BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13799

Length=823
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009619492.1|  PREDICTED: putative DUF21 domain-containing ...    387   2e-129   
ref|XP_009619491.1|  PREDICTED: putative DUF21 domain-containing ...    387   3e-129   
ref|XP_009619494.1|  PREDICTED: putative DUF21 domain-containing ...    384   4e-129   
ref|XP_009777493.1|  PREDICTED: putative DUF21 domain-containing ...    385   5e-126   Nicotiana sylvestris
ref|XP_006346159.1|  PREDICTED: putative DUF21 domain-containing ...    376   8e-125   Solanum tuberosum [potatoes]
ref|XP_006346158.1|  PREDICTED: putative DUF21 domain-containing ...    373   4e-121   Solanum tuberosum [potatoes]
ref|XP_011095519.1|  PREDICTED: DUF21 domain-containing protein A...    365   4e-121   Sesamum indicum [beniseed]
gb|KHG04602.1|  Putative DUF21 domain-containing, chloroplastic -...    366   5e-121   Gossypium arboreum [tree cotton]
gb|KJB45539.1|  hypothetical protein B456_007G310900                    368   2e-119   Gossypium raimondii
ref|XP_010324278.1|  PREDICTED: putative DUF21 domain-containing ...    362   3e-119   Solanum lycopersicum
gb|KHG18151.1|  DUF21 domain-containing protein, chloroplastic          365   4e-118   Gossypium arboreum [tree cotton]
ref|XP_011095518.1|  PREDICTED: putative DUF21 domain-containing ...    364   7e-118   Sesamum indicum [beniseed]
gb|KHG18152.1|  DUF21 domain-containing protein, chloroplastic          364   8e-118   Gossypium arboreum [tree cotton]
gb|KDO62249.1|  hypothetical protein CISIN_1g0415261mg                  349   1e-117   Citrus sinensis [apfelsine]
gb|EYU27423.1|  hypothetical protein MIMGU_mgv1a004081mg                360   1e-117   Erythranthe guttata [common monkey flower]
ref|XP_002533036.1|  Magnesium and cobalt efflux protein corC, pu...    360   3e-116   
ref|XP_004244043.1|  PREDICTED: putative DUF21 domain-containing ...    359   6e-116   Solanum lycopersicum
ref|XP_007020575.1|  CBS domain-containing protein / transporter ...    357   3e-115   
gb|KHN43878.1|  DUF21 domain-containing protein, chloroplastic          345   8e-115   Glycine soja [wild soybean]
ref|XP_007020576.1|  CBS domain-containing protein / transporter ...    357   8e-115   
ref|XP_006474932.1|  PREDICTED: DUF21 domain-containing protein A...    353   2e-114   Citrus sinensis [apfelsine]
ref|XP_010270188.1|  PREDICTED: putative DUF21 domain-containing ...    355   4e-114   
gb|KDP39244.1|  hypothetical protein JCGZ_01001                         351   8e-114   Jatropha curcas
ref|XP_006452545.1|  hypothetical protein CICLE_v10007688mg             353   1e-113   Citrus clementina [clementine]
gb|KHN23862.1|  DUF21 domain-containing protein, chloroplastic          353   2e-113   Glycine soja [wild soybean]
ref|XP_003545104.2|  PREDICTED: putative DUF21 domain-containing ...    353   2e-113   Glycine max [soybeans]
ref|XP_012070978.1|  PREDICTED: putative DUF21 domain-containing ...    351   1e-112   Jatropha curcas
emb|CDP13736.1|  unnamed protein product                                339   4e-112   Coffea canephora [robusta coffee]
ref|XP_010252709.1|  PREDICTED: putative DUF21 domain-containing ...    348   3e-111   Nelumbo nucifera [Indian lotus]
emb|CBI26747.3|  unnamed protein product                                343   4e-111   Vitis vinifera
ref|XP_002273722.1|  PREDICTED: putative DUF21 domain-containing ...    343   1e-109   Vitis vinifera
ref|XP_010480157.1|  PREDICTED: DUF21 domain-containing protein A...    342   2e-109   Camelina sativa [gold-of-pleasure]
ref|XP_006595697.1|  PREDICTED: putative DUF21 domain-containing ...    343   2e-109   Glycine max [soybeans]
ref|XP_010501224.1|  PREDICTED: DUF21 domain-containing protein A...    342   3e-109   Camelina sativa [gold-of-pleasure]
ref|XP_002891864.1|  hypothetical protein ARALYDRAFT_474663             341   4e-109   
gb|KFK35548.1|  hypothetical protein AALP_AA4G005000                    341   4e-109   Arabis alpina [alpine rockcress]
ref|XP_010462466.1|  PREDICTED: DUF21 domain-containing protein A...    341   7e-109   Camelina sativa [gold-of-pleasure]
ref|XP_011002487.1|  PREDICTED: putative DUF21 domain-containing ...    341   7e-109   Populus euphratica
emb|CAN83218.1|  hypothetical protein VITISV_018001                     342   1e-108   Vitis vinifera
ref|XP_006392583.1|  hypothetical protein EUTSA_v10011303mg             340   2e-108   Eutrema salsugineum [saltwater cress]
ref|XP_008364162.1|  PREDICTED: DUF21 domain-containing protein A...    339   5e-108   
ref|XP_008364156.1|  PREDICTED: DUF21 domain-containing protein A...    339   8e-108   
ref|XP_006856876.1|  PREDICTED: putative DUF21 domain-containing ...    338   8e-108   Amborella trichopoda
ref|NP_175989.2|  CBS and transporter associated domain-containin...    337   1e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306885.1|  hypothetical protein CARUB_v10008439mg             339   2e-107   
gb|AAP04147.1|  unknown protein                                         337   2e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008462970.1|  PREDICTED: putative DUF21 domain-containing ...    330   7e-107   Cucumis melo [Oriental melon]
gb|KJB13843.1|  hypothetical protein B456_002G097000                    335   1e-106   Gossypium raimondii
ref|XP_009354561.1|  PREDICTED: DUF21 domain-containing protein A...    335   1e-106   Pyrus x bretschneideri [bai li]
gb|KHG26659.1|  Putative DUF21 domain-containing, chloroplastic -...    324   1e-106   Gossypium arboreum [tree cotton]
ref|XP_007142387.1|  hypothetical protein PHAVU_008G276000g             335   2e-106   Phaseolus vulgaris [French bean]
ref|XP_011651999.1|  PREDICTED: putative DUF21 domain-containing ...    328   3e-106   Cucumis sativus [cucumbers]
gb|KHG25207.1|  DUF21 domain-containing, chloroplastic -like protein    319   8e-106   Gossypium arboreum [tree cotton]
ref|XP_008366421.1|  PREDICTED: DUF21 domain-containing protein A...    332   2e-105   Malus domestica [apple tree]
ref|XP_003617721.1|  Magnesium and cobalt efflux protein corC           336   2e-105   
gb|AAF79321.1|AC002304_14  F14J16.20                                    338   2e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010552379.1|  PREDICTED: putative DUF21 domain-containing ...    332   3e-105   Tarenaya hassleriana [spider flower]
ref|XP_010097266.1|  DUF21 domain-containing protein                    332   3e-105   
ref|XP_002884940.1|  CBS domain-containing protein                      331   5e-105   Arabidopsis lyrata subsp. lyrata
ref|XP_010499942.1|  PREDICTED: putative DUF21 domain-containing ...    330   1e-104   Camelina sativa [gold-of-pleasure]
ref|XP_006407264.1|  hypothetical protein EUTSA_v10020238mg             330   1e-104   Eutrema salsugineum [saltwater cress]
ref|XP_010465109.1|  PREDICTED: putative DUF21 domain-containing ...    330   2e-104   Camelina sativa [gold-of-pleasure]
ref|XP_010675896.1|  PREDICTED: putative DUF21 domain-containing ...    329   3e-104   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_187914.1|  CBS domain and transporter associated domain-co...    329   4e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008462967.1|  PREDICTED: DUF21 domain-containing protein A...    328   4e-104   Cucumis melo [Oriental melon]
ref|XP_004150468.1|  PREDICTED: DUF21 domain-containing protein A...    327   1e-103   Cucumis sativus [cucumbers]
ref|XP_010487053.1|  PREDICTED: putative DUF21 domain-containing ...    327   2e-103   Camelina sativa [gold-of-pleasure]
ref|XP_009346765.1|  PREDICTED: DUF21 domain-containing protein A...    327   2e-103   Pyrus x bretschneideri [bai li]
emb|CDY51900.1|  BnaC03g73630D                                          327   2e-103   Brassica napus [oilseed rape]
gb|KFK38642.1|  hypothetical protein AALP_AA3G141400                    327   3e-103   Arabis alpina [alpine rockcress]
ref|XP_009135280.1|  PREDICTED: putative DUF21 domain-containing ...    326   4e-103   Brassica rapa
ref|XP_002891867.1|  predicted protein                                  318   5e-103   
ref|XP_006296606.1|  hypothetical protein CARUB_v10013158mg             326   5e-103   Capsella rubella
ref|XP_009146552.1|  PREDICTED: putative DUF21 domain-containing ...    325   9e-103   Brassica rapa
emb|CDY23564.1|  BnaC05g40300D                                          323   1e-102   Brassica napus [oilseed rape]
emb|CDX82558.1|  BnaA03g32630D                                          323   3e-102   
emb|CDY44023.1|  BnaA05g26180D                                          323   7e-102   Brassica napus [oilseed rape]
ref|XP_008244537.1|  PREDICTED: putative DUF21 domain-containing ...    317   1e-101   Prunus mume [ume]
ref|XP_004491487.1|  PREDICTED: putative DUF21 domain-containing ...    322   3e-101   Cicer arietinum [garbanzo]
ref|XP_010063281.1|  PREDICTED: DUF21 domain-containing protein A...    319   2e-100   Eucalyptus grandis [rose gum]
ref|XP_007213594.1|  hypothetical protein PRUPE_ppa002455mg             318   4e-100   Prunus persica
ref|XP_004294465.1|  PREDICTED: DUF21 domain-containing protein A...    316   4e-99    Fragaria vesca subsp. vesca
gb|KCW70490.1|  hypothetical protein EUGRSUZ_F03700                     315   7e-99    Eucalyptus grandis [rose gum]
ref|XP_007020577.1|  CBS domain-containing protein / transporter ...    303   2e-94    
ref|XP_008780985.1|  PREDICTED: putative DUF21 domain-containing ...    304   2e-94    Phoenix dactylifera
ref|XP_002966928.1|  hypothetical protein SELMODRAFT_168762             301   9e-94    
ref|XP_002961079.1|  hypothetical protein SELMODRAFT_75780              301   1e-93    
ref|XP_009394749.1|  PREDICTED: DUF21 domain-containing protein A...    291   4e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010907613.1|  PREDICTED: putative DUF21 domain-containing ...    297   2e-91    Elaeis guineensis
ref|XP_006651579.1|  PREDICTED: DUF21 domain-containing protein A...    292   3e-91    
ref|XP_010252711.1|  PREDICTED: putative DUF21 domain-containing ...    293   7e-91    Nelumbo nucifera [Indian lotus]
ref|XP_008800617.1|  PREDICTED: putative DUF21 domain-containing ...    294   1e-90    
ref|XP_009394748.1|  PREDICTED: putative DUF21 domain-containing ...    291   2e-89    Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC75665.1|  hypothetical protein OsI_12456                          285   8e-89    Oryza sativa Indica Group [Indian rice]
ref|XP_011002488.1|  PREDICTED: putative DUF21 domain-containing ...    287   2e-88    Populus euphratica
ref|XP_010905225.1|  PREDICTED: putative DUF21 domain-containing ...    288   4e-88    Elaeis guineensis
gb|ABF97418.1|  CBS domain containing protein, expressed                285   6e-87    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001772154.1|  predicted protein                                  278   1e-86    
ref|XP_001753114.1|  predicted protein                                  278   2e-86    
ref|XP_009402839.1|  PREDICTED: DUF21 domain-containing protein A...    275   5e-86    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004982491.1|  PREDICTED: DUF21 domain-containing protein A...    280   3e-85    Setaria italica
ref|XP_009402838.1|  PREDICTED: DUF21 domain-containing protein A...    275   2e-83    Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT01231.1|  hypothetical protein F775_10996                         270   3e-83    
ref|XP_003562322.1|  PREDICTED: DUF21 domain-containing protein A...    273   6e-83    Brachypodium distachyon [annual false brome]
dbj|BAK02383.1|  predicted protein                                      273   8e-83    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEE59439.1|  hypothetical protein OsJ_11614                          271   7e-82    Oryza sativa Japonica Group [Japonica rice]
gb|AAT81753.1|  transporter associated domain containing protein        259   7e-78    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008800618.1|  PREDICTED: putative DUF21 domain-containing ...    258   1e-77    
ref|NP_001050588.1|  Os03g0593200                                       258   1e-77    
ref|XP_001762927.1|  HO2c heme oxygenase                                259   2e-75    
gb|KGN59102.1|  hypothetical protein Csa_3G769670                       226   1e-66    Cucumis sativus [cucumbers]
ref|XP_008665045.1|  PREDICTED: DUF21 domain-containing protein A...    224   2e-64    Zea mays [maize]
gb|KJB45538.1|  hypothetical protein B456_007G310900                    216   3e-62    Gossypium raimondii
ref|XP_008665048.1|  PREDICTED: DUF21 domain-containing protein A...    206   3e-58    
tpg|DAA50225.1|  TPA: hypothetical protein ZEAMMB73_231355              194   3e-56    
ref|XP_002300360.2|  hypothetical protein POPTR_0001s37310g             178   1e-51    
ref|XP_002317322.1|  hypothetical protein POPTR_0011s08660g             176   6e-51    
gb|AFK45559.1|  unknown                                                 175   1e-50    Lotus japonicus
gb|EPS66961.1|  hypothetical protein M569_07815                         144   6e-38    Genlisea aurea
ref|WP_013703914.1|  hemolysin                                          148   2e-37    Marinithermus hydrothermalis
ref|XP_001420275.1|  predicted protein                                  142   2e-35    Ostreococcus lucimarinus CCE9901
ref|WP_013457825.1|  hemolysin                                          140   1e-34    Oceanithermus profundus
ref|WP_038042808.1|  hemolysin                                          139   2e-34    Thermus tengchongensis
ref|WP_038068792.1|  hemolysin                                          138   5e-34    Thermus scotoductus
ref|XP_002509090.1|  HlyC/CorC family transporter                       137   6e-34    Micromonas commoda
gb|AFH39203.1|  CBS domain-containing protein                           137   7e-34    Thermus thermophilus JL-18
gb|ADW21513.1|  CBS domain containing protein                           137   9e-34    Thermus scotoductus SA-01
ref|WP_041444443.1|  hemolysin                                          137   1e-33    Thermus thermophilus
ref|WP_011228155.1|  hemolysin                                          137   1e-33    Thermus thermophilus
ref|WP_019550090.1|  hemolysin                                          137   1e-33    Thermus scotoductus
ref|WP_038029402.1|  hemolysin                                          137   1e-33    Thermus
ref|WP_041438174.1|  hemolysin                                          137   1e-33    Thermus scotoductus
ref|WP_003048140.1|  hemolysin                                          137   1e-33    Thermus aquaticus
ref|WP_024119167.1|  hemolysin                                          137   1e-33    Thermus thermophilus
ref|WP_028493196.1|  hemolysin                                          137   1e-33    Thermus antranikianii
ref|WP_011172830.1|  hemolysin                                          137   2e-33    Thermus thermophilus
ref|WP_014515871.1|  hemolysin                                          136   2e-33    Thermus sp. CCB_US3_UF1
ref|WP_038046071.1|  hemolysin                                          136   2e-33    Thermus caliditerrae
ref|WP_038056412.1|  hemolysin                                          136   3e-33    Thermus amyloliquefaciens
ref|WP_033399260.1|  hypothetical protein                               136   3e-33    
ref|WP_018111579.1|  hemolysin                                          135   1e-32    Thermus igniterrae
ref|WP_018461981.1|  hemolysin                                          132   5e-32    Thermus oshimai
ref|WP_016329634.1|  CBS domain-containing protein                      132   8e-32    Thermus oshimai
ref|WP_039459033.1|  hemolysin                                          132   8e-32    Thermus sp. 2.9
ref|WP_038060691.1|  hemolysin                                          132   1e-31    Thermus filiformis
ref|XP_003081913.1|  CBS domain-containing protein / transporter ...    132   1e-31    Ostreococcus tauri
ref|WP_014510130.1|  hemolysin                                          131   1e-31    Thermus thermophilus
ref|XP_003061678.1|  HlyC/CorC family                                   130   3e-31    Micromonas pusilla CCMP1545
ref|WP_027338659.1|  hemolysin                                          122   2e-28    Halonatronum saccharophilum
ref|XP_005706513.1|  hemolysin-related protein                          124   2e-28    Galdieria sulphuraria
ref|WP_015234155.1|  hypothetical protein                               122   2e-28    Deinococcus peraridilitoris
gb|ADI15926.1|  protein of unknown function DUF21                       122   3e-28    Truepera radiovictrix DSM 17093
ref|WP_041948144.1|  hemolysin                                          121   4e-28    
ref|XP_005829508.1|  hypothetical protein GUITHDRAFT_141196             121   8e-28    Guillardia theta CCMP2712
ref|WP_012617223.1|  hypothetical protein                               118   4e-27    Methanosphaerula palustris
ref|WP_018247788.1|  hypothetical protein                               117   9e-27    Orenia marismortui
ref|WP_013557494.1|  hypothetical protein                               116   4e-26    Deinococcus maricopensis
ref|WP_007314069.1|  hypothetical protein                               115   6e-26    Methanolinea tarda
ref|XP_005718375.1|  unnamed protein product                            115   6e-26    Chondrus crispus [carageen]
ref|WP_027480723.1|  hemolysin                                          115   9e-26    Deinococcus pimensis
ref|WP_004039608.1|  hypothetical protein                               114   1e-25    Methanofollis liminatans
ref|WP_013257877.1|  hypothetical protein                               112   3e-25    Desulfarculus baarsii
ref|WP_041108081.1|  MULTISPECIES: magnesium transporter                112   3e-25    Pseudomonas stutzeri group
ref|WP_021767638.1|  CBS domain protein                                 112   4e-25    Leptotrichia sp. oral taxon 215
ref|WP_029684181.1|  hemolysin                                          108   6e-25    
ref|WP_006807717.1|  membrane protein                                   112   6e-25    Leptotrichia goodfellowii
ref|WP_026736906.1|  membrane protein                                   112   8e-25    Leptotrichia goodfellowii
ref|WP_038689313.1|  magnesium transporter                              110   1e-24    Stenotrophomonas rhizophila
ref|WP_013277608.1|  hemolysin                                          111   1e-24    Acetohalobium arabaticum
gb|KJS22931.1|  hemolysin                                               111   1e-24    Clostridiaceae bacterium BRH_c20a
ref|WP_026745776.1|  membrane protein                                   111   1e-24    
ref|WP_045658145.1|  hemolysin                                          111   1e-24    
ref|WP_044281261.1|  hypothetical protein                               111   1e-24    Caldithrix abyssi
gb|EHO42422.1|  protein of unknown function DUF21                       111   1e-24    Caldithrix abyssi DSM 13497
ref|WP_013255024.1|  hemolysin                                          109   1e-24    Sediminispirochaeta smaragdinae
ref|WP_038270469.1|  magnesium transporter                              110   1e-24    Xylella taiwanensis
gb|EEX74189.1|  CBS domain protein                                      111   1e-24    Leptotrichia hofstadii F0254
ref|WP_019185852.1|  magnesium transporter                              110   2e-24    Stenotrophomonas maltophilia
ref|WP_039888902.1|  membrane protein                                   111   2e-24    
ref|WP_042698268.1|  CBS domain-containing protein                      111   2e-24    Methanocorpusculum
gb|ERL25704.1|  CBS domain protein                                      111   2e-24    Leptotrichia sp. oral taxon 225 str. F0581
ref|WP_033191821.1|  hemolysin                                          111   2e-24    Fervidobacterium islandicum
ref|WP_036070018.1|  membrane protein                                   110   2e-24    
ref|WP_028918155.1|  magnesium transporter                              109   2e-24    Pseudoxanthomonas sp. J35
ref|WP_020613394.1|  hemolysin                                          108   2e-24    Sediminispirochaeta bajacaliforniensis
ref|WP_034425752.1|  hemolysin                                          110   3e-24    Clostridiales bacterium DRI-13
ref|WP_017357078.1|  magnesium transporter                              108   3e-24    Stenotrophomonas maltophilia
ref|WP_045212316.1|  magnesium transporter                              108   3e-24    Desulfonatronovibrio magnus
ref|WP_043805614.1|  magnesium transporter                              108   3e-24    
ref|WP_029756608.1|  hypothetical protein                               108   4e-24    
ref|WP_028575329.1|  magnesium transporter                              108   4e-24    Desulfonatronovibrio hydrogenovorans
gb|EMG38623.1|  CBS domain-containing protein                           108   5e-24    Desulfovibrio africanus PCS
ref|WP_031338019.1|  magnesium transporter                              108   5e-24    Xylella fastidiosa
ref|WP_024749074.1|  magnesium transporter                              108   5e-24    Xylella fastidiosa
ref|WP_018499215.1|  membrane protein                                   109   5e-24    Leptotrichia wadei
ref|WP_017870940.1|  MULTISPECIES: hemolysin                            109   5e-24    Deinococcus wulumuqiensis
ref|WP_014451671.1|  hemolysin                                          109   5e-24    Fervidobacterium pennivorans
ref|WP_014866189.1|  hypothetical protein                               109   6e-24    Methanoculleus bourgensis
ref|WP_021746245.1|  CBS domain protein                                 109   6e-24    Leptotrichia wadei
gb|ACV38099.1|  CBS domain containing protein                           109   6e-24    Leptotrichia buccalis C-1013-b
ref|WP_011786186.1|  MULTISPECIES: magnesium transporter                107   7e-24    Marinobacter
ref|WP_027700500.1|  magnesium transporter                              108   7e-24    Xylella fastidiosa
gb|AAF83711.1|AE003930_1  polar amino acid transporter                  108   8e-24    Xylella fastidiosa 9a5c
ref|WP_015327511.1|  CBS domain-containing protein                      109   8e-24    Halobacteroides halobius
ref|WP_004089605.1|  magnesium transporter                              107   8e-24    Xylella fastidiosa
gb|AIC09877.1|  magnesium transporter                                   108   8e-24    Xylella fastidiosa subsp. sandyi Ann-1
ref|WP_031337019.1|  magnesium transporter                              107   9e-24    Xylella fastidiosa
ref|WP_035253707.1|  hypothetical protein                               107   9e-24    
gb|EAO12510.1|  CBS:Transporter-associated region                       108   1e-23    Xylella fastidiosa Dixon
ref|WP_036130663.1|  magnesium transporter                              107   1e-23    Marinobacter nitratireducens
gb|AAO29617.1|  magnesium and cobalt efflux protein                     108   1e-23    Xylella fastidiosa Temecula1
ref|WP_011994167.1|  hemolysin                                          108   1e-23    Fervidobacterium nodosum
gb|ETE20127.1|  magnesium transporter                                   107   1e-23    
ref|WP_044352178.1|  hypothetical protein                               107   1e-23    
gb|AIC13121.1|  magnesium transporter                                   107   1e-23    Xylella fastidiosa MUL0034
ref|WP_041378621.1|  hypothetical protein                               107   1e-23    
ref|WP_018450991.1|  membrane protein                                   108   1e-23    Leptotrichia shahii
gb|KIA58756.1|  magnesium transporter                                   107   1e-23    Xylella fastidiosa
gb|KIX11391.1|  hypothetical protein X474_24215                         107   1e-23    Dethiosulfatarculus sandiegensis
ref|WP_026816773.1|  magnesium transporter                              107   1e-23    Arenimonas composti
gb|KDE55658.1|  hypothetical protein EI28_05765                         108   1e-23    Methanoculleus sp. MH98A
ref|WP_015869047.1|  hemolysin                                          108   1e-23    Kosmotoga
ref|WP_011833650.1|  hypothetical protein                               108   1e-23    Methanocorpusculum labreanum
ref|WP_016196919.1|  Hemolysin containing CBS domains                   108   1e-23    Arcticibacter svalbardensis
ref|WP_034133389.1|  hemolysin                                          107   2e-23    
ref|WP_042614392.1|  magnesium transporter                              106   2e-23    Stenotrophomonas
ref|WP_022336358.1|  cBS domain-containing protein                      107   2e-23    
ref|WP_034627367.1|  magnesium transporter                              106   2e-23    
ref|WP_041281703.1|  magnesium transporter                              106   2e-23    
ref|WP_029652822.1|  magnesium transporter                              106   2e-23    Marinobacter daepoensis
gb|EGJ51024.1|  CBS domain containing protein                           106   3e-23    Desulfovibrio africanus str. Walvis Bay
ref|WP_028855778.1|  membrane protein                                   107   4e-23    Psychrilyobacter atlanticus
ref|WP_011449949.1|  hypothetical protein                               107   4e-23    Methanospirillum hungatei
ref|WP_011530418.1|  hypothetical protein                               107   4e-23    Deinococcus geothermalis
ref|WP_024870404.1|  magnesium transporter                              105   4e-23    Pseudoxanthomonas suwonensis
ref|WP_017873431.1|  hypothetical protein                               107   5e-23    
ref|WP_024268162.1|  Magnesium and cobalt efflux protein CorC           105   5e-23    Salinispira pacifica
ref|WP_012827702.1|  hypothetical protein                               107   5e-23    Haliangium ochraceum
ref|WP_013932281.1|  hemolysin                                          107   5e-23    
ref|WP_017888996.1|  hypothetical protein                               107   5e-23    
ref|WP_037042421.1|  magnesium transporter                              105   5e-23    Pseudomonas
ref|WP_043106924.1|  magnesium/cobalt efflux protein CorC               105   6e-23    endosymbiont of unidentified scaly snail isolate Monju
ref|WP_027832709.1|  magnesium transporter                              105   6e-23    Marinobacter sp. HL-58
ref|WP_011844812.1|  hypothetical protein                               106   6e-23    Methanoculleus marisnigri
ref|WP_034383947.1|  hemolysin                                          106   6e-23    Deinococcus sp. YIM 77859
ref|WP_012209613.1|  hemolysin                                          106   6e-23    Petrotoga
ref|WP_034222801.1|  magnesium transporter                              105   6e-23    Arenimonas donghaensis
ref|WP_008938972.1|  Magnesium and cobalt efflux protein corC           105   7e-23    Marinobacter santoriniensis
ref|WP_008170107.1|  MULTISPECIES: magnesium transporter                105   7e-23    Gammaproteobacteria
ref|WP_041332418.1|  magnesium transporter                              105   7e-23    Marinobacter salarius
ref|WP_013329770.1|  hypothetical protein                               106   7e-23    Methanolacinia petrolearia
ref|WP_044384286.1|  magnesium transporter                              105   7e-23    Marinobacter excellens
gb|KFL36660.1|  magnesium transporter                                   105   7e-23    Arenimonas donghaensis DSM 18148 = HO3-R19
ref|WP_007154800.1|  magnesium transporter                              105   7e-23    Marinobacter algicola
ref|WP_036209781.1|  magnesium transporter                              105   8e-23    Marinobacter
ref|WP_027370691.1|  magnesium transporter                              104   9e-23    Desulfovermiculus halophilus
ref|WP_018691034.1|  hypothetical protein                               105   9e-23    Algicola sagamiensis
ref|WP_028458689.1|  hypothetical protein                               106   1e-22    Chloroflexus sp. Y-396-1
ref|WP_026748041.1|  membrane protein                                   105   1e-22    
dbj|BAM03607.1|  hypothetical membrane protein                          105   1e-22    Phycisphaera mikurensis NBRC 102666
ref|WP_036682750.1|  hypothetical protein                               104   1e-22    
ref|WP_010888807.1|  hypothetical protein                               105   1e-22    Deinococcus radiodurans
ref|WP_035418935.1|  hypothetical protein                               105   1e-22    Chloroflexus sp. MS-G
ref|WP_027072901.1|  magnesium transporter                              104   1e-22    Luteimonas sp. J29
gb|ERK55627.1|  CBS domain protein                                      105   2e-22    Leptotrichia sp. oral taxon 879 str. F0557
ref|WP_003240229.1|  magnesium transporter                              103   2e-22    Pseudomonas mendocina
ref|WP_036998240.1|  magnesium transporter                              103   2e-22    Pseudomonas composti
ref|WP_008794127.1|  membrane protein                                   105   2e-22    Fusobacterium periodonticum
ref|WP_020398348.1|  hypothetical protein                               104   2e-22    Kordiimonas gwangyangensis
gb|ERT40535.1|  hypothetical protein HMPREF1539_02111                   105   2e-22    Fusobacterium nucleatum CTI-2
ref|WP_011017189.1|  membrane protein                                   105   2e-22    Fusobacterium nucleatum
ref|WP_032881357.1|  membrane protein                                   105   2e-22    Fusobacterium nucleatum
ref|WP_012871299.1|  hypothetical protein                               105   2e-22    Sphaerobacter thermophilus
ref|WP_012136321.1|  metal ion transporter                              103   2e-22    Marinobacter lipolyticus
gb|EFG95918.1|  hypothetical protein HMPREF0397_0525                    105   2e-22    Fusobacterium nucleatum subsp. nucleatum ATCC 23726
ref|WP_029597326.1|  membrane protein                                   105   2e-22    Fusobacterium nucleatum
ref|WP_008821359.1|  membrane protein                                   105   2e-22    Fusobacterium periodonticum
ref|WP_004424784.1|  magnesium transporter                              103   2e-22    Pseudomonas
ref|WP_021443096.1|  magnesium transporter                              103   2e-22    Pseudomonas
gb|EHI78672.1|  hypothetical protein HMPREF9093_01064                   104   3e-22    
ref|WP_044872286.1|  magnesium transporter                              103   3e-22    
emb|CBJ28738.1|  hemolysin-related protein                              106   3e-22    
ref|WP_035495442.1|  membrane protein                                   104   3e-22    
ref|WP_029492583.1|  membrane protein                                   104   3e-22    
ref|WP_012636190.1|  hemolysin                                          104   3e-22    
ref|WP_043110681.1|  hypothetical protein                               103   3e-22    
ref|WP_015940232.1|  hypothetical protein                               104   3e-22    
ref|WP_038696322.1|  hemolysins-related protein containing CBS do...    104   4e-22    
gb|EFK07190.1|  CBS domain protein                                      103   4e-22    
ref|WP_016404747.1|  hypothetical protein                               104   4e-22    
ref|WP_004581562.1|  metal ion transporter                              103   4e-22    
ref|WP_028577653.1|  magnesium transporter                              102   4e-22    
ref|WP_040874412.1|  hypothetical protein                               102   4e-22    
ref|WP_008907414.1|  hypothetical protein                               104   4e-22    
ref|WP_022989709.1|  magnesium transporter                              102   5e-22    
ref|WP_017675494.1|  MULTISPECIES: magnesium transporter                102   5e-22    
ref|WP_028631421.1|  magnesium transporter                              102   5e-22    
gb|ERT44884.1|  hypothetical protein HMPREF1768_01831                   103   5e-22    
ref|WP_044917925.1|  hypothetical protein                               102   5e-22    
ref|WP_022881618.1|  membrane protein                                   104   5e-22    
ref|WP_008796855.1|  membrane protein                                   103   5e-22    
ref|WP_024309561.1|  magnesium transporter                              102   5e-22    
ref|WP_013717162.1|  magnesium transporter                              102   5e-22    
gb|EJG09949.1|  hypothetical protein A447_01221                         103   5e-22    
ref|WP_041980598.1|  magnesium transporter                              102   5e-22    
gb|EEU33103.2|  hypothetical protein HMPREF0946_01176                   103   5e-22    
ref|WP_005999371.1|  hypothetical protein                               102   5e-22    
ref|WP_008803107.1|  membrane protein                                   103   5e-22    
gb|EFE87667.1|  hypothetical protein FUSPEROL_00390                     103   5e-22    
gb|EMP16547.1|  hypothetical protein H848_04140                         103   5e-22    
ref|WP_039984112.1|  membrane protein                                   103   5e-22    
ref|WP_012057711.1|  hemolysin                                          103   5e-22    
ref|WP_005888378.1|  membrane protein                                   103   5e-22    
ref|WP_032834872.1|  MULTISPECIES: membrane protein                     103   6e-22    
ref|WP_032841570.1|  MULTISPECIES: membrane protein                     103   6e-22    
gb|ERT47146.1|  hypothetical protein HMPREF1767_01501                   103   6e-22    
ref|WP_043297711.1|  magnesium transporter                              102   6e-22    
ref|WP_008702064.1|  membrane protein                                   103   6e-22    
ref|WP_041069787.1|  magnesium/cobalt efflux protein CorC               102   6e-22    
gb|EFD80988.1|  hypothetical protein PSAG_01023                         103   6e-22    
emb|CKH13932.1|  Putative Mg2+ and Co2+ transporter CorB                103   6e-22    
ref|WP_023038571.1|  MULTISPECIES: hypothetical protein                 103   6e-22    
ref|WP_022070544.1|  hypothetical protein                               103   6e-22    
ref|WP_014851310.1|  magnesium transporter                              102   6e-22    
ref|WP_027715921.1|  transporter                                        103   6e-22    
ref|WP_020083594.1|  hypothetical protein                               102   7e-22    
gb|EES53354.1|  protein of unknown function                             103   7e-22    
ref|WP_005898135.1|  MULTISPECIES: membrane protein                     103   7e-22    
ref|WP_015909184.1|  hypothetical protein                               103   7e-22    
gb|EGN66280.1|  hypothetical protein HMPREF0404_00230                   103   7e-22    
ref|WP_005910673.1|  membrane protein                                   103   7e-22    
ref|WP_016490746.1|  magnesium/cobalt efflux protein CorC               102   7e-22    
ref|WP_005968677.1|  membrane protein                                   103   7e-22    
ref|WP_023039649.1|  hypothetical protein                               103   7e-22    
gb|AGM24241.1|  hypothetical protein HMPREF0409_01623                   103   7e-22    
ref|WP_012019708.1|  magnesium transporter                              102   7e-22    
ref|WP_012258059.1|  hypothetical protein                               103   7e-22    
ref|WP_008798625.1|  membrane protein                                   103   7e-22    
ref|WP_037051601.1|  magnesium transporter                              102   8e-22    
ref|WP_029490725.1|  membrane protein                                   103   8e-22    
ref|WP_045424070.1|  magnesium transporter                              102   8e-22    
ref|WP_022799708.1|  MULTISPECIES: hemolysin                            103   8e-22    
ref|WP_004420320.1|  Magnesium and cobalt efflux protein CorC           102   9e-22    
ref|WP_028238691.1|  magnesium transporter                              102   1e-21    
ref|WP_019340050.1|  magnesium transporter                              102   1e-21    
gb|EJU07008.1|  hypothetical protein B437_09555                         103   1e-21    
ref|WP_040647761.1|  hemolysin                                          103   1e-21    
ref|WP_021701861.1|  magnesium/cobalt efflux protein CorC               101   1e-21    
ref|WP_027069227.1|  magnesium transporter                              102   1e-21    
ref|WP_037023840.1|  magnesium transporter                              101   1e-21    
gb|EDM97768.1|  hypothetical protein BACCAP_04243                       103   1e-21    
ref|WP_021188158.1|  hypothetical protein                               103   1e-21    
ref|WP_045753659.1|  hemolysins-related protein containing CBS do...    103   1e-21    
ref|WP_045163810.1|  magnesium transporter                              101   1e-21    
ref|WP_019010519.1|  hemolysin                                          103   1e-21    
ref|WP_025243206.1|  magnesium transporter                              101   1e-21    
ref|WP_023534628.1|  MULTISPECIES: transporter associated domain ...    101   1e-21    
ref|WP_003285140.1|  magnesium transporter                              101   1e-21    
emb|CDZ80607.1|  Hemolysin C                                            102   1e-21    
ref|WP_009685396.1|  MULTISPECIES: magnesium transporter                101   1e-21    
ref|WP_040499588.1|  magnesium transporter                              101   2e-21    
ref|WP_015772878.1|  magnesium transporter                              101   2e-21    
gb|ENA33201.1|  hypothetical protein HMPREF1487_06935                   101   2e-21    
ref|WP_004102683.1|  hemolysin                                          102   2e-21    
emb|CDR33204.1|  Conserved hypothetical protein                         102   2e-21    
ref|WP_016404680.1|  hypothetical protein                               102   2e-21    
ref|WP_013333148.1|  magnesium transporter                              100   2e-21    
emb|CDI92460.1|  Putative Mg2+ and Co2+ transporter CorC              99.8    2e-21    
ref|WP_044410721.1|  magnesium transporter                              100   2e-21    
ref|WP_017507343.1|  hypothetical protein                               100   2e-21    
ref|WP_019364055.1|  MULTISPECIES: magnesium transporter                100   2e-21    
ref|WP_011914772.1|  magnesium transporter                              100   2e-21    
ref|WP_029757754.1|  membrane protein                                   102   2e-21    
ref|WP_045266102.1|  magnesium transporter                              100   2e-21    
ref|WP_003286519.1|  magnesium transporter                              100   2e-21    
ref|WP_042417944.1|  magnesium transporter                              100   2e-21    
ref|WP_043200754.1|  magnesium transporter                              100   2e-21    
ref|WP_034079816.1|  magnesium transporter                              100   2e-21    
emb|CEI03085.1|  Magnesium and cobalt efflux protein CorC               100   3e-21    
gb|ETR72232.1|  hemolysin                                               102   3e-21    
ref|WP_044061148.1|  magnesium transporter                              100   3e-21    
ref|WP_003093161.1|  MULTISPECIES: magnesium transporter                100   3e-21    
ref|WP_016712172.1|  MULTISPECIES: magnesium transporter                100   3e-21    
ref|WP_012074437.1|  magnesium transporter                              100   3e-21    
ref|WP_032975685.1|  magnesium transporter                              100   3e-21    
ref|WP_022444907.1|  hypothetical protein                               102   3e-21    
ref|XP_009040641.1|  hypothetical protein AURANDRAFT_32064              102   3e-21    
ref|WP_034058494.1|  magnesium transporter                              100   3e-21    
ref|WP_027917759.1|  magnesium transporter                              100   3e-21    
ref|WP_031767643.1|  magnesium transporter                              100   3e-21    
ref|WP_033998586.1|  magnesium transporter                              100   3e-21    
ref|WP_023378556.1|  hypothetical protein                               100   3e-21    
ref|WP_015275519.1|  Mg2+ and Co2+ transporter CorC                     100   3e-21    
ref|WP_019659043.1|  magnesium transporter                              100   3e-21    
ref|WP_011313215.1|  cation transporter                                 100   3e-21    
ref|WP_027907993.1|  magnesium transporter                              100   3e-21    
ref|WP_008569660.1|  magnesium transporter                              100   3e-21    
ref|WP_013633968.1|  hypothetical protein                               102   3e-21    
ref|WP_038831639.1|  magnesium transporter                            99.8    3e-21    
ref|WP_018746847.1|  hypothetical protein                               100   3e-21    
ref|WP_003301723.1|  MULTISPECIES: magnesium transporter                100   3e-21    
ref|WP_020588830.1|  hypothetical protein                               101   3e-21    
ref|WP_041015904.1|  magnesium transporter                              100   3e-21    
ref|WP_033940032.1|  magnesium transporter                            99.8    3e-21    
ref|WP_025875310.1|  magnesium transporter                              100   3e-21    
ref|WP_033830752.1|  magnesium transporter                              100   3e-21    
ref|WP_003297126.1|  metal ion transporter                              100   3e-21    
ref|WP_015752294.1|  magnesium transporter                              100   3e-21    
ref|WP_033944505.1|  magnesium transporter                              100   3e-21    
ref|WP_007180446.1|  MULTISPECIES: cation transporter                   100   3e-21    
gb|ABE32308.1|  Putative Mg2+ and Co2+ transporter, CorC family         100   3e-21    
ref|WP_020675500.1|  hypothetical protein                               100   3e-21    
ref|WP_030140361.1|  magnesium transporter                              100   4e-21    
ref|WP_010446702.1|  magnesium transporter                              100   4e-21    
ref|WP_032626363.1|  magnesium transporter                              100   4e-21    
ref|WP_041016740.1|  hypothetical protein                               102   4e-21    
ref|WP_026121025.1|  cation transporter                                 100   4e-21    
ref|WP_027778836.1|  cation transporter                                 100   4e-21    
ref|WP_026106127.1|  magnesium transporter                              100   4e-21    
ref|WP_031374015.1|  magnesium transporter                              100   4e-21    
ref|WP_043192681.1|  magnesium transporter                              100   4e-21    
ref|WP_011340958.1|  hypothetical protein                               100   4e-21    
ref|WP_028982164.1|  hypothetical protein                               101   4e-21    
ref|WP_031502566.1|  hemolysin                                          101   4e-21    
ref|WP_025167608.1|  magnesium transporter                              100   4e-21    
ref|WP_004073641.1|  hypothetical protein                               101   4e-21    
ref|WP_017941103.1|  MULTISPECIES: magnesium transporter                100   4e-21    
ref|WP_005886410.1|  membrane protein                                   101   4e-21    
ref|WP_022336929.1|  hypothetical protein                               101   4e-21    
ref|WP_012844602.1|  hypothetical protein                               101   4e-21    
ref|WP_035548505.1|  cation transporter                                 100   4e-21    
ref|WP_021209670.1|  magnesium transporter                              100   5e-21    
ref|WP_014066415.1|  hypothetical protein                               101   5e-21    
ref|WP_035390304.1|  hypothetical protein                               100   5e-21    
ref|WP_004077631.1|  hypothetical protein                               101   5e-21    
ref|WP_044277083.1|  hypothetical protein                               100   5e-21    
ref|WP_026180297.1|  magnesium transporter                            99.8    5e-21    
ref|WP_013792541.1|  MULTISPECIES: magnesium transporter              99.8    5e-21    
ref|WP_014684679.1|  hypothetical protein                               101   5e-21    
ref|WP_027903525.1|  magnesium transporter                            99.8    5e-21    
ref|WP_012873791.1|  magnesium transporter                              101   5e-21    
ref|WP_017903145.1|  magnesium transporter                            99.8    5e-21    
gb|KJE75971.1|  magnesium and cobalt efflux protein CorC                100   5e-21    
ref|WP_021222012.1|  magnesium transporter                            99.8    5e-21    
ref|WP_023630352.1|  magnesium transporter                            99.8    6e-21    
ref|WP_036101828.1|  magnesium transporter                            99.8    6e-21    
ref|WP_018507470.1|  cation transporter                               99.8    6e-21    
ref|WP_027622661.1|  hypothetical protein [                             100   6e-21    
ref|WP_014254266.1|  hypothetical protein [                             100   6e-21    
ref|WP_008478862.1|  hypothetical protein                               100   6e-21    
ref|WP_036139179.1|  magnesium transporter                            99.8    6e-21    
ref|WP_032960929.1|  magnesium transporter                            99.8    6e-21    
ref|WP_014036584.1|  magnesium transporter                            99.8    6e-21    
ref|WP_034402745.1|  hemolysin                                          101   6e-21    
ref|WP_042555149.1|  magnesium transporter                            99.8    6e-21    
ref|WP_009471483.1|  magnesium transporter                            99.8    6e-21    
ref|WP_033701704.1|  magnesium transporter                            99.4    7e-21    
dbj|BAL99359.1|  hypothetical protein CLDAP_13200                       101   7e-21    
ref|WP_015006473.1|  MULTISPECIES: magnesium transporter              99.8    7e-21    
ref|WP_041077153.1|  hemolysin                                          100   7e-21    
ref|WP_040261598.1|  magnesium transporter                            99.4    7e-21    
gb|ADD83373.1|  hemolysin C                                           97.1    7e-21    
ref|WP_005408827.1|  MULTISPECIES: magnesium transporter              99.8    7e-21    
ref|WP_014190476.1|  cation transporter                               99.8    7e-21    
ref|WP_028632740.1|  magnesium transporter                            99.4    7e-21    
ref|WP_036209126.1|  magnesium transporter                            99.8    7e-21    
ref|WP_027079351.1|  magnesium transporter                            99.4    7e-21    
ref|WP_039376443.1|  hypothetical protein                             99.8    7e-21    
ref|WP_018402391.1|  magnesium transporter                            99.4    7e-21    
gb|EYB66713.1|  hypothetical protein DEIPH_ctg079orf0115                100   8e-21    
ref|WP_005412794.1|  Magnesium and cobalt efflux protein CorC         99.4    8e-21    
ref|WP_036944351.1|  hemolysins-related protein containing CBS do...    100   8e-21    
ref|WP_017334146.1|  cation transporter                               99.4    8e-21    
ref|WP_041399068.1|  hypothetical protein                               100   8e-21    
gb|KIY40352.1|  magnesium transporter                                 99.4    8e-21    
ref|WP_043383092.1|  magnesium transporter                            99.4    8e-21    
ref|WP_008931209.1|  magnesium transporter                            99.4    8e-21    
ref|WP_034360250.1|  hemolysin                                          100   8e-21    
ref|WP_016501793.1|  magnesium/cobalt efflux protein CorC             99.4    8e-21    
gb|KIA78290.1|  UPF0053 protein                                         100   8e-21    
ref|WP_028690402.1|  magnesium transporter                            99.4    8e-21    
gb|ADY58937.1|  CBS domain containing protein                           100   8e-21    
ref|WP_026897689.1|  hypothetical protein                               100   8e-21    
ref|WP_007226092.1|  magnesium transporter                            99.4    8e-21    
ref|WP_015798686.1|  CBS domain-containing protein                      100   9e-21    
ref|WP_028217873.1|  cation transporter                               99.4    9e-21    
ref|WP_037533168.1|  hemolysins-related protein containing CBS do...    100   9e-21    
ref|WP_029895262.1|  magnesium transporter                            99.0    9e-21    
ref|WP_028895114.1|  hypothetical protein                               100   9e-21    
ref|WP_027460311.1|  hemolysin                                          100   9e-21    
ref|WP_008507577.1|  hypothetical protein                               100   1e-20    
ref|WP_005989773.1|  magnesium transporter                            99.0    1e-20    
ref|WP_045458489.1|  hemolysins-related protein containing CBS do...    100   1e-20    
ref|WP_024538145.1|  magnesium transporter                            99.0    1e-20    
ref|WP_042240712.1|  MULTISPECIES: hypothetical protein                 100   1e-20    
ref|WP_027592624.1|  magnesium transporter                            99.0    1e-20    
ref|WP_028225785.1|  cation transporter                               99.0    1e-20    
ref|WP_044015859.1|  hemolysin                                        98.6    1e-20    
ref|WP_012312568.1|  magnesium transporter                            99.0    1e-20    
ref|WP_027198802.1|  cation transporter                               99.0    1e-20    



>ref|XP_009619492.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic isoform X2 [Nicotiana tomentosiformis]
Length=467

 Score =   387 bits (995),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 194/255 (76%), Positives = 219/255 (86%), Gaps = 6/255 (2%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLESS+VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  213  LLESSVVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  272

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGI+DVDANTSIDQLS++L IKMPEDHQYETVSG
Sbjct  273  IVGEIFDENDSKEEIQKKTGYIVMRAEGIYDVDANTSIDQLSEDLNIKMPEDHQYETVSG  332

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGE IKVILE+ N++E N+Y+  ESD+ D+ EKNQ++KLEILAGNARKV
Sbjct  333  FVCEAFGYIPRTGERIKVILERGNEDEDNNYNDTESDRADQTEKNQMFKLEILAGNARKV  392

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNK----QDESN-NEVSFHGKTDNGNCLSN  118
            SAVRFERINHDD E ET  V    PKI+ +  K     D SN NE+SF  + +  +  SN
Sbjct  393  SAVRFERINHDDEETETNEVTRLIPKIMTRKRKNNGGSDRSNHNEISFMERREEDDH-SN  451

Query  117  NFVKSEHKNSHDLHN  73
            NFV +EH+++HD  N
Sbjct  452  NFVMAEHEDNHDTAN  466



>ref|XP_009619491.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic isoform X1 [Nicotiana tomentosiformis]
Length=469

 Score =   387 bits (994),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 194/255 (76%), Positives = 219/255 (86%), Gaps = 6/255 (2%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLESS+VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  215  LLESSVVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  274

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGI+DVDANTSIDQLS++L IKMPEDHQYETVSG
Sbjct  275  IVGEIFDENDSKEEIQKKTGYIVMRAEGIYDVDANTSIDQLSEDLNIKMPEDHQYETVSG  334

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGE IKVILE+ N++E N+Y+  ESD+ D+ EKNQ++KLEILAGNARKV
Sbjct  335  FVCEAFGYIPRTGERIKVILERGNEDEDNNYNDTESDRADQTEKNQMFKLEILAGNARKV  394

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNK----QDESN-NEVSFHGKTDNGNCLSN  118
            SAVRFERINHDD E ET  V    PKI+ +  K     D SN NE+SF  + +  +  SN
Sbjct  395  SAVRFERINHDDEETETNEVTRLIPKIMTRKRKNNGGSDRSNHNEISFMERREEDDH-SN  453

Query  117  NFVKSEHKNSHDLHN  73
            NFV +EH+++HD  N
Sbjct  454  NFVMAEHEDNHDTAN  468



>ref|XP_009619494.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic isoform X3 [Nicotiana tomentosiformis]
Length=399

 Score =   384 bits (987),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 194/255 (76%), Positives = 219/255 (86%), Gaps = 6/255 (2%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLESS+VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  145  LLESSVVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  204

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGI+DVDANTSIDQLS++L IKMPEDHQYETVSG
Sbjct  205  IVGEIFDENDSKEEIQKKTGYIVMRAEGIYDVDANTSIDQLSEDLNIKMPEDHQYETVSG  264

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGE IKVILE+ N++E N+Y+  ESD+ D+ EKNQ++KLEILAGNARKV
Sbjct  265  FVCEAFGYIPRTGERIKVILERGNEDEDNNYNDTESDRADQTEKNQMFKLEILAGNARKV  324

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNK----QDESN-NEVSFHGKTDNGNCLSN  118
            SAVRFERINHDD E ET  V    PKI+ +  K     D SN NE+SF  + +  +  SN
Sbjct  325  SAVRFERINHDDEETETNEVTRLIPKIMTRKRKNNGGSDRSNHNEISFMERREEDDH-SN  383

Query  117  NFVKSEHKNSHDLHN  73
            NFV +EH+++HD  N
Sbjct  384  NFVMAEHEDNHDTAN  398



>ref|XP_009777493.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic [Nicotiana sylvestris]
Length=668

 Score =   385 bits (990),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 193/255 (76%), Positives = 219/255 (86%), Gaps = 6/255 (2%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLESS+VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  414  LLESSVVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  473

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGI+DVDANTSIDQLS++L IKMPEDHQYETVSG
Sbjct  474  IVGEIFDENDSKEEIQKKTGYIVMRAEGIYDVDANTSIDQLSEDLNIKMPEDHQYETVSG  533

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGE IKVILE+ N++E N+Y+  ESD+ D+ EKNQ++KLEILAGNARKV
Sbjct  534  FVCEAFGYIPRTGERIKVILERGNEDEDNNYNDTESDRADQTEKNQMFKLEILAGNARKV  593

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNK----QDESN-NEVSFHGKTDNGNCLSN  118
            SAVRFER+NHDD E ET  V    PKI+ +  K     D SN NE+SF  + +  +  SN
Sbjct  594  SAVRFERLNHDDEETETNEVTRLIPKIMTRKRKNNGGSDRSNHNEISFMERREEDDH-SN  652

Query  117  NFVKSEHKNSHDLHN  73
            NFV +EH+++HD  N
Sbjct  653  NFVMAEHEDNHDTAN  667



>ref|XP_006346159.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic-like isoform X2 [Solanum tuberosum]
Length=469

 Score =   376 bits (965),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 191/255 (75%), Positives = 218/255 (85%), Gaps = 7/255 (3%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLESS+VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  215  LLESSVVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  274

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGI+DVDANTSIDQLS++L IKMPEDHQYETVSG
Sbjct  275  IVGEIFDENDSKEEIQKKTGYIVMRAEGIYDVDANTSIDQLSEDLNIKMPEDHQYETVSG  334

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGE+IK+ILE+ N++E N+Y+  ESD+ D NEKNQ +KLEILAGNARKV
Sbjct  335  FVCEAFGYIPRTGETIKLILERGNEDEDNNYNETESDRTDHNEKNQTFKLEILAGNARKV  394

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNK----QDESN-NEVSFHGKTDNGNCLSN  118
            SAVRFERIN DD E+ET  V    PKI+ +  K     D SN +E+SF  + D  +  SN
Sbjct  395  SAVRFERIN-DDVEVETSEVTRLVPKIMTRKRKSNGGSDRSNHDEISFMERRDEDDN-SN  452

Query  117  NFVKSEHKNSHDLHN  73
            NFV +E +++ D+ N
Sbjct  453  NFVIAEREDNLDVAN  467



>ref|XP_006346158.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic-like isoform X1 [Solanum tuberosum]
Length=664

 Score =   373 bits (957),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 191/255 (75%), Positives = 218/255 (85%), Gaps = 7/255 (3%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLESS+VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  410  LLESSVVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  469

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGI+DVDANTSIDQLS++L IKMPEDHQYETVSG
Sbjct  470  IVGEIFDENDSKEEIQKKTGYIVMRAEGIYDVDANTSIDQLSEDLNIKMPEDHQYETVSG  529

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGE+IK+ILE+ N++E N+Y+  ESD+ D NEKNQ +KLEILAGNARKV
Sbjct  530  FVCEAFGYIPRTGETIKLILERGNEDEDNNYNETESDRTDHNEKNQTFKLEILAGNARKV  589

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNK----QDESN-NEVSFHGKTDNGNCLSN  118
            SAVRFERIN DD E+ET  V    PKI+ +  K     D SN +E+SF  + D  +  SN
Sbjct  590  SAVRFERIN-DDVEVETSEVTRLVPKIMTRKRKSNGGSDRSNHDEISFMERRDEDDN-SN  647

Query  117  NFVKSEHKNSHDLHN  73
            NFV +E +++ D+ N
Sbjct  648  NFVIAEREDNLDVAN  662



>ref|XP_011095519.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic 
isoform X2 [Sesamum indicum]
Length=448

 Score =   365 bits (938),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 181/253 (72%), Positives = 213/253 (84%), Gaps = 13/253 (5%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLESS+VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  198  LLESSVVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  257

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGY+V+RAEGI+DVDANTSIDQLS++L IKMPE HQYETVSG
Sbjct  258  IVGEIFDENDSKEEIQKKTGYVVMRAEGIYDVDANTSIDQLSEDLNIKMPEGHQYETVSG  317

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGE+IKV+LE++N+++H+DY+G ESD+ D+NEK QI+KLEILAGNARKV
Sbjct  318  FVCEAFGYIPRTGETIKVVLERANRDDHDDYNGTESDRQDENEKTQIFKLEILAGNARKV  377

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQD------ESNNEVSFHGKTDNGNCLS  121
            SAVRFERIN+D+A +E+K V     K+  +    D      E +   SFH        ++
Sbjct  378  SAVRFERINNDEASVESKDVTRLLTKVGKRKVGSDDELDRTECDEVASFHE-------IA  430

Query  120  NNFVKSEHKNSHD  82
            N+FV S  K++ D
Sbjct  431  NDFVMSVQKDNID  443



>gb|KHG04602.1| Putative DUF21 domain-containing, chloroplastic -like protein 
[Gossypium arboreum]
Length=467

 Score =   366 bits (940),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 182/254 (72%), Positives = 214/254 (84%), Gaps = 5/254 (2%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+AHKPAYFVPDSM VWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  213  LLESTTVGDMAHKPAYFVPDSMLVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  272

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGIFDVDANTSIDQLS++L IKMPE+HQYETVSG
Sbjct  273  IVGEIFDENDSKEEIQKKTGYIVMRAEGIFDVDANTSIDQLSEDLNIKMPEEHQYETVSG  332

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGES+KV LE+ NQEE ++ S   SD+ D  E+ QIYKLEILAGNARKV
Sbjct  333  FVCEAFGYIPRTGESVKVELERGNQEEEDENSEAASDRQDLKERRQIYKLEILAGNARKV  392

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESN----NEVSFHGKTDNGNCLSNN  115
            SAVRFER+N+++A L+   V    PKI+ KW+K ++SN    NE +F  K ++ N L ++
Sbjct  393  SAVRFERVNNEEALLDVMTVTPMVPKIMKKWSKDEDSNNGKHNEDTFENKQED-NLLDDH  451

Query  114  FVKSEHKNSHDLHN  73
            +V ++HK  ++  N
Sbjct  452  YVIADHKEDNESSN  465



>gb|KJB45539.1| hypothetical protein B456_007G310900 [Gossypium raimondii]
Length=657

 Score =   368 bits (945),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/254 (72%), Positives = 216/254 (85%), Gaps = 5/254 (2%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  403  LLESTTVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  462

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGIFDVDANTSIDQLS++L IKMPE+HQYETVSG
Sbjct  463  IVGEIFDENDSKEEIQKKTGYIVMRAEGIFDVDANTSIDQLSEDLNIKMPEEHQYETVSG  522

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGES+KV LE+ NQEE ++ S   SD+ D  E+ QIYKLEILAGNARKV
Sbjct  523  FVCEAFGYIPRTGESVKVELERGNQEEEDENSEAASDRQDLKERRQIYKLEILAGNARKV  582

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESN----NEVSFHGKTDNGNCLSNN  115
            SAVRFER+N+++A L+   V    PKI+ KW+K ++SN    NE +F  K ++ N L ++
Sbjct  583  SAVRFERVNNEEALLDAMSVTPMVPKIMKKWSKDEDSNNGKHNEDTFENKQED-NLLDDH  641

Query  114  FVKSEHKNSHDLHN  73
            +V ++HK+ ++  N
Sbjct  642  YVIADHKDDNESSN  655



>ref|XP_010324278.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic isoform X2 [Solanum lycopersicum]
Length=470

 Score =   362 bits (928),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 192/256 (75%), Positives = 219/256 (86%), Gaps = 8/256 (3%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLESS+VGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  215  LLESSIVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  274

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGI+DVDANTSIDQLS++L IKMPEDHQYETVSG
Sbjct  275  IVGEIFDENDSKEEIQKKTGYIVMRAEGIYDVDANTSIDQLSEDLNIKMPEDHQYETVSG  334

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGE+IK+ILE+ N++E+N+Y+  ESD+ D NEKNQ +KLEILAGNARKV
Sbjct  335  FVCEAFGYIPRTGETIKLILERGNEDENNNYNDTESDRSDHNEKNQTFKLEILAGNARKV  394

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNK----QDESN-NEVSFHGKTDNGNCLSN  118
            SAVRFERIN DD E+E+  V    PKI+ +  K     D SN +E+SF  + D  +  SN
Sbjct  395  SAVRFERIN-DDVEVESSEVTRLVPKIMTRKRKSNGGSDRSNHDEISFMERRDEDDN-SN  452

Query  117  NFVKSEHK-NSHDLHN  73
            NFV +E + N+ D+ N
Sbjct  453  NFVMAEREDNNLDVAN  468



>gb|KHG18151.1| DUF21 domain-containing protein, chloroplastic [Gossypium arboreum]
Length=657

 Score =   365 bits (936),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 182/254 (72%), Positives = 214/254 (84%), Gaps = 5/254 (2%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+AHKPAYFVPDSM VWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  403  LLESTTVGDMAHKPAYFVPDSMLVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  462

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGIFDVDANTSIDQLS++L IKMPE+HQYETVSG
Sbjct  463  IVGEIFDENDSKEEIQKKTGYIVMRAEGIFDVDANTSIDQLSEDLNIKMPEEHQYETVSG  522

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGES+KV LE+ NQEE ++ S   SD+ D  E+ QIYKLEILAGNARKV
Sbjct  523  FVCEAFGYIPRTGESVKVELERGNQEEEDENSEAASDRQDLKERRQIYKLEILAGNARKV  582

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESN----NEVSFHGKTDNGNCLSNN  115
            SAVRFER+N+++A L+   V    PKI+ KW+K ++SN    NE +F  K ++ N L ++
Sbjct  583  SAVRFERVNNEEALLDVMTVTPMVPKIMKKWSKDEDSNNGKHNEDTFENKQED-NLLDDH  641

Query  114  FVKSEHKNSHDLHN  73
            +V ++HK  ++  N
Sbjct  642  YVIADHKEDNESSN  655



>ref|XP_011095518.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic isoform X1 [Sesamum indicum]
Length=669

 Score =   364 bits (935),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 181/253 (72%), Positives = 213/253 (84%), Gaps = 13/253 (5%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLESS+VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  419  LLESSVVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  478

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGY+V+RAEGI+DVDANTSIDQLS++L IKMPE HQYETVSG
Sbjct  479  IVGEIFDENDSKEEIQKKTGYVVMRAEGIYDVDANTSIDQLSEDLNIKMPEGHQYETVSG  538

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGE+IKV+LE++N+++H+DY+G ESD+ D+NEK QI+KLEILAGNARKV
Sbjct  539  FVCEAFGYIPRTGETIKVVLERANRDDHDDYNGTESDRQDENEKTQIFKLEILAGNARKV  598

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQD------ESNNEVSFHGKTDNGNCLS  121
            SAVRFERIN+D+A +E+K V     K+  +    D      E +   SFH        ++
Sbjct  599  SAVRFERINNDEASVESKDVTRLLTKVGKRKVGSDDELDRTECDEVASFHE-------IA  651

Query  120  NNFVKSEHKNSHD  82
            N+FV S  K++ D
Sbjct  652  NDFVMSVQKDNID  664



>gb|KHG18152.1| DUF21 domain-containing protein, chloroplastic [Gossypium arboreum]
Length=670

 Score =   364 bits (935),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 182/254 (72%), Positives = 214/254 (84%), Gaps = 5/254 (2%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+AHKPAYFVPDSM VWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  403  LLESTTVGDMAHKPAYFVPDSMLVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  462

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGIFDVDANTSIDQLS++L IKMPE+HQYETVSG
Sbjct  463  IVGEIFDENDSKEEIQKKTGYIVMRAEGIFDVDANTSIDQLSEDLNIKMPEEHQYETVSG  522

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGES+KV LE+ NQEE ++ S   SD+ D  E+ QIYKLEILAGNARKV
Sbjct  523  FVCEAFGYIPRTGESVKVELERGNQEEEDENSEAASDRQDLKERRQIYKLEILAGNARKV  582

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESN----NEVSFHGKTDNGNCLSNN  115
            SAVRFER+N+++A L+   V    PKI+ KW+K ++SN    NE +F  K ++ N L ++
Sbjct  583  SAVRFERVNNEEALLDVMTVTPMVPKIMKKWSKDEDSNNGKHNEDTFENKQED-NLLDDH  641

Query  114  FVKSEHKNSHDLHN  73
            +V ++HK  ++  N
Sbjct  642  YVIADHKEDNESSN  655



>gb|KDO62249.1| hypothetical protein CISIN_1g0415261mg, partial [Citrus sinensis]
Length=244

 Score =   349 bits (896),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 171/216 (79%), Positives = 194/216 (90%), Gaps = 1/216 (0%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ V D+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+G+VTLEDVVEE
Sbjct  29   LLESTKVADMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGVVTLEDVVEE  88

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDE+DSKEEIQKKTGYIV+RAEGI+DVDANTSIDQLS++L IKMPE HQYETVSG
Sbjct  89   IVGEIFDESDSKEEIQKKTGYIVMRAEGIYDVDANTSIDQLSEDLNIKMPEGHQYETVSG  148

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGESIKV++EK NQEE+++ +   SD+ D  EK+QIYKLEILAGNARKV
Sbjct  149  FVCEAFGYIPRTGESIKVVVEKENQEENDEDTENGSDRQDSKEKHQIYKLEILAGNARKV  208

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIA-KWNKQD  178
            SAVRFERIN+D+A+L+ K V    PKI+  KW+  D
Sbjct  209  SAVRFERINNDEAKLDAKEVTRMVPKIMKRKWSSDD  244



>gb|EYU27423.1| hypothetical protein MIMGU_mgv1a004081mg [Erythranthe guttata]
Length=545

 Score =   360 bits (924),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/249 (71%), Positives = 209/249 (84%), Gaps = 2/249 (1%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLESSMVGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  292  LLESSMVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  351

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+R EGI+DVDANTSIDQLS++L IKMPE HQYETVSG
Sbjct  352  IVGEIFDENDSKEEIQKKTGYIVMRDEGIYDVDANTSIDQLSEDLTIKMPEGHQYETVSG  411

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGE+IKV+LE+  +E+H DY G ESD+  + EK QIYKLEILAGNARKV
Sbjct  412  FVCEAFGYIPRTGETIKVVLEREIREDHGDYDGTESDRRKEKEKTQIYKLEILAGNARKV  471

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNNEVSFHGKTDNGNC--LSNNFV  109
            SAVRFERIN+++A +E K V  + PKI+ + + ++  +   S     D      ++N++V
Sbjct  472  SAVRFERINNEEASVEAKEVTRFMPKIMKRRSSEEGEDELDSIESDEDEVPFGKIANDYV  531

Query  108  KSEHKNSHD  82
             +  ++S+D
Sbjct  532  MTVQEDSND  540



>ref|XP_002533036.1| Magnesium and cobalt efflux protein corC, putative [Ricinus communis]
 gb|EEF29344.1| Magnesium and cobalt efflux protein corC, putative [Ricinus communis]
Length=676

 Score =   360 bits (925),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 181/252 (72%), Positives = 217/252 (86%), Gaps = 7/252 (3%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  422  LLESTTVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  481

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGY+V+RAEGI+DVDANTSIDQLS++L IKMPE HQYETVSG
Sbjct  482  IVGEIFDENDSKEEIQKKTGYVVMRAEGIYDVDANTSIDQLSEDLNIKMPEGHQYETVSG  541

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            F+CEAFGYIPRTGE+IKVILEK NQEE ++ +  +SD+ D+N+K+QIYKLEILAGNARKV
Sbjct  542  FICEAFGYIPRTGETIKVILEKENQEEDDEQTEGKSDRQDQNDKHQIYKLEILAGNARKV  601

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIA-KWNKQDESN----NEVSFHGKTDNGNCLSN  118
            SAVRFE+IN+ D  +E K V    PKI+  +W+  +ES+    +E SF  + ++G  LS+
Sbjct  602  SAVRFEQINNGDEMMEAKEVTRLVPKIMKRRWSSDEESDVTEYDEDSFQKRPEHG--LSD  659

Query  117  NFVKSEHKNSHD  82
            + V +EH++ ++
Sbjct  660  SNVIAEHEDDNE  671



>ref|XP_004244043.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic isoform X1 [Solanum lycopersicum]
Length=662

 Score =   359 bits (922),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 192/256 (75%), Positives = 219/256 (86%), Gaps = 8/256 (3%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLESS+VGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  407  LLESSIVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  466

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGI+DVDANTSIDQLS++L IKMPEDHQYETVSG
Sbjct  467  IVGEIFDENDSKEEIQKKTGYIVMRAEGIYDVDANTSIDQLSEDLNIKMPEDHQYETVSG  526

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGE+IK+ILE+ N++E+N+Y+  ESD+ D NEKNQ +KLEILAGNARKV
Sbjct  527  FVCEAFGYIPRTGETIKLILERGNEDENNNYNDTESDRSDHNEKNQTFKLEILAGNARKV  586

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNK----QDESN-NEVSFHGKTDNGNCLSN  118
            SAVRFERIN DD E+E+  V    PKI+ +  K     D SN +E+SF  + D  +  SN
Sbjct  587  SAVRFERIN-DDVEVESSEVTRLVPKIMTRKRKSNGGSDRSNHDEISFMERRDEDDN-SN  644

Query  117  NFVKSEHK-NSHDLHN  73
            NFV +E + N+ D+ N
Sbjct  645  NFVMAEREDNNLDVAN  660



>ref|XP_007020575.1| CBS domain-containing protein / transporter associated domain-containing 
protein isoform 1 [Theobroma cacao]
 gb|EOY12100.1| CBS domain-containing protein / transporter associated domain-containing 
protein isoform 1 [Theobroma cacao]
Length=662

 Score =   357 bits (917),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 174/220 (79%), Positives = 198/220 (90%), Gaps = 1/220 (0%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  408  LLESTTVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  467

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGIFDVDANTSIDQLS++L IKMPE+HQYETVSG
Sbjct  468  IVGEIFDENDSKEEIQKKTGYIVMRAEGIFDVDANTSIDQLSEDLNIKMPEEHQYETVSG  527

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGESIKV+LEK NQEE ++ S   SD+ D  +++QIYKLEILAGNARKV
Sbjct  528  FVCEAFGYIPRTGESIKVVLEKENQEEDDENSEAGSDRQDLKDRHQIYKLEILAGNARKV  587

Query  282  SAVRFERINHDDAELETKGVRHWAPKII-AKWNKQDESNN  166
            SAVRFERIN+++A L+   V    PK++  KW+ +++SNN
Sbjct  588  SAVRFERINNEEALLDATAVTPMIPKLMKKKWSSEEDSNN  627



>gb|KHN43878.1| DUF21 domain-containing protein, chloroplastic [Glycine soja]
Length=305

 Score =   345 bits (884),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 172/228 (75%), Positives = 196/228 (86%), Gaps = 5/228 (2%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  59   LLESTTVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  118

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEG+FDVDANTSIDQLS++L IKMPE HQYETVSG
Sbjct  119  IVGEIFDENDSKEEIQKKTGYIVMRAEGVFDVDANTSIDQLSEDLNIKMPEGHQYETVSG  178

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGE IKV+LE+ +++++N+     +DQ D+ EKNQ +KLEILAGNARKV
Sbjct  179  FVCEAFGYIPRTGECIKVVLEREDEDDNNE---SNADQQDQKEKNQSFKLEILAGNARKV  235

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIA-KWNKQDESNNEVSFHGKT  142
            SAVRFE IN++D  LETK  R   PKI+  KW     S+N+  + G T
Sbjct  236  SAVRFEHINNNDEMLETKVTR-MIPKIMKRKWRSDANSDNDAEYDGDT  282



>ref|XP_007020576.1| CBS domain-containing protein / transporter associated domain-containing 
protein isoform 2 [Theobroma cacao]
 gb|EOY12101.1| CBS domain-containing protein / transporter associated domain-containing 
protein isoform 2 [Theobroma cacao]
Length=676

 Score =   357 bits (915),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 174/220 (79%), Positives = 198/220 (90%), Gaps = 1/220 (0%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  408  LLESTTVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  467

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGIFDVDANTSIDQLS++L IKMPE+HQYETVSG
Sbjct  468  IVGEIFDENDSKEEIQKKTGYIVMRAEGIFDVDANTSIDQLSEDLNIKMPEEHQYETVSG  527

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGESIKV+LEK NQEE ++ S   SD+ D  +++QIYKLEILAGNARKV
Sbjct  528  FVCEAFGYIPRTGESIKVVLEKENQEEDDENSEAGSDRQDLKDRHQIYKLEILAGNARKV  587

Query  282  SAVRFERINHDDAELETKGVRHWAPKII-AKWNKQDESNN  166
            SAVRFERIN+++A L+   V    PK++  KW+ +++SNN
Sbjct  588  SAVRFERINNEEALLDATAVTPMIPKLMKKKWSSEEDSNN  627



>ref|XP_006474932.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=604

 Score =   353 bits (907),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 178/252 (71%), Positives = 214/252 (85%), Gaps = 7/252 (3%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ V D+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+G+VTLEDVVEE
Sbjct  354  LLESTKVADMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGVVTLEDVVEE  413

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDE+DSKEEIQKKTGYIV+RAEGI+DVDANTSIDQLS++L IKMPE HQYETVSG
Sbjct  414  IVGEIFDESDSKEEIQKKTGYIVMRAEGIYDVDANTSIDQLSEDLNIKMPEGHQYETVSG  473

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGESIKV++EK NQEE+++ +   SD+ D  EK+QIYKLEILAGNARKV
Sbjct  474  FVCEAFGYIPRTGESIKVVVEKENQEENDEDTENGSDRQDSKEKHQIYKLEILAGNARKV  533

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIA-KWNKQDE----SNNEVSFHGKTDNGNCLSN  118
            SAVRFERIN+D+A+L+ K V    PKI+  KW+  DE     +++ ++  K ++   +++
Sbjct  534  SAVRFERINNDEAKLDAKEVTRMVPKIMKRKWSSDDELDHTEDDDYTYSKKPEDHTHVAS  593

Query  117  NFVKSEHKNSHD  82
              V SEH++ +D
Sbjct  594  --VISEHEDDND  603



>ref|XP_010270188.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic isoform X1 [Nelumbo nucifera]
 ref|XP_010270189.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic isoform X2 [Nelumbo nucifera]
Length=669

 Score =   355 bits (910),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 177/252 (70%), Positives = 214/252 (85%), Gaps = 9/252 (4%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLESS VGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+G+VTLEDVVEE
Sbjct  417  LLESSKVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGLVTLEDVVEE  476

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGI+DVDANTSID LS++L +K+ E HQYETVSG
Sbjct  477  IVGEIFDENDSKEEIQKKTGYIVMRAEGIYDVDANTSIDHLSEDLSVKLAEGHQYETVSG  536

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            F+CEAFGYIPRTGESIKV+LE +NQEE+++ +  E+D+ D  EK+QI+KLEILAGNARKV
Sbjct  537  FICEAFGYIPRTGESIKVVLETANQEENDNEA--ENDRQDHKEKHQIFKLEILAGNARKV  594

Query  282  SAVRFERINHDDAELETKGVRHWAPKII-AKWNKQDESN----NEVSFHGKTDNGNCLSN  118
            SAVRFERINHDDA LE        P+I+  KW+ ++E +    +++ F  + ++G  LS+
Sbjct  595  SAVRFERINHDDATLEVNEFTRLVPRIMKKKWSGEEEFDKSHYDDIPFQERLEDG--LSD  652

Query  117  NFVKSEHKNSHD  82
             +V +EH++ +D
Sbjct  653  GYVIAEHEDDYD  664



>gb|KDP39244.1| hypothetical protein JCGZ_01001 [Jatropha curcas]
Length=578

 Score =   351 bits (901),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 180/253 (71%), Positives = 215/253 (85%), Gaps = 12/253 (5%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  327  LLESTTVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  386

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            +VGEIFDENDSKEEIQKKTGYIV+RA+GI+D+DANTSIDQLS++L +KMPE HQYETVSG
Sbjct  387  LVGEIFDENDSKEEIQKKTGYIVMRADGIYDIDANTSIDQLSEDLNVKMPEGHQYETVSG  446

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGESIKVILEK NQEE ++ +  +S++ DKN+K+QIYKLEILAGNARKV
Sbjct  447  FVCEAFGYIPRTGESIKVILEKENQEEDDEETEGKSERQDKNDKHQIYKLEILAGNARKV  506

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAK--WNKQDESN----NEVSFHGKTDNGNCLS  121
            SAVRFERIN+D      K V    P+I+ K  W+  +ES+    +E SF  + ++G  LS
Sbjct  507  SAVRFERINND----HVKEVTRVIPRIMKKKIWSSNEESDGSDYDEDSFQKRPEHG--LS  560

Query  120  NNFVKSEHKNSHD  82
            ++ V +EH++ ++
Sbjct  561  DSNVIAEHEDDNE  573



>ref|XP_006452545.1| hypothetical protein CICLE_v10007688mg [Citrus clementina]
 ref|XP_006474931.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like 
isoform X1 [Citrus sinensis]
 gb|ESR65785.1| hypothetical protein CICLE_v10007688mg [Citrus clementina]
Length=657

 Score =   353 bits (906),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 178/252 (71%), Positives = 214/252 (85%), Gaps = 7/252 (3%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ V D+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+G+VTLEDVVEE
Sbjct  407  LLESTKVADMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGVVTLEDVVEE  466

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDE+DSKEEIQKKTGYIV+RAEGI+DVDANTSIDQLS++L IKMPE HQYETVSG
Sbjct  467  IVGEIFDESDSKEEIQKKTGYIVMRAEGIYDVDANTSIDQLSEDLNIKMPEGHQYETVSG  526

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGESIKV++EK NQEE+++ +   SD+ D  EK+QIYKLEILAGNARKV
Sbjct  527  FVCEAFGYIPRTGESIKVVVEKENQEENDEDTENGSDRQDSKEKHQIYKLEILAGNARKV  586

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIA-KWNKQDE----SNNEVSFHGKTDNGNCLSN  118
            SAVRFERIN+D+A+L+ K V    PKI+  KW+  DE     +++ ++  K ++   +++
Sbjct  587  SAVRFERINNDEAKLDAKEVTRMVPKIMKRKWSSDDELDHTEDDDYTYSKKPEDHTHVAS  646

Query  117  NFVKSEHKNSHD  82
              V SEH++ +D
Sbjct  647  --VISEHEDDND  656



>gb|KHN23862.1| DUF21 domain-containing protein, chloroplastic [Glycine soja]
Length=665

 Score =   353 bits (905),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 200/228 (88%), Gaps = 5/228 (2%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  419  LLESTTVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  478

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEG+FDVDANTSIDQLS++L IKMPE HQYETVSG
Sbjct  479  IVGEIFDENDSKEEIQKKTGYIVMRAEGVFDVDANTSIDQLSEDLNIKMPEGHQYETVSG  538

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGE IKV+LE+ +++++N+     +DQ D+ EKNQI+KLEILAGNARKV
Sbjct  539  FVCEAFGYIPRTGECIKVVLEREDEDDNNE---SNADQQDQKEKNQIFKLEILAGNARKV  595

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIA-KWNKQDESNNEVSFHGKT  142
            SAVRFERIN++D  LETK  R   PKI+  KW+  + S+N+  + G T
Sbjct  596  SAVRFERINNNDEMLETKVTRM-VPKIMKRKWSSDENSDNDAEYDGDT  642



>ref|XP_003545104.2| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic-like isoform X1 [Glycine max]
Length=666

 Score =   353 bits (905),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 200/228 (88%), Gaps = 5/228 (2%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  420  LLESTTVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  479

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEG+FDVDANTSIDQLS++L IKMPE HQYETVSG
Sbjct  480  IVGEIFDENDSKEEIQKKTGYIVMRAEGVFDVDANTSIDQLSEDLNIKMPEGHQYETVSG  539

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGE IKV+LE+ +++++N+     +DQ D+ EKNQI+KLEILAGNARKV
Sbjct  540  FVCEAFGYIPRTGECIKVVLEREDEDDNNE---SNADQQDQKEKNQIFKLEILAGNARKV  596

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIA-KWNKQDESNNEVSFHGKT  142
            SAVRFERIN++D  LETK  R   PKI+  KW+  + S+N+  + G T
Sbjct  597  SAVRFERINNNDEMLETKVTRM-VPKIMKRKWSSDENSDNDAEYDGDT  643



>ref|XP_012070978.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic [Jatropha curcas]
Length=668

 Score =   351 bits (900),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 180/253 (71%), Positives = 215/253 (85%), Gaps = 12/253 (5%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  417  LLESTTVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  476

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            +VGEIFDENDSKEEIQKKTGYIV+RA+GI+D+DANTSIDQLS++L +KMPE HQYETVSG
Sbjct  477  LVGEIFDENDSKEEIQKKTGYIVMRADGIYDIDANTSIDQLSEDLNVKMPEGHQYETVSG  536

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGESIKVILEK NQEE ++ +  +S++ DKN+K+QIYKLEILAGNARKV
Sbjct  537  FVCEAFGYIPRTGESIKVILEKENQEEDDEETEGKSERQDKNDKHQIYKLEILAGNARKV  596

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAK--WNKQDESN----NEVSFHGKTDNGNCLS  121
            SAVRFERIN+D      K V    P+I+ K  W+  +ES+    +E SF  + ++G  LS
Sbjct  597  SAVRFERINND----HVKEVTRVIPRIMKKKIWSSNEESDGSDYDEDSFQKRPEHG--LS  650

Query  120  NNFVKSEHKNSHD  82
            ++ V +EH++ ++
Sbjct  651  DSNVIAEHEDDNE  663



>emb|CDP13736.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   339 bits (869),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 182/249 (73%), Positives = 210/249 (84%), Gaps = 3/249 (1%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLESS+VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIG+VTLEDVVEE
Sbjct  80   LLESSVVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGLVTLEDVVEE  139

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDS EEIQKKTGYIV+RA+GI+DVDANTSID LS++L IKMPE HQYETVSG
Sbjct  140  IVGEIFDENDSSEEIQKKTGYIVMRAQGIYDVDANTSIDHLSEDLNIKMPEGHQYETVSG  199

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGE+IKV+LE+ N+EE+++Y   ESD+ D++EK+QI+KLEILAGNARKV
Sbjct  200  FVCEAFGYIPRTGETIKVVLERENEEENDEYEEAESDRTDQHEKSQIFKLEILAGNARKV  259

Query  282  SAVRFERINHDDAELETKGVRHWAPKII-AKWN-KQDESNNEVSFHGKTDNGNCLSNNFV  109
            SAVRFER+N DD ELETK V    PKI+  KW    D    +     K    + LS++ V
Sbjct  260  SAVRFERVNQDD-ELETKEVTRLVPKIMKKKWGADDDTDKADDGVLVKEIVDHNLSDDTV  318

Query  108  KSEHKNSHD  82
             +EH +SHD
Sbjct  319  NAEHVDSHD  327



>ref|XP_010252709.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic isoform X1 [Nelumbo nucifera]
Length=675

 Score =   348 bits (892),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 176/253 (70%), Positives = 210/253 (83%), Gaps = 9/253 (4%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLE+S V DIAHK AYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GI TLEDVVEE
Sbjct  422  LLETSTVRDIAHK-AYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIATLEDVVEE  480

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGY+V+RAEGIFDVDANTSID LS++L +KMPE H YETVSG
Sbjct  481  IVGEIFDENDSKEEIQKKTGYVVMRAEGIFDVDANTSIDHLSEDLNVKMPEGHHYETVSG  540

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGESIKV+LEK+N+EE ++YS  ESD  D+ EK+QI+K+EIL GNARKV
Sbjct  541  FVCEAFGYIPRTGESIKVVLEKANREEDDEYSKVESDHRDQKEKHQIFKMEILEGNARKV  600

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIA-KWNKQDES-----NNEVSFHGKTDNGNCLS  121
            SAVRFERINHD+A+ E K V    P+I+  KW    E      ++++ F  +  +G+  S
Sbjct  601  SAVRFERINHDNAKPEAKEVTRLVPRIMKRKWTSGGEEFDKNDHDDIPFRERLGDGH--S  658

Query  120  NNFVKSEHKNSHD  82
            + +V +EH++++D
Sbjct  659  DGYVIAEHEDNYD  671



>emb|CBI26747.3| unnamed protein product [Vitis vinifera]
Length=537

 Score =   343 bits (880),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 180/263 (68%), Positives = 210/263 (80%), Gaps = 17/263 (6%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            +LESS+VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  277  ILESSIVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  336

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGY+V++ EGIFDVDANTSIDQLS++L IKMPE HQYETVSG
Sbjct  337  IVGEIFDENDSKEEIQKKTGYVVMKGEGIFDVDANTSIDQLSEDLNIKMPEGHQYETVSG  396

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            F+CE FGYIPRTGESIKV+LE   + E    + +ESD+ ++ EK  I+KLEILAGNARKV
Sbjct  397  FICEVFGYIPRTGESIKVVLENQEENEEY--TEQESDRQEQKEKQHIFKLEILAGNARKV  454

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIA-KWN------------KQDESNNEVSFHGKT  142
            SAVRFERIN+DDA LETK V    PKI+  KW+                 N+E +   + 
Sbjct  455  SAVRFERINNDDAALETKEVTRLVPKIMKRKWSDGEDSDSADDKDSDSADNDEDAHQMRP  514

Query  141  DNGNCLSNNFVKSEHKNSHDLHN  73
            ++G  LS+ +V +EHK+ HD HN
Sbjct  515  EDG--LSDGYVIAEHKDDHDSHN  535



>ref|XP_002273722.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic [Vitis vinifera]
Length=669

 Score =   343 bits (880),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 180/263 (68%), Positives = 209/263 (79%), Gaps = 17/263 (6%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            +LESS+VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  409  ILESSIVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  468

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGY+V++ EGIFDVDANTSIDQLS++L IKMPE HQYETVSG
Sbjct  469  IVGEIFDENDSKEEIQKKTGYVVMKGEGIFDVDANTSIDQLSEDLNIKMPEGHQYETVSG  528

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            F+CE FGYIPRTGESIKV+LE   + E       ESD+ ++ EK  I+KLEILAGNARKV
Sbjct  529  FICEVFGYIPRTGESIKVVLENQEENEEYTEQ--ESDRQEQKEKQHIFKLEILAGNARKV  586

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIA-KWNKQD------------ESNNEVSFHGKT  142
            SAVRFERIN+DDA LETK V    PKI+  KW+  +              N+E +   + 
Sbjct  587  SAVRFERINNDDAALETKEVTRLVPKIMKRKWSDGEDSDSADDKDSDSADNDEDAHQMRP  646

Query  141  DNGNCLSNNFVKSEHKNSHDLHN  73
            ++G  LS+ +V +EHK+ HD HN
Sbjct  647  EDG--LSDGYVIAEHKDDHDSHN  667



>ref|XP_010480157.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like 
[Camelina sativa]
Length=651

 Score =   342 bits (877),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 169/242 (70%), Positives = 199/242 (82%), Gaps = 11/242 (5%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ V D+AHKPA+FVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  410  LLESTTVVDMAHKPAFFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  469

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGI+DVDANTSIDQLS+EL IKMPE HQYETVSG
Sbjct  470  IVGEIFDENDSKEEIQKKTGYIVMRAEGIYDVDANTSIDQLSEELNIKMPEGHQYETVSG  529

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIP+TGES+ V+LEK N EE+++    + ++ D+ EK+Q+Y+LEILAGNARKV
Sbjct  530  FVCEAFGYIPKTGESVTVVLEKENWEENDEQDDAKHERHDQKEKHQVYRLEILAGNARKV  589

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNNEVSFHGKTDNGNCLSNNFVKS  103
            SAVRFER+N  D   E + V++  PK I KW+ +++S           +GN  + N V  
Sbjct  590  SAVRFERVNDMDEVSEARDVKNMVPKFIRKWSNEEDS-----------DGNLQAKNAVFE  638

Query  102  EH  97
            EH
Sbjct  639  EH  640



>ref|XP_006595697.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic-like isoform X2 [Glycine max]
Length=681

 Score =   343 bits (879),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 174/243 (72%), Positives = 200/243 (82%), Gaps = 20/243 (8%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGI---------  670
            LLES+ VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GI         
Sbjct  420  LLESTTVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIQNRCNKTKS  479

Query  669  ------VTLEDVVEEIVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDEL  508
                  VTLEDVVEEIVGEIFDENDSKEEIQKKTGYIV+RAEG+FDVDANTSIDQLS++L
Sbjct  480  LSGYKIVTLEDVVEEIVGEIFDENDSKEEIQKKTGYIVMRAEGVFDVDANTSIDQLSEDL  539

Query  507  EIKMPEDHQYETVSGFVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKN  328
             IKMPE HQYETVSGFVCEAFGYIPRTGE IKV+LE+ +++++N+     +DQ D+ EKN
Sbjct  540  NIKMPEGHQYETVSGFVCEAFGYIPRTGECIKVVLEREDEDDNNE---SNADQQDQKEKN  596

Query  327  QIYKLEILAGNARKVSAVRFERINHDDAELETKGVRHWAPKIIA-KWNKQDESNNEVSFH  151
            QI+KLEILAGNARKVSAVRFERIN++D  LETK V    PKI+  KW+  + S+N+  + 
Sbjct  597  QIFKLEILAGNARKVSAVRFERINNNDEMLETK-VTRMVPKIMKRKWSSDENSDNDAEYD  655

Query  150  GKT  142
            G T
Sbjct  656  GDT  658



>ref|XP_010501224.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic 
[Camelina sativa]
Length=650

 Score =   342 bits (876),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 169/242 (70%), Positives = 199/242 (82%), Gaps = 11/242 (5%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ V D+AHKPA+FVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGI+TLEDVVEE
Sbjct  409  LLESTTVVDMAHKPAFFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIITLEDVVEE  468

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGI+DVDANTSIDQLS+EL IKMPE HQYETVSG
Sbjct  469  IVGEIFDENDSKEEIQKKTGYIVMRAEGIYDVDANTSIDQLSEELNIKMPEGHQYETVSG  528

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIP+TGES+ V+LEK N EE+++    + ++ D+ EK+Q+Y+LEILAGNARKV
Sbjct  529  FVCEAFGYIPKTGESVTVVLEKENWEENDEQEDGKHERHDQKEKHQVYRLEILAGNARKV  588

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNNEVSFHGKTDNGNCLSNNFVKS  103
            SAVRFER+N  D   E + V++  PK I KW+ +++S           +GN  + N V  
Sbjct  589  SAVRFERVNDMDEVSEARDVKNMVPKFIRKWSNEEDS-----------DGNIQAKNAVFE  637

Query  102  EH  97
            EH
Sbjct  638  EH  639



>ref|XP_002891864.1| hypothetical protein ARALYDRAFT_474663 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68123.1| hypothetical protein ARALYDRAFT_474663 [Arabidopsis lyrata subsp. 
lyrata]
Length=632

 Score =   341 bits (874),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 198/242 (82%), Gaps = 11/242 (5%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ V D+AHKPA+FVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  391  LLESTTVVDMAHKPAFFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  450

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGI+DVDANTSIDQLS+EL IKM E HQYETVSG
Sbjct  451  IVGEIFDENDSKEEIQKKTGYIVMRAEGIYDVDANTSIDQLSEELNIKMAEGHQYETVSG  510

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIP+TGES+ V+LEK N EE+++    + ++ D+ EK+QIY+LE+LAGNARKV
Sbjct  511  FVCEAFGYIPKTGESVTVVLEKENWEENDEQDEGKQERQDQKEKHQIYRLEVLAGNARKV  570

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNNEVSFHGKTDNGNCLSNNFVKS  103
            SAVRFER+N  D   E + V++  PK + KW+ +++S           +GN  + N V  
Sbjct  571  SAVRFERVNDMDQVSEARDVKNMVPKFVRKWSSEEDS-----------DGNLQAKNAVFD  619

Query  102  EH  97
            EH
Sbjct  620  EH  621



>gb|KFK35548.1| hypothetical protein AALP_AA4G005000 [Arabis alpina]
Length=643

 Score =   341 bits (875),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 164/217 (76%), Positives = 188/217 (87%), Gaps = 0/217 (0%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLE + V D+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  401  LLEGTTVVDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  460

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGI+DVDANTSIDQLS+EL IKMPE HQYETVSG
Sbjct  461  IVGEIFDENDSKEEIQKKTGYIVMRAEGIYDVDANTSIDQLSEELNIKMPEGHQYETVSG  520

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIP+TGES+ V+LEK   +EH++    +  + D+ +KNQIY+LEILAGNARKV
Sbjct  521  FVCEAFGYIPKTGESVTVVLEKECSDEHDEQEEGKHKRQDQKDKNQIYRLEILAGNARKV  580

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDES  172
            SAVRFER++  D   E + VR+  PK + KW+ ++ES
Sbjct  581  SAVRFERVDDMDKVSEARDVRNMVPKFVRKWSNEEES  617



>ref|XP_010462466.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like 
[Camelina sativa]
Length=650

 Score =   341 bits (874),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 198/242 (82%), Gaps = 11/242 (5%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ V D+AHKPA+FVPDSMSVWNLLREFRIRKVHM VVLNEYGGTIGI+TLEDVVEE
Sbjct  409  LLESTTVVDMAHKPAFFVPDSMSVWNLLREFRIRKVHMGVVLNEYGGTIGIITLEDVVEE  468

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGI+DVDANTSIDQLS+EL IKMPE HQYETVSG
Sbjct  469  IVGEIFDENDSKEEIQKKTGYIVMRAEGIYDVDANTSIDQLSEELNIKMPEGHQYETVSG  528

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIP+TGES+ V+LEK N EE+++    + ++ D+ EK+Q+Y+LEILAGNARKV
Sbjct  529  FVCEAFGYIPKTGESVTVVLEKENWEENDEQDDAKHERHDQKEKHQVYRLEILAGNARKV  588

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNNEVSFHGKTDNGNCLSNNFVKS  103
            SAVRFER+N  D   E + V++  PK I KW+ +++S           +GN  + N V  
Sbjct  589  SAVRFERVNDMDEVSEARDVKNMVPKFIRKWSNEEDS-----------DGNLQAKNAVFE  637

Query  102  EH  97
            EH
Sbjct  638  EH  639



>ref|XP_011002487.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic isoform X1 [Populus euphratica]
Length=667

 Score =   341 bits (875),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 164/217 (76%), Positives = 191/217 (88%), Gaps = 1/217 (0%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLE + VGD+AHKP YFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  410  LLERTTVGDMAHKPTYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  469

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEI+KKTGYIV+RAEGI+DVDANTSIDQLS++L +KMPE HQYETVSG
Sbjct  470  IVGEIFDENDSKEEIEKKTGYIVMRAEGIYDVDANTSIDQLSEDLNVKMPEGHQYETVSG  529

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            F+CEAFGYIPRTGE+IKV+LEK  QE+ ++++  +SD+ +  EK+QIYKLEILAGNARKV
Sbjct  530  FICEAFGYIPRTGETIKVVLEKETQEDVDEHTEGKSDRQELKEKHQIYKLEILAGNARKV  589

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIA-KWNKQDE  175
            SAVRFERIN+ +A LE   V    P+I+  KW+  +E
Sbjct  590  SAVRFERINNGEALLEANEVTRLVPRIMKRKWSSDEE  626



>emb|CAN83218.1| hypothetical protein VITISV_018001 [Vitis vinifera]
Length=723

 Score =   342 bits (877),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 180/263 (68%), Positives = 211/263 (80%), Gaps = 17/263 (6%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            +LESS+VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  463  ILESSIVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  522

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGY+V++ EGIFDVDANTSIDQLS++L IKMPE HQYETVSG
Sbjct  523  IVGEIFDENDSKEEIQKKTGYVVMKGEGIFDVDANTSIDQLSEDLNIKMPEGHQYETVSG  582

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            F+CE FGYIPRTGESIKV+LE   + E    + +ESD+ ++ EK  I+KLEILAGNARKV
Sbjct  583  FICEVFGYIPRTGESIKVVLENQEENEEY--TEQESDRQEQKEKQHIFKLEILAGNARKV  640

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIA-KWNKQD------------ESNNEVSFHGKT  142
            SAVRFERIN+DDA LETK V    PKI+  KW+  +              N+E +   + 
Sbjct  641  SAVRFERINNDDAALETKEVTRLVPKIMKRKWSDGEDSDSADDKDSDSADNDEDAHQMRP  700

Query  141  DNGNCLSNNFVKSEHKNSHDLHN  73
            ++G  LS+ +V +EHK+ HD HN
Sbjct  701  EDG--LSDGYVIAEHKDDHDSHN  721



>ref|XP_006392583.1| hypothetical protein EUTSA_v10011303mg [Eutrema salsugineum]
 gb|ESQ29869.1| hypothetical protein EUTSA_v10011303mg [Eutrema salsugineum]
Length=648

 Score =   340 bits (871),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 172/247 (70%), Positives = 196/247 (79%), Gaps = 11/247 (4%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES  +  +AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  397  LLESITLVGMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  456

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGI+DVDANTSIDQLS+EL +KMPE HQYETVSG
Sbjct  457  IVGEIFDENDSKEEIQKKTGYIVMRAEGIYDVDANTSIDQLSEELNMKMPEGHQYETVSG  516

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIP+TGES+ V+LEK N EEHN+    + ++ D+ EK QIY+LEILAGNARKV
Sbjct  517  FVCEAFGYIPKTGESVTVVLEKENWEEHNEQEEGKHERQDQKEKYQIYRLEILAGNARKV  576

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNNEVSFHGKTDNGNCL-----SN  118
            SAVRFER+N      E++ VR+  PK + KW+ ++E        G     N L     +N
Sbjct  577  SAVRFERVNDMVEVSESRDVRNMVPKFVRKWSSEEE------LEGNQHERNSLYQEYKAN  630

Query  117  NFVKSEH  97
            N V  EH
Sbjct  631  NAVSDEH  637



>ref|XP_008364162.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like 
isoform X2 [Malus domestica]
Length=665

 Score =   339 bits (869),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 175/252 (69%), Positives = 202/252 (80%), Gaps = 15/252 (6%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+A KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  419  LLESTSVGDMAQKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  478

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGI+DVDANTSIDQLS++L +KMPE HQYETVSG
Sbjct  479  IVGEIFDENDSKEEIQKKTGYIVMRAEGIYDVDANTSIDQLSEDLNVKMPEGHQYETVSG  538

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            F+CEAFGYIPRTGESIKV+LE  N E  ++    +SD  DK EK+QI+K+EILAGNARKV
Sbjct  539  FICEAFGYIPRTGESIKVVLENENDEAIDE---TKSDNQDKKEKHQIFKIEILAGNARKV  595

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIA-KWNKQDESN----NEVSFHGKTDNGNCLSN  118
             AVRFERI +D A LETK V    PKI+  KW+   +S+    +E SF  +         
Sbjct  596  GAVRFERIENDAATLETKEVTRLVPKIMKRKWSGDQDSDGTDYDEDSFQKR-------PQ  648

Query  117  NFVKSEHKNSHD  82
            N +  EH+++ D
Sbjct  649  NTISDEHEDAVD  660



>ref|XP_008364156.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like 
isoform X1 [Malus domestica]
Length=676

 Score =   339 bits (869),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 175/252 (69%), Positives = 202/252 (80%), Gaps = 15/252 (6%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+A KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  430  LLESTSVGDMAQKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  489

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGI+DVDANTSIDQLS++L +KMPE HQYETVSG
Sbjct  490  IVGEIFDENDSKEEIQKKTGYIVMRAEGIYDVDANTSIDQLSEDLNVKMPEGHQYETVSG  549

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            F+CEAFGYIPRTGESIKV+LE  N E  ++    +SD  DK EK+QI+K+EILAGNARKV
Sbjct  550  FICEAFGYIPRTGESIKVVLENENDEAIDE---TKSDNQDKKEKHQIFKIEILAGNARKV  606

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIA-KWNKQDESN----NEVSFHGKTDNGNCLSN  118
             AVRFERI +D A LETK V    PKI+  KW+   +S+    +E SF  +         
Sbjct  607  GAVRFERIENDAATLETKEVTRLVPKIMKRKWSGDQDSDGTDYDEDSFQKR-------PQ  659

Query  117  NFVKSEHKNSHD  82
            N +  EH+++ D
Sbjct  660  NTISDEHEDAVD  671



>ref|XP_006856876.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic [Amborella trichopoda]
 gb|ERN18343.1| hypothetical protein AMTR_s00055p00196140 [Amborella trichopoda]
Length=673

 Score =   338 bits (868),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 170/249 (68%), Positives = 202/249 (81%), Gaps = 8/249 (3%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LL+S+ VGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  418  LLDSAKVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  477

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQ+KTGYIV+RA+G++DVDANTSIDQLS+EL IK+PE HQYETVSG
Sbjct  478  IVGEIFDENDSKEEIQRKTGYIVMRADGVYDVDANTSIDQLSEELTIKLPEGHQYETVSG  537

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            F+CEAFG IPRTGE+IK+ILEK++ +E+N+Y  +E+D+    EKNQ +KLEIL GNARKV
Sbjct  538  FICEAFGCIPRTGETIKLILEKADTKENNEYPDQENDRQGHQEKNQTFKLEILEGNARKV  597

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIA-KWNKQDESNNEVSFHGKTDNGNCLSNNFVK  106
             AVRFERIN +D +L+ + V    P+I+  KW      N +V    KTD    L  N  +
Sbjct  598  GAVRFERINEEDVKLDAESVTRVVPRIMKRKW----RGNQDVD---KTDAPESLYQNKAE  650

Query  105  SEHKNSHDL  79
              + + H+L
Sbjct  651  DGYTDDHNL  659



>ref|NP_175989.2| CBS and transporter associated domain-containing protein [Arabidopsis 
thaliana]
 sp|Q84R21.2|Y1559_ARATH RecName: Full=DUF21 domain-containing protein At1g55930, chloroplastic; 
AltName: Full=CBS domain-containing protein CBSDUFCH2; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AEE33322.1| CBS and transporter associated domain-containing protein [Arabidopsis 
thaliana]
Length=653

 Score =   337 bits (865),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 198/242 (82%), Gaps = 11/242 (5%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ V D+AHKPA+FVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  412  LLESTTVVDMAHKPAFFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  471

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGI+DVDANTSIDQLS+EL IKM E HQYETVSG
Sbjct  472  IVGEIFDENDSKEEIQKKTGYIVMRAEGIYDVDANTSIDQLSEELNIKMAEGHQYETVSG  531

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIP+TGES+ V+LEK N EE+++    + ++ D+ EK+QIY+LEILAGNARKV
Sbjct  532  FVCEAFGYIPKTGESVTVVLEKENWEENDEQDEGKHERQDQKEKHQIYRLEILAGNARKV  591

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNNEVSFHGKTDNGNCLSNNFVKS  103
            SAVRFER++  D   E + V++  PK + KW+ +++S           +GN  + N V  
Sbjct  592  SAVRFERVSDMDQVSEARDVKNMVPKFVRKWSSEEDS-----------DGNLQAKNAVFD  640

Query  102  EH  97
            EH
Sbjct  641  EH  642



>ref|XP_006306885.1| hypothetical protein CARUB_v10008439mg, partial [Capsella rubella]
 gb|EOA39783.1| hypothetical protein CARUB_v10008439mg, partial [Capsella rubella]
Length=723

 Score =   339 bits (869),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 167/242 (69%), Positives = 199/242 (82%), Gaps = 11/242 (5%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ V D+AHKPA+FVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGI+TLEDVVEE
Sbjct  482  LLESTTVVDMAHKPAFFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIITLEDVVEE  541

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGI+DVDANTSIDQLS+EL IKMPE HQYETVSG
Sbjct  542  IVGEIFDENDSKEEIQKKTGYIVMRAEGIYDVDANTSIDQLSEELNIKMPEGHQYETVSG  601

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIP+TGES+ V+LEK N EE+++    + ++ D+ EK+Q+++LEILAGNARKV
Sbjct  602  FVCEAFGYIPKTGESVTVVLEKENWEENDEQEEGKHERQDQKEKHQVHRLEILAGNARKV  661

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNNEVSFHGKTDNGNCLSNNFVKS  103
            SAVRFER+N  D   E + V++  PK + KW+ +++S           +GN  + N V  
Sbjct  662  SAVRFERVNDMDEVSEARDVKNMVPKFVRKWSSEEDS-----------DGNLQAKNAVFD  710

Query  102  EH  97
            EH
Sbjct  711  EH  712



>gb|AAP04147.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF01462.1| hypothetical protein [Arabidopsis thaliana]
Length=653

 Score =   337 bits (864),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 198/242 (82%), Gaps = 11/242 (5%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ V D+AHKPA+FVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  412  LLESTTVVDMAHKPAFFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  471

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGI+DVDANTSIDQLS+EL IKM E HQYETVSG
Sbjct  472  IVGEIFDENDSKEEIQKKTGYIVMRAEGIYDVDANTSIDQLSEELNIKMAEGHQYETVSG  531

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIP+TGES+ V+LEK N EE+++    + ++ D+ EK+QIY+LEILAGNARKV
Sbjct  532  FVCEAFGYIPKTGESVTVVLEKENWEENDEQDEGKHERQDQKEKHQIYRLEILAGNARKV  591

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNNEVSFHGKTDNGNCLSNNFVKS  103
            SAVRFER++  D   E + V++  PK + KW+ +++S           +GN  + N V  
Sbjct  592  SAVRFERVSDMDQVSEARDVKNMVPKFVRKWSSEEDS-----------DGNLQAKNAVFD  640

Query  102  EH  97
            EH
Sbjct  641  EH  642



>ref|XP_008462970.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic isoform X2 [Cucumis melo]
Length=463

 Score =   330 bits (845),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 168/249 (67%), Positives = 198/249 (80%), Gaps = 22/249 (9%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            +LES+  GD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  224  VLESTTAGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  283

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RA+G++DVDANT+IDQLS++L IKMPE HQYETVSG
Sbjct  284  IVGEIFDENDSKEEIQKKTGYIVMRADGVYDVDANTAIDQLSEDLNIKMPEGHQYETVSG  343

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGES+KV+LEK + EE ++   K     ++ E++ I+ +EILAGNARKV
Sbjct  344  FVCEAFGYIPRTGESVKVVLEKEDDEEESNPENK-----NQKERHLIFNIEILAGNARKV  398

Query  282  SAVRFERINHDDAELETKGVRHWAPKII-AKWNKQDESNNEVSFHGKTDNGNCLSNNFV-  109
            SAVRFER+N D+ E     V H  PK++  KW+  DES       G  +N N LS+  V 
Sbjct  399  SAVRFERVNDDNGE-----VAHLVPKVMKKKWSSNDES-------GSVENDNLLSSEGVD  446

Query  108  ---KSEHKN  91
                 EH+N
Sbjct  447  ESLSREHQN  455



>gb|KJB13843.1| hypothetical protein B456_002G097000 [Gossypium raimondii]
Length=666

 Score =   335 bits (860),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 177/255 (69%), Positives = 210/255 (82%), Gaps = 8/255 (3%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            +LES+ VGD+AHKPAYFVPDSM VWNLLREFRIRKVHMAVVLNEYGGT+G+VTLEDVVEE
Sbjct  413  VLESTTVGDMAHKPAYFVPDSMLVWNLLREFRIRKVHMAVVLNEYGGTVGLVTLEDVVEE  472

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDS EEIQKKTGYIV+RA+GIFDVDANTSIDQLS++L IKMPE+HQYETVSG
Sbjct  473  IVGEIFDENDSNEEIQKKTGYIVMRADGIFDVDANTSIDQLSEDLNIKMPEEHQYETVSG  532

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGESIKV+LEK N+EE ++ +   SDQ D  E++QIYKLEILAGNARKV
Sbjct  533  FVCEAFGYIPRTGESIKVVLEKGNEEEDDENAEAGSDQQDMKERHQIYKLEILAGNARKV  592

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIA-KWNKQDESN----NEVSFHGKTDNGNCLSN  118
            SAVRFERIN ++A L+   V     KII  KW+  ++SN    NE +F  + +    +S+
Sbjct  593  SAVRFERIN-EEALLDDTAVTPMISKIIKRKWSSDEDSNNGNYNEDTFEKRQEED--ISD  649

Query  117  NFVKSEHKNSHDLHN  73
            ++V +++K   D  N
Sbjct  650  HYVIADYKEDKDSPN  664



>ref|XP_009354561.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like 
[Pyrus x bretschneideri]
Length=665

 Score =   335 bits (859),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 177/252 (70%), Positives = 204/252 (81%), Gaps = 15/252 (6%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+A KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  419  LLESTTVGDMAQKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  478

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGY+V+RAEGIFDVDANTSIDQLS++L +KMPE HQYETVSG
Sbjct  479  IVGEIFDENDSKEEIQKKTGYVVMRAEGIFDVDANTSIDQLSEDLNVKMPEGHQYETVSG  538

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            F+CEAFGYIPRTGESIKV+LE  N+EE ++    +S+  DK EK+QI+KLEILAGNARKV
Sbjct  539  FICEAFGYIPRTGESIKVVLENENEEEIDE---SKSENQDKKEKHQIFKLEILAGNARKV  595

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIA-KWNKQDESN----NEVSFHGKTDNGNCLSN  118
             AVRFERI +D A LETK V    PKI+  KWN   +S+    +E SF  +         
Sbjct  596  GAVRFERIENDPATLETKEVTRLVPKIMKRKWNGDRDSDGTDYDEDSFQKR-------PQ  648

Query  117  NFVKSEHKNSHD  82
            N +  EH+++ D
Sbjct  649  NTISDEHEDTVD  660



>gb|KHG26659.1| Putative DUF21 domain-containing, chloroplastic -like protein 
[Gossypium arboreum]
Length=329

 Score =   324 bits (831),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 172/248 (69%), Positives = 203/248 (82%), Gaps = 9/248 (4%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES  VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  75   LLESITVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  134

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGIFDVDANTSI QLS++L IK+PE+HQYETVSG
Sbjct  135  IVGEIFDENDSKEEIQKKTGYIVMRAEGIFDVDANTSIYQLSEDLNIKLPEEHQYETVSG  194

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGESIKV+L K ++E+  D S   SD  D  E++QIYKL+ILAGNARKV
Sbjct  195  FVCEAFGYIPRTGESIKVVLGKEDEEDDED-SEAGSDHHDSKERHQIYKLKILAGNARKV  253

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNN------EVSFHGKTDNGNCLS  121
            SAVRFE IN+++  L+T  V    PKI+ +    DE +N      E +F  + ++   LS
Sbjct  254  SAVRFECINNEEFLLDTMEVTPKVPKIMKRKRSNDEDSNNGNNGEEDAFGKRQEDD--LS  311

Query  120  NNFVKSEH  97
            ++++ ++H
Sbjct  312  DHYITADH  319



>ref|XP_007142387.1| hypothetical protein PHAVU_008G276000g [Phaseolus vulgaris]
 gb|ESW14381.1| hypothetical protein PHAVU_008G276000g [Phaseolus vulgaris]
Length=664

 Score =   335 bits (859),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 168/212 (79%), Positives = 189/212 (89%), Gaps = 6/212 (3%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ V D+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  419  LLESTTVVDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  478

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGY+V+RAEGIFDVDANTSIDQLS++L IKMPE HQYETVSG
Sbjct  479  IVGEIFDENDSKEEIQKKTGYVVMRAEGIFDVDANTSIDQLSEDLNIKMPEGHQYETVSG  538

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVC AFGYIPRTGE IKV+LE+ +++++N+ S ++ DQ    EKNQI+KLEILAGNARKV
Sbjct  539  FVCAAFGYIPRTGEFIKVVLEREDEDDNNEASAEQQDQ---KEKNQIFKLEILAGNARKV  595

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIA-KW  190
            SAVRFERIN+D+  LETK V    PKI+  KW
Sbjct  596  SAVRFERINNDEM-LETK-VTRMVPKIMKRKW  625



>ref|XP_011651999.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic isoform X2 [Cucumis sativus]
Length=463

 Score =   328 bits (841),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/249 (67%), Positives = 199/249 (80%), Gaps = 22/249 (9%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            +L+S+  GD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  224  VLDSTTAGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  283

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RA+G++DVDANT+IDQLS++L IKMPE HQYETVSG
Sbjct  284  IVGEIFDENDSKEEIQKKTGYIVMRADGVYDVDANTAIDQLSEDLNIKMPEGHQYETVSG  343

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGES+KV+LEK + EE ++   K     ++ E++ I+ +EILAGNARKV
Sbjct  344  FVCEAFGYIPRTGESVKVVLEKEDDEEESNPENK-----NQKERHLIFNIEILAGNARKV  398

Query  282  SAVRFERINHDDAELETKGVRHWAPKII-AKWNKQDESNNEVSFHGKTDNGNCLS----N  118
            SAVRFER+N D+ E     V H  PK++  KW+  DES       G  +N N LS    +
Sbjct  399  SAVRFERVNDDNGE-----VAHLVPKVMKKKWSSNDES-------GSVENDNLLSSEGVD  446

Query  117  NFVKSEHKN  91
            + +  EH+N
Sbjct  447  DSLSREHQN  455



>gb|KHG25207.1| DUF21 domain-containing, chloroplastic -like protein [Gossypium 
arboreum]
Length=245

 Score =   319 bits (818),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 171/246 (70%), Positives = 200/246 (81%), Gaps = 8/246 (3%)
 Frame = -2

Query  795  IAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDEN  616
            +AHKPAYFVPDSM VWNLLREFRIRKVHMAVVLNEYGGT+G+VTLEDVVEEIVGEIFDEN
Sbjct  1    MAHKPAYFVPDSMLVWNLLREFRIRKVHMAVVLNEYGGTVGLVTLEDVVEEIVGEIFDEN  60

Query  615  DSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYI  436
            DS EEIQKKTGYIV+RAEGIFDVDANTSIDQLS++L IKMPE+HQYETVSGFVCEAFGYI
Sbjct  61   DSNEEIQKKTGYIVMRAEGIFDVDANTSIDQLSEDLNIKMPEEHQYETVSGFVCEAFGYI  120

Query  435  PRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKVSAVRFERIN  256
            PRTGE IKV+LEK N+EE ++ +   SDQ D  E +QIYKLEILAGNARKVSAVRFERIN
Sbjct  121  PRTGERIKVVLEKGNEEEDDENAEAGSDQQDMKESHQIYKLEILAGNARKVSAVRFERIN  180

Query  255  HDDAELETKGVRHWAPKIIA-KWNKQDESN----NEVSFHGKTDNGNCLSNNFVKSEHKN  91
             ++A L+   V     KII  KW+  ++SN    NE +F  + +    +S+++V +++K 
Sbjct  181  -EEALLDDTAVTPMISKIIKRKWSTDEDSNNGNYNEDTFEKRQEED--ISDHYVIADYKE  237

Query  90   SHDLHN  73
              D  N
Sbjct  238  DKDSPN  243



>ref|XP_008366421.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like 
[Malus domestica]
Length=665

 Score =   332 bits (852),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 176/252 (70%), Positives = 201/252 (80%), Gaps = 15/252 (6%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+A KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  419  LLESTTVGDMAQKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  478

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGY+V+RAEGIFDVDANTSIDQLS++L +KMPE HQYETVSG
Sbjct  479  IVGEIFDENDSKEEIQKKTGYVVMRAEGIFDVDANTSIDQLSEDLNVKMPEGHQYETVSG  538

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            F+CEAFGYIPRTGESIKV+LE  N+EE  +   +     DK EK+QI+KLEILAGNARKV
Sbjct  539  FICEAFGYIPRTGESIKVVLENENEEEIEESKSENQ---DKKEKHQIFKLEILAGNARKV  595

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIA-KWNKQDESN----NEVSFHGKTDNGNCLSN  118
             AVRFERI +D A LETK V    PKI+  KWN   +S+    +E SF  +         
Sbjct  596  GAVRFERIENDPATLETKEVTRLVPKIMKRKWNGDQDSDGTDYDEDSFQKR-------PQ  648

Query  117  NFVKSEHKNSHD  82
            N +  EH+++ D
Sbjct  649  NTISDEHEDTVD  660



>ref|XP_003617721.1| Magnesium and cobalt efflux protein corC [Medicago truncatula]
 gb|AET00680.1| CBS domain protein/transporter associated domain protein [Medicago 
truncatula]
Length=821

 Score =   336 bits (862),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 175/251 (70%), Positives = 203/251 (81%), Gaps = 8/251 (3%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            LES  VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+G+VTLEDVVEEI
Sbjct  425  LESITVGDLAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGLVTLEDVVEEI  484

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEIFDENDSKEEIQKKTGYIV+RAEG+FDVDANTSIDQLS++L IKMPE HQYETVSGF
Sbjct  485  VGEIFDENDSKEEIQKKTGYIVMRAEGVFDVDANTSIDQLSEDLNIKMPEGHQYETVSGF  544

Query  459  VCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKVS  280
            VCEAFGYIPRTGESIK++LE+ ++++ +D +G   D  +  EK  I+KLEILAGNARKVS
Sbjct  545  VCEAFGYIPRTGESIKLVLERDDEDDDDDTNG---DHQEPKEKKHIFKLEILAGNARKVS  601

Query  279  AVRFERINHDDAELETKGVRHWAPKIIA-KWNKQDESNNEVSFHGKTDNGNC---LSNNF  112
            AVRFER++  D  LE K V    PKI+  KWN  +ES N+  + G T        +SN +
Sbjct  602  AVRFERLHSGDEMLEAKEVTRMFPKIVKRKWNSGEESENDAEYDGYTFPKRPHEDISNEY  661

Query  111  VKSEHKNSHDL  79
            V  + +NSH L
Sbjct  662  V-VDQENSHRL  671



>gb|AAF79321.1|AC002304_14 F14J16.20 [Arabidopsis thaliana]
Length=930

 Score =   338 bits (868),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 198/242 (82%), Gaps = 11/242 (5%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ V D+AHKPA+FVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  689  LLESTTVVDMAHKPAFFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  748

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGI+DVDANTSIDQLS+EL IKM E HQYETVSG
Sbjct  749  IVGEIFDENDSKEEIQKKTGYIVMRAEGIYDVDANTSIDQLSEELNIKMAEGHQYETVSG  808

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIP+TGES+ V+LEK N EE+++    + ++ D+ EK+QIY+LEILAGNARKV
Sbjct  809  FVCEAFGYIPKTGESVTVVLEKENWEENDEQDEGKHERQDQKEKHQIYRLEILAGNARKV  868

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNNEVSFHGKTDNGNCLSNNFVKS  103
            SAVRFER++  D   E + V++  PK + KW+ +++S           +GN  + N V  
Sbjct  869  SAVRFERVSDMDQVSEARDVKNMVPKFVRKWSSEEDS-----------DGNLQAKNAVFD  917

Query  102  EH  97
            EH
Sbjct  918  EH  919



>ref|XP_010552379.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic [Tarenaya hassleriana]
Length=668

 Score =   332 bits (851),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 170/235 (72%), Positives = 189/235 (80%), Gaps = 5/235 (2%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIG+VTLEDVVEE
Sbjct  420  LLESTSVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGLVTLEDVVEE  479

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEG +DVDANTSIDQLS+EL IKMPE HQYETVSG
Sbjct  480  IVGEIFDENDSKEEIQKKTGYIVMRAEGTYDVDANTSIDQLSEELSIKMPEGHQYETVSG  539

Query  462  FVCEAFGYIPRTGESIKVIL-EKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARK  286
            FVCEAFGYIPRTGES+ V+L ++  +EE      K   Q D  EK+ IYKLEILAGNARK
Sbjct  540  FVCEAFGYIPRTGESVTVVLEKEQREEEDEQDESKPERQQDPKEKHLIYKLEILAGNARK  599

Query  285  VSAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNN----EVSFHGKTDNG  133
            VSAVRFERI+  D   E + VR   PK + KW+  +ES +      S H   +NG
Sbjct  600  VSAVRFERISDIDEAAEARDVRSMVPKFVRKWSSDEESADADAPSSSVHENVENG  654



>ref|XP_010097266.1| DUF21 domain-containing protein [Morus notabilis]
 gb|EXB67418.1| DUF21 domain-containing protein [Morus notabilis]
Length=659

 Score =   332 bits (850),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 175/252 (69%), Positives = 209/252 (83%), Gaps = 14/252 (6%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIG+VTLEDVVEE
Sbjct  412  LLESTSVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGLVTLEDVVEE  471

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEG+FDVDANTSIDQLS++L +KMPE HQYETVSG
Sbjct  472  IVGEIFDENDSKEEIQKKTGYIVMRAEGVFDVDANTSIDQLSEDLNVKMPEGHQYETVSG  531

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            F+CEAFGYIPRTGE+IKV+LEK N+EE +     +SD  D+ EK+QI+KLEILAGNARKV
Sbjct  532  FICEAFGYIPRTGETIKVVLEKENEEEED--EESKSDHQDQKEKHQIFKLEILAGNARKV  589

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIA-KWNKQDESN----NEVSFHGKTDNGNCLSN  118
            SA+RFER+++ +A LETK +  + PKI+  KWN  ++S     +E SF  +  N      
Sbjct  590  SAIRFERLDNGEAALETKEMTRFVPKIMKRKWNSDEDSESTECDEDSFQKRPQNS-----  644

Query  117  NFVKSEHKNSHD  82
              +  EH++++D
Sbjct  645  --LLDEHEDNYD  654



>ref|XP_002884940.1| CBS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61199.1| CBS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=660

 Score =   331 bits (849),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 163/219 (74%), Positives = 187/219 (85%), Gaps = 0/219 (0%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  417  LLESTSVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  476

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+R EGI+DVDANTSIDQLS+EL +KMPE  QYETVSG
Sbjct  477  IVGEIFDENDSKEEIQKKTGYIVMRDEGIYDVDANTSIDQLSEELNMKMPEGIQYETVSG  536

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIP+TGES+KV+LEK + EE  D    + ++ +  EKNQIY++EILAGNARKV
Sbjct  537  FVCEAFGYIPKTGESVKVVLEKESWEEDGDEEEGKQERQEPKEKNQIYRVEILAGNARKV  596

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNN  166
            SAVRFER+N  D   E + V+   PK + KW+ +++  N
Sbjct  597  SAVRFERVNDMDQVSEARDVKSMVPKFVRKWSSEEDDGN  635



>ref|XP_010499942.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic [Camelina sativa]
Length=660

 Score =   330 bits (846),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/219 (74%), Positives = 188/219 (86%), Gaps = 0/219 (0%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  417  LLESTSVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  476

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+R EGI+DVDANTSIDQLS+EL +KMPE  QYETVSG
Sbjct  477  IVGEIFDENDSKEEIQKKTGYIVMRDEGIYDVDANTSIDQLSEELNMKMPEGIQYETVSG  536

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIP+TGES+KV+LEK + EE N+    + ++ +  EK+QIY++EILAGNARKV
Sbjct  537  FVCEAFGYIPKTGESVKVVLEKESWEEDNEEEEGKQERQETKEKHQIYRVEILAGNARKV  596

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNN  166
            SAVRFER+N  D   E K V+   PK + KW+ +++  N
Sbjct  597  SAVRFERVNDMDQVSEAKDVKSMVPKFVRKWSSEEDDGN  635



>ref|XP_006407264.1| hypothetical protein EUTSA_v10020238mg [Eutrema salsugineum]
 gb|ESQ48717.1| hypothetical protein EUTSA_v10020238mg [Eutrema salsugineum]
Length=660

 Score =   330 bits (846),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/230 (72%), Positives = 194/230 (84%), Gaps = 1/230 (0%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLE + VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  417  LLECTSVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  476

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+R EGI+DVDANTSIDQLS+EL +KMPED QYETVSG
Sbjct  477  IVGEIFDENDSKEEIQKKTGYIVMRDEGIYDVDANTSIDQLSEELNMKMPEDIQYETVSG  536

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIP+TGES+KV+LEK N EE  +    + ++ ++ EK+QIY++EILAGNARKV
Sbjct  537  FVCEAFGYIPKTGESVKVVLEKENWEEDGEEEEGKQERQEQKEKHQIYRVEILAGNARKV  596

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNNEVSFHGKTDNG  133
            SAVRFER+N  D   E K V+   PK + KW+ +++  N  S+  K+++ 
Sbjct  597  SAVRFERVNDMDQVSEAKDVKSMVPKFVRKWSSEEDDGNS-SYQEKSEHA  645



>ref|XP_010465109.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic [Camelina sativa]
Length=660

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/219 (74%), Positives = 188/219 (86%), Gaps = 0/219 (0%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  417  LLESTSVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  476

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+R EGI+DVDANTSIDQLS+EL +KMPE  QYETVSG
Sbjct  477  IVGEIFDENDSKEEIQKKTGYIVMRDEGIYDVDANTSIDQLSEELNMKMPEGIQYETVSG  536

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIP+TGES+KV+LEK + EE N+    + ++ +  EK+QIY++EILAGNARKV
Sbjct  537  FVCEAFGYIPKTGESVKVVLEKESWEEDNEEEEGKQERQEPKEKHQIYRVEILAGNARKV  596

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNN  166
            SAVRFER+N  D   E K V+   PK + KW+ +++  N
Sbjct  597  SAVRFERVNDMDQVSEAKDVKSMVPKFVRKWSSEEDDGN  635



>ref|XP_010675896.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=676

 Score =   329 bits (844),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 191/216 (88%), Gaps = 0/216 (0%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLESS VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMA+VLNEYGGT+G+VTLEDVVEE
Sbjct  416  LLESSTVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAIVLNEYGGTVGLVTLEDVVEE  475

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEI+DENDSKEEIQKKTGYIV+RA+GI+DVDANT+IDQLS+EL IKMPE HQYETVSG
Sbjct  476  IVGEIYDENDSKEEIQKKTGYIVMRADGIYDVDANTTIDQLSEELSIKMPEGHQYETVSG  535

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGES+KV+LE+ N+EE + Y  +ES++ +  EK+QI+K+EILAG+ARKV
Sbjct  536  FVCEAFGYIPRTGESMKVVLERDNEEEEDKYKEEESERQENKEKSQIFKVEILAGDARKV  595

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDE  175
            SAVRFE++ HDD  L   GV    PKI+ +   +DE
Sbjct  596  SAVRFEKVEHDDTVLGANGVAPSFPKIMKRNRPRDE  631



>ref|NP_187914.1| CBS domain and transporter associated domain-containing protein 
[Arabidopsis thaliana]
 sp|Q9LK65.1|Y3307_ARATH RecName: Full=Putative DUF21 domain-containing protein At3g13070, 
chloroplastic; AltName: Full=CBS domain-containing protein 
CBSDUFCH1; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01398.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE75290.1| CBS domain and transporter associated domain-containing protein 
[Arabidopsis thaliana]
Length=661

 Score =   329 bits (843),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 162/219 (74%), Positives = 186/219 (85%), Gaps = 0/219 (0%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  417  LLESTSVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  476

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+R EGI+DVDANTSIDQLS+EL +KMPE  QYETVSG
Sbjct  477  IVGEIFDENDSKEEIQKKTGYIVMRDEGIYDVDANTSIDQLSEELNMKMPEGIQYETVSG  536

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIP+TGES+KV+LEK + EE  +    + ++ +  EKNQIY++EILAGNARKV
Sbjct  537  FVCEAFGYIPKTGESVKVVLEKESWEEDGEEEEGKQERQEPKEKNQIYRVEILAGNARKV  596

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNN  166
            SAVRFER+N  D   E   V+   PK + KW+ +++  N
Sbjct  597  SAVRFERVNDMDQVSEASDVKSMVPKFVRKWSSEEDDGN  635



>ref|XP_008462967.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic 
isoform X1 [Cucumis melo]
 ref|XP_008462969.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic 
isoform X1 [Cucumis melo]
Length=655

 Score =   328 bits (842),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 168/249 (67%), Positives = 198/249 (80%), Gaps = 22/249 (9%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            +LES+  GD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  416  VLESTTAGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  475

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RA+G++DVDANT+IDQLS++L IKMPE HQYETVSG
Sbjct  476  IVGEIFDENDSKEEIQKKTGYIVMRADGVYDVDANTAIDQLSEDLNIKMPEGHQYETVSG  535

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGES+KV+LEK + EE ++   K     ++ E++ I+ +EILAGNARKV
Sbjct  536  FVCEAFGYIPRTGESVKVVLEKEDDEEESNPENK-----NQKERHLIFNIEILAGNARKV  590

Query  282  SAVRFERINHDDAELETKGVRHWAPKII-AKWNKQDESNNEVSFHGKTDNGNCLSNNFV-  109
            SAVRFER+N D+ E     V H  PK++  KW+  DES       G  +N N LS+  V 
Sbjct  591  SAVRFERVNDDNGE-----VAHLVPKVMKKKWSSNDES-------GSVENDNLLSSEGVD  638

Query  108  ---KSEHKN  91
                 EH+N
Sbjct  639  ESLSREHQN  647



>ref|XP_004150468.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic 
isoform X1 [Cucumis sativus]
 ref|XP_011651998.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic 
isoform X1 [Cucumis sativus]
Length=655

 Score =   327 bits (839),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 167/249 (67%), Positives = 198/249 (80%), Gaps = 22/249 (9%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            +L+S+  GD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  416  VLDSTTAGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  475

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RA+G++DVDANT+IDQLS++L IKMPE HQYETVSG
Sbjct  476  IVGEIFDENDSKEEIQKKTGYIVMRADGVYDVDANTAIDQLSEDLNIKMPEGHQYETVSG  535

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGES+KV+LEK + EE ++   K     ++ E++ I+ +EILAGNARKV
Sbjct  536  FVCEAFGYIPRTGESVKVVLEKEDDEEESNPENK-----NQKERHLIFNIEILAGNARKV  590

Query  282  SAVRFERINHDDAELETKGVRHWAPKII-AKWNKQDESNNEVSFHGKTDNGNCLSNNFV-  109
            SAVRFER+N D+ E     V H  PK++  KW+  DES       G  +N N LS+  V 
Sbjct  591  SAVRFERVNDDNGE-----VAHLVPKVMKKKWSSNDES-------GSVENDNLLSSEGVD  638

Query  108  ---KSEHKN  91
                 EH+N
Sbjct  639  DSLSREHQN  647



>ref|XP_010487053.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic [Camelina sativa]
Length=660

 Score =   327 bits (838),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/219 (74%), Positives = 187/219 (85%), Gaps = 0/219 (0%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  417  LLESTSVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  476

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+R EGI+DVDANTSIDQLS+EL +KMPE  QYETVSG
Sbjct  477  IVGEIFDENDSKEEIQKKTGYIVMRDEGIYDVDANTSIDQLSEELNMKMPEGIQYETVSG  536

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIP+TGES+KV+LEK + EE  +    + ++ +  EK+QIY++EILAGNARKV
Sbjct  537  FVCEAFGYIPKTGESVKVVLEKESWEEDGEEEEGKQERQEPKEKHQIYRVEILAGNARKV  596

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNN  166
            SAVRFER+N  D   E K V+   PK + KW+ +++  N
Sbjct  597  SAVRFERVNDMDQVSEAKDVKSMVPKFVRKWSSEEDDGN  635



>ref|XP_009346765.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like 
[Pyrus x bretschneideri]
Length=665

 Score =   327 bits (839),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 173/252 (69%), Positives = 202/252 (80%), Gaps = 15/252 (6%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+A KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  419  LLESTSVGDMAQKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  478

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RA+GI+DVDANTSIDQLS++L +KMPE HQYETVSG
Sbjct  479  IVGEIFDENDSKEEIQKKTGYIVMRAKGIYDVDANTSIDQLSEDLNVKMPEGHQYETVSG  538

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            F+CEAFGYIPRTGESIK++LE  N EE ++    +SD  DK EK+QI+K+EILAGNARKV
Sbjct  539  FICEAFGYIPRTGESIKIVLENENDEEIDE---TKSDNQDKKEKHQIFKIEILAGNARKV  595

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIA-KWNKQDESN----NEVSFHGKTDNGNCLSN  118
             AVRFERI +D A LET  V    PKI+  KW+   +S+    +E SF  +         
Sbjct  596  GAVRFERIENDAATLETDEVTRLVPKIMKRKWSGDQDSDGTDYDEDSFQKR-------PQ  648

Query  117  NFVKSEHKNSHD  82
            N +  EH+++ D
Sbjct  649  NTISDEHEDAVD  660



>emb|CDY51900.1| BnaC03g73630D [Brassica napus]
Length=665

 Score =   327 bits (838),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 167/235 (71%), Positives = 196/235 (83%), Gaps = 4/235 (2%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  410  LLESTSVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  469

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+R EG++DVDANTSIDQLS+EL +KMPE  QYETVSG
Sbjct  470  IVGEIFDENDSKEEIQKKTGYIVMRDEGVYDVDANTSIDQLSEELNMKMPEGIQYETVSG  529

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIP+TGES+KV+LEK N EE  +    + ++ ++ EK+QIY++EILAGNARKV
Sbjct  530  FVCEAFGYIPKTGESVKVVLEKENWEEEGEEEEGKQERQEQKEKHQIYRVEILAGNARKV  589

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNN----EVSFHGKTDNGN  130
            SAVRFER+N  D   E K VR   PK + KW+ +++  N    E ++  + D+GN
Sbjct  590  SAVRFERVNDMDQVSEAKDVRSMVPKFVRKWSSEEDDGNSTYQEKTWSSEEDDGN  644



>gb|KFK38642.1| hypothetical protein AALP_AA3G141400 [Arabis alpina]
Length=656

 Score =   327 bits (837),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 187/219 (85%), Gaps = 0/219 (0%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLE + VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  416  LLECTSVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  475

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+R EG++DVDANTSIDQLS+EL +KMPE  QYETVSG
Sbjct  476  IVGEIFDENDSKEEIQKKTGYIVMRDEGVYDVDANTSIDQLSEELNMKMPEGIQYETVSG  535

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIP+TGES+KVILEK N EE  +    + ++ ++ EK+QIY++EILAGNARKV
Sbjct  536  FVCEAFGYIPKTGESVKVILEKENWEEDGEEEEGKQEKREQKEKHQIYRVEILAGNARKV  595

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNN  166
            SAVRFER+N  D   E K ++   PK + KW+ +++  N
Sbjct  596  SAVRFERVNDMDQVSEAKDIKSMVPKFVRKWSSEEDDGN  634



>ref|XP_009135280.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic [Brassica rapa]
Length=665

 Score =   326 bits (836),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 167/235 (71%), Positives = 195/235 (83%), Gaps = 4/235 (2%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  410  LLESTSVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  469

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+R EG++DVDANTSIDQLS+EL +KMPE  QYETVSG
Sbjct  470  IVGEIFDENDSKEEIQKKTGYIVMRDEGVYDVDANTSIDQLSEELNMKMPEGIQYETVSG  529

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIP+TGES+KV+LEK N EE  +    + ++ ++ EK+QIY++EILAGNARKV
Sbjct  530  FVCEAFGYIPKTGESVKVVLEKENWEEEGEEEEGKQERQEQKEKHQIYRVEILAGNARKV  589

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNN----EVSFHGKTDNGN  130
            SAVRFER+N  D   E K VR   PK + KW+ +++  N    E  +  + D+GN
Sbjct  590  SAVRFERVNDMDQVSEAKDVRSMVPKFVRKWSSEEDDGNSSYQEKPWSSEEDDGN  644



>ref|XP_002891867.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68126.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=409

 Score =   318 bits (815),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 160/242 (66%), Positives = 194/242 (80%), Gaps = 14/242 (6%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ V D+AHKPA+FVPDSMSVWN+LREFRIRKVHMAVVLNEYGGTIGI+TLEDVVE+
Sbjct  171  LLESTTVVDMAHKPAFFVPDSMSVWNVLREFRIRKVHMAVVLNEYGGTIGIITLEDVVEQ  230

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGI+DVDANTSIDQLS+EL IKM E   YETVSG
Sbjct  231  IVGEIFDENDSKEEIQKKTGYIVMRAEGIYDVDANTSIDQLSEELNIKMLE---YETVSG  287

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIP+T ES+ V+LEK N EE+++    + +  D+ EK+Q+Y+LEILAGNARKV
Sbjct  288  FVCEAFGYIPKTCESVTVVLEKENWEENDEQDEGKHESQDQKEKHQVYRLEILAGNARKV  347

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNNEVSFHGKTDNGNCLSNNFVKS  103
            S VRFER+N+ D   E + V++  PK + KW+ ++++           +GN  + N V  
Sbjct  348  STVRFERVNNMDEVSEARDVKNMVPKFVRKWSSEEDT-----------DGNLQAKNAVFD  396

Query  102  EH  97
            EH
Sbjct  397  EH  398



>ref|XP_006296606.1| hypothetical protein CARUB_v10013158mg [Capsella rubella]
 gb|EOA29504.1| hypothetical protein CARUB_v10013158mg [Capsella rubella]
Length=661

 Score =   326 bits (835),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 186/219 (85%), Gaps = 0/219 (0%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  417  LLESTSVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  476

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+R EGI+DVDANTSIDQLS+EL +KMPE  QYETVSG
Sbjct  477  IVGEIFDENDSKEEIQKKTGYIVMRDEGIYDVDANTSIDQLSEELNMKMPEGIQYETVSG  536

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIP+TGES+KV+LEK + EE  +    + ++ +  EK+QIY++EILAGNARKV
Sbjct  537  FVCEAFGYIPKTGESVKVVLEKESWEEDGEEEEGKQERQEPKEKHQIYRVEILAGNARKV  596

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNN  166
            SAVRFER+N  D   E   V+   PK + KW+ +++  N
Sbjct  597  SAVRFERVNDMDQVSEATDVKSMVPKFVRKWSSEEDDGN  635



>ref|XP_009146552.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic [Brassica rapa]
Length=661

 Score =   325 bits (833),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 165/231 (71%), Positives = 196/231 (85%), Gaps = 2/231 (1%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  416  LLESTSVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  475

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+R EG++DVDANTSIDQLS+EL IKMPE  QYETVSG
Sbjct  476  IVGEIFDENDSKEEIQKKTGYIVMRDEGVYDVDANTSIDQLSEELNIKMPEGIQYETVSG  535

Query  462  FVCEAFGYIPRTGESIKVIL-EKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARK  286
            FVCEAFGYIP+TGES+KV+L +++ +EE  +  G + ++ ++ EK+QIY++EILAGNARK
Sbjct  536  FVCEAFGYIPKTGESVKVVLEKENWEEEGEEEEGNKQERQEQKEKHQIYRVEILAGNARK  595

Query  285  VSAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNNEVSFHGKTDNG  133
            VSAVRFER+N  D   E K VR   PK + KW+ +++  N  S+  KT++ 
Sbjct  596  VSAVRFERVNDMDQVSEAKDVRSMVPKFVRKWSSEEDDGNS-SYQEKTEDA  645



>emb|CDY23564.1| BnaC05g40300D [Brassica napus]
Length=588

 Score =   323 bits (827),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 166/231 (72%), Positives = 196/231 (85%), Gaps = 2/231 (1%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  343  LLESTSVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  402

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+R EG++DVDANTSIDQLS+EL IKMPE  QYETVSG
Sbjct  403  IVGEIFDENDSKEEIQKKTGYIVMRDEGVYDVDANTSIDQLSEELNIKMPEGIQYETVSG  462

Query  462  FVCEAFGYIPRTGESIKVILEK-SNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARK  286
            FVCEAFGYIP+TGES+KV+LEK + +E+  +  G + ++ ++ EK+QIY++EILAGNARK
Sbjct  463  FVCEAFGYIPKTGESVKVVLEKENWEEDGEEEEGNKQEKQEQKEKHQIYRVEILAGNARK  522

Query  285  VSAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNNEVSFHGKTDNG  133
            VSAVRFER+N  D   E K VR   PK + KW+ +++  N  S+  KT++ 
Sbjct  523  VSAVRFERVNDMDQVSEAKDVRSMVPKFVRKWSSEEDDGNS-SYQEKTEDA  572



>emb|CDX82558.1| BnaA03g32630D [Brassica napus]
Length=652

 Score =   323 bits (829),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 162/216 (75%), Positives = 187/216 (87%), Gaps = 0/216 (0%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  410  LLESTSVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  469

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+R EG++DVDANTSIDQLS+EL +KMPE  QYETVSG
Sbjct  470  IVGEIFDENDSKEEIQKKTGYIVMRDEGVYDVDANTSIDQLSEELNMKMPEGIQYETVSG  529

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIP+TGES+KV+LEK N EE  +    + ++ ++ EK+QIY++EILAGNARKV
Sbjct  530  FVCEAFGYIPKTGESVKVVLEKENWEEEGEEEEGKQERQEQKEKHQIYRVEILAGNARKV  589

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDE  175
            SAVRFER+N  D   E K VR   PK + KW+ +++
Sbjct  590  SAVRFERVNDMDQVSEAKDVRSMVPKFVRKWSSEED  625



>emb|CDY44023.1| BnaA05g26180D [Brassica napus]
Length=661

 Score =   323 bits (827),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 166/231 (72%), Positives = 196/231 (85%), Gaps = 2/231 (1%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE
Sbjct  416  LLESTSVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  475

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+R EG++DVDANTSIDQLS+EL IKMPE  QYETVSG
Sbjct  476  IVGEIFDENDSKEEIQKKTGYIVMRDEGVYDVDANTSIDQLSEELNIKMPEGIQYETVSG  535

Query  462  FVCEAFGYIPRTGESIKVILEK-SNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARK  286
            FVCEAFGYIP+TGES+KV+LEK + +E+  +  G + ++ ++ EK+QIY++EILAGNARK
Sbjct  536  FVCEAFGYIPKTGESVKVVLEKENWEEDGEEEEGNKQEKQEQKEKHQIYRVEILAGNARK  595

Query  285  VSAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNNEVSFHGKTDNG  133
            VSAVRFER+N  D   E K VR   PK + KW+ +++  N  S+  KT++ 
Sbjct  596  VSAVRFERVNDMDQVSEAKDVRSMVPKFVRKWSSEEDDGNS-SYQEKTEDA  645



>ref|XP_008244537.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic [Prunus mume]
Length=493

 Score =   317 bits (813),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 169/237 (71%), Positives = 194/237 (82%), Gaps = 8/237 (3%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+A KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  241  LLESTTVGDMAQKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  300

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGIFDVDANTSIDQLS++L +KMPE HQYETVSG
Sbjct  301  IVGEIFDENDSKEEIQKKTGYIVMRAEGIFDVDANTSIDQLSEDLNVKMPEGHQYETVSG  360

Query  462  FVCEAFGYIPRTGESIKVIL---EKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNA  292
            F+CEAFGYIPRTGESIKV+L    +   +E    +  + D+ DK EK+QI+K+EILAGNA
Sbjct  361  FICEAFGYIPRTGESIKVVLEKEIEEEIDESKSDNQDKKDKKDKKEKHQIFKVEILAGNA  420

Query  291  RKVSAVRFERINHDDAELETKGVRHWAPKIIA-KWNKQDESN----NEVSFHGKTDN  136
            RKV +VRFERI +D A +ETK V    PKI+  KW+   +S+    +E SF  K  N
Sbjct  421  RKVGSVRFERIENDAATVETKEVTRLVPKIMKRKWSNDHDSDGTEYDEDSFQKKPQN  477



>ref|XP_004491487.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic-like [Cicer arietinum]
Length=668

 Score =   322 bits (824),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 173/251 (69%), Positives = 204/251 (81%), Gaps = 10/251 (4%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            LES+ VGD+AHKPA+FVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIG+VTLEDVVEEI
Sbjct  419  LESTTVGDMAHKPAFFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGLVTLEDVVEEI  478

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEIFDENDSKEEIQKKTGYIV+RAEG+FDVDANTSIDQLS++L IKMPE HQYETVSGF
Sbjct  479  VGEIFDENDSKEEIQKKTGYIVMRAEGVFDVDANTSIDQLSEDLNIKMPEGHQYETVSGF  538

Query  459  VCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKVS  280
            VCEAFGYIPRTGESIK+++E+ ++++ ND      D  +  EK  I+KLEILAGNARKVS
Sbjct  539  VCEAFGYIPRTGESIKIVVERDDEDDDND---TNGDHQEPKEKKHIFKLEILAGNARKVS  595

Query  279  AVRFERINHD-DAE-LETKGVRHWAPKIIA-KWNKQDESNNEVSFHGKTDNGNC---LSN  118
            AVRFER+N+  +AE LETK V    PKI+  KWN  ++S ++  + G          +SN
Sbjct  596  AVRFERLNNGAEAEVLETKEVTRMFPKIVKRKWNNGEDSEDDGEYDGYAFGKRPQEDISN  655

Query  117  NFVKSEHKNSH  85
             +V  + +NSH
Sbjct  656  EYV-VDQENSH  665



>ref|XP_010063281.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic 
[Eucalyptus grandis]
 gb|KCW70491.1| hypothetical protein EUGRSUZ_F03700 [Eucalyptus grandis]
Length=670

 Score =   319 bits (818),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 165/216 (76%), Positives = 185/216 (86%), Gaps = 7/216 (3%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLESS VG++AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  417  LLESSTVGEMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  476

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEG++DVDANTSIDQLS++L IKMPE HQYETVSG
Sbjct  477  IVGEIFDENDSKEEIQKKTGYIVMRAEGVYDVDANTSIDQLSEDLNIKMPEGHQYETVSG  536

Query  462  FVCEAFGYIPRTGESIKVIL---EKSNQEEHNDYSGKESDQGDK--NEKNQIYKLEILAG  298
            FVCEAFGYIPRTGE+IKVIL    +  ++E+ +      DQ D+   EK+Q +KLEIL G
Sbjct  537  FVCEAFGYIPRTGETIKVILEKENREEEDEYMEDESDRKDQKDQKEKEKHQFFKLEILEG  596

Query  297  NARKVSAVRFERINHDD-AELETKGVRHWAPKIIAK  193
            NARKVSAVRF+RIN DD A LETK V    PKI+ +
Sbjct  597  NARKVSAVRFDRINSDDAAALETK-VTRLVPKIMKR  631



>ref|XP_007213594.1| hypothetical protein PRUPE_ppa002455mg [Prunus persica]
 gb|EMJ14793.1| hypothetical protein PRUPE_ppa002455mg [Prunus persica]
Length=671

 Score =   318 bits (816),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 169/237 (71%), Positives = 193/237 (81%), Gaps = 8/237 (3%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+A KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  419  LLESTTVGDMAQKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  478

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEGIFDVDANTSIDQLS++L +KMPE HQYETVSG
Sbjct  479  IVGEIFDENDSKEEIQKKTGYIVMRAEGIFDVDANTSIDQLSEDLNVKMPEGHQYETVSG  538

Query  462  FVCEAFGYIPRTGESIKVIL---EKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNA  292
            F+CEAFGYIPRTGESIKV+L    +   +E    +  + D+ DK EK+QI+K+EILAGNA
Sbjct  539  FICEAFGYIPRTGESIKVVLEKEIEEEIDESKSDNQDKKDKKDKKEKHQIFKIEILAGNA  598

Query  291  RKVSAVRFERINHDDAELETKGVRHWAPKIIA-KWNKQDESNNEV----SFHGKTDN  136
            RKV +VRFERI +D A +ETK V    PKI+  KW+   +S+  V    SF  K  N
Sbjct  599  RKVGSVRFERIENDAATVETKEVTRLVPKIMKRKWSTDHDSDGTVYDEDSFQKKPQN  655



>ref|XP_004294465.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=665

 Score =   316 bits (809),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 170/249 (68%), Positives = 201/249 (81%), Gaps = 12/249 (5%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+A KP YFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GI+TLEDVVEE
Sbjct  419  LLESTTVGDMAQKPGYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIITLEDVVEE  478

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGYIV+RAEG+FDVDANTSIDQLS++L +KMPE HQYETVSG
Sbjct  479  IVGEIFDENDSKEEIQKKTGYIVMRAEGVFDVDANTSIDQLSEDLNVKMPEGHQYETVSG  538

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            F+CEAFGYIPRTGESIKV+LEK  +EE+++    +S++ +K EK+QI+KLEILAGNARKV
Sbjct  539  FICEAFGYIPRTGESIKVVLEKEIEEENDE---SKSEKQEKKEKHQIFKLEILAGNARKV  595

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNNEVSFHGKTDNGNCLSNNFVKS  103
             AVRFER+ +D A LETK V    PKI+    ++  S ++      +D G    ++F K 
Sbjct  596  GAVRFERLENDTATLETKEVARLVPKIM---KRKSSSGHD------SDGGESDEDSFQKR  646

Query  102  EHKNSHDLH  76
             H    D H
Sbjct  647  PHLEIPDEH  655



>gb|KCW70490.1| hypothetical protein EUGRSUZ_F03700 [Eucalyptus grandis]
Length=670

 Score =   315 bits (808),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 163/216 (75%), Positives = 184/216 (85%), Gaps = 7/216 (3%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLESS VG++AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  417  LLESSTVGEMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  476

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSK +IQKKTGYIV+RAEG++DVDANTSIDQLS++L IKMPE HQYETVSG
Sbjct  477  IVGEIFDENDSKVKIQKKTGYIVMRAEGVYDVDANTSIDQLSEDLNIKMPEGHQYETVSG  536

Query  462  FVCEAFGYIPRTGESIKVIL---EKSNQEEHNDYSGKESDQGDK--NEKNQIYKLEILAG  298
            FVCEAFGYIPRTGE+IKVIL    +  ++E+ +      DQ D+   EK+Q +KLEIL G
Sbjct  537  FVCEAFGYIPRTGETIKVILEKENREEEDEYMEDESDRKDQKDQKEKEKHQFFKLEILEG  596

Query  297  NARKVSAVRFERINHDD-AELETKGVRHWAPKIIAK  193
            NARKVSAVRF+RIN DD A LETK V    PKI+ +
Sbjct  597  NARKVSAVRFDRINSDDAAALETK-VTRLVPKIMKR  631



>ref|XP_007020577.1| CBS domain-containing protein / transporter associated domain-containing 
protein isoform 3 [Theobroma cacao]
 gb|EOY12102.1| CBS domain-containing protein / transporter associated domain-containing 
protein isoform 3 [Theobroma cacao]
Length=655

 Score =   303 bits (776),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/220 (69%), Positives = 176/220 (80%), Gaps = 23/220 (10%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+G          
Sbjct  409  LLESTTVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVG----------  458

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
                        EEIQKKTGYIV+RAEGIFDVDANTSIDQLS++L IKMPE+HQYETVSG
Sbjct  459  ------------EEIQKKTGYIVMRAEGIFDVDANTSIDQLSEDLNIKMPEEHQYETVSG  506

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGESIKV+LEK NQEE ++ S   SD+ D  +++QIYKLEILAGNARKV
Sbjct  507  FVCEAFGYIPRTGESIKVVLEKENQEEDDENSEAGSDRQDLKDRHQIYKLEILAGNARKV  566

Query  282  SAVRFERINHDDAELETKGVRHWAPKII-AKWNKQDESNN  166
            SAVRFERIN+++A L+   V    PK++  KW+ +++SNN
Sbjct  567  SAVRFERINNEEALLDATAVTPMIPKLMKKKWSSEEDSNN  606



>ref|XP_008780985.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic [Phoenix dactylifera]
Length=699

 Score =   304 bits (779),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 154/249 (62%), Positives = 189/249 (76%), Gaps = 2/249 (1%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+   V +IAH P YFVPDSMSVWNLLREFRIR+VHMAVVLNEYGGTIGIVTLEDVVEEI
Sbjct  423  LKEITVREIAHVPTYFVPDSMSVWNLLREFRIRQVHMAVVLNEYGGTIGIVTLEDVVEEI  482

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEIFDENDSKEEI KKTGYIV+R +G FDVDANTSIDQLS+EL +K+PE HQYETVSGF
Sbjct  483  VGEIFDENDSKEEITKKTGYIVMREDGTFDVDANTSIDQLSEELNVKIPEGHQYETVSGF  542

Query  459  VCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKVS  280
            VCE+FGYIP  G +  V+LEK+N+EE+++YS   SD  ++ EK+Q ++LEIL  NARKV 
Sbjct  543  VCESFGYIPEEGRNTVVVLEKANKEENSEYSDTTSDHQNEKEKHQTFELEILEANARKVG  602

Query  279  AVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNNEVSFHG--KTDNGNCLSNNFVK  106
             VRF+ +N +  ++E +G     P  + K   Q+ S  E+S HG  +TD  N L     +
Sbjct  603  KVRFKPLNSEYVDMENEGTNCLVPPKVMKQKNQNGSEPELSNHGDSETDRSNNLGEITEQ  662

Query  105  SEHKNSHDL  79
             EH  S+++
Sbjct  663  PEHGYSNEV  671



>ref|XP_002966928.1| hypothetical protein SELMODRAFT_168762 [Selaginella moellendorffii]
 gb|EFJ31527.1| hypothetical protein SELMODRAFT_168762 [Selaginella moellendorffii]
Length=649

 Score =   301 bits (772),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 153/243 (63%), Positives = 186/243 (77%), Gaps = 16/243 (7%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LL+   V  +AH+PAYFVPDSMSVWNLLREFRIRKVHMA+VLNEYGGT+GIVTLEDVVEE
Sbjct  300  LLQKITVARVAHRPAYFVPDSMSVWNLLREFRIRKVHMAIVLNEYGGTVGIVTLEDVVEE  359

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEI++KTGY+V RAEG+FDVDANTSI+ LS+ L++K PE+H YETVSG
Sbjct  360  IVGEIFDENDSKEEIRRKTGYVVQRAEGVFDVDANTSIEDLSEALQVKFPEEHHYETVSG  419

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGES+KV+L K + EE+ +  G+  +Q +K EK Q YKLEILAGNARKV
Sbjct  420  FVCEAFGYIPRTGESVKVVLRKQDSEENQE--GETENQEEKKEKFQTYKLEILAGNARKV  477

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAK-WNKQDESNNE----VSFHGKT------DN  136
             A RFE +   D+    + V    P+ + + W +Q E+N+     + + GKT      DN
Sbjct  478  GATRFEVL---DSSKSNEDVARPLPRFVRRAWEEQCEANDSDKVAIIWDGKTVPCAKGDN  534

Query  135  GNC  127
              C
Sbjct  535  ELC  537



>ref|XP_002961079.1| hypothetical protein SELMODRAFT_75780 [Selaginella moellendorffii]
 gb|EFJ38618.1| hypothetical protein SELMODRAFT_75780 [Selaginella moellendorffii]
Length=649

 Score =   301 bits (771),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 154/243 (63%), Positives = 186/243 (77%), Gaps = 16/243 (7%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LL+   V  +AH+PAYFVPDSMSVWNLLREFRIRKVHMA+VLNEYGGT+GIVTLEDVVEE
Sbjct  300  LLQKITVARVAHRPAYFVPDSMSVWNLLREFRIRKVHMAIVLNEYGGTVGIVTLEDVVEE  359

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEI++KTGY+V RAEG+FDVDANTSI+ LS+ L++K PE+H YETVSG
Sbjct  360  IVGEIFDENDSKEEIRRKTGYVVQRAEGVFDVDANTSIEDLSEALQVKFPEEHHYETVSG  419

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            FVCEAFGYIPRTGESIKV+L K + EE+ +  G+  +Q +K EK Q YKLEILAGNARKV
Sbjct  420  FVCEAFGYIPRTGESIKVVLGKQDPEENQE--GETENQEEKKEKFQTYKLEILAGNARKV  477

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIAK-WNKQDESNNE----VSFHGKT------DN  136
             A RFE +   D+    + V    P+ + + W +Q E+N+     + + GKT      DN
Sbjct  478  GATRFEVL---DSSKSNEDVARPLPRFVRRAWEEQCEANDSDKVAIIWDGKTVPCAKGDN  534

Query  135  GNC  127
              C
Sbjct  535  ELC  537



>ref|XP_009394749.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=420

 Score =   291 bits (744),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+ S V +IAHKP YFVPDSM VW+LLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEEI
Sbjct  167  LQESTVKEIAHKPTYFVPDSMFVWSLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEEI  226

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEIFDENDSKEEIQ+KTGYIV++ +G FDVDANTSIDQLS+EL +K+PE HQYETVSGF
Sbjct  227  VGEIFDENDSKEEIQRKTGYIVMKEDGTFDVDANTSIDQLSEELNVKLPEGHQYETVSGF  286

Query  459  VCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKVS  280
            +CE FGYIP  G  I V+LEK+N+EE+++Y  +ESD   +NE++Q Y++EIL  +ARKV+
Sbjct  287  MCEVFGYIPEEGAKIVVVLEKANREENSEYRNEESDGPSRNERHQKYEIEILEADARKVA  346

Query  279  AVRFERINHDDAELETKGV  223
             V F+ +++  A+L+ KG+
Sbjct  347  KVHFKPLSNQGADLDAKGI  365



>ref|XP_010907613.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic [Elaeis guineensis]
Length=699

 Score =   297 bits (760),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/232 (64%), Positives = 178/232 (77%), Gaps = 2/232 (1%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+   V +IAH P YFVPDSMSVWNLLREFR+R+VHMAVVLNEYGGTIGIVTLEDVVEEI
Sbjct  424  LKEITVREIAHMPTYFVPDSMSVWNLLREFRVRQVHMAVVLNEYGGTIGIVTLEDVVEEI  483

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEIFDENDSKEEI KKTGYIV+R +G FDVDANTSIDQLS+EL +K+PE HQYETVSGF
Sbjct  484  VGEIFDENDSKEEITKKTGYIVMREDGTFDVDANTSIDQLSEELNVKIPEGHQYETVSGF  543

Query  459  VCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKVS  280
            VCE+FGYIP  G ++ V+LEK+N+ E+N+Y    SD  ++ EK+Q ++LEIL  NARKV 
Sbjct  544  VCESFGYIPEEGGNMVVVLEKANKGENNEYGDTTSDHQNEKEKHQTFELEILEANARKVG  603

Query  279  AVRFERINHDDAELETKGVRHWAPKIIAKWNKQDESNNEVSFHG--KTDNGN  130
             VRF+ I  +   +E +G+    P  + K   Q  S  E+S HG  + D GN
Sbjct  604  KVRFKPIKGEYVNMENEGINSLVPTNVMKRKNQSGSEPELSSHGDCEMDAGN  655



>ref|XP_006651579.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like, 
partial [Oryza brachyantha]
Length=550

 Score =   292 bits (748),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 170/214 (79%), Gaps = 0/214 (0%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+   V +IAH P YFVPDSMSVWNLLREFRIR+VHMAVVLNEYGGTIGIVTLEDVVEEI
Sbjct  289  LKEITVKEIAHMPTYFVPDSMSVWNLLREFRIRQVHMAVVLNEYGGTIGIVTLEDVVEEI  348

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEIFDENDSKEEIQKKTGYIV+R +G FDVDANTSID LS+EL +K+PE HQYETVSGF
Sbjct  349  VGEIFDENDSKEEIQKKTGYIVMRDDGTFDVDANTSIDHLSEELGVKIPEGHQYETVSGF  408

Query  459  VCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKVS  280
            VCE+FGYIP  G  + VILEK N+EE+++Y  + SD  D  E+ Q Y+LEIL  NARKV 
Sbjct  409  VCESFGYIPEEGGKMLVILEKDNREENDEYKEEGSDHQDDRERTQAYELEILEANARKVG  468

Query  279  AVRFERINHDDAELETKGVRHWAPKIIAKWNKQD  178
             VRF+ I+ +   +++KGV     K I K  KQ+
Sbjct  469  KVRFKPISSECVGVDSKGVNRMVSKKIIKRKKQN  502



>ref|XP_010252711.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic isoform X2 [Nelumbo nucifera]
Length=602

 Score =   293 bits (749),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 158/173 (91%), Gaps = 1/173 (1%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLE+S V DIAHK AYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GI TLEDVVEE
Sbjct  422  LLETSTVRDIAHK-AYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIATLEDVVEE  480

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTGY+V+RAEGIFDVDANTSID LS++L +KMPE H YETVSG
Sbjct  481  IVGEIFDENDSKEEIQKKTGYVVMRAEGIFDVDANTSIDHLSEDLNVKMPEGHHYETVSG  540

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEIL  304
            FVCEAFGYIPRTGESIKV+LEK+N+EE ++YS  ESD  D+ EK+QI+K+E L
Sbjct  541  FVCEAFGYIPRTGESIKVVLEKANREEDDEYSKVESDHRDQKEKHQIFKMETL  593



>ref|XP_008800617.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic isoform X1 [Phoenix dactylifera]
Length=690

 Score =   294 bits (753),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 159/265 (60%), Positives = 195/265 (74%), Gaps = 15/265 (6%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+ + V +IAH P YFVPDSMSVWNLLREFR+RKVHMAVVLNEYGGT+GIVTLEDVVEEI
Sbjct  419  LKETTVKEIAHMPTYFVPDSMSVWNLLREFRVRKVHMAVVLNEYGGTVGIVTLEDVVEEI  478

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEIFDENDSKEEIQKKTG+IV++ +G FDVDANTSIDQLS+EL IK+PE HQYETVSGF
Sbjct  479  VGEIFDENDSKEEIQKKTGHIVMQEDGTFDVDANTSIDQLSEELNIKIPEGHQYETVSGF  538

Query  459  VCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKVS  280
            +CE+FGYIP  G    V+LEK N+EE+++Y+  +S+  +K E ++IY+LEIL  N RKVS
Sbjct  539  ICESFGYIPEEGGKTVVVLEKENREENSEYTDTKSNHHNK-ETHRIYELEILEANERKVS  597

Query  279  AVRFERINHDD-AELETKGVRHW-APKIIAKWNKQDESN-------NEVSFHGKTDNGNC  127
             VRF  IN++  A+LETKG+R   + K+I + N  D          ++V F G  +  NC
Sbjct  598  EVRFRPINNNKVADLETKGIRRLVSTKVIKRKNPSDPPEKMEEGHPSQVQFQGTMEGLNC  657

Query  126  -LSNNFVK----SEHKNSHDLHNVE  67
             + NN        E K  H LH  E
Sbjct  658  YVINNKTTDDRDGEGKYQHLLHCSE  682



>ref|XP_009394748.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic isoform X1 [Musa acuminata subsp. malaccensis]
Length=672

 Score =   291 bits (744),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 170/199 (85%), Gaps = 0/199 (0%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+ S V +IAHKP YFVPDSM VW+LLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEEI
Sbjct  419  LQESTVKEIAHKPTYFVPDSMFVWSLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEEI  478

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEIFDENDSKEEIQ+KTGYIV++ +G FDVDANTSIDQLS+EL +K+PE HQYETVSGF
Sbjct  479  VGEIFDENDSKEEIQRKTGYIVMKEDGTFDVDANTSIDQLSEELNVKLPEGHQYETVSGF  538

Query  459  VCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKVS  280
            +CE FGYIP  G  I V+LEK+N+EE+++Y  +ESD   +NE++Q Y++EIL  +ARKV+
Sbjct  539  MCEVFGYIPEEGAKIVVVLEKANREENSEYRNEESDGPSRNERHQKYEIEILEADARKVA  598

Query  279  AVRFERINHDDAELETKGV  223
             V F+ +++  A+L+ KG+
Sbjct  599  KVHFKPLSNQGADLDAKGI  617



>gb|EEC75665.1| hypothetical protein OsI_12456 [Oryza sativa Indica Group]
Length=502

 Score =   285 bits (728),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+   V +IAH P YFVPDSMSVWNLLREFRIR+VHMAVVLNEYGGTIGIVTLEDVVEEI
Sbjct  242  LKEITVKEIAHMPTYFVPDSMSVWNLLREFRIRQVHMAVVLNEYGGTIGIVTLEDVVEEI  301

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEIFDENDSKEEIQKKTGYIV+  +G FDVDANTSID LS+EL +K+PE HQYETVSGF
Sbjct  302  VGEIFDENDSKEEIQKKTGYIVMLDDGTFDVDANTSIDHLSEELGVKIPEGHQYETVSGF  361

Query  459  VCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKVS  280
            VCE+FGYIP  G  + VILEK N+EE+++Y  + SD  D  E+ Q Y+LEIL  NARKV 
Sbjct  362  VCESFGYIPEEGGKMLVILEKDNREENDEYKEEGSDNQDDKERTQAYELEILEANARKVG  421

Query  279  AVRFERINHDDAELETKGV  223
             VRF+ I+ +  ++++KGV
Sbjct  422  KVRFKPISSECVDVDSKGV  440



>ref|XP_011002488.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic isoform X2 [Populus euphratica]
Length=645

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/217 (65%), Positives = 169/217 (78%), Gaps = 23/217 (11%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLE + VGD+AHKP YFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+G          
Sbjct  410  LLERTTVGDMAHKPTYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVG----------  459

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
                        EEI+KKTGYIV+RAEGI+DVDANTSIDQLS++L +KMPE HQYETVSG
Sbjct  460  ------------EEIEKKTGYIVMRAEGIYDVDANTSIDQLSEDLNVKMPEGHQYETVSG  507

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            F+CEAFGYIPRTGE+IKV+LEK  QE+ ++++  +SD+ +  EK+QIYKLEILAGNARKV
Sbjct  508  FICEAFGYIPRTGETIKVVLEKETQEDVDEHTEGKSDRQELKEKHQIYKLEILAGNARKV  567

Query  282  SAVRFERINHDDAELETKGVRHWAPKIIA-KWNKQDE  175
            SAVRFERIN+ +A LE   V    P+I+  KW+  +E
Sbjct  568  SAVRFERINNGEALLEANEVTRLVPRIMKRKWSSDEE  604



>ref|XP_010905225.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic [Elaeis guineensis]
Length=692

 Score =   288 bits (736),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 151/252 (60%), Positives = 188/252 (75%), Gaps = 11/252 (4%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            +L+   V +IAH P YFVPDSMSVWNLLRE R+RKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  437  MLKEITVKEIAHMPTYFVPDSMSVWNLLRELRVRKVHMAVVLNEYGGTVGIVTLEDVVEE  496

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEIFDENDSKEEIQKKTG+IV++ +G FDVDANTSIDQLS+EL IK+PEDHQYETVSG
Sbjct  497  IVGEIFDENDSKEEIQKKTGHIVMQEDGTFDVDANTSIDQLSEELNIKIPEDHQYETVSG  556

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKV  283
            F+CE+FGYIP  G    V++EK NQEE+++Y+  E +  ++ E +Q Y+LEI+  NARKV
Sbjct  557  FICESFGYIPEEGGKTVVVVEKENQEENSEYTDTEYNHHNE-ETHQTYELEIMEANARKV  615

Query  282  SAVRFERI-NHDDAELETKGV-RHWAPKIIAKWNKQDESN-------NEVSFHGKTDNGN  130
            S VRF+ I N+  A+LETKG+ R  + K+I +    D          ++V   G  +  N
Sbjct  616  SRVRFKPIHNNKVADLETKGIKRLVSTKVIKRKTPSDPQGKMKEGHPSQVQLQGTMEGLN  675

Query  129  C-LSNNFVKSEH  97
            C + NN    +H
Sbjct  676  CYVINNNTTDDH  687



>gb|ABF97418.1| CBS domain containing protein, expressed [Oryza sativa Japonica 
Group]
Length=680

 Score =   285 bits (728),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 164/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+   V +IAH P YFVPDSMSVWNLLREFRIR+VHMAVVLNEYGGTIGIVTLEDVVEEI
Sbjct  422  LKEITVKEIAHMPTYFVPDSMSVWNLLREFRIRQVHMAVVLNEYGGTIGIVTLEDVVEEI  481

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEIFDENDSKEEIQKKTGYIV+  +G FDVDANTSID LS+EL +K+PE HQYETVSGF
Sbjct  482  VGEIFDENDSKEEIQKKTGYIVMLDDGTFDVDANTSIDHLSEELGVKIPEGHQYETVSGF  541

Query  459  VCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKVS  280
            VCE+FGYIP  G  + VILEK N+EE+++Y  + SD  D  E+ Q Y+LEIL  NARKV 
Sbjct  542  VCESFGYIPEEGGKMLVILEKDNREENDEYKEEGSDNQDDKERTQAYELEILEANARKVG  601

Query  279  AVRFERINHDDAELETKGV  223
             VRF+ I+ +  ++++KGV
Sbjct  602  KVRFKPISSECVDVDSKGV  620



>ref|XP_001772154.1| predicted protein [Physcomitrella patens]
 gb|EDQ62967.1| predicted protein [Physcomitrella patens]
Length=490

 Score =   278 bits (712),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 164/202 (81%), Gaps = 20/202 (10%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LL+   VG IAH+PAYFVPDSMSVWNLLREFR+RKVHMA+VLNEYGGT+G+VTLEDVVEE
Sbjct  273  LLQRMNVGRIAHRPAYFVPDSMSVWNLLREFRVRKVHMAIVLNEYGGTVGVVTLEDVVEE  332

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPE--DHQYETV  469
            IVGEIFDENDSKEEI+KKTGY+V RA+G+FDVDANTS++ L + LEIK+PE   H+YETV
Sbjct  333  IVGEIFDENDSKEEIRKKTGYVVQRADGVFDVDANTSVEDLKEALEIKLPEQGSHRYETV  392

Query  468  SGFVCEAFGYIPRTGESIKVILEKS-----------NQEEHNDYSGKESDQGDK-NEKNQ  325
            SGFVCEAFGYIPRTGES K+ L K+           NQ EH+D      D+ +K  EK Q
Sbjct  393  SGFVCEAFGYIPRTGESTKITLWKADADEGERRDGDNQGEHHD------DRREKEKEKFQ  446

Query  324  IYKLEILAGNARKVSAVRFERI  259
             Y+LEILAGNARKV +VRFER+
Sbjct  447  KYRLEILAGNARKVGSVRFERL  468



>ref|XP_001753114.1| predicted protein [Physcomitrella patens]
 gb|EDQ82155.1| predicted protein, partial [Physcomitrella patens]
Length=481

 Score =   278 bits (710),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 160/196 (82%), Gaps = 8/196 (4%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LL+   VG IAHKPAYFVPDSMSVWNLLREFRIRKVHMA+VLNEYGGT+G+VTLEDVVEE
Sbjct  275  LLQRMNVGRIAHKPAYFVPDSMSVWNLLREFRIRKVHMAIVLNEYGGTVGVVTLEDVVEE  334

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPE--DHQYETV  469
            IVGEIFDENDSKEEI+KKTGY+V RA+G+FD+DANT+++ L + LEIK+PE   H+YETV
Sbjct  335  IVGEIFDENDSKEEIRKKTGYVVQRADGVFDIDANTAVEDLKEALEIKLPEQGSHRYETV  394

Query  468  SGFVCEAFGYIPRTGESIKVILEKSNQEE------HNDYSGKESDQGDKNEKNQIYKLEI  307
            SGFVCEAFGYIPRTGES K+ L  ++ EE       N     E  +  + EK Q Y+LEI
Sbjct  395  SGFVCEAFGYIPRTGESTKITLRNADAEEGEWRDGENQGEHHEDRREKEREKFQKYRLEI  454

Query  306  LAGNARKVSAVRFERI  259
            LAGNARKV +VRFER+
Sbjct  455  LAGNARKVGSVRFERL  470



>ref|XP_009402839.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=428

 Score =   275 bits (703),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 165/214 (77%), Gaps = 2/214 (1%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+   V +IA  P YFVPD MSVWNLLREFRIR+VHMAVVLNEYGGT+GIVTLEDVVEEI
Sbjct  167  LKEITVREIARMPTYFVPDLMSVWNLLREFRIRQVHMAVVLNEYGGTVGIVTLEDVVEEI  226

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEIFDENDSKEEIQ+KTGYIVLR +G FDVDANTSIDQLS+EL +K+PE HQYETVSGF
Sbjct  227  VGEIFDENDSKEEIQRKTGYIVLRDDGTFDVDANTSIDQLSEELNVKIPEGHQYETVSGF  286

Query  459  VCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKVS  280
            VCE FGYIP  G  I V+LEK+NQEE ++ +    D  D+ E++Q ++LE+L  N RKV 
Sbjct  287  VCETFGYIPEEGGKIIVVLEKANQEEESENAETSPDNQDE-ERHQTFELEVLEANERKVG  345

Query  279  AVRFERI-NHDDAELETKGVRHWAPKIIAKWNKQ  181
             VRF  I N  + +L+ KGV     K + K  KQ
Sbjct  346  LVRFIPIDNEGEEDLDNKGVNRVVSKKVIKQKKQ  379



>ref|XP_004982491.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like 
[Setaria italica]
Length=672

 Score =   280 bits (716),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 161/199 (81%), Gaps = 0/199 (0%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+   V +IAH P YFVPDSMSVWNLLREFRIR+VHMAVVLNEYGGTIGIVTLEDVVEEI
Sbjct  414  LKEITVKEIAHMPTYFVPDSMSVWNLLREFRIRQVHMAVVLNEYGGTIGIVTLEDVVEEI  473

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEIFDENDSKEEIQKKTGYIV R +G FDVDANTSIDQLS+EL IK+PE H YETVSGF
Sbjct  474  VGEIFDENDSKEEIQKKTGYIVRREDGTFDVDANTSIDQLSEELGIKIPEGHHYETVSGF  533

Query  459  VCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKVS  280
            VC +FGYIP  G  + VILEK  +EE+ +Y  + SD+ D  EK Q Y+LEIL GNARKV 
Sbjct  534  VCASFGYIPEEGAKMLVILEKDYREENVEYQEEGSDRQDDREKTQAYELEILEGNARKVG  593

Query  279  AVRFERINHDDAELETKGV  223
             V F+ I+ +  +++ KGV
Sbjct  594  KVLFKPISSECVDVDDKGV  612



>ref|XP_009402838.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=664

 Score =   275 bits (702),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 165/214 (77%), Gaps = 2/214 (1%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+   V +IA  P YFVPD MSVWNLLREFRIR+VHMAVVLNEYGGT+GIVTLEDVVEEI
Sbjct  403  LKEITVREIARMPTYFVPDLMSVWNLLREFRIRQVHMAVVLNEYGGTVGIVTLEDVVEEI  462

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEIFDENDSKEEIQ+KTGYIVLR +G FDVDANTSIDQLS+EL +K+PE HQYETVSGF
Sbjct  463  VGEIFDENDSKEEIQRKTGYIVLRDDGTFDVDANTSIDQLSEELNVKIPEGHQYETVSGF  522

Query  459  VCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKVS  280
            VCE FGYIP  G  I V+LEK+NQEE ++ +    D  D+ E++Q ++LE+L  N RKV 
Sbjct  523  VCETFGYIPEEGGKIIVVLEKANQEEESENAETSPDNQDE-ERHQTFELEVLEANERKVG  581

Query  279  AVRFERI-NHDDAELETKGVRHWAPKIIAKWNKQ  181
             VRF  I N  + +L+ KGV     K + K  KQ
Sbjct  582  LVRFIPIDNEGEEDLDNKGVNRVVSKKVIKQKKQ  615



>gb|EMT01231.1| hypothetical protein F775_10996 [Aegilops tauschii]
Length=512

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 158/199 (79%), Gaps = 0/199 (0%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+   V +IAH P YFVPDSMSVWNLLREFRIR+VHMAVVLNEYGGTIGIVTLEDVVEEI
Sbjct  242  LKDITVKEIAHMPIYFVPDSMSVWNLLREFRIRQVHMAVVLNEYGGTIGIVTLEDVVEEI  301

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEIFDENDSKEEIQKKTG IV+  +G F VDANTSID LS+EL +K+PE HQYETVSGF
Sbjct  302  VGEIFDENDSKEEIQKKTGNIVMLEDGTFVVDANTSIDDLSEELGVKIPEGHQYETVSGF  361

Query  459  VCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKVS  280
            VCE+FGYIP  G  + VILE+   EE+ +Y  + SD  D+ E  Q Y+LEIL  NARKVS
Sbjct  362  VCESFGYIPEEGGKMLVILERDKSEENGEYQDEGSDHQDEREATQAYELEILEANARKVS  421

Query  279  AVRFERINHDDAELETKGV  223
             V F+ I+ +  +++ KGV
Sbjct  422  KVCFKPISSECVDVDNKGV  440



>ref|XP_003562322.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like 
[Brachypodium distachyon]
Length=667

 Score =   273 bits (699),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 160/199 (80%), Gaps = 0/199 (0%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+   V +IAH P YFVPDSMSVWNLLREFRIR+VHMAVVLNEYGGTIGIVTLEDVVEEI
Sbjct  408  LKEITVKEIAHMPTYFVPDSMSVWNLLREFRIRQVHMAVVLNEYGGTIGIVTLEDVVEEI  467

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEIFDENDSKEEIQKKTG IV+  +G F VDANTSID LS+EL +K+PE HQYETVSGF
Sbjct  468  VGEIFDENDSKEEIQKKTGNIVMLEDGTFYVDANTSIDDLSEELGVKIPEGHQYETVSGF  527

Query  459  VCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKVS  280
            VCE+FGYIP  G  + VILE+  +EE+++Y  + SD  D  E+ Q Y+LEIL  NARKVS
Sbjct  528  VCESFGYIPEEGGKMLVILERDKREENDEYQDEGSDHQDDRERTQAYELEILEANARKVS  587

Query  279  AVRFERINHDDAELETKGV  223
             V F+ I+ +  +++ KGV
Sbjct  588  KVSFKPISSECVDVDNKGV  606



>dbj|BAK02383.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=673

 Score =   273 bits (699),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 160/199 (80%), Gaps = 0/199 (0%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+   V +IAH P YFVPDSMSVWNLLREFRIR+VHMAVVLNEYGGTIGIVTLEDVVEEI
Sbjct  415  LKDITVKEIAHMPIYFVPDSMSVWNLLREFRIRQVHMAVVLNEYGGTIGIVTLEDVVEEI  474

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEIFDENDSKEEIQKKTG IV+  +G F VDANTSID LS+EL +K+P+ HQYETVSGF
Sbjct  475  VGEIFDENDSKEEIQKKTGNIVMLEDGTFVVDANTSIDDLSEELVVKIPDGHQYETVSGF  534

Query  459  VCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKVS  280
            VCE+FGYIP  G  + VILE+  +EE+++Y  + SD  D  E  Q Y+LEIL  NARKVS
Sbjct  535  VCESFGYIPEEGGKMLVILERDKREENDEYQDEGSDNQDGRETTQAYELEILEANARKVS  594

Query  279  AVRFERINHDDAELETKGV  223
             VRF+ I+ +  +++ KGV
Sbjct  595  KVRFKPISSECVDVDNKGV  613



>gb|EEE59439.1| hypothetical protein OsJ_11614 [Oryza sativa Japonica Group]
Length=701

 Score =   271 bits (694),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 164/221 (74%), Gaps = 22/221 (10%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+   V +IAH P YFVPDSMSVWNLLREFRIR+VHMAVVLNEYGGTIGIVTLEDVVEEI
Sbjct  421  LKEITVKEIAHMPTYFVPDSMSVWNLLREFRIRQVHMAVVLNEYGGTIGIVTLEDVVEEI  480

Query  639  VGEIFDENDSK----------------------EEIQKKTGYIVLRAEGIFDVDANTSID  526
            VGEIFDENDSK                      EEIQKKTGYIV+  +G FDVDANTSID
Sbjct  481  VGEIFDENDSKIVTLEDVVEEIVGEIFDENDSKEEIQKKTGYIVMLDDGTFDVDANTSID  540

Query  525  QLSDELEIKMPEDHQYETVSGFVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQG  346
             LS+EL +K+PE HQYETVSGFVCE+FGYIP  G  + VILEK N+EE+++Y  + SD  
Sbjct  541  HLSEELGVKIPEGHQYETVSGFVCESFGYIPEEGGKMLVILEKDNREENDEYKEEGSDNQ  600

Query  345  DKNEKNQIYKLEILAGNARKVSAVRFERINHDDAELETKGV  223
            D  E+ Q Y+LEIL  NARKV  VRF+ I+ +  ++++KGV
Sbjct  601  DDKERTQAYELEILEANARKVGKVRFKPISSECVDVDSKGV  641



>gb|AAT81753.1| transporter associated domain containing protein [Oryza sativa 
Japonica Group]
Length=608

 Score =   259 bits (661),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+   V +IAH P YFVPDSMSVWNLLREFRIR+VHMAVVLNEYGGTIGIVTLEDVVEEI
Sbjct  422  LKEITVKEIAHMPTYFVPDSMSVWNLLREFRIRQVHMAVVLNEYGGTIGIVTLEDVVEEI  481

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEIFDENDSKEEIQKKTGYIV+  +G FDVDANTSID LS+EL +K+PE HQYETVSGF
Sbjct  482  VGEIFDENDSKEEIQKKTGYIVMLDDGTFDVDANTSIDHLSEELGVKIPEGHQYETVSGF  541

Query  459  VCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEI  307
            VCE+FGYIP  G  + VILEK N+EE+++Y  + SD  D  E+ Q Y+LE+
Sbjct  542  VCESFGYIPEEGGKMLVILEKDNREENDEYKEEGSDNQDDKERTQAYELEV  592



>ref|XP_008800618.1| PREDICTED: putative DUF21 domain-containing protein At3g13070, 
chloroplastic isoform X2 [Phoenix dactylifera]
Length=597

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 150/173 (87%), Gaps = 1/173 (1%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+ + V +IAH P YFVPDSMSVWNLLREFR+RKVHMAVVLNEYGGT+GIVTLEDVVEEI
Sbjct  419  LKETTVKEIAHMPTYFVPDSMSVWNLLREFRVRKVHMAVVLNEYGGTVGIVTLEDVVEEI  478

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEIFDENDSKEEIQKKTG+IV++ +G FDVDANTSIDQLS+EL IK+PE HQYETVSGF
Sbjct  479  VGEIFDENDSKEEIQKKTGHIVMQEDGTFDVDANTSIDQLSEELNIKIPEGHQYETVSGF  538

Query  459  VCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILA  301
            +CE+FGYIP  G    V+LEK N+EE+++Y+  +S+  +K E ++IY+LE+ A
Sbjct  539  ICESFGYIPEEGGKTVVVLEKENREENSEYTDTKSNHHNK-ETHRIYELELFA  590



>ref|NP_001050588.1| Os03g0593200 [Oryza sativa Japonica Group]
 dbj|BAF12502.1| Os03g0593200 [Oryza sativa Japonica Group]
Length=598

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 143/170 (84%), Gaps = 0/170 (0%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+   V +IAH P YFVPDSMSVWNLLREFRIR+VHMAVVLNEYGGTIGIVTLEDVVEEI
Sbjct  422  LKEITVKEIAHMPTYFVPDSMSVWNLLREFRIRQVHMAVVLNEYGGTIGIVTLEDVVEEI  481

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEIFDENDSKEEIQKKTGYIV+  +G FDVDANTSID LS+EL +K+PE HQYETVSGF
Sbjct  482  VGEIFDENDSKEEIQKKTGYIVMLDDGTFDVDANTSIDHLSEELGVKIPEGHQYETVSGF  541

Query  459  VCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLE  310
            VCE+FGYIP  G  + VILEK N+EE+++Y  + SD  D  E+ Q Y+LE
Sbjct  542  VCESFGYIPEEGGKMLVILEKDNREENDEYKEEGSDNQDDKERTQAYELE  591



>ref|XP_001762927.1| HO2c heme oxygenase [Physcomitrella patens]
 gb|EDQ72132.1| HO2c heme oxygenase [Physcomitrella patens]
Length=1050

 Score =   259 bits (661),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 159/201 (79%), Gaps = 13/201 (6%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LL+   VG IAH+PAYFVPDSMSVWNLLREFRIRKVHMA+VLNEYGGT+G+VTLEDVVEE
Sbjct  655  LLQRMNVGRIAHRPAYFVPDSMSVWNLLREFRIRKVHMAIVLNEYGGTVGVVTLEDVVEE  714

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANT-SIDQLSDEL----EIKMPEDHQY  478
            IVGEIFDENDSKEEI+KKTGY+V RA+G+FDVDANT +I Q+   L    ++ +   + Y
Sbjct  715  IVGEIFDENDSKEEIRKKTGYVVQRADGVFDVDANTQAIRQIDASLSVIVDVPVVGSNHY  774

Query  477  ETVSGFVCEAFGYIPRTGESIKVILEKSNQEEHN----DYSGKESDQGDKNEKN----QI  322
            ETVSGFVCEAFGYIPRTGES K+ L K++ E+ +    +  G+  D  D+ EK     Q 
Sbjct  775  ETVSGFVCEAFGYIPRTGESTKITLRKADAEDSDRRDGENQGENQDDRDRREKEKEKFQK  834

Query  321  YKLEILAGNARKVSAVRFERI  259
            Y+LEILAGNARKV +VRFER+
Sbjct  835  YRLEILAGNARKVGSVRFERL  855



>gb|KGN59102.1| hypothetical protein Csa_3G769670 [Cucumis sativus]
Length=495

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 152/201 (76%), Gaps = 22/201 (11%)
 Frame = -2

Query  678  IGIVTLEDVVEEIVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIK  499
            + IVTLEDVVEEIVGEIFDENDSKEEIQKKTGYIV+RA+G++DVDANT+IDQLS++L IK
Sbjct  304  VQIVTLEDVVEEIVGEIFDENDSKEEIQKKTGYIVMRADGVYDVDANTAIDQLSEDLNIK  363

Query  498  MPEDHQYETVSGFVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIY  319
            MPE HQYETVSGFVCEAFGYIPRTGES+KV+LEK + EE ++   K     ++ E++ I+
Sbjct  364  MPEGHQYETVSGFVCEAFGYIPRTGESVKVVLEKEDDEEESNPENK-----NQKERHLIF  418

Query  318  KLEILAGNARKVSAVRFERINHDDAELETKGVRHWAPKII-AKWNKQDESNNEVSFHGKT  142
             +EILAGNARKVSAVRFER+N D+ E     V H  PK++  KW+  DES       G  
Sbjct  419  NIEILAGNARKVSAVRFERVNDDNGE-----VAHLVPKVMKKKWSSNDES-------GSV  466

Query  141  DNGNCLS----NNFVKSEHKN  91
            +N N LS    ++ +  EH+N
Sbjct  467  ENDNLLSSEGVDDSLSREHQN  487



>ref|XP_008665045.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like 
isoform X1 [Zea mays]
 ref|XP_008665046.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like 
isoform X1 [Zea mays]
 ref|XP_008665047.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like 
isoform X1 [Zea mays]
Length=653

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/199 (58%), Positives = 138/199 (69%), Gaps = 22/199 (11%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L +  V +IAH P YFVPDSMSVWNLLREFRIR+VHMAVVLNEYGGTIG           
Sbjct  419  LNAITVKEIAHMPTYFVPDSMSVWNLLREFRIRQVHMAVVLNEYGGTIG-----------  467

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
                       EEIQKKTGYIV R +G FDVDANTSID LS+EL IK+PE HQYETVSGF
Sbjct  468  -----------EEIQKKTGYIVRRGDGTFDVDANTSIDHLSEELGIKIPEGHQYETVSGF  516

Query  459  VCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKVS  280
            VC +FGYIP  G  + VILEK+ +EE+ +Y  +  D+ D  EK Q Y+LEI+  NARKV 
Sbjct  517  VCASFGYIPEEGGKMLVILEKNFREENGEYQEEGPDRQDDREKTQAYELEIVEANARKVG  576

Query  279  AVRFERINHDDAELETKGV  223
             V F+ I+ +  +++ KGV
Sbjct  577  KVLFKPISSECVDVDNKGV  595



>gb|KJB45538.1| hypothetical protein B456_007G310900 [Gossypium raimondii]
Length=516

 Score =   216 bits (549),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLES+ VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  403  LLESTTVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  462

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDH  484
            IVGEIFDENDSKEEIQKKTGYIV+RAEGIFDVDANTSIDQLS++L IKMPE +
Sbjct  463  IVGEIFDENDSKEEIQKKTGYIVMRAEGIFDVDANTSIDQLSEDLNIKMPEVY  515



>ref|XP_008665048.1| PREDICTED: DUF21 domain-containing protein At1g55930, chloroplastic-like 
isoform X2 [Zea mays]
Length=587

 Score =   206 bits (525),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 121/172 (70%), Gaps = 22/172 (13%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L +  V +IAH P YFVPDSMSVWNLLREFRIR+VHMAVVLNEYGGTIG           
Sbjct  419  LNAITVKEIAHMPTYFVPDSMSVWNLLREFRIRQVHMAVVLNEYGGTIG-----------  467

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
                       EEIQKKTGYIV R +G FDVDANTSID LS+EL IK+PE HQYETVSGF
Sbjct  468  -----------EEIQKKTGYIVRRGDGTFDVDANTSIDHLSEELGIKIPEGHQYETVSGF  516

Query  459  VCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEIL  304
            VC +FGYIP  G  + VILEK+ +EE+ +Y  +  D+ D  EK Q Y+LE+L
Sbjct  517  VCASFGYIPEEGGKMLVILEKNFREENGEYQEEGPDRQDDREKTQAYELEVL  568



>tpg|DAA50225.1| TPA: hypothetical protein ZEAMMB73_231355 [Zea mays]
 tpg|DAA50226.1| TPA: hypothetical protein ZEAMMB73_231355 [Zea mays]
Length=285

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 117/231 (51%), Positives = 143/231 (62%), Gaps = 33/231 (14%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L +  V +IAH P YFVPD                               +TLEDVVEEI
Sbjct  60   LNAITVKEIAHMPTYFVPD-------------------------------LTLEDVVEEI  88

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEIFDENDSKEEIQKKTGYIV R +G FDVDANTSID LS+EL IK+PE HQYETVSGF
Sbjct  89   VGEIFDENDSKEEIQKKTGYIVRRGDGTFDVDANTSIDHLSEELGIKIPEGHQYETVSGF  148

Query  459  VCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKVS  280
            VC +FGYIP  G  + VILEK+ +EE+ +Y  +  D+ D  EK Q Y+LEI+  NARKV 
Sbjct  149  VCASFGYIPEEGGKMLVILEKNFREENGEYQEEGPDRQDDREKTQAYELEIVEANARKVG  208

Query  279  AVRFERINHDDAELETKGVRHWAPKIIAKWNK--QDESNNEVSFHGKTDNG  133
             V F+ I+ +  +++ KGV     K I K  K   D+S+N+      T+NG
Sbjct  209  KVLFKPISSECVDVDNKGVNRLISKKIIKRKKKGSDDSSNDDECPDVTENG  259



>ref|XP_002300360.2| hypothetical protein POPTR_0001s37310g [Populus trichocarpa]
 gb|EEE85165.2| hypothetical protein POPTR_0001s37310g [Populus trichocarpa]
Length=175

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 110/134 (82%), Gaps = 1/134 (1%)
 Frame = -2

Query  573  LRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRTGESIKVILEKS  394
            +RAEGI+DVDANTSIDQLS++L +KMPE HQYETVSGF+CEAFGYIPRTGE+I V+LEK 
Sbjct  1    MRAEGIYDVDANTSIDQLSEDLNVKMPEGHQYETVSGFICEAFGYIPRTGETINVVLEKE  60

Query  393  NQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKVSAVRFERINHDDAELETKGVRHW  214
             QE+ ++++  +SD+ +  EK+QIYKLEILAGNARKVSAVRFERIN+ +A LE   V   
Sbjct  61   TQEDVDEHTEGKSDRQELKEKHQIYKLEILAGNARKVSAVRFERINNGEALLEANEVTRL  120

Query  213  APKIIA-KWNKQDE  175
             P+I+  KW+  +E
Sbjct  121  VPRIMKRKWSSDEE  134



>ref|XP_002317322.1| hypothetical protein POPTR_0011s08660g [Populus trichocarpa]
 gb|EEE97934.1| hypothetical protein POPTR_0011s08660g [Populus trichocarpa]
Length=146

 Score =   176 bits (445),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 106/124 (85%), Gaps = 0/124 (0%)
 Frame = -2

Query  669  VTLEDVVEEIVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPE  490
            VTLEDVVEEIVGEIF+ENDSKEEI+KKTG+IV+RAEGI+DVDANTSIDQLS++L IKMPE
Sbjct  10   VTLEDVVEEIVGEIFNENDSKEEIEKKTGFIVMRAEGIYDVDANTSIDQLSEDLNIKMPE  69

Query  489  DHQYETVSGFVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIYKLE  310
             HQY+TVSGFVCE FGYIPRT E+IKVILEK   E+ + ++  + D  +  EK+QIYKLE
Sbjct  70   GHQYKTVSGFVCEVFGYIPRTVETIKVILEKETLEDEDVHTEGKFDIQEVKEKHQIYKLE  129

Query  309  ILAG  298
            +  G
Sbjct  130  VEFG  133



>gb|AFK45559.1| unknown [Lotus japonicus]
Length=169

 Score =   175 bits (444),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 118/160 (74%), Gaps = 5/160 (3%)
 Frame = -2

Query  573  LRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRTGESIKVILEKS  394
            +RAEGIFDVDANTSIDQLSD+L IKMPE  QYETVSGFVCEAFGYIPRTGESIKV+LE+ 
Sbjct  1    MRAEGIFDVDANTSIDQLSDDLNIKMPEGIQYETVSGFVCEAFGYIPRTGESIKVVLERE  60

Query  393  NQEEHNDYSGKESDQGDKNEKNQIYKLEILAGNARKVSAVRFERINHDDAELETKGVRHW  214
            +++++ +      DQ    EKNQI+KLEILAGNARKVSAVRFER+N+ D   ETK V   
Sbjct  61   DEDDNEESDADRQDQ---KEKNQIFKLEILAGNARKVSAVRFERVNNGDEMSETKEVTRL  117

Query  213  APKIIA--KWNKQDESNNEVSFHGKTDNGNCLSNNFVKSE  100
             PKI+   KW+  ++S ++  + G+      L ++ + SE
Sbjct  118  VPKIMKRRKWSSDEDSEDDAEYDGEAALAKRLHDDAISSE  157



>gb|EPS66961.1| hypothetical protein M569_07815, partial [Genlisea aurea]
Length=238

 Score =   144 bits (364),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/72 (96%), Positives = 71/72 (99%), Gaps = 0/72 (0%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LLESS VGD+AHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGT+GIVTLEDVVEE
Sbjct  167  LLESSKVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTVGIVTLEDVVEE  226

Query  642  IVGEIFDENDSK  607
            IVGEIFDENDSK
Sbjct  227  IVGEIFDENDSK  238



>ref|WP_013703914.1| hemolysin [Marinithermus hydrothermalis]
 gb|AEB11867.1| protein of unknown function DUF21 [Marinithermus hydrothermalis 
DSM 14884]
Length=462

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 100/137 (73%), Gaps = 7/137 (5%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
             L++  V  I H PAYFVP+SMSVWNLL E R R  HMA+V++E+GGT G+VT+ED+VEE
Sbjct  298  FLDTLTVSSITH-PAYFVPESMSVWNLLLEMRRRHTHMAIVVDEFGGTAGLVTMEDIVEE  356

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEI+DE D +E +      I L  +G F +DA T +D++S+ L +K+PE  +YET+SG
Sbjct  357  IVGEIYDETDEEEGLA-----IQLLPDGNFLIDAQTPLDEVSEALGVKLPEG-EYETLSG  410

Query  462  FVCEAFGYIPRTGESIK  412
            F+ E FGYIP+ GE++ 
Sbjct  411  FLYETFGYIPKVGEAVP  427



>ref|XP_001420275.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO98568.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=420

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 97/153 (63%), Gaps = 5/153 (3%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            LE  +V D+  +  YFVP+SMSV  LLRE   RK HM VV+NE+GGT+GI TLED VEEI
Sbjct  264  LEDVLVQDVMLRDTYFVPESMSVSKLLRELMQRKSHMCVVVNEFGGTVGIATLEDCVEEI  323

Query  639  VGEIFDENDSK-----EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYE  475
            VGEI+DE DS+     E+ Q  T +I    +G + VD   ++ +L+DEL + +PE   YE
Sbjct  324  VGEIYDEEDSQKANADEDEQDATPFIREVGQGAYLVDTRAALWKLADELSLDIPESPLYE  383

Query  474  TVSGFVCEAFGYIPRTGESIKVILEKSNQEEHN  376
            TV GFVC+ FG IP  G SI    E    E+ +
Sbjct  384  TVGGFVCDLFGSIPDVGASITTTFEHVEDEDAS  416



>ref|WP_013457825.1| hemolysin [Oceanithermus profundus]
 gb|ADR36655.1| protein of unknown function DUF21 [Oceanithermus profundus DSM 
14977]
Length=456

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 98/134 (73%), Gaps = 7/134 (5%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LL+   V  +A  P +FVP+SM VWNLL E R RKVHMA+V++E+GGT G+VTLED++EE
Sbjct  294  LLDQLTVMSLAQDP-FFVPESMPVWNLLLEIRRRKVHMAIVVDEFGGTAGLVTLEDIIEE  352

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEI+DE D +EE       I ++A+G F +DA T +D +S+ L + +PE  +YET+SG
Sbjct  353  IVGEIYDETDVEEEQP-----IQVQADGSFLIDAQTPLDDVSEALGVVLPEG-EYETLSG  406

Query  462  FVCEAFGYIPRTGE  421
            ++ E FGYIP+ GE
Sbjct  407  YLYETFGYIPKVGE  420



>ref|WP_038042808.1| hemolysin [Thermus yunnanensis]
Length=441

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 103/149 (69%), Gaps = 12/149 (8%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L++  V  IAH P YFVP++M  W LLRE R RKVHMA+V++E+GGT G+VTLEDV+EEI
Sbjct  283  LKARTVASIAHPP-YFVPENMDAWTLLRELRRRKVHMAIVVDEFGGTAGLVTLEDVMEEI  341

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEI+DE D  E++  +        +G F + A T +D++S+ L +++PE  +Y+T+SGF
Sbjct  342  VGEIYDETDEPEDLAIRR-----LPDGSFSIQAQTPVDEVSEALGVELPEG-EYDTLSGF  395

Query  459  VCEAFGYIPRTGESI-----KVILEKSNQ  388
            + E FG IP  GES+     + ++E ++Q
Sbjct  396  LYERFGRIPSVGESVEWQGFRFVVESADQ  424



>ref|WP_038068792.1| hemolysin [Thermus scotoductus]
Length=441

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 103/149 (69%), Gaps = 12/149 (8%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+   V  IAH P YFVP++M  W+LLRE R RKVHMA+V++E+GGT G+VTLEDV+EEI
Sbjct  283  LKGRTVASIAHPP-YFVPENMDAWSLLRELRRRKVHMAIVVDEFGGTAGLVTLEDVMEEI  341

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEI+DE D  E++  +        +G F + A T +D++S+ L +++PE  +Y+T+SGF
Sbjct  342  VGEIYDETDEPEDLAIRR-----LPDGSFSIQAQTPVDEVSEALGVELPEG-EYDTLSGF  395

Query  459  VCEAFGYIPRTGESI-----KVILEKSNQ  388
            + E FG IP  GES+     + ++E ++Q
Sbjct  396  LYEQFGRIPGVGESVEWQGFRFVVESADQ  424



>ref|XP_002509090.1| HlyC/CorC family transporter, partial [Micromonas sp. RCC299]
 gb|ACO70348.1| HlyC/CorC family transporter, partial [Micromonas sp. RCC299]
Length=405

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 95/150 (63%), Gaps = 0/150 (0%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LL +  V ++  KP Y+VP+SMSV  L+RE   RK HMA+V+NE+GG +GI T ED VEE
Sbjct  251  LLSTIKVENLTQKPPYYVPESMSVVKLMRELLARKTHMAIVVNEHGGVVGIATFEDCVEE  310

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEI+DEND  +E +    YI   A  ++DVD    +D L++ + I +P    Y+TV G
Sbjct  311  IVGEIYDENDRPDESEINDDYIRQVAHDVYDVDCRAFVDDLAESIGIDIPSSALYDTVGG  370

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHND  373
            F C+ F  IP  GE++ V +  +++   +D
Sbjct  371  FTCDCFDRIPNVGETMVVHMASASKNYDDD  400



>gb|AFH39203.1| CBS domain-containing protein [Thermus thermophilus JL-18]
Length=423

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 104/149 (70%), Gaps = 12/149 (8%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L++  V  IAH P YFVP++M  W+LL+E R RKVHMA+V++E+GGT G+VTLEDV+EEI
Sbjct  263  LKAFKVASIAHPP-YFVPENMDAWSLLKELRRRKVHMAIVVDEFGGTAGLVTLEDVMEEI  321

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEI+DEND  EE       I L  +G + + A T ID++S+ L +++PE  +Y+T+SGF
Sbjct  322  VGEIYDENDEPEEHP-----IRLLPDGAYSIQAQTPIDEVSEVLGVELPEG-EYDTLSGF  375

Query  459  VCEAFGYIPRTGESI-----KVILEKSNQ  388
            +   FG IP  GES+     + ++E ++Q
Sbjct  376  LYALFGRIPSVGESVEWQGFRFVVESADQ  404



>gb|ADW21513.1| CBS domain containing protein [Thermus scotoductus SA-01]
Length=430

 Score =   137 bits (346),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 103/149 (69%), Gaps = 12/149 (8%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+   V  IAH P YFVP++M  W+LLRE R RKVHMA+V++E+GGT G+VT+EDV+EEI
Sbjct  272  LKGRTVASIAHPP-YFVPENMDAWSLLRELRRRKVHMAIVVDEFGGTAGLVTMEDVMEEI  330

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEI+DE D  E++  +        +G F + A T +D++S+ L +++PE  +Y+T+SGF
Sbjct  331  VGEIYDETDEPEDLAIRR-----LPDGSFSIQAQTPVDEVSEALGVELPEG-EYDTLSGF  384

Query  459  VCEAFGYIPRTGESI-----KVILEKSNQ  388
            + E FG IP  GES+     + ++E ++Q
Sbjct  385  LYEQFGRIPGVGESVEWQGFRFVVESADQ  413



>ref|WP_041444443.1| hemolysin [Thermus thermophilus]
Length=446

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 104/149 (70%), Gaps = 12/149 (8%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L++  V  IAH P YFVP++M  W+LL+E R RKVHMA+V++E+GGT G+VTLEDV+EEI
Sbjct  286  LKAFKVASIAHPP-YFVPENMDAWSLLKELRRRKVHMAIVVDEFGGTAGLVTLEDVMEEI  344

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEI+DEND  EE       I L  +G + + A T ID++S+ L +++PE  +Y+T+SGF
Sbjct  345  VGEIYDENDEPEEHP-----IRLLPDGAYSIQAQTPIDEVSEVLGVELPEG-EYDTLSGF  398

Query  459  VCEAFGYIPRTGESI-----KVILEKSNQ  388
            +   FG IP  GES+     + ++E ++Q
Sbjct  399  LYALFGRIPSVGESVEWQGFRFVVESADQ  427



>ref|WP_011228155.1| hemolysin [Thermus thermophilus]
 ref|YP_144000.1| hemolysin-like protein [Thermus thermophilus HB8]
 dbj|BAD70557.1| hemolysin-related protein [Thermus thermophilus HB8]
Length=445

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 104/149 (70%), Gaps = 12/149 (8%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L++  V  IAH P YFVP++M  W+LL+E R RKVHMA+V++E+GGT G+VTLEDV+EEI
Sbjct  285  LKAFKVASIAHPP-YFVPENMDAWSLLKELRRRKVHMAIVVDEFGGTAGLVTLEDVIEEI  343

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEI+DE+D  EE       I L  +G + + A T ID++S+ L +++PE  +Y+T+SGF
Sbjct  344  VGEIYDESDEPEEHP-----IRLLPDGAYSIQAQTPIDEVSEALGVELPEG-EYDTLSGF  397

Query  459  VCEAFGYIPRTGESI-----KVILEKSNQ  388
            +   FG IP  GES+     + ++E ++Q
Sbjct  398  LYALFGRIPSVGESLEWQGFRFVVESADQ  426



>ref|WP_019550090.1| hemolysin [Thermus scotoductus]
Length=441

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 103/149 (69%), Gaps = 12/149 (8%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+   V  IAH P YFVP++M  W+LLRE R RKVHMA+V++E+GGT G+VTLEDV+EEI
Sbjct  283  LKGRTVASIAHPP-YFVPENMDAWSLLRELRRRKVHMAIVVDEFGGTAGLVTLEDVMEEI  341

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEI+DE D  E++  +        +G F + A T +D++S+ L +++PE  +Y+T+SGF
Sbjct  342  VGEIYDETDEPEDLAIRR-----LPDGSFSIQAQTPVDEVSEVLGVELPEG-EYDTLSGF  395

Query  459  VCEAFGYIPRTGESI-----KVILEKSNQ  388
            + E FG IP  GES+     + ++E ++Q
Sbjct  396  LYEQFGRIPGVGESVEWQGFRFVVESADQ  424



>ref|WP_038029402.1| hemolysin [Thermus sp. NMX2.A1]
 gb|ETN89142.1| hemolysin [Thermus sp. NMX2.A1]
Length=441

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 103/149 (69%), Gaps = 12/149 (8%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+   V  IAH P YFVP++M  W+LLRE R RKVHMA+V++E+GGT G+VTLEDV+EEI
Sbjct  283  LKGRTVASIAHPP-YFVPENMDAWSLLRELRRRKVHMAIVVDEFGGTAGLVTLEDVMEEI  341

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEI+DE D  E++  +        +G F + A T +D++S+ L +++PE  +Y+T+SGF
Sbjct  342  VGEIYDETDEPEDLAIRR-----LPDGSFSIQAQTPVDEVSEVLGVELPEG-EYDTLSGF  395

Query  459  VCEAFGYIPRTGESI-----KVILEKSNQ  388
            + E FG IP  GES+     + ++E ++Q
Sbjct  396  LYEQFGRIPGVGESVEWQGFRFVVESADQ  424



>ref|WP_041438174.1| hemolysin [Thermus scotoductus]
Length=441

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 103/149 (69%), Gaps = 12/149 (8%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+   V  IAH P YFVP++M  W+LLRE R RKVHMA+V++E+GGT G+VT+EDV+EEI
Sbjct  283  LKGRTVASIAHPP-YFVPENMDAWSLLRELRRRKVHMAIVVDEFGGTAGLVTMEDVMEEI  341

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEI+DE D  E++  +        +G F + A T +D++S+ L +++PE  +Y+T+SGF
Sbjct  342  VGEIYDETDEPEDLAIRR-----LPDGSFSIQAQTPVDEVSEALGVELPEG-EYDTLSGF  395

Query  459  VCEAFGYIPRTGESI-----KVILEKSNQ  388
            + E FG IP  GES+     + ++E ++Q
Sbjct  396  LYEQFGRIPGVGESVEWQGFRFVVESADQ  424



>ref|WP_003048140.1| hemolysin [Thermus aquaticus]
 gb|EED09622.1| protein of unknown function DUF21 [Thermus aquaticus Y51MC23]
Length=441

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 102/149 (68%), Gaps = 12/149 (8%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+   V  IAH P YFVP++M  W+LL+E R RKVHMA+V++E+GGT G+VTLEDV+EEI
Sbjct  283  LKGRTVASIAHPP-YFVPENMDAWSLLKELRRRKVHMAIVVDEFGGTAGLVTLEDVIEEI  341

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEI+DE D  E+   K       A+G   + A T ID++S+ L +++PE  +Y+T+SGF
Sbjct  342  VGEIYDETDEPEDAPIKR-----LADGALSIQAQTPIDEVSEALGVELPEG-EYDTLSGF  395

Query  459  VCEAFGYIPRTGESI-----KVILEKSNQ  388
            + E FG IP  GES+     + ++E ++Q
Sbjct  396  LYERFGRIPGVGESVEWQGFRFVVESADQ  424



>ref|WP_024119167.1| hemolysin [Thermus thermophilus]
Length=446

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 103/149 (69%), Gaps = 12/149 (8%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L +  V  IAH P YFVP++M  W+LL+E R RKVHMA+V++E+GGT G+VTLEDV+EEI
Sbjct  286  LRAFKVASIAHPP-YFVPENMDAWSLLKELRRRKVHMAIVVDEFGGTAGLVTLEDVIEEI  344

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEI+DE+D  EE       I L  +G + + A T ID++S+ L +++PE  +Y+T+SGF
Sbjct  345  VGEIYDESDEPEEHP-----IRLLPDGAYSIQAQTPIDEVSEALGVELPEG-EYDTLSGF  398

Query  459  VCEAFGYIPRTGESI-----KVILEKSNQ  388
            +   FG IP  GES+     + ++E ++Q
Sbjct  399  LYALFGRIPSVGESLEWQGFRFVVESADQ  427



>ref|WP_028493196.1| hemolysin [Thermus antranikianii]
Length=441

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 101/149 (68%), Gaps = 12/149 (8%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L    V  IAH P YFVP++M  W+LLRE R RKVHMA+V++E+GGT G+VTLEDV+EEI
Sbjct  283  LRGRTVASIAHPP-YFVPENMDAWSLLRELRRRKVHMAIVVDEFGGTAGLVTLEDVMEEI  341

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEI+DE D  E++  +        +G F + A T +D++S  L +++PE  +Y+T+SGF
Sbjct  342  VGEIYDETDEPEDMAIRR-----LPDGSFSIQAQTPVDEVSKALGVELPEG-EYDTLSGF  395

Query  459  VCEAFGYIPRTGESI-----KVILEKSNQ  388
            + E FG IP  GES+     + ++E ++Q
Sbjct  396  LYEQFGRIPGVGESVEWQGFRFVVESADQ  424



>ref|WP_011172830.1| hemolysin [Thermus thermophilus]
 gb|AAS80730.1| probable hemolysin-related protein/CBS domain containing protein 
[Thermus thermophilus HB27]
Length=446

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 104/149 (70%), Gaps = 12/149 (8%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L++  V  IAH P YFVP++M  W+LL+E R RKVHMA+V++E+GGT G+VTLEDV+EEI
Sbjct  286  LKAFKVASIAHPP-YFVPENMDAWSLLKELRRRKVHMAIVVDEFGGTAGLVTLEDVMEEI  344

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEI+DE+D  EE       I L  +G + + A T ID++S+ L +++PE  +Y+T+SGF
Sbjct  345  VGEIYDESDEPEEHP-----IRLLPDGAYSIQAQTPIDEVSEALGVELPEG-EYDTLSGF  398

Query  459  VCEAFGYIPRTGESI-----KVILEKSNQ  388
            +   FG IP  GES+     + ++E ++Q
Sbjct  399  LYALFGRIPSVGESLEWQGFRFVVESADQ  427



>ref|WP_014515871.1| hemolysin [Thermus sp. CCB_US3_UF1]
 gb|AEV16515.1| hypothetical protein TCCBUS3UF1_14740 [Thermus sp. CCB_US3_UF1]
Length=441

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 101/149 (68%), Gaps = 12/149 (8%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+   V  IAH P YFVP++M  W LLRE R RKVHMA+V++E+GGT G+VTLEDV+EEI
Sbjct  283  LKGRTVASIAHPP-YFVPENMDAWTLLRELRRRKVHMAIVVDEFGGTAGLVTLEDVMEEI  341

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEI+DE D  E+   +        +G F + A T +D++S+ L +++P D +Y+T+SGF
Sbjct  342  VGEIYDETDEPEDAPIRR-----LPDGSFSIQAQTPVDEVSEALGVELP-DGEYDTLSGF  395

Query  459  VCEAFGYIPRTGESI-----KVILEKSNQ  388
            + E FG IP  GES+     + ++E ++Q
Sbjct  396  LYERFGRIPGVGESVEWQGFRFLVESASQ  424



>ref|WP_038046071.1| hemolysin [Thermus caliditerrae]
Length=441

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 101/149 (68%), Gaps = 12/149 (8%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L++  V  IAH P YFVP++M  W LLRE R RKVHMA+V++E+GGT G+VTLEDV+EEI
Sbjct  283  LKARTVASIAHPP-YFVPENMDAWTLLRELRRRKVHMAIVVDEFGGTAGLVTLEDVMEEI  341

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEI+DE D  E+   +        +G   + A T +D++S+ L +++PE  +Y+T+SGF
Sbjct  342  VGEIYDETDEPEDAAIRR-----LPDGTLSIQAQTPVDEVSEALGVELPEG-EYDTLSGF  395

Query  459  VCEAFGYIPRTGESI-----KVILEKSNQ  388
            + E FG IP  GES+     + ++E ++Q
Sbjct  396  LYEQFGRIPSVGESVEWQGFRFVVESADQ  424



>ref|WP_038056412.1| hemolysin [Thermus sp. YIM 77409]
Length=441

 Score =   136 bits (343),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 102/149 (68%), Gaps = 12/149 (8%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+   V  IAH P YFVP++M  W LLRE R RKVHMA+V++E+GGT G+VTLEDV+EEI
Sbjct  283  LKGRTVVSIAHPP-YFVPENMDAWTLLRELRRRKVHMAIVVDEFGGTAGLVTLEDVMEEI  341

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEI+DE D  E++  +        +G F + A T +D++S+ L +++PE  +Y+T+SGF
Sbjct  342  VGEIYDETDEPEDMAIRR-----LPDGSFSIQAQTPVDEVSEALGVELPEG-EYDTLSGF  395

Query  459  VCEAFGYIPRTGESI-----KVILEKSNQ  388
            + E FG IP  GES+     + ++E ++Q
Sbjct  396  LYERFGRIPGVGESVEWQGFRFVVESADQ  424



>ref|WP_033399260.1| hypothetical protein, partial [Thermus islandicus]
Length=434

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/149 (48%), Positives = 102/149 (68%), Gaps = 12/149 (8%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L +  V  IAH PAYFVP++M  W LL+E R RKVHMA+V++E+GGT G+VTLEDV+EEI
Sbjct  270  LVARTVASIAH-PAYFVPENMDAWTLLKELRRRKVHMAIVVDEFGGTAGLVTLEDVMEEI  328

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEI+DE D  E+   K        +G F + A T +D++S+ L +++PE  +Y+T+SGF
Sbjct  329  VGEIYDETDEPEDQPIKR-----LPDGSFSIQAQTPVDEVSEALGVELPEG-EYDTLSGF  382

Query  459  VCEAFGYIPRTGESI-----KVILEKSNQ  388
            + E FG IP  GES+     + ++E ++Q
Sbjct  383  LYELFGRIPGVGESVEWQGFRFLVESADQ  411



>ref|WP_018111579.1| hemolysin [Thermus igniterrae]
Length=441

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 100/149 (67%), Gaps = 12/149 (8%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L    V  IAH P YFVP++M  W+LLRE R RKVHMA+V++E+GGT G+VTLEDV+EEI
Sbjct  283  LRGRTVASIAHPP-YFVPENMDAWSLLRELRRRKVHMAIVVDEFGGTAGLVTLEDVMEEI  341

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEI+DE D  E+   +        +G   + A T +D++S+ L +++PE  +Y+T+SGF
Sbjct  342  VGEIYDETDEPEDAPIRH-----LPDGTLSIQAQTPVDEVSEALGVELPEG-EYDTLSGF  395

Query  459  VCEAFGYIPRTGESI-----KVILEKSNQ  388
            + E FG IP  GES+     + ++E ++Q
Sbjct  396  LYERFGRIPGVGESVEWQGFRFVVESADQ  424



>ref|WP_018461981.1| hemolysin [Thermus oshimai]
Length=447

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 101/149 (68%), Gaps = 12/149 (8%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+   V  IAH P YFVP++M  W+LLRE + RKVHMA+V++E+GGT G+VTLEDV+EEI
Sbjct  285  LKGRTVVSIAHPP-YFVPENMDAWSLLREMKRRKVHMAIVVDEFGGTAGLVTLEDVMEEI  343

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEI+DE D  E+   +        +G   + A T ID++S+ L +++PE  +Y+T+SGF
Sbjct  344  VGEIYDETDEPEDAAIRR-----LPDGALSIQAQTPIDEVSEALGVELPEG-EYDTLSGF  397

Query  459  VCEAFGYIPRTGESI-----KVILEKSNQ  388
            + E FG IP  GES+     + ++E ++Q
Sbjct  398  LYERFGRIPSVGESVEWAGFRFLVESADQ  426



>ref|WP_016329634.1| CBS domain-containing protein [Thermus oshimai]
 gb|AFV76448.1| CBS domain-containing protein [Thermus oshimai JL-2]
Length=447

 Score =   132 bits (332),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 101/149 (68%), Gaps = 12/149 (8%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+   V  IAH P YFVP++M  W+LLRE + RKVHMA+V++E+GGT G+VTLEDV+EEI
Sbjct  285  LKGRTVVSIAHPP-YFVPENMDAWSLLREMKRRKVHMAIVVDEFGGTAGLVTLEDVMEEI  343

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEI+DE D  E+   +        +G   + A T ID++S+ L +++PE  +Y+T+SGF
Sbjct  344  VGEIYDETDEPEDAAIRR-----LPDGALSIQAQTPIDEVSEALGVELPEG-EYDTLSGF  397

Query  459  VCEAFGYIPRTGESI-----KVILEKSNQ  388
            + E FG IP  GES+     + ++E ++Q
Sbjct  398  LYERFGRIPGVGESVEWAGFRFLVESADQ  426



>ref|WP_039459033.1| hemolysin [Thermus sp. 2.9]
 gb|KHG65185.1| hemolysin [Thermus sp. 2.9]
Length=444

 Score =   132 bits (332),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 100/149 (67%), Gaps = 12/149 (8%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+   V  IAH P YFVP++M  W LL+E R RKVH+A+V++E+GGT G+VTLEDV+EEI
Sbjct  283  LKGRSVASIAHPP-YFVPENMDAWTLLKELRRRKVHLAIVVDEFGGTAGLVTLEDVMEEI  341

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEI+DE D  E+   +         G + + A T +D++S+ L +++PE  +Y+T+SGF
Sbjct  342  VGEIYDETDEPEDAPIRR-----LPNGAYSIQAQTPVDEVSEALGVELPEG-EYDTLSGF  395

Query  459  VCEAFGYIPRTGESI-----KVILEKSNQ  388
            + E FG IP  GES+     + ++E ++Q
Sbjct  396  LYELFGRIPGVGESVEWRGLRFVVESADQ  424



>ref|WP_038060691.1| hemolysin [Thermus filiformis]
 gb|KGQ22964.2| hemolysin [Thermus filiformis]
Length=440

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 99/149 (66%), Gaps = 12/149 (8%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L++  V  IAH P YFVP++M  W+LLRE R RKVHMA+V++E+GGT G+VTLEDV+EEI
Sbjct  281  LKARRVASIAHPP-YFVPENMDAWDLLRELRRRKVHMAIVVDEFGGTAGLVTLEDVIEEI  339

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEI+DE D  EE   +        +G   V A   ID++ + L ++ PE  +Y+T+SGF
Sbjct  340  VGEIYDETDEDEEAPVRH-----LPDGSLSVQAQLPIDEVGEVLGVEFPEG-EYDTLSGF  393

Query  459  VCEAFGYIPRTGESI-----KVILEKSNQ  388
            +   FG IP  GESI     + ++E+++Q
Sbjct  394  LYAEFGRIPTVGESIVWNGFRFLVERADQ  422



>ref|XP_003081913.1| CBS domain-containing protein / transporter associated domain-containing 
protein (ISS) [Ostreococcus tauri]
 emb|CAL55716.1| CO dehydrogenase flavoprotein-like,FAD-binding,subdomain 2 [Ostreococcus 
tauri]
Length=520

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 91/140 (65%), Gaps = 5/140 (4%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            LE  +V  +     YFVP+SMSV  LLRE   RK HM VV+NE+GG +GI TLED VEEI
Sbjct  298  LEEIIVSQVMVDDPYFVPESMSVSKLLRELMFRKTHMCVVVNEFGGVVGIATLEDCVEEI  357

Query  639  VGEIFDE-----NDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYE  475
            VGEI+DE     +D KEE++ +   I +   G + VD +  + +L++EL +++PE   YE
Sbjct  358  VGEIYDEEDNTKSDEKEEVRDEEPLITVVRPGEYLVDTSVPLWKLAEELSLEIPESPLYE  417

Query  474  TVSGFVCEAFGYIPRTGESI  415
            TV GFVC+ FG IP  G +I
Sbjct  418  TVGGFVCDLFGSIPEQGATI  437



>ref|WP_014510130.1| hemolysin [Thermus thermophilus]
 gb|AEG33164.1| protein of unknown function DUF21 [Thermus thermophilus SG0.5JP17-16]
Length=444

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 101/149 (68%), Gaps = 12/149 (8%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L++  V  IAH P YFVP++M  W+LL+E R RKVHMA+V++E+GGT G+VTLEDV+EEI
Sbjct  286  LKAFKVVSIAHPP-YFVPENMDAWSLLKELRRRKVHMAIVVDEFGGTAGLVTLEDVIEEI  344

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
            VGEI+DE D  E+   +        +G   + A T ID++S+ L +++PE  +Y+T+SGF
Sbjct  345  VGEIYDETDEPEDAAIRR-----LPDGSLSIQAQTPIDEVSEALGVELPEG-EYDTLSGF  398

Query  459  VCEAFGYIPRTGESI-----KVILEKSNQ  388
            +   FG IP  GES+     + ++E ++Q
Sbjct  399  LYALFGRIPSVGESVEWQGFRFVVESADQ  427



>ref|XP_003061678.1| HlyC/CorC family, partial [Micromonas pusilla CCMP1545]
 gb|EEH54308.1| HlyC/CorC family, partial [Micromonas pusilla CCMP1545]
Length=402

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 85/150 (57%), Gaps = 0/150 (0%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            +L    V  +  KP ++VP+SMSV  L+RE   RK HM +V+NE+GGTIGI T ED VEE
Sbjct  250  MLSKVSVEGLTQKPPFYVPESMSVVKLMRELLARKTHMCIVVNEFGGTIGIATFEDCVEE  309

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            IVGEI+DE D +E         V     ++DVD    +  L D L + +P    Y+TV G
Sbjct  310  IVGEIYDETDDREPASSDYVRAVKGQTDVYDVDYRAQVSDLGDALGVDIPSSALYDTVGG  369

Query  462  FVCEAFGYIPRTGESIKVILEKSNQEEHND  373
            F C+ F  IP TGE+I + L        +D
Sbjct  370  FTCDCFDRIPATGETILITLPAQTGYLEDD  399



>ref|WP_027338659.1| hemolysin [Halonatronum saccharophilum]
Length=426

 Score =   122 bits (307),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 88/124 (71%), Gaps = 7/124 (6%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +PAY++P+S  V NLL E R  K+HMA++L+EYGGT G+VT+ED++EEIVG+I DE D +
Sbjct  275  RPAYYIPESKKVDNLLTELRKEKIHMAIILDEYGGTAGLVTIEDLLEEIVGDIQDEYDEE  334

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E + K     V+  E I  VD    ID+++D LEI +PE+  YET+SGF+    GY+P+T
Sbjct  335  ENMIK-----VISTEEI-QVDGRVDIDEINDILEIDLPEE-DYETISGFILSMLGYVPKT  387

Query  426  GESI  415
            GE +
Sbjct  388  GEKL  391



>ref|XP_005706513.1| hemolysin-related protein [Galdieria sulphuraria]
 gb|EME29993.1| hemolysin-related protein [Galdieria sulphuraria]
Length=610

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 98/141 (70%), Gaps = 9/141 (6%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            LE+ +V ++  +P +FVP+SM VWN+L + + ++ HMA+V++EYGGT G+VTLED+VEEI
Sbjct  427  LETVIVRELM-EPVFFVPESMPVWNVLEQMKKKRQHMAIVVDEYGGTAGLVTLEDIVEEI  485

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELE-IKM---PEDHQYET  472
            VGEI+DE+D    + + T YI   +EG++ +  NT+++ L   LE + +   PE  Q+ET
Sbjct  486  VGEIYDEDD----VDENTEYICQVSEGVYSIKGNTNMEHLCKVLEGLSLSHDPELDQFET  541

Query  471  VSGFVCEAFGYIPRTGESIKV  409
            +SG +C   G IP  GE++ +
Sbjct  542  ISGVICHMIGRIPDVGETLHL  562



>ref|WP_015234155.1| hypothetical protein [Deinococcus peraridilitoris]
 gb|AFZ65844.1| CBS domain-containing protein [Deinococcus peraridilitoris DSM 
19664]
Length=449

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/139 (45%), Positives = 96/139 (69%), Gaps = 9/139 (6%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+   +GDI  +P Y+ P+SM V +LLR  R RK HMA+V++E+GGT G+VTLEDV+EEI
Sbjct  277  LDHVTIGDIV-RPTYYAPESMRVSDLLRTMRERKSHMAIVVDEFGGTAGLVTLEDVLEEI  335

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKM---PEDHQYETV  469
            VGEI+DE D + E+Q +        EG++ +DA+ +ID++ + L +++    E  +++T+
Sbjct  336  VGEIYDETDEEAEVQVEH-----LGEGVYRLDASLNIDEVEEVLGVELDGQEEAGEFDTL  390

Query  468  SGFVCEAFGYIPRTGESIK  412
            +GFV + FGYIP  GE  +
Sbjct  391  AGFVTQHFGYIPTVGERFQ  409



>gb|ADI15926.1| protein of unknown function DUF21 [Truepera radiovictrix DSM 
17093]
Length=496

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 96/137 (70%), Gaps = 6/137 (4%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L ++ V D+   PA +VP+++S+ NLLR+ R RK H+A+V++E+GGT GIVTLED++EEI
Sbjct  316  LHTTRVADL-MTPAQYVPETLSILNLLRDMRARKNHIAIVVDEFGGTAGIVTLEDIIEEI  374

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
             GEI+DE D     Q++   IV   EG+F +  +  ++++  EL++ + E  +Y+T++GF
Sbjct  375  TGEIYDETD-----QEEAAPIVPLDEGVFRIQGSAHLEEVGAELKLTLGEGGEYDTLAGF  429

Query  459  VCEAFGYIPRTGESIKV  409
            +   FG+IP+ GE++ +
Sbjct  430  LISRFGHIPQPGETLDI  446



>ref|WP_041948144.1| hemolysin, partial [Truepera radiovictrix]
Length=461

 Score =   121 bits (304),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 96/137 (70%), Gaps = 6/137 (4%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L ++ V D+   PA +VP+++S+ NLLR+ R RK H+A+V++E+GGT GIVTLED++EEI
Sbjct  316  LHTTRVADL-MTPAQYVPETLSILNLLRDMRARKNHIAIVVDEFGGTAGIVTLEDIIEEI  374

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
             GEI+DE D     Q++   IV   EG+F +  +  ++++  EL++ + E  +Y+T++GF
Sbjct  375  TGEIYDETD-----QEEAAPIVPLDEGVFRIQGSAHLEEVGAELKLTLGEGGEYDTLAGF  429

Query  459  VCEAFGYIPRTGESIKV  409
            +   FG+IP+ GE++ +
Sbjct  430  LISRFGHIPQPGETLDI  446



>ref|XP_005829508.1| hypothetical protein GUITHDRAFT_141196 [Guillardia theta CCMP2712]
 gb|EKX42528.1| hypothetical protein GUITHDRAFT_141196 [Guillardia theta CCMP2712]
Length=485

 Score =   121 bits (303),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 113/189 (60%), Gaps = 23/189 (12%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            ++ S V DI   PAY+VP+SM+VWN L E R+R+VHMA+V++EYGGT GIVT+ED++EE+
Sbjct  264  IQHSTVADI-MDPAYYVPESMTVWNALEEMRLRRVHMAIVVDEYGGTAGIVTMEDILEEV  322

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDH--QYETVS  466
            +GEI+DE+D  EE+ K+   I    +G F ++ +  +++    L+I++ E    ++ T+S
Sbjct  323  IGEIYDEDD-IEELVKEQSSIYKETDGSFTIEGSADLEETIKALQIEVGEKDLIEFATLS  381

Query  465  GFVCEAFGYIPRTGESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQIY-----KLEILA  301
            G++C   G IP  G  I +               K   +G+  ++ + Y     K+ + A
Sbjct  382  GYLCHKAGCIPAIGTEILL--------------SKTMPKGNPKDETEPYVFDGWKVMVTA  427

Query  300  GNARKVSAV  274
             + R+V +V
Sbjct  428  ADERRVISV  436



>ref|WP_012617223.1| hypothetical protein [Methanosphaerula palustris]
 ref|YP_002465627.1| hypothetical protein Mpal_0531 [Methanosphaerula palustris E1-9c]
 gb|ACL15904.1| protein of unknown function DUF21 [Methanosphaerula palustris 
E1-9c]
Length=421

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 95/138 (69%), Gaps = 9/138 (7%)
 Frame = -2

Query  804  VGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIF  625
            + D+ + P YFVP++  + +LL+E ++RKV MA+V++EYGG +G+VT+ED++EE+VG+I 
Sbjct  266  ISDLMYDP-YFVPETKKIDDLLKELQLRKVPMAMVMDEYGGFVGVVTVEDILEELVGDIL  324

Query  624  DENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAF  445
            DE D +E    + G      EGI+ +DA   +D L+++L+I +P    YET+ G + E  
Sbjct  325  DEFDDEEPELSRIG------EGIYMLDARMWVDDLNEQLDIALPTSDTYETIGGLLIEQL  378

Query  444  GYIPRTGESIKVILEKSN  391
            G+IP  GE+++V  E+SN
Sbjct  379  GHIPHPGETVRV--EESN  394



>ref|WP_018247788.1| hypothetical protein [Orenia marismortui]
Length=427

 Score =   117 bits (294),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 95/138 (69%), Gaps = 12/138 (9%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +PAY++P++  V NLL EFR  K+HMA++L+EYGGT G+VT+ED++EEIVG+I DE D +
Sbjct  274  RPAYYIPETKKVDNLLTEFRKEKIHMAIILDEYGGTAGLVTIEDLLEEIVGDIQDEYDEE  333

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E+      +I +  E    +D    ID++++ LEI +PE+  YET+SGF+    GY+P+ 
Sbjct  334  EK------WIKVFNEDEILIDGRVDIDEINEILEIDLPEE-DYETISGFILSMLGYVPKA  386

Query  426  G-----ESIKVILEKSNQ  388
            G     E++K+++EK  Q
Sbjct  387  GEWIEFENLKIVVEKVIQ  404



>ref|WP_013557494.1| hypothetical protein [Deinococcus maricopensis]
 gb|ADV67989.1| protein of unknown function DUF21 [Deinococcus maricopensis DSM 
21211]
Length=445

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 92/125 (74%), Gaps = 7/125 (6%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +P +FVP++M V +LL++ + RK H+ +V++E+GGT G+VTLEDV+EEIVGEI+DE D +
Sbjct  287  RPTFFVPENMRVSDLLKQMQGRKSHLTIVVDEFGGTAGMVTLEDVLEEIVGEIYDETDEE  346

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPE--DHQYETVSGFVCEAFGYIP  433
            EE       I + A+G++ +DA  ++D++ + L++ + E  + +++T++GFV   FGYIP
Sbjct  347  EE-----RLIEMVADGVYLIDAAATVDEVEERLDLTLDEGDEGEFDTLAGFVTNHFGYIP  401

Query  432  RTGES  418
             +GE+
Sbjct  402  ESGEA  406



>ref|WP_007314069.1| hypothetical protein [Methanolinea tarda]
Length=426

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 89/132 (67%), Gaps = 7/132 (5%)
 Frame = -2

Query  804  VGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIF  625
            + D+ + P +FVP+S  +  +LRE ++RKV MA+VL+EY   +GIVT+ED++EE+VG+I 
Sbjct  265  IRDLMYDP-FFVPESKKIDEVLRELQLRKVQMAIVLDEYSSFVGIVTVEDILEELVGDIL  323

Query  624  DENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAF  445
            DE D +E   +K G      EG++ VDA   +++L+DEL++ +P    YE++ G V E  
Sbjct  324  DEFDREEPQIQKIG------EGVYLVDAKVWVEELNDELDLSLPVSESYESIGGLVIERL  377

Query  444  GYIPRTGESIKV  409
            G+IP  GES+ +
Sbjct  378  GHIPHPGESVYI  389



>ref|XP_005718375.1| unnamed protein product [Chondrus crispus]
 emb|CDF38482.1| unnamed protein product [Chondrus crispus]
Length=503

 Score =   115 bits (289),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 91/136 (67%), Gaps = 6/136 (4%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            LL ++ V +I   PA+FVP+SMSVW +L E R R++HMA+V++EYGGT G+VTLED++EE
Sbjct  251  LLPTTKVSEI-MDPAFFVPESMSVWIVLEEMRKRRLHMAIVVDEYGGTAGLVTLEDILEE  309

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDH--QYETV  469
            +VGEI+DE+D  E    +  +I  + +G F V+    ++++   L + + ED    Y T+
Sbjct  310  VVGEIYDEDDDYE---AEAQFIKKKQDGNFLVEGQADLEKVDQALGMHLDEDDLGDYGTI  366

Query  468  SGFVCEAFGYIPRTGE  421
            SGF+C   G IP  G+
Sbjct  367  SGFLCARMGGIPEVGD  382



>ref|WP_027480723.1| hemolysin [Deinococcus pimensis]
Length=454

 Score =   115 bits (287),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 93/135 (69%), Gaps = 8/135 (6%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+   V DI  +P +F P+SM V +LL+  R +K HMA+V++E+GGT G+VTLEDV+EEI
Sbjct  277  LDGKTVRDIM-RPTFFTPESMRVSDLLKAMREKKTHMAIVVDEFGGTAGLVTLEDVLEEI  335

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQ--YETVS  466
            VGEI+DE D  E++ + T    +  EG + +DA+ S+D+  + L I +  D +  +ET++
Sbjct  336  VGEIYDETD-DEDVARVT----VVGEGEYLLDASLSVDEAEETLGIDLDGDEEVDFETLA  390

Query  465  GFVCEAFGYIPRTGE  421
            GFV + FGYIP+ GE
Sbjct  391  GFVTQHFGYIPQPGE  405



>ref|WP_004039608.1| hypothetical protein [Methanofollis liminatans]
 gb|EJG07743.1| protein of unknown function DUF21 [Methanofollis liminatans DSM 
4140]
Length=417

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 82/124 (66%), Gaps = 6/124 (5%)
 Frame = -2

Query  780  AYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSKEE  601
            AYF+P+S  +  LL+E ++RKVHM +VL+EYGG  G+VT+ED++EE+VGEI DE D +E 
Sbjct  272  AYFIPESKMIDELLKEMQVRKVHMVIVLDEYGGFAGVVTVEDILEELVGEILDEFDEEEP  331

Query  600  IQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRTGE  421
              +K G      EG++ VDA   ++ L++EL   +P    YETV G +    G+IP  GE
Sbjct  332  TIQKLG------EGVYMVDAQVWVEHLNEELGTALPIGESYETVGGLLFTMLGHIPLRGE  385

Query  420  SIKV  409
             +K+
Sbjct  386  VVKL  389



>ref|WP_013257877.1| hypothetical protein [Desulfarculus baarsii]
 gb|ADK84423.1| CBS domain containing protein [Desulfarculus baarsii DSM 2075]
Length=290

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 87/132 (66%), Gaps = 10/132 (8%)
 Frame = -2

Query  795  IAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDEN  616
            I  KP +FVP SMSV  L+ EFR R+ H+AVV++EYGGT GIVT+EDV+EEIVGEI DE 
Sbjct  133  ICRKP-FFVPLSMSVNRLMAEFRKRRAHLAVVVDEYGGTAGIVTMEDVLEEIVGEIVDEY  191

Query  615  DSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMP---EDHQYETVSGFVCEAF  445
            D ++ + ++      + +G   +DA   ++ L+D L +++P    + ++ET+ G +  A 
Sbjct  192  DQEQPMLEE------QPDGALLLDARLEVEDLADHLGVELPTELPEGRFETMGGLITTAL  245

Query  444  GYIPRTGESIKV  409
            G +P+ GE I V
Sbjct  246  GRVPKVGEEIVV  257



>ref|WP_041108081.1| MULTISPECIES: magnesium transporter [Pseudomonas stutzeri group]
 gb|AJE16857.1| magnesium transporter [Pseudomonas balearica DSM 6083]
 gb|KIL03963.1| magnesium transporter [Pseudomonas stutzeri]
Length=282

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 85/126 (67%), Gaps = 6/126 (5%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +PA FVP+S  +  LLREFR    HMAVV++EYGG  G+VT+EDV+E+IVG+I DE+D +
Sbjct  135  RPATFVPESKRLNVLLREFRANHNHMAVVIDEYGGVAGLVTIEDVLEQIVGDIEDEHDVE  194

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E+      YI     G F V A T ID+ +D  E+  P+D +++TV+G V  AFG++P+ 
Sbjct  195  ED-----SYIRPLPSGDFLVKALTPIDEFNDYFEVAFPDD-EFDTVAGLVMNAFGHLPKR  248

Query  426  GESIKV  409
             E I++
Sbjct  249  NEVIEI  254



>ref|WP_021767638.1| CBS domain protein [Leptotrichia sp. oral taxon 215]
 gb|ERK65444.1| CBS domain protein [Leptotrichia sp. oral taxon 215 str. W9775]
Length=442

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 91/126 (72%), Gaps = 8/126 (6%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            K AY+VP + ++  LL EF+ ++ HMA++++EYGGT+GIVT+ED++EEIVGEI DE D +
Sbjct  285  KEAYYVPATKTLTELLEEFKRKQSHMAIIIDEYGGTLGIVTIEDLLEEIVGEIRDEFDQE  344

Query  606  EE-IQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPR  430
            EE IQ+      +R E I+D+  +T I++++DELEI MP   +Y+TV+G+V +  G +  
Sbjct  345  EESIQQ------IR-EKIYDIKGDTLIEEINDELEINMPVSEEYDTVAGYVQDELGKVAE  397

Query  429  TGESIK  412
            TG  +K
Sbjct  398  TGNQVK  403



>ref|WP_029684181.1| hemolysin, partial [Thermotogae bacterium JGI 0000106-O11]
Length=183

 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 83/123 (67%), Gaps = 6/123 (5%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +P  FVP+ M V  LL+EF+ +KVHMA+V++EYGGT GIVT+ED++EEI GEI DE D  
Sbjct  44   RPPLFVPEFMPVSELLKEFKAKKVHMAIVVDEYGGTAGIVTMEDILEEIFGEIMDEYDEG  103

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E I  K        +  + VDA  S++ +  EL I+ PE  +++T++G++ E F +IP+ 
Sbjct  104  ENIGIKK-----IDDNSYLVDATLSLNDIERELRIEFPE-GEFDTLAGYLLEKFKHIPKV  157

Query  426  GES  418
            GE+
Sbjct  158  GET  160



>ref|WP_006807717.1| membrane protein [Leptotrichia goodfellowii]
 gb|EEY34686.1| CBS domain protein [Leptotrichia goodfellowii F0264]
Length=439

 Score =   112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 87/125 (70%), Gaps = 6/125 (5%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            K  YFVP + ++  LL EF+ ++ HMA++++EYGGT+GIVT+ED++EEIVGEI DE D +
Sbjct  284  KEPYFVPTTKTLVELLEEFKKKQSHMAIIIDEYGGTLGIVTIEDLLEEIVGEIRDEFDQE  343

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            EE  ++        E IFD+  +T I++L++EL+I MP   +Y+TVSG+V +  G +   
Sbjct  344  EESIQQI------KETIFDIRGDTVIEELNEELDINMPVSEEYDTVSGYVQDELGKVAEE  397

Query  426  GESIK  412
            G+ +K
Sbjct  398  GDQVK  402



>ref|WP_026736906.1| membrane protein [Leptotrichia goodfellowii]
Length=439

 Score =   112 bits (279),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 87/125 (70%), Gaps = 6/125 (5%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            K  YFVP + ++  LL EF+ ++ HMA++++EYGGT+GIVT+ED++EEIVGEI DE D +
Sbjct  284  KEPYFVPTTKTLVELLEEFKKKQSHMAIIIDEYGGTLGIVTIEDLLEEIVGEIRDEFDQE  343

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            EE  ++        E IFD+  +T I++L++EL+I MP   +Y+TVSG+V +  G +   
Sbjct  344  EESIQQI------KETIFDIRGDTVIEELNEELDINMPVSEEYDTVSGYVQDELGKVAEE  397

Query  426  GESIK  412
            G+ +K
Sbjct  398  GDQVK  402



>ref|WP_038689313.1| magnesium transporter [Stenotrophomonas rhizophila]
 gb|AHY59599.1| magnesium transporter [Stenotrophomonas rhizophila]
Length=293

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 86/126 (68%), Gaps = 4/126 (3%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +PA  +P++  +  LL+EFR+ + HMA+V++EYGG  G+VT+EDV+E+IVGEI DE+D  
Sbjct  141  RPAVLIPEAKKLNVLLKEFRLSRNHMAIVVDEYGGVAGLVTIEDVLEQIVGEIDDEHDEA  200

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E+    T  I ++A+G + VDA T+I+  ++      P+D  Y+T+ G V EA G++P T
Sbjct  201  ED---HTAQIAIQADGQYVVDALTAIEDFNERFGASFPDD-DYDTIGGLVTEAIGHLPET  256

Query  426  GESIKV  409
            G+ + +
Sbjct  257  GDELSL  262



>ref|WP_013277608.1| hemolysin [Acetohalobium arabaticum]
 gb|ADL12162.1| protein of unknown function DUF21 [Acetohalobium arabaticum DSM 
5501]
Length=428

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 94/138 (68%), Gaps = 12/138 (9%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +PAY+VP++  V  LL E R  ++HMA+VL+EYGGT G++T+ED++EEIVG+I DE D +
Sbjct  275  RPAYYVPETKEVDTLLTELRKERIHMAIVLDEYGGTAGLITIEDLLEEIVGDIQDEYDEE  334

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E + +     V+  + I  VDA   ID++++ L I +PE+  YETV GF+    GY+P T
Sbjct  335  ENLIE-----VISDDEIL-VDARIDIDEVNEVLNIHLPEE-DYETVGGFILSTLGYVPET  387

Query  426  G-----ESIKVILEKSNQ  388
            G     E++K+I+E++ Q
Sbjct  388  GEELEFENLKLIIEETIQ  405



>gb|KJS22931.1| hemolysin [Clostridiaceae bacterium BRH_c20a]
Length=418

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 86/126 (68%), Gaps = 7/126 (6%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +PAY++P++  V +LL E R+ KVHMA+V++EYGGT G+VT+EDV+EEI+G+I DE D +
Sbjct  274  RPAYYIPETKKVRDLLAELRLAKVHMAIVIDEYGGTAGLVTIEDVIEEIIGDIQDEFDIE  333

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            EE       IV+  +    VDA  SI  +++ L I +P+D  +ET+SG V    G++P+ 
Sbjct  334  EE------SIVMLTDDSIRVDARASIYDINESLNIDLPDD-DFETISGLVFHLLGHLPKE  386

Query  426  GESIKV  409
            GE + +
Sbjct  387  GEELSL  392



>ref|WP_026745776.1| membrane protein [Leptotrichia hofstadii]
Length=429

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 92/126 (73%), Gaps = 8/126 (6%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            K AYFVP + S+  LL EF+++++HMA+V++EYGGT GIVT+ED++EEIVGEI DE D +
Sbjct  279  KEAYFVPITKSLIELLEEFKLKQLHMAIVIDEYGGTQGIVTIEDLLEEIVGEIRDEFDQE  338

Query  606  EE-IQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPR  430
            EE IQ+      +R E IFD+  +T I++++D+LEI++P   +Y+T+SG++ +  G +  
Sbjct  339  EENIQQ------IR-EKIFDIKGDTPIEEVNDKLEIEIPLSEEYDTISGYIQDKLGKVAD  391

Query  429  TGESIK  412
              + +K
Sbjct  392  VFDQVK  397



>ref|WP_045658145.1| hemolysin [Clostridiaceae bacterium BRH_c20a]
Length=414

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 86/126 (68%), Gaps = 7/126 (6%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +PAY++P++  V +LL E R+ KVHMA+V++EYGGT G+VT+EDV+EEI+G+I DE D +
Sbjct  270  RPAYYIPETKKVRDLLAELRLAKVHMAIVIDEYGGTAGLVTIEDVIEEIIGDIQDEFDIE  329

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            EE       IV+  +    VDA  SI  +++ L I +P+D  +ET+SG V    G++P+ 
Sbjct  330  EE------SIVMLTDDSIRVDARASIYDINESLNIDLPDD-DFETISGLVFHLLGHLPKE  382

Query  426  GESIKV  409
            GE + +
Sbjct  383  GEELSL  388



>ref|WP_044281261.1| hypothetical protein [Caldithrix abyssi]
Length=422

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 85/124 (69%), Gaps = 6/124 (5%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +PAY+VP++  +  LLREF+  K+HMA+V++EYGGT G+VTLEDV+EEIVGEI DE D +
Sbjct  271  RPAYYVPETKRINELLREFQTEKIHMAIVVDEYGGTAGLVTLEDVIEEIVGEIQDEYDKE  330

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
                KK        E  F V+A + ID++++EL++ +P +   +T++GF+   FG +P+ 
Sbjct  331  TPQIKKIN------ETTFLVNAGSLIDEINEELDLDLPTEEGVDTLAGFLLGQFGSVPKV  384

Query  426  GESI  415
             + I
Sbjct  385  KDKI  388



>gb|EHO42422.1| protein of unknown function DUF21 [Caldithrix abyssi DSM 13497]
Length=431

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 85/124 (69%), Gaps = 6/124 (5%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +PAY+VP++  +  LLREF+  K+HMA+V++EYGGT G+VTLEDV+EEIVGEI DE D +
Sbjct  280  RPAYYVPETKRINELLREFQTEKIHMAIVVDEYGGTAGLVTLEDVIEEIVGEIQDEYDKE  339

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
                KK        E  F V+A + ID++++EL++ +P +   +T++GF+   FG +P+ 
Sbjct  340  TPQIKKIN------ETTFLVNAGSLIDEINEELDLDLPTEEGVDTLAGFLLGQFGSVPKV  393

Query  426  GESI  415
             + I
Sbjct  394  KDKI  397



>ref|WP_013255024.1| hemolysin [Spirochaeta smaragdinae]
 gb|ADK81561.1| transporter-associated region [Spirochaeta smaragdinae DSM 11293]
Length=261

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 93/134 (69%), Gaps = 8/134 (6%)
 Frame = -2

Query  816  ESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIV  637
            E+  +G +A KP YFVP+S  + +LL+EFR RKVH+AV ++EYGG  GIV LED++EEIV
Sbjct  105  EAIDIGLVARKP-YFVPESKRLDSLLKEFRRRKVHIAVAVDEYGGVSGIVCLEDIIEEIV  163

Query  636  GEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFV  457
            G+I DE D++EE   + G      EG++  DA   I+ L++++++++P+D  ++T+ GFV
Sbjct  164  GDIQDEFDNEEEDILEIG------EGVYLCDARVDIEDLNEQVKLQLPDD-DFDTLGGFV  216

Query  456  CEAFGYIPRTGESI  415
             + FG IP   E +
Sbjct  217  FDLFGKIPVRYEKV  230



>ref|WP_038270469.1| magnesium transporter [Xylella fastidiosa]
 gb|EWS78818.1| magnesium transporter [Xylella fastidiosa PLS229]
Length=293

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 86/126 (68%), Gaps = 4/126 (3%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +P   +P+S  +  LL+EFR+   HMA+V++EYGG  G+VT+EDV+E+IVG+I DE+D  
Sbjct  141  RPVVLIPESKKLNVLLKEFRLSHNHMAIVVDEYGGVAGLVTIEDVLEQIVGDIDDEHDDT  200

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E+   +T  I ++A+G + VDA T I+  ++    + P+D  Y+T+ G V EA G++P T
Sbjct  201  ED---QTNMIAVQADGCYVVDALTPIEDFNERFSAEFPDD-DYDTIGGLVTEAIGHLPET  256

Query  426  GESIKV  409
            G+++ +
Sbjct  257  GDALTL  262



>gb|EEX74189.1| CBS domain protein [Leptotrichia hofstadii F0254]
Length=439

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 92/126 (73%), Gaps = 8/126 (6%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            K AYFVP + S+  LL EF+++++HMA+V++EYGGT GIVT+ED++EEIVGEI DE D +
Sbjct  287  KEAYFVPITKSLIELLEEFKLKQLHMAIVIDEYGGTQGIVTIEDLLEEIVGEIRDEFDQE  346

Query  606  EE-IQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPR  430
            EE IQ+      +R E IFD+  +T I++++D+LEI++P   +Y+T+SG++ +  G +  
Sbjct  347  EENIQQ------IR-EKIFDIKGDTPIEEVNDKLEIEIPLSEEYDTISGYIQDKLGKVAD  399

Query  429  TGESIK  412
              + +K
Sbjct  400  VFDQVK  405



>ref|WP_019185852.1| magnesium transporter [Stenotrophomonas maltophilia]
Length=293

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 86/126 (68%), Gaps = 4/126 (3%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +PA  +P++  +  LL+EFR+ + HMA+V++EYGG  G+VT+EDV+E+IVGEI DE+D  
Sbjct  141  RPAVLIPEAKKLNVLLKEFRLSRNHMAIVVDEYGGVAGLVTIEDVLEQIVGEIDDEHDEA  200

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E+    T  I ++A+G + VDA T+I+  ++      P+D  Y+T+ G V EA G++P T
Sbjct  201  ED---HTSQIAIQADGQYVVDALTAIEDFNERFGATFPDD-DYDTIGGLVTEAIGHLPET  256

Query  426  GESIKV  409
            G+ + +
Sbjct  257  GDELTL  262



>ref|WP_039888902.1| membrane protein [Leptotrichia hofstadii]
Length=431

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 92/126 (73%), Gaps = 8/126 (6%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            K AYFVP + S+  LL EF+++++HMA+V++EYGGT GIVT+ED++EEIVGEI DE D +
Sbjct  279  KEAYFVPITKSLIELLEEFKLKQLHMAIVIDEYGGTQGIVTIEDLLEEIVGEIRDEFDQE  338

Query  606  EE-IQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPR  430
            EE IQ+      +R E IFD+  +T I++++D+LEI++P   +Y+T+SG++ +  G +  
Sbjct  339  EENIQQ------IR-EKIFDIKGDTPIEEVNDKLEIEIPLSEEYDTISGYIQDKLGKVAD  391

Query  429  TGESIK  412
              + +K
Sbjct  392  VFDQVK  397



>ref|WP_042698268.1| CBS domain-containing protein [Methanocorpusculum bavaricum]
Length=420

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 81/125 (65%), Gaps = 6/125 (5%)
 Frame = -2

Query  780  AYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSKEE  601
             Y VP+S  +  LLRE ++R+VHMA+VL+E+GG  G+VT ED++EE+VG+I DE+D  E 
Sbjct  264  VYCVPESKKIDVLLRELQVRRVHMAIVLDEFGGFSGVVTFEDILEELVGDIMDESDGDE-  322

Query  600  IQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDH-QYETVSGFVCEAFGYIPRTG  424
                   I+   +G++ VDA   +  L+D  +I +PED   YET+ G V    G+IPR G
Sbjct  323  ----VSDIIPLGDGMYLVDAQVRVALLNDRFDISLPEDPGNYETIGGLVFSQLGHIPRLG  378

Query  423  ESIKV  409
            ESI +
Sbjct  379  ESIPL  383



>gb|ERL25704.1| CBS domain protein [Leptotrichia sp. oral taxon 225 str. F0581]
Length=437

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 92/126 (73%), Gaps = 8/126 (6%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            K AYFVP + S+  LL EF+++++HMA+V++EYGGT GIVT+ED++EEIVGEI DE D +
Sbjct  287  KEAYFVPITKSLIELLEEFKLKQLHMAIVIDEYGGTQGIVTIEDLLEEIVGEIRDEFDQE  346

Query  606  EE-IQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPR  430
            EE IQ+      +R E IFD+  +T I++++D+LEI++P   +Y+T+SG++ +  G +  
Sbjct  347  EENIQQ------IR-EKIFDIKGDTPIEEVNDKLEIEIPLSEEYDTISGYIQDKLGKVAD  399

Query  429  TGESIK  412
              + +K
Sbjct  400  VFDQVK  405



>ref|WP_033191821.1| hemolysin [Fervidobacterium islandicum]
 gb|KHG31927.1| hemolysin [Fervidobacterium islandicum]
Length=443

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 107/181 (59%), Gaps = 23/181 (13%)
 Frame = -2

Query  822  LLESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEE  643
            +++  +V ++   P  FVP+ M V  LL+EF+ +K+HMA+V++EYGGT GIVT+ED++EE
Sbjct  270  IVDKVLVKELMRAP-LFVPEFMPVSELLKEFKAKKMHMAIVVDEYGGTAGIVTMEDILEE  328

Query  642  IVGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSG  463
            I GEI DE D  E I  K        E  + VDA  S++ +  EL I+ PE  +++T++G
Sbjct  329  IFGEIMDEYDEGEHIGIKK-----VTENSYLVDATLSLNDIERELRIEFPEG-EFDTLAG  382

Query  462  FVCEAFGYIPRTGE-------SIKVILEKSN---------QEEHNDYSGKESDQGDKNEK  331
            ++ E F +IP+ GE       S KV+    N         + E  + + K +D+GD N++
Sbjct  383  YLLEKFKHIPKVGETYEDERISFKVVAASRNKIEKVLVTIKHEMEENTQKSNDKGDGNDE  442

Query  330  N  328
            +
Sbjct  443  D  443



>ref|WP_036070018.1| membrane protein [Leptotrichia sp. oral taxon 225]
Length=429

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 92/126 (73%), Gaps = 8/126 (6%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            K AYFVP + S+  LL EF+++++HMA+V++EYGGT GIVT+ED++EEIVGEI DE D +
Sbjct  279  KEAYFVPITKSLIELLEEFKLKQLHMAIVIDEYGGTQGIVTIEDLLEEIVGEIRDEFDQE  338

Query  606  EE-IQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPR  430
            EE IQ+      +R E IFD+  +T I++++D+LEI++P   +Y+T+SG++ +  G +  
Sbjct  339  EENIQQ------IR-EKIFDIKGDTPIEEVNDKLEIEIPLSEEYDTISGYIQDKLGKVAD  391

Query  429  TGESIK  412
              + +K
Sbjct  392  VFDQVK  397



>ref|WP_028918155.1| magnesium transporter [Pseudoxanthomonas sp. J35]
Length=294

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 84/126 (67%), Gaps = 4/126 (3%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +PA  +P+S  +  LL+EFR+ + HMA+V++EYGG  G+VT+EDV+E+IVGEI DE+D  
Sbjct  141  RPAVLIPESKKLNLLLKEFRLSRNHMAIVVDEYGGVAGLVTIEDVLEQIVGEIDDEHDEA  200

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E+    +  I  +A+G F VDA T I   ++     +P+D +Y+T+ G V EA G++P  
Sbjct  201  ED---ASALIAAQADGQFVVDALTPIGDFNERFGATLPDD-EYDTIGGLVTEAIGHLPEV  256

Query  426  GESIKV  409
            GE + +
Sbjct  257  GEELTL  262



>ref|WP_020613394.1| hemolysin [Spirochaeta bajacaliforniensis]
Length=261

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 93/134 (69%), Gaps = 8/134 (6%)
 Frame = -2

Query  816  ESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIV  637
            E+  +G +A KP YFVP+S  + +LL+EFR RKVH+AV ++EYGG  GIV LED++EEIV
Sbjct  105  EAIDIGLVARKP-YFVPESKRLDSLLKEFRRRKVHIAVSVDEYGGVSGIVCLEDIIEEIV  163

Query  636  GEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFV  457
            G+I DE D++EE   + G      EG++  DA   I+ L++++++++P+D  ++T+ GFV
Sbjct  164  GDIQDEFDNEEEDILEIG------EGVYLCDARVDIEDLNEQVKLQLPDD-DFDTLGGFV  216

Query  456  CEAFGYIPRTGESI  415
             + FG IP   E +
Sbjct  217  FDLFGKIPVRYEKV  230



>ref|WP_034425752.1| hemolysin [Clostridiales bacterium DRI-13]
Length=419

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 87/126 (69%), Gaps = 7/126 (6%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +PAY+VP+S  V +L  E R  KVHMA+VL+EYGGT G+VT+ED++EEIVG+I DE D +
Sbjct  270  RPAYYVPESKKVRDLFAELRKEKVHMAIVLDEYGGTAGLVTIEDMIEEIVGDIQDEFDRE  329

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E+      +I   A+G   VDA TSI  +++ LE+ +P+D +++T+SG V    G +P  
Sbjct  330  EK------HIETLADGSLRVDARTSIYDINELLELDLPDD-EFDTISGLVFHTLGKLPYE  382

Query  426  GESIKV  409
            G+ +++
Sbjct  383  GQEVEI  388



>ref|WP_017357078.1| magnesium transporter [Stenotrophomonas maltophilia]
Length=293

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 85/126 (67%), Gaps = 4/126 (3%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +PA  +P++  +  LL+EFR+ + HMA+V++EYGG  G+VT+EDV+E+IVGEI DE+D  
Sbjct  141  RPAVLIPEAKKLNVLLKEFRLSRNHMAIVVDEYGGVAGLVTIEDVLEQIVGEIDDEHDEA  200

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E+    T  I ++A+G + VDA T I+  ++      P+D  Y+T+ G V EA G++P T
Sbjct  201  ED---HTAQIAIQADGQYVVDALTPIEDFNERFGAAFPDD-DYDTIGGLVTEAIGHLPET  256

Query  426  GESIKV  409
            G+ + +
Sbjct  257  GDELTL  262



>ref|WP_045212316.1| magnesium transporter [Desulfobulbus alkaliphilus]
Length=280

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 83/122 (68%), Gaps = 6/122 (5%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +P YF+P++ ++ ++L EF+ +K+HMA++L+EYGGT G+VTLEDV+EEIVGEI DE D  
Sbjct  128  RPPYFIPETKNIKDVLLEFQTKKIHMAIILDEYGGTSGVVTLEDVLEEIVGEIEDEYDP-  186

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
                 K   I ++ +G + V   TS+D+L DEL I++    Q ET+ G+VC   G +P+ 
Sbjct  187  ----PKPQEIQVQQDGSYYVSGRTSLDELQDELGIEI-HSEQVETIGGYVCHIAGKVPQK  241

Query  426  GE  421
             E
Sbjct  242  EE  243



>ref|WP_043805614.1| magnesium transporter [Desulfovibrio africanus]
Length=271

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 86/126 (68%), Gaps = 6/126 (5%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +PA FVP++ +  ++LREF  R++HMA+ L+EYGGT G+VTLEDV+E+IVG+I DE+D +
Sbjct  118  RPAMFVPENKNARDMLREFLARRMHMAIALDEYGGTSGLVTLEDVIEQIVGDIEDEHDIQ  177

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E  +     I+    G   V   T+++ L++E  +++  D Q ET+ G++CE  G +PR+
Sbjct  178  EPEE-----ILFLDNGQLRVSGRTALEDLNEESGMRLSSD-QVETIGGYLCELTGRVPRS  231

Query  426  GESIKV  409
            G+S  V
Sbjct  232  GDSFVV  237



>ref|WP_029756608.1| hypothetical protein, partial [Planctomycetes bacterium SCGC 
AAA282-C19]
Length=262

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 87/131 (66%), Gaps = 10/131 (8%)
 Frame = -2

Query  795  IAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDEN  616
            I  KP   VP++  +  LL +F+  +VHMAVV++EYGGT G+VT+EDV+EEIVGEI DE+
Sbjct  107  ILRKP-IVVPETKLIQELLADFQTSEVHMAVVIDEYGGTAGLVTIEDVLEEIVGEIRDEH  165

Query  615  D---SKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAF  445
            D   S E + ++        E + +VD   ++D L+DEL I +PED +Y+T++GF+    
Sbjct  166  DDSVSDEPVLERID------ENLVEVDGRYNLDDLNDELGIHLPEDEEYDTIAGFLLAKL  219

Query  444  GYIPRTGESIK  412
            G++P  GE ++
Sbjct  220  GHVPLVGEVLE  230



>ref|WP_028575329.1| magnesium transporter [Desulfonatronovibrio hydrogenovorans]
Length=276

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 81/122 (66%), Gaps = 6/122 (5%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +  YF+P++ ++  +L +F+ RK+HMA+VL+EYGGT G+VTLEDV+EEIVGEI DE D  
Sbjct  127  RSPYFIPETKNIREVLLDFQSRKIHMAIVLDEYGGTSGVVTLEDVLEEIVGEIEDEYDP-  185

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
                 K   I +R +G F V   TS+D+L DEL I +  D Q ET+ G+VC   G +P+ 
Sbjct  186  ----PKPQEIQVRQDGSFYVSGRTSLDELKDELGIVIHSD-QVETIGGYVCHVAGKVPQK  240

Query  426  GE  421
             E
Sbjct  241  EE  242



>gb|EMG38623.1| CBS domain-containing protein [Desulfovibrio africanus PCS]
Length=283

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 86/126 (68%), Gaps = 6/126 (5%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +PA FVP++ +  ++LREF  R++HMA+ L+EYGGT G+VTLEDV+E+IVG+I DE+D +
Sbjct  130  RPAMFVPENKNARDMLREFLARRMHMAIALDEYGGTSGLVTLEDVIEQIVGDIEDEHDIQ  189

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E  +     I+    G   V   T+++ L++E  +++  D Q ET+ G++CE  G +PR+
Sbjct  190  EPEE-----ILFLDNGQLRVSGRTALEDLNEESGMRLSSD-QVETIGGYLCELTGRVPRS  243

Query  426  GESIKV  409
            G+S  V
Sbjct  244  GDSFVV  249



>ref|WP_031338019.1| magnesium transporter [Xylella fastidiosa]
Length=293

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 85/126 (67%), Gaps = 4/126 (3%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +P   +P+S  +  LL+EFR+   HMA+V++EYGG  G+VT+EDV+E+IVG+I DE+D  
Sbjct  141  RPVGMIPESKKLNVLLKEFRLSHNHMAIVVDEYGGVAGLVTIEDVLEQIVGDIDDEHDET  200

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E+   +T  I ++A+G + VDA T I+  ++    + P+D  Y+T+ G V EA G++P T
Sbjct  201  ED---QTNMIAIQADGCYIVDALTPIEDFNERFNAEFPDD-DYDTIGGLVTEAIGHLPET  256

Query  426  GESIKV  409
            G+ + +
Sbjct  257  GDELTI  262



>ref|WP_024749074.1| magnesium transporter [Xylella fastidiosa]
Length=293

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 85/126 (67%), Gaps = 4/126 (3%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +P   +P+S  +  LL+EFR+   HMA+V++EYGG  G+VT+EDV+E+IVG+I DE+D  
Sbjct  141  RPVGMIPESKKLNVLLKEFRLSHNHMAIVVDEYGGVAGLVTIEDVLEQIVGDIDDEHDET  200

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E+   +T  I ++A+G + VDA T I+  ++    + P+D  Y+T+ G V EA G++P T
Sbjct  201  ED---QTNMIAIQADGCYIVDALTPIEDFNERFNAEFPDD-DYDTIGGLVTEAIGHLPET  256

Query  426  GESIKV  409
            G+ + +
Sbjct  257  GDELTI  262



>ref|WP_018499215.1| membrane protein [Leptotrichia wadei]
Length=437

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 91/126 (72%), Gaps = 8/126 (6%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            K AYFVP +  +  LL EF+++++HMA+V++EYGGT GIVT+ED++EEIVGEI DE D +
Sbjct  279  KEAYFVPITKPLVELLEEFKLKQLHMAIVIDEYGGTQGIVTIEDLLEEIVGEIRDEFDQE  338

Query  606  EE-IQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPR  430
            EE IQ+      +R E IFD+  +T I++++D+LEI++P   +Y+T+SG++ +  G +  
Sbjct  339  EENIQQ------IR-EKIFDIRGDTPIEEINDKLEIEIPLSEEYDTISGYIQDKLGKVAE  391

Query  429  TGESIK  412
              + +K
Sbjct  392  VFDQVK  397



>ref|WP_017870940.1| MULTISPECIES: hemolysin [Deinococcus]
Length=446

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 88/124 (71%), Gaps = 6/124 (5%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +P +FVP++M + +LL + R +K HM++V++E+GGT+G+VTLED +EEIVGEI+DE D +
Sbjct  287  RPVFFVPEAMKIKDLLAKMRAKKSHMSIVVDEFGGTMGLVTLEDAIEEIVGEIYDETDEE  346

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPE-DHQYETVSGFVCEAFGYIPR  430
            EE       I++ AEGI+ +DA  ++ ++ + L   + E + +Y+T++GF+   FG IP 
Sbjct  347  EE-----QPIIVIAEGIYLMDAGLTVHEVEERLGTDIEEGEAEYDTLAGFMTNHFGDIPE  401

Query  429  TGES  418
             G+S
Sbjct  402  VGQS  405



>ref|WP_014451671.1| hemolysin [Fervidobacterium pennivorans]
 gb|AFG35231.1| CBS domain-containing protein [Fervidobacterium pennivorans DSM 
9078]
Length=442

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 98/162 (60%), Gaps = 13/162 (8%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +P  FVP+ M V  LL+EF+ +KVHMA+V++EYGGT GIVT+ED++EEI GEI DE D  
Sbjct  282  RPPLFVPEFMPVSELLKEFKAKKVHMAIVVDEYGGTAGIVTMEDILEEIFGEIMDEYDEG  341

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E     TG I    +  + VDA  S++ +  EL I+ PE  +++T++G++ E F +IP+ 
Sbjct  342  E----NTG-IKKINDNSYLVDATLSLNDIERELRIEFPEG-EFDTLAGYLLEKFKHIPKV  395

Query  426  GES-------IKVILEKSNQEEHNDYSGKESDQGDKNEKNQI  322
            GE+        KV+    N+ E    + K+     KN+  ++
Sbjct  396  GETYEDERIAFKVVAASRNKIEKVLVTIKQEKDAAKNQNKEV  437



>ref|WP_014866189.1| hypothetical protein [Methanoculleus bourgensis]
 ref|YP_006543928.1| hemolysin-related protein [Methanoculleus bourgensis MS2]
 emb|CCJ35212.1| hemolysin-related protein [Methanoculleus bourgensis MS2]
Length=426

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 86/132 (65%), Gaps = 7/132 (5%)
 Frame = -2

Query  804  VGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIF  625
            + D+ ++P  FVP+S  +  LL+E ++ K HMAVVL+EYG   GIVT+ED++EE+VGEI 
Sbjct  268  IKDLMYEPC-FVPESKKIDELLKELQVMKQHMAVVLDEYGSFAGIVTVEDMLEELVGEIM  326

Query  624  DENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAF  445
            DE D +E   +K G      EG++ VDA   +  L+++L + +PE   YET+ G V +  
Sbjct  327  DEFDEEEPEVQKIG------EGVYLVDAQAWVGHLNEDLNLSLPETDSYETIGGLVIDRL  380

Query  444  GYIPRTGESIKV  409
            G+IPR GE  ++
Sbjct  381  GHIPRRGEVARI  392



>ref|WP_021746245.1| CBS domain protein [Leptotrichia wadei]
 gb|ERK52801.1| CBS domain protein [Leptotrichia wadei F0279]
Length=437

 Score =   109 bits (273),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 91/126 (72%), Gaps = 8/126 (6%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            K AYFVP +  +  LL EF+++++HMA+V++EYGGT GIVT+ED++EEIVGEI DE D +
Sbjct  279  KEAYFVPITKPLVELLEEFKLKQLHMAIVIDEYGGTQGIVTIEDLLEEIVGEIRDEFDQE  338

Query  606  EE-IQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPR  430
            EE IQ+      +R E IFD+  +T I++++D+LEI++P   +Y+T+SG++ +  G +  
Sbjct  339  EENIQQ------IR-EKIFDIRGDTPIEEINDKLEIEIPLSEEYDTISGYIQDKLGKVAE  391

Query  429  TGESIK  412
              + +K
Sbjct  392  VFDQVK  397



>gb|ACV38099.1| CBS domain containing protein [Leptotrichia buccalis C-1013-b]
Length=427

 Score =   109 bits (272),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 91/126 (72%), Gaps = 8/126 (6%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            K AYFVP +  +  LL EF+++++HMA+V++EYGGT GIVT+ED++EEIVGEI DE D +
Sbjct  279  KEAYFVPITKPLVELLEEFKLKQLHMAIVIDEYGGTQGIVTIEDLLEEIVGEIRDEFDQE  338

Query  606  EE-IQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPR  430
            EE IQ+      +R E IFD+  +T I++++D+LEI++P   +Y+T+SG++ +  G +  
Sbjct  339  EENIQQ------IR-EKIFDIKGDTPIEEINDKLEIEIPLSEEYDTISGYIQDKLGKVAD  391

Query  429  TGESIK  412
              + +K
Sbjct  392  VFDQVK  397



>ref|WP_011786186.1| MULTISPECIES: magnesium transporter [Marinobacter]
 gb|ABM19816.1| transporter-associated region [Marinobacter hydrocarbonoclasticus 
VT8]
 emb|CCG96092.1| Magnesium and cobalt efflux protein corC [Marinobacter hydrocarbonoclasticus 
ATCC 49840]
 gb|ERS09861.1| magnesium transporter [Marinobacter sp. EN3]
 gb|ERS84379.1| magnesium transporter [Marinobacter sp. EVN1]
 gb|ERS89699.1| magnesium transporter [Marinobacter sp. C1S70]
Length=281

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 85/125 (68%), Gaps = 6/125 (5%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +P  FVP+S  +  LL+EF+  + HMA+V++EYGGT G++T+EDV+E+IVGEI DE+D  
Sbjct  137  RPPTFVPESKRLNQLLKEFKENRNHMAIVVDEYGGTAGLITIEDVLEQIVGEIEDEHDFD  196

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            EE      +I  R +G F V A T ID  ++  E  M E+ +++T+ G V + FG++PR 
Sbjct  197  EET-----HIKARGDGTFAVKAVTPIDDFNEFFETDMDEE-EFDTIGGLVLKEFGHLPRR  250

Query  426  GESIK  412
            GE+++
Sbjct  251  GETVE  255



>ref|WP_027700500.1| magnesium transporter [Xylella fastidiosa]
 gb|KFA40215.1| magnesium and cobalt efflux protein [Xylella fastidiosa]
Length=293

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 85/126 (67%), Gaps = 4/126 (3%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +P   +P+S  +  LL+EFR+   HMA+V++EYGG  G+VT+EDV+E+IVG+I DE+D  
Sbjct  141  RPVGMIPESKKLNVLLKEFRLSHNHMAIVVDEYGGVAGLVTIEDVLEQIVGDIDDEHDET  200

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E+   +T  I ++A+G + VDA T I+  ++    + P+D  Y+T+ G V EA G++P T
Sbjct  201  ED---QTKMIAIQADGCYIVDALTPIEDFNERFNAEFPDD-DYDTIGGLVTEAIGHLPET  256

Query  426  GESIKV  409
            G+ + +
Sbjct  257  GDELTI  262



>gb|AAF83711.1|AE003930_1 polar amino acid transporter [Xylella fastidiosa 9a5c]
 gb|ETE30520.1| magnesium transporter [Xylella fastidiosa 32]
Length=323

 Score =   108 bits (270),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 85/126 (67%), Gaps = 4/126 (3%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +P   +P+S  +  LL+EFR+   HMA+V++EYGG  G+VT+EDV+E+IVG+I DE+D  
Sbjct  171  RPVGMIPESKKLNVLLKEFRLSHNHMAIVVDEYGGVAGLVTIEDVLEQIVGDIDDEHDET  230

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E+   +T  I ++A+G + VDA T I+  ++    + P+D  Y+T+ G V EA G++P T
Sbjct  231  ED---QTNMIAIQADGCYIVDALTPIEDFNERFNAEFPDD-DYDTIGGLVTEAIGHLPET  286

Query  426  GESIKV  409
            G+ + +
Sbjct  287  GDELTI  292



>ref|WP_015327511.1| CBS domain-containing protein [Halobacteroides halobius]
 gb|AGB41795.1| CBS domain-containing protein [Halobacteroides halobius DSM 5150]
Length=431

 Score =   109 bits (272),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 87/125 (70%), Gaps = 7/125 (6%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +PA++VP++  V NLL E +  K+HMA++L+EYGGT G+VT+ED++EEIVG+I DE D +
Sbjct  274  RPAFYVPETKKVDNLLSELKKEKIHMAIILDEYGGTAGLVTIEDLLEEIVGDIQDEYDEE  333

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E++ K     +L  + +  VD    ID++++ L I +PE+  YET+SGF+    GY+P  
Sbjct  334  EKLIK-----MLEDDELL-VDGRVDIDEINEVLGIDLPEE-DYETISGFILSMLGYVPDN  386

Query  426  GESIK  412
            GE I+
Sbjct  387  GERIE  391



>ref|WP_004089605.1| magnesium transporter [Xylella fastidiosa]
 gb|ADN62649.1| CBS domain-containing protein [Xylella fastidiosa subsp. fastidiosa 
GB514]
 gb|EGO81698.1| Mg2+ and Co2+ transporter [Xylella fastidiosa EB92.1]
 gb|EWG13707.1| hypothetical protein P910_002974 [Xylella fastidiosa Mul-MD]
 gb|KGM20500.1| magnesium transporter [Xylella fastidiosa]
Length=293

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 85/126 (67%), Gaps = 4/126 (3%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +P   +P+S  +  LL+EFR+   HMA+V++EYGG  G+VT+ED++E+IVG+I DE+D  
Sbjct  141  RPVGMIPESKKLNVLLKEFRLSHNHMAIVVDEYGGVAGLVTIEDILEQIVGDIDDEHDET  200

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E+   +T  I ++A+G + VDA T I+  ++    + P+D  Y+T+ G V EA G++P T
Sbjct  201  ED---QTNMIAIQADGCYIVDALTPIEDFNERFNAEFPDD-DYDTIGGLVTEAIGHLPET  256

Query  426  GESIKV  409
            G+ + +
Sbjct  257  GDELTI  262



>gb|AIC09877.1| magnesium transporter [Xylella fastidiosa subsp. sandyi Ann-1]
Length=323

 Score =   108 bits (269),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 85/126 (67%), Gaps = 4/126 (3%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +P   +P+S  +  LL+EFR+   HMA+V++EYGG  G+VT+EDV+E+IVG+I DE+D  
Sbjct  171  RPVGMIPESKKLNVLLKEFRLSHNHMAIVVDEYGGVAGLVTIEDVLEQIVGDIDDEHDET  230

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E+   +T  I ++A+G + VDA T I+  ++    + P+D  Y+T+ G V EA G++P T
Sbjct  231  ED---QTNMIAIQADGCYIVDALTPIEDFNERFNAEFPDD-DYDTIGGLVTEAIGHLPET  286

Query  426  GESIKV  409
            G+ + +
Sbjct  287  GDELTI  292



>ref|WP_031337019.1| magnesium transporter [Xylella fastidiosa]
Length=293

 Score =   107 bits (268),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 85/126 (67%), Gaps = 4/126 (3%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +P   +P+S  +  LL+EFR+   HMA+V++EYGG  G+VT+EDV+E+IVG+I DE+D  
Sbjct  141  RPVGMIPESKKLNVLLKEFRLSHNHMAIVVDEYGGVAGLVTIEDVLEQIVGDIDDEHDET  200

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E+   +T  I ++A+G + VDA T I+  ++    + P+D  Y+T+ G V EA G++P T
Sbjct  201  ED---QTNMIAIQADGCYIVDALTPIEDFNERFNAEFPDD-DYDTIGGLVTEAIGHLPET  256

Query  426  GESIKV  409
            G+ + +
Sbjct  257  GDELTL  262



>ref|WP_035253707.1| hypothetical protein, partial [Desulfatiglans anilini]
Length=259

 Score =   107 bits (267),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 90/151 (60%), Gaps = 18/151 (12%)
 Frame = -2

Query  798  DIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDE  619
            DI  KP +F P       LLRE R RK HMA++ +EYGGT GI+T+ED+VEEIVG+I DE
Sbjct  118  DILRKP-FFAPRGQLTGELLRELRARKTHMAILTDEYGGTAGIITIEDIVEEIVGDIMDE  176

Query  618  NDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGY  439
            +D++E +      + ++ +G   VDA    D+++D L++ +PE   +E+V G V + FG 
Sbjct  177  HDTEEPL------LSVQDDGSILVDARLEADEMADYLKVDLPEG-DFESVGGLVIQLFGG  229

Query  438  IPRTGESIKVILEKSNQEEHN-DYSGKESDQ  349
            IP  G  I           H+ D + KE+DQ
Sbjct  230  IPEKGACIPF---------HDFDITVKEADQ  251



>gb|EAO12510.1| CBS:Transporter-associated region [Xylella fastidiosa Dixon]
 gb|ACA12824.1| magnesium and cobalt efflux protein [Xylella fastidiosa M12]
 gb|ERI59947.1| magnesium transporter [Xylella fastidiosa subsp. multiplex Griffin-1]
Length=323

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 85/126 (67%), Gaps = 4/126 (3%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +P   +P+S  +  LL+EFR+   HMA+V++EYGG  G+VT+EDV+E+IVG+I DE+D  
Sbjct  171  RPVGMIPESKKLNVLLKEFRLSHNHMAIVVDEYGGVAGLVTIEDVLEQIVGDIDDEHDET  230

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E+   +T  I ++A+G + VDA T I+  ++    + P+D  Y+T+ G V EA G++P T
Sbjct  231  ED---QTKMIAIQADGCYIVDALTPIEDFNERFNAEFPDD-DYDTIGGLVTEAIGHLPET  286

Query  426  GESIKV  409
            G+ + +
Sbjct  287  GDELTI  292



>ref|WP_036130663.1| magnesium transporter [Marinobacter sp. AK21]
 gb|KEF31563.1| Magnesium and cobalt efflux protein CorC [Marinobacter sp. AK21]
Length=281

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 85/124 (69%), Gaps = 6/124 (5%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +P  FVP+S  +  LL+EF+  + HMA+V++EYGGT G++T+EDV+E+IVGEI DE+D  
Sbjct  137  RPPTFVPESKRLNQLLKEFKANRNHMAIVVDEYGGTAGLITIEDVLEQIVGEIEDEHDID  196

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            EE Q K      R +G + V A TS+D  ++  +  + E+ +++T+ G V + FG++PR 
Sbjct  197  EETQIKA-----RDDGSYAVKAATSVDDFNEFFQTDLDEE-EFDTIGGLVLKEFGHLPRR  250

Query  426  GESI  415
            GE++
Sbjct  251  GETV  254



>gb|AAO29617.1| magnesium and cobalt efflux protein [Xylella fastidiosa Temecula1]
 gb|ACB93286.1| CBS domain containing protein [Xylella fastidiosa M23]
Length=323

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 85/126 (67%), Gaps = 4/126 (3%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +P   +P+S  +  LL+EFR+   HMA+V++EYGG  G+VT+ED++E+IVG+I DE+D  
Sbjct  171  RPVGMIPESKKLNVLLKEFRLSHNHMAIVVDEYGGVAGLVTIEDILEQIVGDIDDEHDET  230

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E+   +T  I ++A+G + VDA T I+  ++    + P+D  Y+T+ G V EA G++P T
Sbjct  231  ED---QTNMIAIQADGCYIVDALTPIEDFNERFNAEFPDD-DYDTIGGLVTEAIGHLPET  286

Query  426  GESIKV  409
            G+ + +
Sbjct  287  GDELTI  292



>ref|WP_011994167.1| hemolysin [Fervidobacterium nodosum]
 gb|ABS60852.1| protein of unknown function DUF21 [Fervidobacterium nodosum Rt17-B1]
Length=443

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 83/124 (67%), Gaps = 10/124 (8%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +P  FVP+ M V  LL+EF+ +KVHMA+V++EYGGT GIVT+ED++EEI GEI DE D  
Sbjct  281  RPPLFVPEVMPVSELLKEFKSKKVHMAIVVDEYGGTAGIVTMEDILEEIFGEIMDEYDEH  340

Query  606  EE--IQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIP  433
            E   I+K   +  L       VDA  S++ +  EL I+ PE  ++ET++G++ + F +IP
Sbjct  341  ESTGIKKLDDFTYL-------VDATLSLNDIERELRIEFPEG-EFETLAGYLLDKFHHIP  392

Query  432  RTGE  421
            + GE
Sbjct  393  KVGE  396



>gb|ETE20127.1| magnesium transporter [Xylella fastidiosa 6c]
Length=323

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 85/126 (67%), Gaps = 4/126 (3%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +P   +P+S  +  LL+EFR+   HMA+V++EYGG  G+VT+EDV+E+IVG+I DE+D  
Sbjct  171  RPVGMIPESKKLNVLLKEFRLSHNHMAIVVDEYGGVAGLVTIEDVLEQIVGDIDDEHDET  230

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E+   +T  I ++A+G + VDA T I+  ++    + P+D  Y+T+ G V EA G++P T
Sbjct  231  ED---QTNMIAIQADGCYIVDALTPIEDFNERFNAEFPDD-DYDTIGGLVTEAIGHLPET  286

Query  426  GESIKV  409
            G+ + +
Sbjct  287  GDELTL  292



>ref|WP_044352178.1| hypothetical protein [Desulfarculus sp. SPR]
Length=281

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 89/135 (66%), Gaps = 10/135 (7%)
 Frame = -2

Query  816  ESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIV  637
            E++ + ++A KP +FVP +M +  LL  FR ++VH+AVV++EYGGT G+VTLEDV+EEIV
Sbjct  117  ETNNICEVARKP-FFVPQAMPLNELLTAFRRKRVHLAVVVDEYGGTAGVVTLEDVLEEIV  175

Query  636  GEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPE---DHQYETVS  466
            GEI DE D +E + ++      + +G   VDA   +++LS  L  ++PE   + ++ETV 
Sbjct  176  GEIEDEYDQEEHLSQR------QQDGSLVVDARLEVEELSGLLGYEVPEELPEGRFETVG  229

Query  465  GFVCEAFGYIPRTGE  421
            GF+    G +P  GE
Sbjct  230  GFITTYLGRVPNAGE  244



>gb|AIC13121.1| magnesium transporter [Xylella fastidiosa MUL0034]
Length=323

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 85/126 (67%), Gaps = 4/126 (3%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +P   +P+S  +  LL+EFR+   HMA+V++EYGG  G+VT+ED++E+IVG+I DE+D  
Sbjct  171  RPVGMIPESKKLNVLLKEFRLSHNHMAIVVDEYGGVAGLVTIEDILEQIVGDIDDEHDET  230

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E+   +T  I ++A+G + VDA T I+  ++    + P+D  Y+T+ G V EA G++P T
Sbjct  231  ED---QTNMIAIQADGCYIVDALTPIEDFNERFNAEFPDD-DYDTIGGLVTEAIGHLPET  286

Query  426  GESIKV  409
            G+ + +
Sbjct  287  GDELTI  292



>ref|WP_041378621.1| hypothetical protein, partial [Phycisphaera mikurensis]
Length=256

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 82/120 (68%), Gaps = 5/120 (4%)
 Frame = -2

Query  774  FVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSKEEIQ  595
             VP++ SV  +L EFR R+VH+AVVL+EYGGT G+VT+ED++EEIVGEI DE + K+E  
Sbjct  141  LVPETKSVREMLAEFRRRQVHLAVVLDEYGGTAGLVTIEDILEEIVGEIHDEYEEKDE--  198

Query  594  KKTGYIVLRAEGIFD-VDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRTGES  418
                 + + A+G    VDA   +D L+D + + +P+D  YET++GFV    G+IP  GE+
Sbjct  199  --EPALEMDADGRRAVVDARMHVDVLNDAMNLDLPDDGDYETLAGFVFSKLGHIPVAGEA  256



>ref|WP_018450991.1| membrane protein [Leptotrichia shahii]
Length=437

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 91/126 (72%), Gaps = 8/126 (6%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            K AYFVP +  +  LL EF+++++HMA+V++EYGGT GIVT+ED++EEIVGEI DE D +
Sbjct  279  KEAYFVPITKPLVELLEEFKLKQLHMAIVIDEYGGTQGIVTIEDLLEEIVGEIRDEFDQE  338

Query  606  EE-IQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPR  430
            EE IQ+      +R E IFD+  +T I++++D+LEI++P   +Y+T+SG++ +  G +  
Sbjct  339  EENIQQ------IR-EKIFDIKGDTPIEEVNDKLEIEIPLSEEYDTISGYIQDKLGKVAE  391

Query  429  TGESIK  412
              + ++
Sbjct  392  VFDQVR  397



>gb|KIA58756.1| magnesium transporter [Xylella fastidiosa]
Length=293

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 85/126 (67%), Gaps = 4/126 (3%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +P   +P+S  +  LL+EFR+   HMA+V++EYGG  G+VT+EDV+E+IVG+I DE+D  
Sbjct  141  RPVGMIPESKKLNVLLKEFRLSHNHMAIVVDEYGGVAGLVTIEDVLEQIVGDIDDEHDET  200

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E+   +T  I ++A+G + VDA T I+  ++    + P+D  Y+T+ G V EA G++P T
Sbjct  201  ED---QTKMIAIQADGCYIVDALTPIEDFNERFNAEFPDD-DYDTIGGLVTEAIGHLPET  256

Query  426  GESIKV  409
            G+ + +
Sbjct  257  GDELTL  262



>gb|KIX11391.1| hypothetical protein X474_24215 [Desulfarculus sp. SPR]
Length=290

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/135 (43%), Positives = 89/135 (66%), Gaps = 10/135 (7%)
 Frame = -2

Query  816  ESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIV  637
            E++ + ++A KP +FVP +M +  LL  FR ++VH+AVV++EYGGT G+VTLEDV+EEIV
Sbjct  126  ETNNICEVARKP-FFVPQAMPLNELLTAFRRKRVHLAVVVDEYGGTAGVVTLEDVLEEIV  184

Query  636  GEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPE---DHQYETVS  466
            GEI DE D +E + ++      + +G   VDA   +++LS  L  ++PE   + ++ETV 
Sbjct  185  GEIEDEYDQEEHLSQR------QQDGSLVVDARLEVEELSGLLGYEVPEELPEGRFETVG  238

Query  465  GFVCEAFGYIPRTGE  421
            GF+    G +P  GE
Sbjct  239  GFITTYLGRVPNAGE  253



>ref|WP_026816773.1| magnesium transporter [Arenimonas composti]
 gb|KFN51153.1| magnesium transporter [Arenimonas composti TR7-09 = DSM 18010]
Length=283

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 83/126 (66%), Gaps = 5/126 (4%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +PA  +P+S  +  LLREFR+ + HMA+V++E+GG  G+VT+EDV+E+IVGEI DE+D  
Sbjct  137  RPAVLIPESKRLNVLLREFRLSRNHMAIVVDEHGGVAGLVTIEDVLEQIVGEIDDEHDDL  196

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            +E +     I  +A+G F VDA T ID  ++      P+D +Y+T+ G V  A G++P  
Sbjct  197  DEAK----LIAAQADGQFMVDALTPIDDFNERFGADFPDD-EYDTIGGLVTSAIGHLPAA  251

Query  426  GESIKV  409
            GE + +
Sbjct  252  GEELAL  257



>gb|KDE55658.1| hypothetical protein EI28_05765 [Methanoculleus sp. MH98A]
Length=426

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 95/141 (67%), Gaps = 9/141 (6%)
 Frame = -2

Query  813  SSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVG  634
            S+ + ++ ++P YFVP+S  +  LL+E +++K HMAVVL+EYG   GIVT+ED++EE+VG
Sbjct  265  SATIRNLMYEP-YFVPESKKIDELLKELQVKKQHMAVVLDEYGSFAGIVTVEDMLEELVG  323

Query  633  EIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVC  454
            EI DE D +E   ++        +G++ VDA   ++ L+++LE+ +P    YE++ G V 
Sbjct  324  EIMDEFDEEEPEVQQV------EDGVYLVDARAWVEHLNEDLELSLPLTDAYESIGGLVI  377

Query  453  EAFGYIPRTGESIKVILEKSN  391
            +  G+IPR GE +K+  E+SN
Sbjct  378  DRLGHIPRRGEVVKI--EESN  396



>ref|WP_015869047.1| hemolysin [Kosmotoga olearia]
 gb|ACR80403.1| protein of unknown function DUF21 [Kosmotoga olearia TBF 19.5.1]
Length=459

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/139 (44%), Positives = 92/139 (66%), Gaps = 10/139 (7%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            LE + V ++  +P YFVP++  V +L++EF+ +K+H+A+V++EYGGT G+VT+ED++EE+
Sbjct  285  LEKTPVKEMMRQP-YFVPETKKVDDLMKEFKEQKIHLAIVVDEYGGTAGLVTMEDILEEL  343

Query  639  VGEIFDEND-SKEEIQ-KKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVS  466
             GEI DE D   EEI  KK G      + ++ VDA T I+ L  EL++K PE  +YET+ 
Sbjct  344  TGEILDEYDIEAEEITIKKVG------DNVYIVDAMTPINDLERELDVKFPE-TEYETIG  396

Query  465  GFVCEAFGYIPRTGESIKV  409
            G++ E     P  GE I V
Sbjct  397  GYLLEILERFPEIGERIVV  415



>ref|WP_011833650.1| hypothetical protein [Methanocorpusculum labreanum]
 ref|YP_001030714.1| aminotransferase class-III [Methanocorpusculum labreanum Z]
 gb|ABN07447.1| protein of unknown function DUF21 [Methanocorpusculum labreanum 
Z]
Length=420

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 81/125 (65%), Gaps = 6/125 (5%)
 Frame = -2

Query  780  AYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSKEE  601
             Y VP+S  +  LLRE ++R+VHMA+VL+E+GG  G+VT ED++EE+VG+I DE+D  E 
Sbjct  264  VYCVPESKKIDVLLRELQVRRVHMAIVLDEFGGFSGVVTFEDILEELVGDIMDESDGDE-  322

Query  600  IQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDH-QYETVSGFVCEAFGYIPRTG  424
                   I+   +G++ +DA   +  L++  +I +PED   YET+ G V    G+IPR G
Sbjct  323  ----VSDIIPIGDGLYMIDAQVRVALLNERFDISLPEDPGNYETIGGLVFSQLGHIPRLG  378

Query  423  ESIKV  409
            ESI +
Sbjct  379  ESIPL  383



>ref|WP_016196919.1| Hemolysin containing CBS domains [Arcticibacter svalbardensis]
 gb|EOR93129.1| Hemolysin containing CBS domains [Arcticibacter svalbardensis 
MN12-7]
Length=441

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 88/129 (68%), Gaps = 7/129 (5%)
 Frame = -2

Query  807  MVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEI  628
            +V +I  KP YF+P+S  + +L+ EF++R++ +A+VL+E+GGT G+VTLED+VEE+VGEI
Sbjct  283  LVSNIIRKP-YFIPESKKINDLMAEFQLRRIQIAIVLDEFGGTAGMVTLEDIVEELVGEI  341

Query  627  FDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEA  448
             DE D ++ I +K       +E  F V+A+ SI  +++ L   +PED  Y+TV G V + 
Sbjct  342  QDEFDEEKPIVEKV------SEHEFIVNASASIYDVNEHLPHDLPEDEDYDTVGGLVGDL  395

Query  447  FGYIPRTGE  421
            FG IP  GE
Sbjct  396  FGKIPEVGE  404



>ref|WP_034133389.1| hemolysin [Peptococcaceae bacterium BICA1-8]
 gb|KJS80399.1| hemolysin [Peptococcaceae bacterium BICA1-8]
Length=414

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 84/126 (67%), Gaps = 7/126 (6%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +PAY++P++  V +LL E R  KVHMA+V++EYGGT G+VT+EDV+EEI+G+I DE D +
Sbjct  270  RPAYYIPETKKVRDLLAELRQAKVHMAIVIDEYGGTAGLVTIEDVIEEIIGDIQDEFDIE  329

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            EE       IV+  +     DA  SI  +++ L I +P+D  +ET+SG V    G++P+ 
Sbjct  330  EE------SIVMLTDDAIRADARASIYDINESLNIDLPDD-DFETISGLVFHLLGHLPKE  382

Query  426  GESIKV  409
            GE + +
Sbjct  383  GEELSL  388



>ref|WP_042614392.1| magnesium transporter [Stenotrophomonas maltophilia]
 gb|KIP83743.1| magnesium transporter [Stenotrophomonas maltophilia]
Length=293

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 84/126 (67%), Gaps = 4/126 (3%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +PA  +P++  +  LL+EFR+ + HMA+V++EYGG  G+VT+EDV+E+IVGEI DE+D  
Sbjct  141  RPAVLIPEAKRLNVLLKEFRLSRNHMAIVVDEYGGVAGLVTIEDVLEQIVGEIDDEHDEA  200

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E+    T  I ++A+G + VDA T+I   ++      P+D  Y+T+ G V EA G++P  
Sbjct  201  ED---PTAGIAIQADGQYVVDALTAIGDFNERFGATFPDD-DYDTIGGLVTEAIGHLPEI  256

Query  426  GESIKV  409
            G+ + +
Sbjct  257  GDELAL  262



>ref|WP_022336358.1| cBS domain-containing protein [Firmicutes bacterium CAG:94]
 emb|CDD29226.1| cBS domain-containing protein [Firmicutes bacterium CAG:94]
Length=439

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 79/122 (65%), Gaps = 5/122 (4%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +PAYFVP++M   NL +E +  KVH+AVV++EYGGT GI+T+ED++EEIVG I+DE D  
Sbjct  286  RPAYFVPETMKADNLFKEMQKEKVHIAVVVDEYGGTEGIITMEDLLEEIVGNIYDEFDKA  345

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E+ +     IV   E  + +  +T I  L D+LE+ +PE   Y+T+ G +      IP+ 
Sbjct  346  EQPE-----IVPLGENQWRIAGSTPISTLVDDLELPLPESDDYDTLGGLIVTRLNAIPKD  400

Query  426  GE  421
            GE
Sbjct  401  GE  402



>ref|WP_034627367.1| magnesium transporter [Desulfovibrio africanus]
Length=271

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 85/126 (67%), Gaps = 6/126 (5%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +PA FVP++ +  ++LREF  R++HMA+ L+EYGGT G+VTLEDV+E+IVG+I DE+D +
Sbjct  118  RPAMFVPENKNARDMLREFLARRMHMAIALDEYGGTSGLVTLEDVIEQIVGDIEDEHDIQ  177

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E  +     I+    G   V    +++ L++E  +++  D Q ET+ G++CE  G +PR+
Sbjct  178  EPEE-----ILFLDNGQLRVSGRMALEDLNEESGMRLSSD-QVETIGGYLCELTGRVPRS  231

Query  426  GESIKV  409
            G+S  V
Sbjct  232  GDSFVV  237



>ref|WP_041281703.1| magnesium transporter [Desulfovibrio africanus]
Length=271

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 85/126 (67%), Gaps = 6/126 (5%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +PA FVP++ +  ++LREF  R++HMA+ L+EYGGT G+VTLEDV+E+IVG+I DE+D +
Sbjct  118  RPAMFVPENKNARDMLREFLARRMHMAIALDEYGGTSGLVTLEDVIEQIVGDIEDEHDIQ  177

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E  +     I+    G   V    +++ L++E  +++  D Q ET+ G++CE  G +PR+
Sbjct  178  EPEE-----ILFLDNGQLRVSGRMALEDLNEESGMRLSSD-QVETIGGYLCELTGRVPRS  231

Query  426  GESIKV  409
            G+S  V
Sbjct  232  GDSFVV  237



>ref|WP_029652822.1| magnesium transporter [Marinobacter daepoensis]
Length=281

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 86/125 (69%), Gaps = 6/125 (5%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +P  FVP+S  +  LL+EF+  + HMA+V++EYGGT G++T+EDV+E+IVGEI DE+D  
Sbjct  137  RPPNFVPESKRLNQLLKEFKENRNHMAIVVDEYGGTAGLITIEDVLEQIVGEIEDEHDFD  196

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            EE      +I  R +G F V A T +D  ++  + +M E+ +++T+ G V + FG++PR 
Sbjct  197  EET-----HIKARGDGTFAVKAVTPVDDFNEFFQTEMDEE-EFDTIGGLVLKEFGHLPRR  250

Query  426  GESIK  412
            GE+++
Sbjct  251  GEAVE  255



>gb|EGJ51024.1| CBS domain containing protein [Desulfovibrio africanus str. Walvis 
Bay]
Length=283

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 85/126 (67%), Gaps = 6/126 (5%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +PA FVP++ +  ++LREF  R++HMA+ L+EYGGT G+VTLEDV+E+IVG+I DE+D +
Sbjct  130  RPAMFVPENKNARDMLREFLARRMHMAIALDEYGGTSGLVTLEDVIEQIVGDIEDEHDIQ  189

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E  +     I+    G   V    +++ L++E  +++  D Q ET+ G++CE  G +PR+
Sbjct  190  EPEE-----ILFLDNGQLRVSGRMALEDLNEESGMRLSSD-QVETIGGYLCELTGRVPRS  243

Query  426  GESIKV  409
            G+S  V
Sbjct  244  GDSFVV  249



>ref|WP_028855778.1| membrane protein [Psychrilyobacter atlanticus]
Length=423

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 82/119 (69%), Gaps = 9/119 (8%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            + AYFVPD+ S+  +L EFR ++VHMAVVL+EYGGT+G+ T+ED++EEI+GEI DE D  
Sbjct  276  REAYFVPDTKSIVEILDEFRNKQVHMAVVLDEYGGTVGLATIEDLIEEIIGEIKDEYDLH  335

Query  606  E--EIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYI  436
            E  EI+K        +E  + VDA  +I+ L+ ELE+ +PE   YE++ G+V +  G +
Sbjct  336  EEDEIEK-------ISESKYRVDARINIEDLNKELELNIPESEDYESLGGYVLDILGRV  387



>ref|WP_011449949.1| hypothetical protein [Methanospirillum hungatei]
 ref|YP_504417.1| hypothetical protein Mhun_3011 [Methanospirillum hungatei JF-1]
 gb|ABD42698.1| protein of unknown function DUF21 [Methanospirillum hungatei 
JF-1]
Length=429

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 87/132 (66%), Gaps = 7/132 (5%)
 Frame = -2

Query  816  ESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIV  637
            ES  + ++  +P  FVP++ ++ +LLRE R +K HMA+VL+EYG  +GIVT+ED++EE+V
Sbjct  263  ESIPIVELLSEP-LFVPETKNIDDLLRELRAKKTHMAIVLDEYGSFVGIVTVEDILEELV  321

Query  636  GEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFV  457
            G+I DE D++E        +V  AE ++ VDA   ++ L+  L++ +P    YET++G V
Sbjct  322  GDILDEFDTEEH------ELVRVAEDVYSVDARMWVEDLNKHLDLHLPTSETYETIAGLV  375

Query  456  CEAFGYIPRTGE  421
             E  G IPR G+
Sbjct  376  IERLGNIPRIGD  387



>ref|WP_011530418.1| hypothetical protein [Deinococcus geothermalis]
 gb|ABF45581.1| CBS domain-containing protein DUF21 [Deinococcus geothermalis 
DSM 11300]
Length=446

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 92/135 (68%), Gaps = 7/135 (5%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+ +++ D+ H P +FVP+ M + +LL + R +K HMA+V++E+GGT G+VTLED +EEI
Sbjct  277  LDETLIADVMH-PVFFVPEGMKINDLLAKMREKKSHMAIVVDEFGGTSGLVTLEDALEEI  335

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPE-DHQYETVSG  463
            VGEI+DE D +E+       I +  EGI+ +DA+ ++ ++ + L   + + + +Y+T+SG
Sbjct  336  VGEIYDETDEEEQ-----PLIEVLGEGIYLMDASLTVGEVEERLGTNLEDGEGEYDTLSG  390

Query  462  FVCEAFGYIPRTGES  418
            F+   FG IP  G+S
Sbjct  391  FMTSHFGDIPEIGQS  405



>ref|WP_024870404.1| magnesium transporter [Pseudoxanthomonas suwonensis]
Length=294

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 83/126 (66%), Gaps = 4/126 (3%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +PA  +P+S  +  LL+EFR+ + HMA+V++EYGG  G+VT+EDV+E+IVGEI DE+D  
Sbjct  141  RPAVLIPESKKLNLLLKEFRLSRNHMAIVVDEYGGVAGLVTIEDVLEQIVGEIDDEHDEA  200

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E+    +  I  +A+G F VDA T I   ++     + +D +Y+T+ G V EA G++P  
Sbjct  201  ED---ASALIAAQADGQFVVDALTPIGDFNERFGATLSDD-EYDTIGGLVTEAIGHLPEV  256

Query  426  GESIKV  409
            GE + +
Sbjct  257  GEELTL  262



>ref|WP_017873431.1| hypothetical protein [Candidatus Caldatribacterium saccharofermentans]
Length=442

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 84/126 (67%), Gaps = 6/126 (5%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +P +FVP +  V  LLRE + R++HMA+VL+EYGGT G+VT+ED++EE+VGEI DE+D +
Sbjct  286  RPIHFVPATKKVVELLRELQQRRIHMAIVLDEYGGTAGLVTIEDLLEELVGEIRDEHDRE  345

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
                +K       ++  + VDA+  I+ +++ L +++PE  + ET+ G V E  G IP  
Sbjct  346  APPYRKI------SDREYLVDASLPIETVNETLGVQIPESEESETLGGLVMELLGKIPEE  399

Query  426  GESIKV  409
            GE++ +
Sbjct  400  GETVSI  405



>ref|WP_024268162.1| Magnesium and cobalt efflux protein CorC [Salinispira pacifica]
 gb|AHC15245.1| Magnesium and cobalt efflux protein CorC [Salinispira pacifica]
Length=261

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 83/123 (67%), Gaps = 7/123 (6%)
 Frame = -2

Query  780  AYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSKEE  601
            AYFVP+SM +  LLRE + R+VH+AVV++EYGG  GIV +ED++EEI+G+I DE D++ E
Sbjct  114  AYFVPESMKLDALLREMKRRRVHIAVVVDEYGGMSGIVCMEDILEEIIGDIQDEFDNERE  173

Query  600  IQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRTGE  421
               K G      EG++  DA  +ID L +EL I +P D  ++T+ G+V + FG IP   E
Sbjct  174  DVIKIG------EGVYLCDARVNIDDLDEELGINLPFD-DFDTLGGYVFDLFGKIPVKFE  226

Query  420  SIK  412
             ++
Sbjct  227  KVE  229



>ref|WP_012827702.1| hypothetical protein [Haliangium ochraceum]
 gb|ACY15094.1| protein of unknown function DUF21 [Haliangium ochraceum DSM 14365]
Length=420

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 86/132 (65%), Gaps = 7/132 (5%)
 Frame = -2

Query  804  VGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIF  625
            V ++A +PA FVP++M   +LL E +    HMA+V++EYGG +GIVT+ED++EE+VGEI 
Sbjct  270  VAEVA-RPATFVPETMPAGDLLVELQKTGRHMAIVVDEYGGAVGIVTVEDLLEEVVGEID  328

Query  624  DENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAF  445
            DE+D      +    I     G++ V A T +++L++EL + +PE   YETV+G + + F
Sbjct  329  DEHD------RPPALIRPERPGVWWVAARTPVERLNEELSLSLPESEDYETVAGLLLDHF  382

Query  444  GYIPRTGESIKV  409
              IP  GES+ +
Sbjct  383  KRIPEQGESMVI  394



>ref|WP_013932281.1| hemolysin [Thermotoga thermarum]
 gb|AEH51061.1| CBS domain containing protein [Thermotoga thermarum DSM 5069]
Length=431

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 89/134 (66%), Gaps = 11/134 (8%)
 Frame = -2

Query  804  VGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIF  625
            V +I  +P  FVP++M V  LL+ F+ +KVH+A+V++E+GGT GIVTLED++EE+VGEI 
Sbjct  275  VKEIMREPI-FVPETMKVSTLLKIFKEKKVHLAIVVDEFGGTAGIVTLEDILEELVGEIM  333

Query  624  DENDSKE--EIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCE  451
            DE D  E  EI+K        +E  + V A   I+ L  EL++++PE  ++ET++GF+ E
Sbjct  334  DEYDYDEVNEIKK-------ISENTYLVKATIPINDLERELDVELPET-EHETLAGFLLE  385

Query  450  AFGYIPRTGESIKV  409
             F  IP  GE I V
Sbjct  386  FFQRIPSVGEEITV  399



>ref|WP_017888996.1| hypothetical protein [Candidatus Caldatribacteirum californiense]
Length=442

 Score =   107 bits (266),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 84/126 (67%), Gaps = 6/126 (5%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +P +FVP +  V  LLRE + R++HMA+VL+EYGGT G+VT+ED++EE+VGEI DE+D +
Sbjct  286  RPIHFVPATKKVVELLRELQQRRIHMAIVLDEYGGTAGLVTIEDLLEELVGEIRDEHDRE  345

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
                +K       ++  + VDA+  I+ +++ L +++PE  + ET+ G V E  G IP  
Sbjct  346  APPYRKI------SDREYLVDASLPIETVNETLGVQIPESEESETLGGLVMELLGKIPEE  399

Query  426  GESIKV  409
            GE++ +
Sbjct  400  GETVSI  405



>ref|WP_037042421.1| magnesium transporter [Pseudomonas sp. BAY1663]
 gb|EXF44101.1| metal ion transporter [Pseudomonas sp. BAY1663]
Length=279

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 98/179 (55%), Gaps = 37/179 (21%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +PA FVP+S  +  LLREFR    HMA+V++EYGG  G+VT+EDV+E+IVG+I DE+D +
Sbjct  135  RPATFVPESKRLNVLLREFRANHNHMAIVIDEYGGVAGLVTIEDVLEQIVGDIEDEHDVE  194

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E+      YI     G F V A T ID  ++      P+D +++TV+G V   FG++P+ 
Sbjct  195  ED-----SYIRPLPSGDFLVKALTPIDSFNEYFGSAFPDD-EFDTVAGLVMSTFGHLPK-  247

Query  426  GESIKVILEKSNQEEHNDYSGKESDQGDKNEKNQI--YKLEILAGNARKVSAVRFERIN  256
                                        +NE  +I  +++ +L  ++R+V  +RF R+N
Sbjct  248  ----------------------------RNEVTEIDGFRVRVLNADSRRVHMLRFSRLN  278



>ref|WP_043106924.1| magnesium/cobalt efflux protein CorC [endosymbiont of unidentified 
scaly snail isolate Monju]
 dbj|BAN68203.1| magnesium and cobalt transporter [endosymbiont of unidentified 
scaly snail isolate Monju]
Length=291

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 82/126 (65%), Gaps = 6/126 (5%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            + A FVP+S  +  LLREFR  + HMA+V++EYG   G+VT+EDV+E+IVGEI DE D  
Sbjct  137  RSAVFVPESKRLDVLLREFRASRSHMAIVVDEYGAAAGLVTIEDVLEQIVGEIEDEYDFD  196

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            E       +I+ R E  +   A+TSI+  +   E+ +P D  Y+T+ G V +AFG +P+ 
Sbjct  197  E-----GAFIMRRDENHYTAKAHTSIEDFNAYFEVDLP-DEGYDTIGGLVLKAFGRMPKR  250

Query  426  GESIKV  409
            GES++V
Sbjct  251  GESVEV  256



>ref|WP_027832709.1| magnesium transporter [Marinobacter sp. HL-58]
Length=283

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 86/125 (69%), Gaps = 6/125 (5%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +P  FVP+S  +  LL+EF+  + HMA+V++EYGGT G++T+EDV+E+IVGEI DE+D  
Sbjct  138  RPPTFVPESKRLNQLLKEFKETRNHMAIVVDEYGGTAGLITIEDVLEQIVGEIEDEHDFD  197

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            EE      +I  R +G + V A T +D  ++  E ++ E+ +++T+ G V + FG++PR 
Sbjct  198  EET-----HIKARGDGTYAVKAVTPVDDFNEFFETELDEE-EFDTIGGVVLKEFGHLPRR  251

Query  426  GESIK  412
            GES++
Sbjct  252  GESVE  256



>ref|WP_011844812.1| hypothetical protein [Methanoculleus marisnigri]
 ref|YP_001047885.1| hypothetical protein Memar_1977 [Methanoculleus marisnigri JR1]
 gb|ABN57903.1| protein of unknown function DUF21 [Methanoculleus marisnigri 
JR1]
Length=426

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 94/141 (67%), Gaps = 9/141 (6%)
 Frame = -2

Query  813  SSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVG  634
            S+ +  + ++P YFVP+S  +  LL+E +++K HMAVVL+EYG   GIVT+ED++EE+VG
Sbjct  265  SATIPSLMYEP-YFVPESKKIDELLKELQVKKQHMAVVLDEYGSFAGIVTVEDMLEELVG  323

Query  633  EIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVC  454
            EI DE D +E   ++        EG++ VDA   ++ L+++LE+ +P    YE++ G V 
Sbjct  324  EIMDEFDEEEPEVQQV------EEGVYLVDARAWVEHLNEDLELFLPLTDAYESIGGLVI  377

Query  453  EAFGYIPRTGESIKVILEKSN  391
            +  G+IPR GE +K+  E+SN
Sbjct  378  DRLGHIPRRGEVVKI--EESN  396



>ref|WP_034383947.1| hemolysin [Deinococcus sp. YIM 77859]
Length=446

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 92/135 (68%), Gaps = 7/135 (5%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+  ++ D+  +P YFVP+ M + +LL + R +K HMA+V++E+GGT G+VTLED +EEI
Sbjct  277  LDEILIADVM-RPVYFVPEGMKINDLLAKMREKKSHMAIVVDEFGGTAGLVTLEDALEEI  335

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPE-DHQYETVSG  463
            VGEI+DE D +E+       I + AEG++ +DA+ ++ ++ + L   + + + +Y+T+SG
Sbjct  336  VGEIYDETDEEEK-----PLIEVLAEGVYLMDASLTVGEVEERLGTNLEDGEGEYDTLSG  390

Query  462  FVCEAFGYIPRTGES  418
            F+   FG IP  G+S
Sbjct  391  FMTSHFGDIPEVGQS  405



>ref|WP_012209613.1| hemolysin [Petrotoga mobilis]
 gb|ABX32516.1| protein of unknown function DUF21 [Petrotoga mobilis SJ95]
Length=448

 Score =   106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 97/177 (55%), Gaps = 26/177 (15%)
 Frame = -2

Query  819  LESSMVGDIAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEI  640
            L+   V +I HKP +FVP +M + ++ R F     HMA+V++EYGGT G+VTLED++EE+
Sbjct  278  LQKLRVVEIMHKP-FFVPITMKIRDVFRLFLNNHTHMAIVVDEYGGTAGLVTLEDIIEEM  336

Query  639  VGEIFDENDSKEEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGF  460
             GEIFDE D   +       I+  AE +  VD  T I+ +  EL+I+ PE  ++ET+ GF
Sbjct  337  TGEIFDEYDDYSDETN----IIRVAENVILVDGTTPINDVERELDIEFPET-EFETIGGF  391

Query  459  VCEAFGYIPRTGE--------------------SIKVILEKSNQEEHNDYSGKESDQ  349
            + E F   P+ GE                     +K+ +    Q E+ + +GKE D+
Sbjct  392  LLERFKRFPKPGEIYYIENIEFEIVSVTINKIDKVKITVHPKMQTENQEGTGKEKDE  448



>ref|WP_034222801.1| magnesium transporter [Arenimonas donghaensis]
Length=282

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 83/126 (66%), Gaps = 5/126 (4%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +PA  +P+S  +  LL+EFR+ + HMA+V++E+GG  G+VT+EDV+E+IVGEI DE+D  
Sbjct  136  RPAVLIPESKRLNVLLKEFRLSRNHMAIVVDEHGGVAGLVTIEDVLEQIVGEIDDEHDDA  195

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            +E    T  I  +A+G + VDA T I+  ++      PED +Y+T+ G V  A G++P  
Sbjct  196  DE----TKLIAAQADGQYLVDALTPIEDFNERFGADFPED-EYDTIGGLVTAAIGHLPEA  250

Query  426  GESIKV  409
            GE + +
Sbjct  251  GEELAL  256



>ref|WP_008938972.1| Magnesium and cobalt efflux protein corC [Marinobacter santoriniensis]
 gb|EMP56027.1| Magnesium and cobalt efflux protein corC [Marinobacter santoriniensis 
NKSG1]
Length=281

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 85/125 (68%), Gaps = 6/125 (5%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +P  FVP+S  +  LL+EF+  + HMA+V++EYGGT G++T+EDV+E+IVGEI DE+D  
Sbjct  137  RPPTFVPESKRLNQLLKEFKENRNHMAIVVDEYGGTAGLITIEDVLEQIVGEIEDEHDFD  196

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            EE   K      R +G F V A TSI+  ++  +  + E+ +++T+ G V + FG++PR 
Sbjct  197  EETNIKA-----RGDGTFAVKAATSIEDFNEFFQTDLDEE-EFDTIGGVVLKEFGHLPRR  250

Query  426  GESIK  412
            GE+++
Sbjct  251  GETVE  255



>ref|WP_008170107.1| MULTISPECIES: magnesium transporter [Marinobacter]
 gb|ADP98234.1| metal ion transporter [Marinobacter adhaerens HP15]
 gb|EHJ06038.1| transporter-associated region [Marinobacter manganoxydans MnI7-9]
Length=281

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 85/125 (68%), Gaps = 6/125 (5%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +P  FVP+S  +  LL+EF+  + HMA+V++EYGGT G++T+EDV+E+IVGEI DE+D  
Sbjct  137  RPPTFVPESKRLNQLLKEFKENRNHMAIVVDEYGGTAGLITIEDVLEQIVGEIEDEHDFD  196

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            EE   K      R +G + V A T ID  ++  E ++ E+ +++T+ G V + FG++PR 
Sbjct  197  EETHIKA-----RGDGSYAVKAVTPIDDFNEFFETELDEE-EFDTIGGVVLKEFGHLPRR  250

Query  426  GESIK  412
            GES++
Sbjct  251  GESVE  255



>ref|WP_041332418.1| magnesium transporter [Marinobacter salarius]
 gb|AHI30435.1| magnesium transporter [Marinobacter salarius]
Length=283

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 86/125 (69%), Gaps = 6/125 (5%)
 Frame = -2

Query  786  KPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGEIFDENDSK  607
            +P  FVP+S  +  LL+EF+  + HMA+V++EYGGT G++T+EDV+E+IVGEI DE+D  
Sbjct  138  RPPTFVPESKRLNQLLKEFKETRNHMAIVVDEYGGTAGLITIEDVLEQIVGEIEDEHDFD  197

Query  606  EEIQKKTGYIVLRAEGIFDVDANTSIDQLSDELEIKMPEDHQYETVSGFVCEAFGYIPRT  427
            EE      +I  R +G + V A T +D  ++  E ++ E+ +++T+ G V + FG++PR 
Sbjct  198  EET-----HIKARGDGTYAVKAVTPVDDFNEFFETELDEE-EFDTIGGVVLKEFGHLPRR  251

Query  426  GESIK  412
            GES++
Sbjct  252  GESVE  256



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1752198629708