (75%), Gaps = 1/261 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++GH  +FE ALQ LRGK  DIS+EA EI+++ + L+ LP+A + DLFQK+Y  S+ +GV
Sbjct  109  KVGHHNKFEAALQSLRGKYTDISQEAEEIREFTKSLQSLPQANMLDLFQKKYLYSVTVGV  168

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ GG+N ICFY S IF SAGF S + GTI   I+Q+ +T +G  L+DK+GR+P+
Sbjct  169  GLMVFQQFGGVNAICFYASEIFVSAGFSSGNTGTIAMVIVQIPMTTLGVLLLDKSGRRPI  228

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSA+G  +GC L  +S+ L+           LA+TGI+V+ GSFS+GMG +PWVIMSE
Sbjct  229  LMVSAAGTCVGCFLVAMSFLLQEHEWPKEINTALALTGILVFAGSFSLGMGGIPWVIMSE  288

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KG AGS  TLVNW G+ + SYTFNFL+ W+S GTF ++A+I  L +LFV ++VP
Sbjct  289  IFPINMKGSAGSLVTLVNWLGSGIVSYTFNFLITWSSAGTFFIFASICGLTVLFVERLVP  348

Query  266  ETKGRTLEQIQATINA*SRTR  204
            ETKGRTLE+IQA++N+ S  +
Sbjct  349  ETKGRTLEEIQASMNSFSSDK  369



>ref|XP_007147087.1| hypothetical protein PHAVU_006G095200g [Phaseolus vulgaris]
 gb|ESW19081.1| hypothetical protein PHAVU_006G095200g [Phaseolus vulgaris]
Length=482

 Score =   301 bits (772),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 141/254 (56%), Positives = 192/254 (76%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + GH +  E  LQ+LRGKNAD+S+EA EI+D+ + LE+  +A +F LFQ +Y +S+ +GV
Sbjct  228  KFGHWERSESVLQRLRGKNADVSQEATEIRDFTKALERETEATIFGLFQLQYLKSLTVGV  287

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLMI QQ GG+NGI FY SSIF SAGF   IG I    +Q+ +TA+G  L+DK+GR+PLL
Sbjct  288  GLMILQQFGGVNGIAFYASSIFISAGFSGSIGMIAMVAVQIPMTALGVLLMDKSGRRPLL  347

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++SASG  LGC L  +S++L+ L+     +P++A+ G++VY GSFS+GMG +PWVIMSEI
Sbjct  348  LISASGTCLGCFLAALSFFLQDLHKWKEVSPIMALAGVLVYTGSFSLGMGGIPWVIMSEI  407

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPINVKG AGS  TLV+W  +W+ SY FNFLM+W+S GTF +++TI    +LFV K+VPE
Sbjct  408  FPINVKGSAGSLVTLVSWLCSWIVSYAFNFLMSWSSAGTFFIFSTICGFTVLFVAKLVPE  467

Query  263  TKGRTLEQIQATIN  222
            TKGR LE+IQA++ 
Sbjct  468  TKGRALEEIQASLK  481



>ref|XP_008450689.1| PREDICTED: sugar transporter ERD6-like 5 isoform X2 [Cucumis 
melo]
 ref|XP_008450690.1| PREDICTED: sugar transporter ERD6-like 5 isoform X2 [Cucumis 
melo]
Length=479

 Score =   301 bits (771),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/252 (54%), Positives = 194/252 (77%), Gaps = 0/252 (0%)
 Frame = -3

Query  977  GHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGVGL  798
            G G + E ALQ+LRGKN DIS E  EIQ+Y E+L++LP+  + DLFQ++Y+RS+ +G+GL
Sbjct  222  GQGLDCEDALQRLRGKNKDISAEVLEIQEYTELLKQLPEPSVLDLFQRQYARSLIVGLGL  281

Query  797  MICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLLVV  618
            M+ QQ GG+NGI FY +S+F SAGF  +IGTI  A +Q+ +TA+G  L+D +GR+PLL++
Sbjct  282  MVLQQFGGVNGIAFYVTSLFTSAGFSGNIGTIALAAVQIPMTALGVVLMDVSGRRPLLMI  341

Query  617  SASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFP  438
            SA+G  LG +   +S+  K L +  + +P++A+ G++V+ GSFS+GMGA+PWVIMSEIFP
Sbjct  342  SAAGTCLGSLCLALSFLFKDLQLWRSGSPMMALAGVLVFSGSFSLGMGAIPWVIMSEIFP  401

Query  437  INVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETK  258
            IN+KG+AGS  TLV+W G+W+ SY+FNFL  W+S G F ++++I    +LFV K VPETK
Sbjct  402  INMKGLAGSLVTLVSWLGSWIVSYSFNFLFNWSSTGIFFIFSSICGFTVLFVAKFVPETK  461

Query  257  GRTLEQIQATIN  222
            GRTLE+IQA +N
Sbjct  462  GRTLEEIQAAMN  473



>ref|XP_008450688.1| PREDICTED: sugar transporter ERD6-like 5 isoform X1 [Cucumis 
melo]
Length=479

 Score =   301 bits (771),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 137/252 (54%), Positives = 194/252 (77%), Gaps = 0/252 (0%)
 Frame = -3

Query  977  GHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGVGL  798
            G G + E ALQ+LRGKN DIS E  EIQ+Y E+L++LP+  + DLFQ++Y+RS+ +G+GL
Sbjct  222  GQGLDCEDALQRLRGKNKDISAEVLEIQEYTELLKQLPEPSVLDLFQRQYARSLIVGLGL  281

Query  797  MICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLLVV  618
            M+ QQ GG+NGI FY +S+F SAGF  +IGTI  A +Q+ +TA+G  L+D +GR+PLL++
Sbjct  282  MVLQQFGGVNGIAFYVTSLFTSAGFSGNIGTIALAAVQIPMTALGVVLMDVSGRRPLLMI  341

Query  617  SASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEIFP  438
            SA+G  LG +   +S+  K L +  + +P++A+ G++V+ GSFS+GMGA+PWVIMSEIFP
Sbjct  342  SAAGTCLGSLCLALSFLFKDLQLWRSGSPMMALAGVLVFSGSFSLGMGAIPWVIMSEIFP  401

Query  437  INVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPETK  258
            IN+KG+AGS  TLV+W G+W+ SY+FNFL  W+S G F ++++I    +LFV K VPETK
Sbjct  402  INMKGLAGSLVTLVSWLGSWIVSYSFNFLFNWSSTGIFFIFSSICGFTVLFVAKFVPETK  461

Query  257  GRTLEQIQATIN  222
            GRTLE+IQA +N
Sbjct  462  GRTLEEIQAAMN  473



>ref|XP_008795116.1| PREDICTED: sugar transporter ERD6-like 5 isoform X2 [Phoenix 
dactylifera]
Length=372

 Score =   297 bits (760),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/261 (55%), Positives = 195/261 (75%), Gaps = 1/261 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++GH  +FE ALQ LRGK  DIS+EA EI+++ + L+ LP+A + DLFQK+Y  S+ +GV
Sbjct  111  KVGHHNKFEAALQSLRGKYTDISQEAEEIREFTKSLQSLPQANMLDLFQKKYLYSVTVGV  170

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ GG+N ICFY S IF SAGF S + GTI   I+Q+ +T +G  L+DK+GR+P+
Sbjct  171  GLMVFQQFGGVNAICFYASEIFVSAGFSSGNTGTIAMVIVQIPMTTLGVLLLDKSGRRPI  230

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSA+G  +GC L  +S+ L+           LA+TGI+V+ GSFS+GMG +PWVIMSE
Sbjct  231  LMVSAAGTCVGCFLVAMSFLLQEHEWPKEINTALALTGILVFAGSFSLGMGGIPWVIMSE  290

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KG AGS  TLVNW G+ + SYTFNFL+ W+S GTF ++A+I  L +LFV ++VP
Sbjct  291  IFPINMKGSAGSLVTLVNWLGSGIVSYTFNFLITWSSAGTFFIFASICGLTVLFVERLVP  350

Query  266  ETKGRTLEQIQATINA*SRTR  204
            ETKGRTLE+IQA++N+ S  +
Sbjct  351  ETKGRTLEEIQASMNSFSSDK  371



>dbj|BAJ93725.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=477

 Score =   300 bits (769),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/255 (56%), Positives = 193/255 (76%), Gaps = 1/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
             +G     E ALQKLRGK  D++EEAA+I+D+ E L  LP++K+ DLFQK Y  ++ +GV
Sbjct  209  NIGRPGALEEALQKLRGKETDVTEEAADIKDFTEKLHHLPQSKILDLFQKDYIHAVTVGV  268

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ GG+N ICFY S IF SAGF S + G +    +Q+ +TA+G  L+DKAGR+PL
Sbjct  269  GLMVLQQFGGVNAICFYASEIFVSAGFSSGNTGMLAMVAVQIPMTALGVLLMDKAGRRPL  328

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSA+G  LGC+L G+S+  K  + A N   VLA+ GI+V+ GSFS+GMG +PWVIMSE
Sbjct  329  LMVSAAGTCLGCLLVGLSFLSKEHHWAKNLNVVLALAGILVFTGSFSLGMGGIPWVIMSE  388

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPI++KG AGS  TLV+W G+W+ SY FNFL+ W+S+GTF ++A+I  L I+FV ++VP
Sbjct  389  IFPIHMKGSAGSLVTLVSWLGSWIVSYAFNFLLLWSSYGTFFMFASICGLTIVFVDQLVP  448

Query  266  ETKGRTLEQIQATIN  222
            ETKGRTLE+IQA++N
Sbjct  449  ETKGRTLEEIQASMN  463



>ref|XP_006845811.2| PREDICTED: sugar transporter ERD6-like 16 [Amborella trichopoda]
Length=495

 Score =   301 bits (770),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/260 (55%), Positives = 197/260 (76%), Gaps = 1/260 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G   EFEVALQ LRGK ADISEEAAEIQDY+ ++E LP+ KL DLFQ++Y+  + +GV
Sbjct  228  KVGSHNEFEVALQTLRGKGADISEEAAEIQDYITIIEGLPQGKLQDLFQRKYTHPLIVGV  287

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSD-IGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GL+  QQ GGINGI FY S  F SAGF S  +GTI  A +QV +T +   L+DK GR+PL
Sbjct  288  GLIALQQFGGINGIAFYASETFVSAGFSSGAVGTIAMATIQVPLTGLVTLLMDKFGRRPL  347

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L++SASG  LG +L  +S+ L+  +     AP+LA+TG++VYI +FS+GMGA+PWV+M+E
Sbjct  348  LMISASGTCLGSLLAALSFVLQDQDNTFEFAPILALTGLLVYIAAFSLGMGAIPWVMMAE  407

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            +FP+NVKG AGS  +LV+WFG+W+ SY++NF M+W+  GTF +++ +  + +LFV K+VP
Sbjct  408  VFPLNVKGTAGSLVSLVHWFGSWIMSYSYNFFMSWSKAGTFFMFSGVCGVTVLFVAKLVP  467

Query  266  ETKGRTLEQIQATINA*SRT  207
            ETKGRTLE+IQA++   S +
Sbjct  468  ETKGRTLEEIQASMEHSSHS  487



>ref|XP_010511205.1| PREDICTED: sugar transporter ERD6-like 5 isoform X1 [Camelina 
sativa]
Length=470

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 137/254 (54%), Positives = 196/254 (77%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  +EFE+ALQ+LRG+ AD S E++EI+DY + L  L K  L DL Q RY++S+F+GV
Sbjct  213  KVGTWEEFEIALQRLRGECADTSYESSEIKDYTKRLTDLSKGSLVDLIQPRYAKSLFVGV  272

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+NGI FY SSIFESAGF S IG I   ++Q+ +T +G  L+DK+GR+PLL
Sbjct  273  GLMVLQQFGGVNGIAFYASSIFESAGFSSKIGMIAMVVVQIPMTTIGVLLMDKSGRRPLL  332

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++SA+G  +GC L G+S+ L+ +++       +A+TG+++Y GSFS+GMG +PWVIMSEI
Sbjct  333  LISATGTCIGCFLVGLSFSLQVVSLFSGETSYIALTGVLMYTGSFSLGMGGIPWVIMSEI  392

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPI++KG AGS  T+V+W G+W+ S+TFNFLM W+  GTF ++AT+  + ++FV K+VPE
Sbjct  393  FPIDIKGPAGSLVTVVSWIGSWIISFTFNFLMNWSPAGTFYVFATVCGVTVIFVAKLVPE  452

Query  263  TKGRTLEQIQATIN  222
            TKGRTLE+IQ++I 
Sbjct  453  TKGRTLEEIQSSIG  466



>ref|XP_002894602.1| hypothetical protein ARALYDRAFT_474748 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70861.1| hypothetical protein ARALYDRAFT_474748 [Arabidopsis lyrata subsp. 
lyrata]
Length=470

 Score =   300 bits (768),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/253 (54%), Positives = 195/253 (77%), Gaps = 0/253 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  +EFE+ALQ+LRG++ADIS E+ EI+DY + L  L +  + DLFQ +Y++S+F+GV
Sbjct  213  KVGRWEEFEIALQRLRGESADISYESNEIKDYTQRLTNLSEGSILDLFQPKYAKSLFVGV  272

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+NGI FY+SSIFESAGF S IG I   ++Q+ +T +G  L+DK+GR+PLL
Sbjct  273  GLMVLQQFGGVNGIAFYSSSIFESAGFSSKIGMIAMVVVQIPMTTLGVVLMDKSGRRPLL  332

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++SA+G  +GC L G+S+ L+ + +    A  LA+ G++VY GSFS+GMG +PWVIMSEI
Sbjct  333  LISATGTCIGCFLVGLSFSLQFVKLLSGDASYLALAGVLVYTGSFSLGMGGIPWVIMSEI  392

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPI++KG AGS  T+V+W G+W+ S+TFNFLM WN  GTF ++A++    ++FV K+VPE
Sbjct  393  FPIDIKGPAGSLVTVVSWVGSWIISFTFNFLMNWNPAGTFYVFASVCGATVIFVAKLVPE  452

Query  263  TKGRTLEQIQATI  225
            T GRTLE+IQ +I
Sbjct  453  TIGRTLEEIQYSI  465



>ref|XP_008795119.1| PREDICTED: sugar transporter ERD6-like 5 isoform X5 [Phoenix 
dactylifera]
Length=392

 Score =   297 bits (761),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 143/261 (55%), Positives = 195/261 (75%), Gaps = 1/261 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++GH  +FE ALQ LRGK  DIS+EA EI+++ + L+ LP+A + DLFQK+Y  S+ +GV
Sbjct  131  KVGHHNKFEAALQSLRGKYTDISQEAEEIREFTKSLQSLPQANMLDLFQKKYLYSVTVGV  190

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ GG+N ICFY S IF SAGF S + GTI   I+Q+ +T +G  L+DK+GR+P+
Sbjct  191  GLMVFQQFGGVNAICFYASEIFVSAGFSSGNTGTIAMVIVQIPMTTLGVLLLDKSGRRPI  250

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSA+G  +GC L  +S+ L+           LA+TGI+V+ GSFS+GMG +PWVIMSE
Sbjct  251  LMVSAAGTCVGCFLVAMSFLLQEHEWPKEINTALALTGILVFAGSFSLGMGGIPWVIMSE  310

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KG AGS  TLVNW G+ + SYTFNFL+ W+S GTF ++A+I  L +LFV ++VP
Sbjct  311  IFPINMKGSAGSLVTLVNWLGSGIVSYTFNFLITWSSAGTFFIFASICGLTVLFVERLVP  370

Query  266  ETKGRTLEQIQATINA*SRTR  204
            ETKGRTLE+IQA++N+ S  +
Sbjct  371  ETKGRTLEEIQASMNSFSSDK  391



>ref|XP_006287631.1| hypothetical protein CARUB_v10000842mg [Capsella rubella]
 gb|EOA20529.1| hypothetical protein CARUB_v10000842mg [Capsella rubella]
Length=483

 Score =   300 bits (767),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 148/255 (58%), Positives = 187/255 (73%), Gaps = 1/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KEF +ALQKLRGK+ DI  EA  IQ  ++ LE LPKA++ DL  K+Y RS+ IGV
Sbjct  226  KAGREKEFRIALQKLRGKDTDIKNEAEGIQVSIQALEILPKARIQDLVSKKYRRSVIIGV  285

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
             LM+ QQ  GINGI FY S  F  AGF S  +GTI  A +QV +T +G  LIDK+GR+PL
Sbjct  286  SLMVFQQFVGINGIGFYASETFVKAGFSSGKLGTIAIACIQVPITVLGTILIDKSGRRPL  345

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            +++SA G+ LGCILTG S++LK  N+     P+LAV G+++Y+ +FS+GMG VPWVIMSE
Sbjct  346  IMISAGGIFLGCILTGTSFFLKEQNLLLEWVPMLAVGGVLIYVAAFSIGMGPVPWVIMSE  405

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPINVKG+AGS   LVNW GAW  SYTFNFLM W+S GTF +Y+    + I+FV K+VP
Sbjct  406  IFPINVKGIAGSLVVLVNWSGAWAVSYTFNFLMTWSSPGTFYIYSAFAAMTIIFVAKMVP  465

Query  266  ETKGRTLEQIQATIN  222
            ETKG+TLE+IQA I 
Sbjct  466  ETKGKTLEEIQACIR  480



>ref|XP_010660046.1| PREDICTED: sugar transporter ERD6-like 8 isoform X4 [Vitis vinifera]
Length=450

 Score =   298 bits (764),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 155/254 (61%), Positives = 196/254 (77%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            R G+ +EF+  LQKLRG  ADISEE AEIQ+Y+   + LPK  +  L  K+  RS+ +GV
Sbjct  196  RAGYEREFKAELQKLRGVEADISEEEAEIQEYMVTHQLLPKVGIMVLLDKQNVRSVIVGV  255

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG NGI FY   IF SAG P ++G I+Y+ LQVIVTA GA+LID+ GR+PLL
Sbjct  256  GLMVFQQFGGYNGIVFYADQIFVSAGVPPNLGGILYSSLQVIVTAFGASLIDRLGRRPLL  315

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA GL LGC+LTG+S++LK   +A N  P+LAVTGIMV+IG +SVG+G +PW+IMSEI
Sbjct  316  MVSAFGLLLGCLLTGISFFLKAHQLAPNLVPILAVTGIMVHIGFYSVGLGPIPWLIMSEI  375

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FP++VK +AGS  TLVNWFGAW  SYTFNFLM W+S GTF  YA +   AI+F+I VVPE
Sbjct  376  FPLHVKAIAGSLVTLVNWFGAWAVSYTFNFLMNWSSHGTFFGYAFVCAAAIVFIIMVVPE  435

Query  263  TKGRTLEQIQATIN  222
            TKG+TLE+IQA++N
Sbjct  436  TKGQTLEEIQASMN  449



>ref|XP_008795114.1| PREDICTED: sugar transporter ERD6-like 5 isoform X1 [Phoenix 
dactylifera]
Length=414

 Score =   297 bits (761),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 143/261 (55%), Positives = 195/261 (75%), Gaps = 1/261 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++GH  +FE ALQ LRGK  DIS+EA EI+++ + L+ LP+A + DLFQK+Y  S+ +GV
Sbjct  153  KVGHHNKFEAALQSLRGKYTDISQEAEEIREFTKSLQSLPQANMLDLFQKKYLYSVTVGV  212

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM+ QQ GG+N ICFY S IF SAGF S + GTI   I+Q+ +T +G  L+DK+GR+P+
Sbjct  213  GLMVFQQFGGVNAICFYASEIFVSAGFSSGNTGTIAMVIVQIPMTTLGVLLLDKSGRRPI  272

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L+VSA+G  +GC L  +S+ L+           LA+TGI+V+ GSFS+GMG +PWVIMSE
Sbjct  273  LMVSAAGTCVGCFLVAMSFLLQEHEWPKEINTALALTGILVFAGSFSLGMGGIPWVIMSE  332

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KG AGS  TLVNW G+ + SYTFNFL+ W+S GTF ++A+I  L +LFV ++VP
Sbjct  333  IFPINMKGSAGSLVTLVNWLGSGIVSYTFNFLITWSSAGTFFIFASICGLTVLFVERLVP  392

Query  266  ETKGRTLEQIQATINA*SRTR  204
            ETKGRTLE+IQA++N+ S  +
Sbjct  393  ETKGRTLEEIQASMNSFSSDK  413



>gb|EMS53450.1| Sugar transporter ERD6-like 16 [Triticum urartu]
Length=433

 Score =   298 bits (762),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 142/254 (56%), Positives = 195/254 (77%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  +EF  ALQ LRG+NADISEEA EI++Y+E L+ LPKA++ DLF  R   ++ +GV
Sbjct  180  QVGREEEFHTALQMLRGENADISEEAIEIKEYIESLQSLPKARIQDLFLSRNIFAVIVGV  239

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLMI QQLGGING+ FY SSIF SAGF   +GTI+  I+Q+ +T +GA L+D++GR+ LL
Sbjct  240  GLMIFQQLGGINGVGFYASSIFSSAGFSGKLGTILIGIVQIPITLLGAFLMDRSGRRVLL  299

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSASG  LGC LTG+S+YLK   +     P LA++GI+VYIG++S+GMG VPWV+MSEI
Sbjct  300  MVSASGTFLGCFLTGISFYLKAHGLFLEWVPALALSGILVYIGAYSIGMGPVPWVVMSEI  359

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            F IN+K + GS  TL++W G++  SY+FNFLM W+S GTF +++  +++ ILFV ++VPE
Sbjct  360  FAINIKAIGGSLVTLISWLGSFAVSYSFNFLMDWSSAGTFFMFSAASLVTILFVARLVPE  419

Query  263  TKGRTLEQIQATIN  222
            TKG+TLE+IQ   N
Sbjct  420  TKGKTLEEIQDAWN  433



>ref|XP_004494647.1| PREDICTED: sugar transporter ERD6-like 5-like [Cicer arietinum]
Length=490

 Score =   300 bits (767),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 143/260 (55%), Positives = 196/260 (75%), Gaps = 0/260 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KE + +LQ+LRGKNAD+ +EA EI+DY E L++  +A +  LFQ +Y +S+ +GV
Sbjct  231  KVGRLKESDSSLQRLRGKNADVYKEANEIRDYTEALQQQTEASIIGLFQMQYLKSLTVGV  290

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLMI QQ GGINGI FY +SIF SAGF   IGTI    +++ +T +G  L+DK+GR+PLL
Sbjct  291  GLMILQQFGGINGIVFYANSIFISAGFSESIGTIAMVAVKIPMTTLGVFLMDKSGRRPLL  350

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++SA G  LGC L  +S++L+ ++     +PVLA+ G++VY+GS+S+G+GA+PWVIMSEI
Sbjct  351  LLSAVGTCLGCFLAALSFFLQDMHKWKEVSPVLALVGVLVYVGSYSLGIGAIPWVIMSEI  410

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPINVKG AGS  TL+NW  +W+ SYTFNFLM W+S GTF  +A I    +LFV K+VPE
Sbjct  411  FPINVKGSAGSLVTLINWLCSWIVSYTFNFLMTWSSTGTFFGFAVICGFTVLFVAKLVPE  470

Query  263  TKGRTLEQIQATINA*SRTR  204
            TKGRTLE+IQA++N+ S  R
Sbjct  471  TKGRTLEEIQASLNSNSTKR  490



>ref|XP_010660044.1| PREDICTED: sugar transporter ERD6-like 8 isoform X3 [Vitis vinifera]
 ref|XP_010660045.1| PREDICTED: sugar transporter ERD6-like 8 isoform X3 [Vitis vinifera]
 gb|ADP37167.1| putative ERD6-like transporter [Vitis vinifera]
Length=474

 Score =   299 bits (765),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 155/254 (61%), Positives = 196/254 (77%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            R G+ +EF+  LQKLRG  ADISEE AEIQ+Y+   + LPK  +  L  K+  RS+ +GV
Sbjct  220  RAGYEREFKAELQKLRGVEADISEEEAEIQEYMVTHQLLPKVGIMVLLDKQNVRSVIVGV  279

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG NGI FY   IF SAG P ++G I+Y+ LQVIVTA GA+LID+ GR+PLL
Sbjct  280  GLMVFQQFGGYNGIVFYADQIFVSAGVPPNLGGILYSSLQVIVTAFGASLIDRLGRRPLL  339

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA GL LGC+LTG+S++LK   +A N  P+LAVTGIMV+IG +SVG+G +PW+IMSEI
Sbjct  340  MVSAFGLLLGCLLTGISFFLKAHQLAPNLVPILAVTGIMVHIGFYSVGLGPIPWLIMSEI  399

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FP++VK +AGS  TLVNWFGAW  SYTFNFLM W+S GTF  YA +   AI+F+I VVPE
Sbjct  400  FPLHVKAIAGSLVTLVNWFGAWAVSYTFNFLMNWSSHGTFFGYAFVCAAAIVFIIMVVPE  459

Query  263  TKGRTLEQIQATIN  222
            TKG+TLE+IQA++N
Sbjct  460  TKGQTLEEIQASMN  473



>ref|NP_187166.2| sugar transporter ERD6-like 8 [Arabidopsis thaliana]
 sp|Q0WQ63.1|ERDL8_ARATH RecName: Full=Sugar transporter ERD6-like 8 [Arabidopsis thaliana]
 dbj|BAF00736.1| putative sugar transporter [Arabidopsis thaliana]
 gb|AEE74191.1| sugar transporter ERD6-like 8 [Arabidopsis thaliana]
Length=470

 Score =   298 bits (764),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 145/255 (57%), Positives = 190/255 (75%), Gaps = 1/255 (0%)
 Frame = -3

Query  986  QRLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIG  807
            + +G   +FE+ALQKLRG  A+I+ EA EIQ+Y+  L  LPKA L DL  K+  R + +G
Sbjct  215  EMVGRHSDFEIALQKLRGPQANITREAGEIQEYLASLAHLPKATLMDLIDKKNIRFVIVG  274

Query  806  VGLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATL-IDKAGRKP  630
            VGLM  QQ  GING+ FY   IF SAG    +G+I+Y+I QV++TA+GATL ID+ GR+P
Sbjct  275  VGLMFFQQFVGINGVIFYAQQIFVSAGASPTLGSILYSIEQVVLTALGATLLIDRLGRRP  334

Query  629  LLVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMS  450
            LL+ SA G+ +GC+L G S+ LK   +A +  P LAV+G++VYIGSFS+GMGA+PWVIMS
Sbjct  335  LLMASAVGMLIGCLLIGNSFLLKAHGLALDIIPALAVSGVLVYIGSFSIGMGAIPWVIMS  394

Query  449  EIFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVV  270
            EIFPIN+KG AG   T+VNW  +WL S+TFNFLM W+  GTF +Y  + VLAI+F+ K+V
Sbjct  395  EIFPINLKGTAGGLVTVVNWLSSWLVSFTFNFLMIWSPHGTFYVYGGVCVLAIIFIAKLV  454

Query  269  PETKGRTLEQIQATI  225
            PETKGRTLE+IQA +
Sbjct  455  PETKGRTLEEIQAMM  469



>gb|AAF27021.1|AC009177_11 putative sugar transporter [Arabidopsis thaliana]
Length=463

 Score =   298 bits (764),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 145/255 (57%), Positives = 190/255 (75%), Gaps = 1/255 (0%)
 Frame = -3

Query  986  QRLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIG  807
            + +G   +FE+ALQKLRG  A+I+ EA EIQ+Y+  L  LPKA L DL  K+  R + +G
Sbjct  208  EMVGRHSDFEIALQKLRGPQANITREAGEIQEYLASLAHLPKATLMDLIDKKNIRFVIVG  267

Query  806  VGLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATL-IDKAGRKP  630
            VGLM  QQ  GING+ FY   IF SAG    +G+I+Y+I QV++TA+GATL ID+ GR+P
Sbjct  268  VGLMFFQQFVGINGVIFYAQQIFVSAGASPTLGSILYSIEQVVLTALGATLLIDRLGRRP  327

Query  629  LLVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMS  450
            LL+ SA G+ +GC+L G S+ LK   +A +  P LAV+G++VYIGSFS+GMGA+PWVIMS
Sbjct  328  LLMASAVGMLIGCLLIGNSFLLKAHGLALDIIPALAVSGVLVYIGSFSIGMGAIPWVIMS  387

Query  449  EIFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVV  270
            EIFPIN+KG AG   T+VNW  +WL S+TFNFLM W+  GTF +Y  + VLAI+F+ K+V
Sbjct  388  EIFPINLKGTAGGLVTVVNWLSSWLVSFTFNFLMIWSPHGTFYVYGGVCVLAIIFIAKLV  447

Query  269  PETKGRTLEQIQATI  225
            PETKGRTLE+IQA +
Sbjct  448  PETKGRTLEEIQAMM  462



>gb|EYU27040.1| hypothetical protein MIMGU_mgv1a022081mg [Erythranthe guttata]
Length=306

 Score =   293 bits (749),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/253 (53%), Positives = 193/253 (76%), Gaps = 1/253 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G     E +L +LRGKNA+I EEAAEI DY   LE+   +++ DLFQ++Y+ S+ +GV
Sbjct  48   KIGKWDRSEKSLVRLRGKNANIYEEAAEIGDYTRSLEQFEDSRMVDLFQRKYAHSLIVGV  107

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+N I +Y S+IF SAGF   +GT    I+QV +T VG  L+DK+GR+PLL
Sbjct  108  GLMVLQQFGGVNAISYYASAIFSSAGFSYRVGTTTMVIVQVPMTVVGTLLMDKSGRRPLL  167

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA+G  LGC+L G+SY L+   +  + +P LA  G++++ GSFS+GMG +PWVIMSEI
Sbjct  168  LVSATGTCLGCLLIGLSYLLQDHKLW-DFSPSLAFGGVLIFSGSFSLGMGGIPWVIMSEI  226

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG+AGS  T+VNWFG W+ +Y+FNFL  W+S GTF+++A++  L ++F++K+VPE
Sbjct  227  FPINIKGLAGSLVTVVNWFGTWIITYSFNFLAQWSSAGTFLVFASVCGLTVIFIVKLVPE  286

Query  263  TKGRTLEQIQATI  225
            TKGRTLE+IQA++
Sbjct  287  TKGRTLEEIQASM  299



>gb|KHN43250.1| Sugar transporter ERD6-like 5 [Glycine soja]
Length=434

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/260 (54%), Positives = 194/260 (75%), Gaps = 0/260 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KE + ALQ+LRGKNAD+ +EA EI+D+ E  +K  +A +  LFQ +Y +S+ +GV
Sbjct  175  KAGRLKESDSALQRLRGKNADVYQEATEIRDHTEAFQKQTEASIIGLFQMQYLKSLTVGV  234

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLMI QQ GGINGI FY +SIF S+GF   IGTI    +++ +T +G  L+DK+GR+PLL
Sbjct  235  GLMILQQFGGINGIVFYANSIFISSGFSESIGTIAIVAVKIPMTTIGVLLMDKSGRRPLL  294

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA G  +GC L  +S+ L+ L+     +P+LA+ G++VY+GS+S+GMGA+PWVIMSEI
Sbjct  295  LVSAVGTCVGCFLAALSFVLQDLHKWKGVSPILALVGVLVYVGSYSIGMGAIPWVIMSEI  354

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPINVKG AGS  TLV+W  +W+ SY FNFLM+W+S GTF +++ I    +LFV K+VPE
Sbjct  355  FPINVKGSAGSLVTLVSWLCSWIISYAFNFLMSWSSAGTFFMFSGICGFTVLFVAKLVPE  414

Query  263  TKGRTLEQIQATINA*SRTR  204
            TKGRTLE+IQA++N+ S  R
Sbjct  415  TKGRTLEEIQASLNSYSSKR  434



>ref|XP_008672347.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=453

 Score =   298 bits (762),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/264 (55%), Positives = 198/264 (75%), Gaps = 3/264 (1%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            R GH   F  ALQ LRG   DISEEA+EI+ + E L++LPK+K+ DLFQK Y R++  GV
Sbjct  191  RFGHPGAFTGALQTLRGHGTDISEEASEIKVFTEKLQRLPKSKMLDLFQKEYIRAVIAGV  250

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM  QQLGG+NG+ FY S +F SAGF S + GT+  A++QV +  +G  L+DKAGR+PL
Sbjct  251  GLMALQQLGGVNGVLFYASEVFVSAGFSSGNTGTVAMAVVQVPMVGLGVLLMDKAGRRPL  310

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L++SA+G  +GC+L G+S+  K  +   +   VLA+ G++V+IGSFS+GMG +PWVIMSE
Sbjct  311  LMISAAGTCVGCLLVGLSFLSKEQHWERDLN-VLALAGLLVFIGSFSLGMGGIPWVIMSE  369

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KG AGS  TLV+W G+W+ SY FNFL+ W+S+GTF ++A I  L ++FV ++VP
Sbjct  370  IFPINMKGSAGSLVTLVSWLGSWIVSYAFNFLLIWSSYGTFFIFAAICGLTVVFVHRLVP  429

Query  266  ETKGRTLEQIQATINA*SRTRRHK  195
            ETKGRTLE+IQA++N+ S T  HK
Sbjct  430  ETKGRTLEEIQASMNS-SLTPFHK  452



>ref|XP_010660042.1| PREDICTED: sugar transporter ERD6-like 8 isoform X1 [Vitis vinifera]
Length=497

 Score =   298 bits (764),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 155/254 (61%), Positives = 196/254 (77%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            R G+ +EF+  LQKLRG  ADISEE AEIQ+Y+   + LPK  +  L  K+  RS+ +GV
Sbjct  243  RAGYEREFKAELQKLRGVEADISEEEAEIQEYMVTHQLLPKVGIMVLLDKQNVRSVIVGV  302

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG NGI FY   IF SAG P ++G I+Y+ LQVIVTA GA+LID+ GR+PLL
Sbjct  303  GLMVFQQFGGYNGIVFYADQIFVSAGVPPNLGGILYSSLQVIVTAFGASLIDRLGRRPLL  362

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA GL LGC+LTG+S++LK   +A N  P+LAVTGIMV+IG +SVG+G +PW+IMSEI
Sbjct  363  MVSAFGLLLGCLLTGISFFLKAHQLAPNLVPILAVTGIMVHIGFYSVGLGPIPWLIMSEI  422

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FP++VK +AGS  TLVNWFGAW  SYTFNFLM W+S GTF  YA +   AI+F+I VVPE
Sbjct  423  FPLHVKAIAGSLVTLVNWFGAWAVSYTFNFLMNWSSHGTFFGYAFVCAAAIVFIIMVVPE  482

Query  263  TKGRTLEQIQATIN  222
            TKG+TLE+IQA++N
Sbjct  483  TKGQTLEEIQASMN  496



>ref|XP_002882396.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58655.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=470

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 191/255 (75%), Gaps = 1/255 (0%)
 Frame = -3

Query  986  QRLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIG  807
            + +G   +FE+ALQKLRG + +I  EA EIQ+Y+  L  LPKA L+DL  K+  R + +G
Sbjct  215  EMVGRHHDFEIALQKLRGPHTNIRREAEEIQEYLASLAHLPKATLWDLIDKKNIRFVIVG  274

Query  806  VGLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATL-IDKAGRKP  630
            VGLM  QQ  GING+ FY   IF SAG    +G+I+Y+I QV++TA+GATL ID+ GR+P
Sbjct  275  VGLMFFQQFVGINGVIFYAQQIFVSAGASPTLGSILYSIEQVVLTALGATLLIDRLGRRP  334

Query  629  LLVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMS  450
            LL+ SA G+ +GC+L G S+ LK   +A +  P LAV+G++VYIGSFS+GMGA+PWVIMS
Sbjct  335  LLMASAVGMLIGCLLIGNSFLLKAHGLALDIIPALAVSGVLVYIGSFSIGMGAIPWVIMS  394

Query  449  EIFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVV  270
            EIFPIN+KG AG   T+VNW  +WL S+TFNFLM W++ GTF +Y  + VLAI+F+ K+V
Sbjct  395  EIFPINMKGTAGGLVTVVNWLSSWLVSFTFNFLMIWSTHGTFYVYGGVCVLAIIFIAKLV  454

Query  269  PETKGRTLEQIQATI  225
            PETKGRTLE+IQA +
Sbjct  455  PETKGRTLEEIQAMM  469



>ref|XP_006577261.1| PREDICTED: sugar transporter ERD6-like 5-like isoform X2 [Glycine 
max]
Length=497

 Score =   298 bits (764),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/260 (54%), Positives = 196/260 (75%), Gaps = 0/260 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KE + ALQ+LRGKNAD  +EA EI+DY E  +K  +A +  LFQ +Y +S+ +GV
Sbjct  238  KVGRLKESDSALQRLRGKNADFYQEATEIRDYTEAFQKQTEASIIGLFQIQYLKSLTVGV  297

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLMI QQ GGIN I FY +SIF S+GF   IGTI    +++ +T +G  L+DK+GR+PLL
Sbjct  298  GLMILQQFGGINAIVFYANSIFISSGFSESIGTIAIVAVKIPMTTIGVLLMDKSGRRPLL  357

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA G  +GC L  +S+ L+ L+     +P+LA+ G++VY+GS+S+GMGA+PWVIMSEI
Sbjct  358  LVSAVGTCVGCFLAALSFILQDLHKWKGVSPILALVGVLVYVGSYSIGMGAIPWVIMSEI  417

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPINVKG AGS  TLV+W  +W+ SY+FNFLM+W+S GTF+++++I    +LFV K+VPE
Sbjct  418  FPINVKGSAGSLVTLVSWLCSWIISYSFNFLMSWSSAGTFLMFSSICGFTVLFVAKLVPE  477

Query  263  TKGRTLEQIQATINA*SRTR  204
            TKGRTLE+IQA++N+ S  R
Sbjct  478  TKGRTLEEIQASLNSFSSKR  497



>gb|KCW85182.1| hypothetical protein EUGRSUZ_B02013 [Eucalyptus grandis]
Length=369

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/254 (54%), Positives = 190/254 (75%), Gaps = 0/254 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  +++E ALQ LRGKN+DISEE+ EI++Y   L+++ + ++ DLFQK Y+RS+ +GV
Sbjct  112  KVGSDRKYEAALQYLRGKNSDISEESTEIKEYTLTLQQISEGRILDLFQKTYARSLLVGV  171

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM  QQ GG N I FY SSIFESAGF +++GTI  A++QV +T VG  L+D++GR+PLL
Sbjct  172  GLMALQQFGGSNAIAFYASSIFESAGFSANVGTITMAVVQVPMTIVGVLLMDRSGRRPLL  231

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            ++SASG  LGC L G+S+ L+  +     AP L   GI++Y  SF +G+  +PW+IMSEI
Sbjct  232  LISASGTCLGCFLAGLSFLLEDFHRWTQVAPALVFVGIVLYNASFGLGLAGIPWLIMSEI  291

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS  +LVNWF +W+ +Y FNFLM  ++ GTF +++ I  L ILFV K+VPE
Sbjct  292  FPINMKGSAGSLVSLVNWFASWIVTYIFNFLMELSTAGTFFIFSAIAGLTILFVAKLVPE  351

Query  263  TKGRTLEQIQATIN  222
            TKGRTLE+IQA +N
Sbjct  352  TKGRTLEEIQAAMN  365



>ref|XP_002263418.1| PREDICTED: sugar transporter ERD6-like 5 [Vitis vinifera]
 gb|ADP37156.1| putative ERD6-like transporter [Vitis vinifera]
Length=488

 Score =   298 bits (762),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/265 (53%), Positives = 194/265 (73%), Gaps = 0/265 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            R G  ++ E ALQ+LRG+ A IS+EAAEI+DY E L++L +A + DLFQ  Y+RS+ +GV
Sbjct  224  RSGRWQDCEDALQRLRGEGAIISQEAAEIKDYSETLQRLSEATILDLFQWTYARSLIVGV  283

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLM+ QQ GG+N I FY S+IF SAGF   +G+I    +Q+ +T +G  L+DK+GR+PLL
Sbjct  284  GLMVLQQFGGVNAIVFYASAIFVSAGFSGRVGSIAMVAVQIPMTTLGTILMDKSGRRPLL  343

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            + SA+G  LGC   G+S+ L+GL       P+ A+ G+++Y G+FS+GMG +PWVIMSEI
Sbjct  344  LASAAGTCLGCFFVGISFLLQGLQGWKELGPIFALLGVLIYDGAFSLGMGGIPWVIMSEI  403

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPIN+KG AGS  TLV+W G+W+ SY FNFLM W+S GTF ++++I  + +LFV K+VPE
Sbjct  404  FPINMKGSAGSLVTLVSWLGSWIISYAFNFLMKWSSAGTFFIFSSICGITVLFVAKLVPE  463

Query  263  TKGRTLEQIQATINA*SRTRRHKNS  189
            TKGRTLE+IQA++N  S    H  S
Sbjct  464  TKGRTLEEIQASMNPLSAKDIHSIS  488



>gb|ACN26851.1| unknown [Zea mays]
 tpg|DAA53932.1| TPA: hypothetical protein ZEAMMB73_856317 [Zea mays]
Length=482

 Score =   298 bits (762),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/264 (55%), Positives = 198/264 (75%), Gaps = 3/264 (1%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            R GH   F  ALQ LRG   DISEEA+EI+ + E L++LPK+K+ DLFQK Y R++  GV
Sbjct  220  RFGHPGAFTGALQTLRGHGTDISEEASEIKVFTEKLQRLPKSKMLDLFQKEYIRAVIAGV  279

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM  QQLGG+NG+ FY S +F SAGF S + GT+  A++QV +  +G  L+DKAGR+PL
Sbjct  280  GLMALQQLGGVNGVLFYASEVFVSAGFSSGNTGTVAMAVVQVPMVGLGVLLMDKAGRRPL  339

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L++SA+G  +GC+L G+S+  K  +   +   VLA+ G++V+IGSFS+GMG +PWVIMSE
Sbjct  340  LMISAAGTCVGCLLVGLSFLSKEQHWERDLN-VLALAGLLVFIGSFSLGMGGIPWVIMSE  398

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KG AGS  TLV+W G+W+ SY FNFL+ W+S+GTF ++A I  L ++FV ++VP
Sbjct  399  IFPINMKGSAGSLVTLVSWLGSWIVSYAFNFLLIWSSYGTFFIFAAICGLTVVFVHRLVP  458

Query  266  ETKGRTLEQIQATINA*SRTRRHK  195
            ETKGRTLE+IQA++N+ S T  HK
Sbjct  459  ETKGRTLEEIQASMNS-SLTPFHK  481



>ref|XP_003521722.1| PREDICTED: sugar transporter ERD6-like 5-like isoform X1 [Glycine 
max]
 gb|KHN04026.1| Sugar transporter ERD6-like 5 [Glycine soja]
Length=482

 Score =   298 bits (762),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/260 (54%), Positives = 196/260 (75%), Gaps = 0/260 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            ++G  KE + ALQ+LRGKNAD  +EA EI+DY E  +K  +A +  LFQ +Y +S+ +GV
Sbjct  223  KVGRLKESDSALQRLRGKNADFYQEATEIRDYTEAFQKQTEASIIGLFQIQYLKSLTVGV  282

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPSDIGTIIYAILQVIVTAVGATLIDKAGRKPLL  624
            GLMI QQ GGIN I FY +SIF S+GF   IGTI    +++ +T +G  L+DK+GR+PLL
Sbjct  283  GLMILQQFGGINAIVFYANSIFISSGFSESIGTIAIVAVKIPMTTIGVLLMDKSGRRPLL  342

Query  623  VVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSEI  444
            +VSA G  +GC L  +S+ L+ L+     +P+LA+ G++VY+GS+S+GMGA+PWVIMSEI
Sbjct  343  LVSAVGTCVGCFLAALSFILQDLHKWKGVSPILALVGVLVYVGSYSIGMGAIPWVIMSEI  402

Query  443  FPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVPE  264
            FPINVKG AGS  TLV+W  +W+ SY+FNFLM+W+S GTF+++++I    +LFV K+VPE
Sbjct  403  FPINVKGSAGSLVTLVSWLCSWIISYSFNFLMSWSSAGTFLMFSSICGFTVLFVAKLVPE  462

Query  263  TKGRTLEQIQATINA*SRTR  204
            TKGRTLE+IQA++N+ S  R
Sbjct  463  TKGRTLEEIQASLNSFSSKR  482



>ref|XP_010420663.1| PREDICTED: sugar transporter ERD6-like 16 isoform X2 [Camelina 
sativa]
Length=482

 Score =   298 bits (762),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 147/255 (58%), Positives = 188/255 (74%), Gaps = 1/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KEF +AL+KLRGK+ DI+ EA  IQ  ++ LE LPKA + DL  K+Y RS+ IGV
Sbjct  225  KAGREKEFRIALEKLRGKDTDITNEAEGIQGSIQALEILPKAIIQDLVSKKYGRSVIIGV  284

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
             LM+ QQ  GINGI FY S  F  AGF S  +GTI  A +QV +T +G  LIDK GR+PL
Sbjct  285  SLMVFQQFVGINGIGFYASETFVKAGFSSGKLGTIAIACVQVPITVLGTILIDKTGRRPL  344

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            +++SA G+ LGCILTG S++LKG ++     P+LAV G+++Y+ +FS+GMG VPWVIMSE
Sbjct  345  IMISAGGIFLGCILTGTSFFLKGQSLLLEWVPMLAVGGVLIYVAAFSIGMGPVPWVIMSE  404

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPINVKG+AGS   LVNW GAW  SYTFNFLM+W+S GTF +Y+    + I+FV K+VP
Sbjct  405  IFPINVKGIAGSLVVLVNWSGAWAVSYTFNFLMSWSSPGTFYIYSAFAAMTIIFVAKMVP  464

Query  266  ETKGRTLEQIQATIN  222
            ETKG+TLE+IQA I 
Sbjct  465  ETKGKTLEEIQACIR  479



>ref|XP_008672346.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=483

 Score =   298 bits (762),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/264 (55%), Positives = 198/264 (75%), Gaps = 3/264 (1%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            R GH   F  ALQ LRG   DISEEA+EI+ + E L++LPK+K+ DLFQK Y R++  GV
Sbjct  221  RFGHPGAFTGALQTLRGHGTDISEEASEIKVFTEKLQRLPKSKMLDLFQKEYIRAVIAGV  280

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
            GLM  QQLGG+NG+ FY S +F SAGF S + GT+  A++QV +  +G  L+DKAGR+PL
Sbjct  281  GLMALQQLGGVNGVLFYASEVFVSAGFSSGNTGTVAMAVVQVPMVGLGVLLMDKAGRRPL  340

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            L++SA+G  +GC+L G+S+  K  +   +   VLA+ G++V+IGSFS+GMG +PWVIMSE
Sbjct  341  LMISAAGTCVGCLLVGLSFLSKEQHWERDLN-VLALAGLLVFIGSFSLGMGGIPWVIMSE  399

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPIN+KG AGS  TLV+W G+W+ SY FNFL+ W+S+GTF ++A I  L ++FV ++VP
Sbjct  400  IFPINMKGSAGSLVTLVSWLGSWIVSYAFNFLLIWSSYGTFFIFAAICGLTVVFVHRLVP  459

Query  266  ETKGRTLEQIQATINA*SRTRRHK  195
            ETKGRTLE+IQA++N+ S T  HK
Sbjct  460  ETKGRTLEEIQASMNS-SLTPFHK  482



>ref|XP_010420662.1| PREDICTED: sugar transporter ERD6-like 16 isoform X1 [Camelina 
sativa]
Length=483

 Score =   298 bits (762),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 147/255 (58%), Positives = 188/255 (74%), Gaps = 1/255 (0%)
 Frame = -3

Query  983  RLGHGKEFEVALQKLRGKNADISEEAAEIQDYVEMLEKLPKAKLFDLFQKRYSRSIFIGV  804
            + G  KEF +AL+KLRGK+ DI+ EA  IQ  ++ LE LPKA + DL  K+Y RS+ IGV
Sbjct  226  KAGREKEFRIALEKLRGKDTDITNEAEGIQGSIQALEILPKAIIQDLVSKKYGRSVIIGV  285

Query  803  GLMICQQLGGINGICFYTSSIFESAGFPS-DIGTIIYAILQVIVTAVGATLIDKAGRKPL  627
             LM+ QQ  GINGI FY S  F  AGF S  +GTI  A +QV +T +G  LIDK GR+PL
Sbjct  286  SLMVFQQFVGINGIGFYASETFVKAGFSSGKLGTIAIACVQVPITVLGTILIDKTGRRPL  345

Query  626  LVVSASGLALGCILTGVSYYLKGLNIAGNAAPVLAVTGIMVYIGSFSVGMGAVPWVIMSE  447
            +++SA G+ LGCILTG S++LKG ++     P+LAV G+++Y+ +FS+GMG VPWVIMSE
Sbjct  346  IMISAGGIFLGCILTGTSFFLKGQSLLLEWVPMLAVGGVLIYVAAFSIGMGPVPWVIMSE  405

Query  446  IFPINVKGVAGSFATLVNWFGAWLCSYTFNFLMAWNSFGTFILYATINVLAILFVIKVVP  267
            IFPINVKG+AGS   LVNW GAW  SYTFNFLM+W+S GTF +Y+    + I+FV K+VP
Sbjct  406  IFPINVKGIAGSLVVLVNWSGAWAVSYTFNFLMSWSSPGTFYIYSAFAAMTIIFVAKMVP  465

Query  266  ETKGRTLEQIQATIN  222
            ETKG+TLE+IQA I 
Sbjct  466  ETKGKTLEEIQACIR  480



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2448168820380