BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13794

Length=1429
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006350379.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    539   0.0      Solanum tuberosum [potatoes]
ref|XP_009623368.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    537   0.0      Nicotiana tomentosiformis
ref|NP_001234574.1|  succinyl-CoA ligase [ADP-forming] subunit al...    537   0.0      Solanum lycopersicum
gb|AIS71903.1|  mitochondrial succinyl-CoA ligase ADP-forming sub...    534   0.0      Nicotiana tabacum [American tobacco]
ref|XP_006348504.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    532   0.0      Solanum tuberosum [potatoes]
ref|XP_009781531.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    530   0.0      Nicotiana sylvestris
gb|AFL48180.1|  succinyl-CoA synthetase                                 525   0.0      Capsicum annuum
ref|NP_001234277.1|  succinyl-CoA ligase [ADP-forming] subunit al...    523   0.0      
emb|CDP14400.1|  unnamed protein product                                521   2e-180   Coffea canephora [robusta coffee]
ref|XP_009355925.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    513   3e-177   Pyrus x bretschneideri [bai li]
ref|XP_011091459.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    509   1e-175   Sesamum indicum [beniseed]
gb|EPS68438.1|  hypothetical protein M569_06331                         507   5e-175   Genlisea aurea
ref|XP_008467310.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    507   5e-175   Cucumis melo [Oriental melon]
gb|KJB79846.1|  hypothetical protein B456_013G069200                    507   5e-175   Gossypium raimondii
gb|EYU19899.1|  hypothetical protein MIMGU_mgv1a009825mg                504   5e-174   Erythranthe guttata [common monkey flower]
ref|XP_010934473.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    503   2e-173   Elaeis guineensis
ref|XP_004137529.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    503   4e-173   Cucumis sativus [cucumbers]
ref|XP_007152547.1|  hypothetical protein PHAVU_004G139300g             501   6e-173   Phaseolus vulgaris [French bean]
gb|ABK95068.1|  unknown                                                 501   7e-173   Populus trichocarpa [western balsam poplar]
ref|XP_008375061.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    501   1e-172   Malus domestica [apple tree]
gb|KHG06820.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha-2...    501   1e-172   Gossypium arboreum [tree cotton]
ref|XP_002514510.1|  Succinyl-CoA ligase [GDP-forming] subunit al...    500   3e-172   Ricinus communis
ref|XP_009413310.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    500   4e-172   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011022031.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    499   4e-172   Populus euphratica
ref|XP_002307162.2|  hypothetical protein POPTR_0005s09370g             499   4e-172   
emb|CDX81092.1|  BnaC03g03460D                                          499   6e-172   
ref|XP_009136375.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    499   7e-172   Brassica rapa
ref|XP_004299462.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    499   8e-172   Fragaria vesca subsp. vesca
emb|CDY61908.1|  BnaC07g49680D                                          499   9e-172   Brassica napus [oilseed rape]
ref|XP_002460917.1|  hypothetical protein SORBIDRAFT_02g037420          498   1e-171   Sorghum bicolor [broomcorn]
ref|XP_006399319.1|  hypothetical protein EUTSA_v10013993mg             499   1e-171   Eutrema salsugineum [saltwater cress]
ref|XP_010423114.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    498   2e-171   Camelina sativa [gold-of-pleasure]
ref|XP_006493424.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    499   2e-171   Citrus sinensis [apfelsine]
ref|XP_009125723.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    498   4e-171   Brassica rapa
ref|XP_002514509.1|  Succinyl-CoA ligase [GDP-forming] subunit al...    497   4e-171   Ricinus communis
ref|XP_010491456.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    498   4e-171   Camelina sativa [gold-of-pleasure]
sp|Q6ZL94.1|SUCA_ORYSJ  RecName: Full=Probable succinyl-CoA ligas...    497   4e-171   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007209332.1|  hypothetical protein PRUPE_ppa008341mg             497   5e-171   Prunus persica
ref|XP_003562832.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    497   5e-171   Brachypodium distachyon [annual false brome]
gb|KHG04322.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha-1...    497   5e-171   Gossypium arboreum [tree cotton]
ref|XP_010452813.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    497   5e-171   Camelina sativa [gold-of-pleasure]
ref|XP_008788992.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    497   6e-171   Phoenix dactylifera
ref|XP_002271746.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    496   6e-171   Vitis vinifera
ref|XP_008796686.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    497   6e-171   Phoenix dactylifera
ref|XP_006394592.1|  hypothetical protein EUTSA_v10004347mg             499   6e-171   
ref|XP_003548295.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    496   7e-171   Glycine max [soybeans]
ref|NP_196447.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha-1     497   7e-171   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004958125.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    496   9e-171   Setaria italica
ref|XP_002871316.1|  hypothetical protein ARALYDRAFT_487662             497   9e-171   
ref|XP_012079367.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    496   1e-170   Jatropha curcas
ref|XP_006441425.1|  hypothetical protein CICLE_v10020931mg             496   1e-170   Citrus clementina [clementine]
ref|XP_006288079.1|  hypothetical protein CARUB_v10001317mg             496   1e-170   Capsella rubella
ref|XP_002872045.1|  hypothetical protein ARALYDRAFT_489184             496   1e-170   
ref|XP_008393504.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    496   1e-170   Malus domestica [apple tree]
ref|XP_010547709.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    496   1e-170   Tarenaya hassleriana [spider flower]
dbj|BAJ94034.1|  predicted protein                                      496   1e-170   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK03449.1|  predicted protein                                      495   2e-170   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY02216.1|  BnaA03g39510D                                          496   2e-170   
ref|XP_011047755.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    495   3e-170   Populus euphratica
ref|NP_001136494.1|  succinyl-CoA ligase alpha-chain 2                  494   3e-170   Zea mays [maize]
ref|XP_009131054.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    495   3e-170   Brassica rapa
emb|CDX78333.1|  BnaA03g02450D                                          495   4e-170   
ref|NP_001241205.1|  uncharacterized protein LOC100782001               494   4e-170   Glycine max [soybeans]
gb|ABK94372.1|  unknown                                                 494   6e-170   Populus trichocarpa [western balsam poplar]
emb|CDY21531.1|  BnaC09g47610D                                          494   6e-170   Brassica napus [oilseed rape]
emb|CDX69957.1|  BnaA10g23060D                                          494   9e-170   
ref|XP_006437603.1|  hypothetical protein CICLE_v10032075mg             493   2e-169   Citrus clementina [clementine]
emb|CBI35274.3|  unnamed protein product                                493   2e-169   Vitis vinifera
ref|XP_006484523.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    493   2e-169   Citrus sinensis [apfelsine]
ref|XP_002268479.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    492   4e-169   Vitis vinifera
gb|ACG31861.1|  succinyl-CoA ligase alpha-chain 2                       491   4e-169   Zea mays [maize]
ref|NP_001149702.1|  succinyl-CoA ligase alpha-chain 2                  492   5e-169   Zea mays [maize]
ref|NP_197716.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha-2     492   6e-169   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011624630.1|  PREDICTED: LOW QUALITY PROTEIN: probable suc...    491   9e-169   Amborella trichopoda
ref|XP_007043270.1|  Succinyl-CoA ligase, alpha subunit                 492   9e-169   
ref|XP_012079379.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    491   1e-168   Jatropha curcas
ref|XP_003620150.1|  Succinyl-CoA ligase                                490   2e-168   Medicago truncatula
gb|KJB31853.1|  hypothetical protein B456_005G211200                    491   2e-168   Gossypium raimondii
ref|XP_004515280.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    489   4e-168   Cicer arietinum [garbanzo]
gb|AAM65450.1|  succinyl-CoA synthetase, alpha subunit                  490   4e-168   Arabidopsis thaliana [mouse-ear cress]
gb|AGT16123.1|  succinyl-CoA ligase                                     494   5e-168   Saccharum hybrid cultivar R570
ref|XP_011003681.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    491   6e-168   Populus euphratica
ref|XP_006658733.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    488   6e-168   Oryza brachyantha
gb|KFK27646.1|  hypothetical protein AALP_AA8G410300                    488   2e-167   Arabis alpina [alpine rockcress]
ref|XP_010546242.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    488   3e-167   Tarenaya hassleriana [spider flower]
ref|XP_010241497.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    488   3e-167   Nelumbo nucifera [Indian lotus]
ref|XP_010493442.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    486   9e-167   Camelina sativa [gold-of-pleasure]
emb|CAA48891.1|  succinate--CoA ligase (GDP-forming)                    486   1e-166   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454606.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    486   1e-166   Camelina sativa [gold-of-pleasure]
ref|XP_009122444.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    486   1e-166   Brassica rapa
ref|XP_001765853.1|  predicted protein                                  484   3e-166   
ref|XP_006288023.1|  hypothetical protein CARUB_v10001256mg             486   3e-166   
ref|XP_010421123.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    484   7e-166   Camelina sativa [gold-of-pleasure]
ref|XP_001762925.1|  predicted protein                                  483   8e-166   
gb|KHN23614.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha-1...    483   3e-165   Glycine soja [wild soybean]
ref|XP_010923343.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    482   4e-165   Elaeis guineensis
ref|XP_010069514.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    482   5e-165   Eucalyptus grandis [rose gum]
ref|XP_010031908.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    481   1e-164   Eucalyptus grandis [rose gum]
ref|XP_010688675.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    480   2e-164   Beta vulgaris subsp. vulgaris [field beet]
gb|EMT17065.1|  Putative succinyl-CoA ligase (GDP-forming) subuni...    480   5e-164   
ref|XP_008240339.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    478   1e-163   Prunus mume [ume]
ref|XP_009389047.1|  PREDICTED: probable succinyl-CoA ligase [ADP...    478   2e-163   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY44764.1|  BnaC02g01230D                                          474   4e-162   Brassica napus [oilseed rape]
gb|KHN24503.1|  Succinyl-CoA ligase [ADP-forming] subunit alpha-1...    470   2e-160   Glycine soja [wild soybean]
gb|EMS53891.1|  putative succinyl-CoA ligase [ADP-forming] subuni...    468   5e-159   Triticum urartu
ref|XP_001693108.1|  succinyl-coa ligase alpha chain                    446   3e-151   Chlamydomonas reinhardtii
ref|XP_003078495.1|  putative succinyl-CoA ligase alpha subunit (...    445   1e-150   Ostreococcus tauri
gb|ABB29950.1|  succinyl-CoA ligase alpha 1 subunit-like                441   3e-150   Solanum tuberosum [potatoes]
ref|XP_002957241.1|  succinate-coa ligase alpha chain, succinyl-C...    442   1e-149   Volvox carteri f. nagariensis
gb|KDD74604.1|  hypothetical protein H632_c1190p0                       441   3e-149   Helicosporidium sp. ATCC 50920
ref|XP_001416813.1|  predicted protein                                  437   3e-147   Ostreococcus lucimarinus CCE9901
ref|XP_001780609.1|  predicted protein                                  431   7e-146   
ref|NP_001119263.1|  Succinyl-CoA ligase [GDP-forming] subunit al...    427   2e-144   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002507022.1|  succinate-coa ligase                               427   1e-143   Micromonas commoda
ref|XP_005643816.1|  succinyl-CoA ligase alpha chain                    425   2e-143   Coccomyxa subellipsoidea C-169
gb|ERN09415.1|  hypothetical protein AMTR_s00029p00055000               426   3e-143   Amborella trichopoda
gb|ACN28789.1|  unknown                                                 422   1e-142   Zea mays [maize]
gb|EEC82322.1|  hypothetical protein OsI_26601                          426   1e-141   Oryza sativa Indica Group [Indian rice]
ref|XP_011398589.1|  Succinyl-CoA ligase [ADP-forming] subunit al...    417   6e-140   Auxenochlorella protothecoides
ref|XP_005843440.1|  hypothetical protein CHLNCDRAFT_141133             417   1e-139   Chlorella variabilis
gb|EYU45725.1|  hypothetical protein MIMGU_mgv1a012075mg                410   3e-138   Erythranthe guttata [common monkey flower]
dbj|GAM28077.1|  hypothetical protein SAMD00019534_112530               411   2e-137   Acytostelium subglobosum LB1
ref|XP_004351803.1|  succinate-CoA ligase                               408   3e-136   Cavenderia fasciculata
ref|XP_009775900.1|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    403   2e-135   Nicotiana sylvestris
emb|CBJ28950.1|  Succinate--CoA ligase (GDP-forming), alpha subunit     406   2e-135   Ectocarpus siliculosus
ref|XP_007512066.1|  predicted protein                                  407   8e-135   Bathycoccus prasinos
ref|XP_009524111.1|  hypothetical protein PHYSODRAFT_557468             402   2e-134   Phytophthora sojae
gb|KDO21510.1|  succinyl-CoA ligase subunit alpha                       401   9e-134   Saprolegnia parasitica CBS 223.65
ref|XP_003054766.1|  predicted protein                                  401   9e-134   Micromonas pusilla CCMP1545
ref|XP_002610474.1|  hypothetical protein BRAFLDRAFT_124275             401   1e-133   Branchiostoma floridae
ref|XP_008905429.1|  succinyl-CoA ligase [GDP-forming] subunit al...    400   2e-133   Phytophthora parasitica INRA-310
ref|XP_002908607.1|  succinyl-CoA ligase subunit alpha, mitochond...    400   3e-133   Phytophthora infestans T30-4
ref|XP_008608930.1|  succinyl-CoA ligase [GDP-forming] subunit al...    399   5e-133   Saprolegnia diclina VS20
ref|XP_005837665.1|  hypothetical protein GUITHDRAFT_157241             399   5e-133   Guillardia theta CCMP2712
gb|ETP44985.1|  succinyl-CoA ligase [GDP-forming] subunit alpha, ...    399   8e-133   Phytophthora parasitica P10297
ref|XP_636263.1|  succinate-CoA ligase                                  396   8e-132   Dictyostelium discoideum AX4
gb|AAA85724.1|  succinyl coenzyme A synthetase alpha subunit            395   2e-131   Dictyostelium discoideum AX2
gb|ABW76150.1|  succinyl-CoA synthetase alpha subunit                   395   4e-131   Blastocystis sp. ATCC 50177/Nand II
ref|XP_003294260.1|  succinyl coenzyme A synthetase alpha subunit       394   4e-131   Dictyostelium purpureum
ref|XP_008871215.1|  succinyl-CoA ligase [GDP-forming] subunit al...    393   1e-130   Aphanomyces invadans
gb|KJB31856.1|  hypothetical protein B456_005G211200                    391   4e-130   Gossypium raimondii
gb|KJB79847.1|  hypothetical protein B456_013G069200                    389   9e-130   Gossypium raimondii
emb|CCI47060.1|  unnamed protein product                                390   1e-129   Albugo candida
emb|CCI47059.1|  unnamed protein product                                390   2e-129   Albugo candida
ref|WP_028099766.1|  succinate--CoA ligase                              387   1e-128   Dongia sp. URHE0060
ref|XP_001007751.3|  succinyl-CoA synthetase, alpha subunit famil...    388   1e-128   Tetrahymena thermophila SB210
emb|CBK25395.2|  Succinyl-CoA Synthetase subunit ? (SCS?)               388   2e-128   Blastocystis hominis
ref|XP_002289446.1|  precursor of synthetase                            387   2e-128   Thalassiosira pseudonana CCMP1335
ref|WP_046022538.1|  succinate--CoA ligase                              386   2e-128   Magnetospira sp. QH-2
emb|CBK19683.2|  Succinyl-CoA Synthetase subunit ? (SCS?)               387   3e-128   Blastocystis hominis
ref|WP_038538362.1|  MULTISPECIES: succinate--CoA ligase                386   4e-128   Candidatus Jidaibacter acanthamoeba
emb|CBK23557.2|  Succinyl-CoA Synthetase subunit ? (SCS?)               387   4e-128   Blastocystis hominis
ref|XP_009831202.1|  succinyl-CoA ligase [GDP-forming] subunit al...    386   6e-128   Aphanomyces astaci
emb|CCA20859.1|  unnamed protein product                                385   2e-127   Albugo laibachii Nc14
ref|WP_021777427.1|  3-oxoacyl-Acyl-carrier protein reductase           384   2e-127   Candidatus Micropelagos thuwalensis
ref|WP_009540580.1|  Succinyl-CoA ligase [ADP-forming] alpha chain      384   3e-127   Caenispirillum salinarum
ref|XP_002160938.2|  PREDICTED: succinyl-CoA ligase [ADP-forming]...    385   3e-127   
ref|WP_008519360.1|  succinyl-CoA synthetase subsunit alpha             383   4e-127   alpha proteobacterium IMCC14465
ref|WP_012110353.1|  succinyl-CoA synthetase subsunit alpha             383   4e-127   Parvibaculum lavamentivorans
gb|KDO52721.1|  hypothetical protein CISIN_1g0195001mg                  381   6e-127   Citrus sinensis [apfelsine]
ref|XP_008889195.1|  succinyl-CoA-synthetase alpha SCSA                 384   8e-127   
ref|XP_004029838.1|  succinyl-CoA synthetase, alpha subunit, puta...    383   1e-126   Ichthyophthirius multifiliis
ref|XP_009038265.1|  hypothetical protein AURANDRAFT_28269              383   1e-126   Aureococcus anophagefferens
ref|XP_002368454.1|  succinyl-CoA ligase alpha subunit, putative        383   2e-126   Toxoplasma gondii ME49
ref|XP_001425910.1|  hypothetical protein                               382   2e-126   Paramecium tetraurelia strain d4-2
ref|WP_028879580.1|  succinate--CoA ligase                              381   2e-126   Terasakiella pusilla
ref|XP_001442597.1|  hypothetical protein                               382   4e-126   Paramecium tetraurelia strain d4-2
ref|WP_014415904.1|  succinyl-CoA synthetase subsunit alpha             380   5e-126   Pararhodospirillum photometricum
dbj|GAA49470.1|  succinyl-CoA synthetase alpha subunit                  382   8e-126   Clonorchis sinensis [oriental liver fluke]
gb|ELU05339.1|  hypothetical protein CAPTEDRAFT_170724                  382   8e-126   Capitella teleta
ref|XP_001452638.1|  hypothetical protein                               380   1e-125   Paramecium tetraurelia strain d4-2
gb|ABE76513.1|  mitochondrial putative GDP-forming succinate-CoA ...    381   1e-125   Toxoplasma gondii
ref|WP_020401362.1|  succinyl-CoA synthetase subsunit alpha             379   2e-125   Kordiimonas gwangyangensis
ref|WP_014363954.1|  succinyl-CoA synthetase subsunit alpha             379   3e-125   Rickettsia canadensis
ref|XP_004995026.1|  succinyl-CoA ligase subunit alpha                  379   4e-125   Salpingoeca rosetta
ref|WP_045774326.1|  succinate--CoA ligase                              378   4e-125   Elstera litoralis
ref|XP_006441424.1|  hypothetical protein CICLE_v10020931mg             378   4e-125   
gb|EGV93208.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha, ...    380   4e-125   Cricetulus griseus [Chinese hamsters]
ref|WP_040257675.1|  MULTISPECIES: succinate--CoA ligase                378   5e-125   spotted fever group
gb|EFA80958.1|  Endo-beta-N-acetylglucosaminidase                       407   6e-125   Heterostelium album PN500
ref|XP_002772148.1|  Succinyl-CoA ligase, putative                      379   6e-125   Perkinsus marinus ATCC 50983
ref|WP_012151579.1|  succinyl-CoA ligase [ADP-forming] subunit alpha    377   7e-125   Rickettsia bellii
ref|WP_014746522.1|  succinyl-CoA synthetase subsunit alpha             377   7e-125   Tistrella mobilis
ref|WP_011477883.1|  succinyl-CoA ligase [ADP-forming] subunit alpha    377   7e-125   Rickettsia bellii
ref|XP_007625515.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    379   1e-124   
ref|XP_003505683.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    379   1e-124   Cricetulus griseus [Chinese hamsters]
ref|XP_006675876.1|  hypothetical protein BATDEDRAFT_36456              379   1e-124   Batrachochytrium dendrobatidis JAM81
ref|XP_009162469.1|  hypothetical protein T265_00432                    379   1e-124   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|WP_039594975.1|  succinate--CoA ligase                              377   1e-124   Rickettsia felis
ref|WP_014014291.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    377   1e-124   spotted fever group
ref|WP_022731741.1|  succinyl-CoA synthetase subsunit alpha             377   1e-124   Thalassospira
ref|WP_008579810.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    377   1e-124   Rickettsia
ref|XP_004660591.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    379   1e-124   Jaculus jaculus
ref|WP_014241630.1|  succinyl-CoA synthetase subsunit alpha             377   2e-124   Azospirillum brasilense
ref|WP_017443052.1|  succinyl-CoA synthetase subsunit alpha             377   2e-124   Rickettsia gravesii
ref|WP_045800311.1|  succinate--CoA ligase                              377   2e-124   Rickettsia amblyommatis
ref|WP_014392217.1|  succinyl-CoA synthetase subsunit alpha             377   2e-124   Rickettsia amblyommatis
ref|WP_012148768.1|  succinyl-CoA synthetase subsunit alpha             377   2e-124   Rickettsia canadensis
ref|WP_011270994.1|  succinyl-CoA ligase [ADP-forming] subunit alpha    376   2e-124   Rickettsia felis
ref|WP_008621975.1|  succinyl-CoA synthetase subunit alpha              376   2e-124   Magnetospirillum caucaseum
ref|WP_012152767.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    376   2e-124   spotted fever group
ref|WP_038528120.1|  succinate--CoA ligase                              376   3e-124   Azospirillum brasilense
ref|WP_011386313.1|  succinyl-CoA synthetase subsunit alpha             376   3e-124   Magnetospirillum
gb|KCW57893.1|  hypothetical protein EUGRSUZ_H00643                     374   3e-124   Eucalyptus grandis [rose gum]
ref|WP_014409142.1|  succinyl-CoA synthetase subsunit alpha             375   4e-124   Rickettsia montanensis
ref|XP_786544.2|  PREDICTED: succinyl-CoA ligase subunit alpha, m...    377   4e-124   Strongylocentrotus purpuratus [purple urchin]
ref|WP_012149562.1|  succinyl-CoA synthetase subsunit alpha             375   5e-124   Rickettsia akari [rickettsialpox]
ref|WP_032138585.1|  succinate--CoA ligase                              375   6e-124   Rickettsia tamurae
ref|WP_009868831.1|  Succinyl-CoA synthetase, alpha subunit             375   8e-124   Magnetospirillum magnetotacticum
ref|WP_045363367.1|  succinate--CoA ligase                              375   9e-124   Methyloceanibacter caenitepidi
emb|CDH53782.1|  probable succinyl-coa synthetase alpha gdp-forming     376   9e-124   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_002779820.1|  Succinyl-CoA ligase, putative                      376   1e-123   Perkinsus marinus ATCC 50983
gb|ERE66319.1|  succinyl-CoA ligase [GDP-forming] subunit alpha         377   1e-123   Cricetulus griseus [Chinese hamsters]
ref|WP_042311149.1|  succinate--CoA ligase                              374   1e-123   Burkholderiaceae
ref|WP_027287415.1|  succinate--CoA ligase                              374   1e-123   Rhodovibrio salinarum
emb|CDS02808.1|  Putative Succinyl-CoA ligase                           376   1e-123   Lichtheimia ramosa
ref|WP_041861374.1|  succinate--CoA ligase                              374   2e-123   Candidatus Puniceispirillum marinum
ref|XP_002180696.1|  ligase succinate-coa ligase                        375   2e-123   Phaeodactylum tricornutum CCAP 1055/1
gb|ADE40076.1|  succinyl-CoA synthetase, alpha subunit                  375   2e-123   Candidatus Puniceispirillum marinum IMCC1322
ref|WP_010423152.1|  succinyl-CoA synthetase subsunit alpha             374   2e-123   Rickettsia helvetica
ref|WP_028368926.1|  succinate--CoA ligase                              374   3e-123   Burkholderia sp. UYPR1.413
ref|WP_038035751.1|  hypothetical protein                               373   3e-123   Thermopetrobacter sp. TC1
gb|KJB31855.1|  hypothetical protein B456_005G211200                    372   3e-123   Gossypium raimondii
ref|WP_019645135.1|  succinyl-CoA synthetase subsunit alpha             373   5e-123   Novispirillum itersonii
ref|XP_005089238.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    374   5e-123   Aplysia californica
gb|EWM26381.1|  succinyl- ligase subunit mitochondrial precursor        374   6e-123   Nannochloropsis gaditana
ref|WP_011190880.1|  succinyl-CoA ligase [ADP-forming] subunit alpha    373   6e-123   Rickettsia typhi
ref|WP_045664860.1|  succinate--CoA ligase                              372   6e-123   
ref|WP_025896902.1|  succinate--CoA ligase                              372   7e-123   Sneathiella glossodoripedis
ref|WP_014412789.1|  succinyl-CoA synthetase subsunit alpha             372   7e-123   Rickettsia australis
ref|NP_001002577.2|  succinyl-CoA ligase [ADP/GDP-forming] subuni...    374   8e-123   Danio rerio [leopard danio]
gb|KJE93223.1|  succinate-CoA ligase                                    375   1e-122   Capsaspora owczarzaki ATCC 30864
ref|WP_014246680.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    372   1e-122   Azospirillum
ref|WP_007089205.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    372   1e-122   Thalassospira
ref|XP_006394390.1|  hypothetical protein EUTSA_v10003962mg             380   1e-122   Eutrema salsugineum [saltwater cress]
ref|WP_038603019.1|  succinate--CoA ligase                              372   1e-122   Rickettsiales bacterium Ac37b
gb|EUB56696.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha         373   2e-122   Echinococcus granulosus
ref|WP_006577242.1|  succinyl-CoA synthetase, alpha subunit             371   2e-122   Cupriavidus
ref|WP_043950111.1|  succinate--CoA ligase                              371   2e-122   Candidatus Phaeomarinobacter ectocarpi
ref|WP_029011387.1|  succinate--CoA ligase                              371   2e-122   Azospirillum halopraeferens
ref|WP_023386589.1|  succinyl-CoA synthetase subsunit alpha             371   2e-122   Anaplasma marginale
ref|XP_004347867.1|  succinate-CoA ligase                               372   2e-122   Capsaspora owczarzaki ATCC 30864
emb|CCG84081.1|  protein of unknown function                            372   3e-122   Taphrina deformans PYCC 5710
emb|CDH52273.1|  succinyl-ligase subunit mitochondrialprecursor         372   3e-122   Lichtheimia corymbifera JMRC:FSU:9682
ref|WP_025527854.1|  succinate--CoA ligase                              371   3e-122   Burkholderia sp. yr520
ref|WP_046058391.1|  succinate--CoA ligase                              371   3e-122   Rickettsia monacensis
emb|CDS05386.1|  Putative Succinyl-CoA ligase                           372   3e-122   Lichtheimia ramosa
ref|WP_002730338.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    371   3e-122   Phaeospirillum
ref|XP_012142093.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    372   3e-122   Megachile rotundata
ref|WP_010263012.1|  succinyl-CoA ligase chain A (sucD)                 371   3e-122   Anaplasma marginale
ref|WP_035931250.1|  succinate--CoA ligase                              370   3e-122   Caballeronia glathei
ref|WP_036001007.1|  succinate--CoA ligase                              370   4e-122   Paraburkholderia caribensis
ref|WP_004597642.1|  succinyl-CoA ligase [ADP-forming] subunit alpha    370   4e-122   Rickettsia prowazekii
ref|WP_012975136.1|  succinyl-CoA synthetase subsunit alpha             370   5e-122   Azospirillum lipoferum
ref|WP_022728556.1|  succinyl-CoA synthetase subsunit alpha             370   5e-122   Fodinicurvata sediminis
ref|XP_002781462.1|  Succinyl-CoA ligase, putative                      372   5e-122   Perkinsus marinus ATCC 50983
ref|XP_010087141.1|  Succinyl-CoA ligase [ADP-forming] subunit al...    369   6e-122   
ref|WP_007733326.1|  succinyl-CoA synthetase subsunit alpha             370   6e-122   Burkholderia sp. BT03
ref|WP_004995747.1|  succinyl-CoA synthetase subsunit alpha             370   6e-122   Rickettsia sibirica
ref|WP_045581682.1|  succinate--CoA ligase                              370   6e-122   Azospirillum thiophilum
ref|WP_026988416.1|  succinate--CoA ligase                              370   8e-122   Fodinicurvata fenggangensis
ref|WP_012567360.1|  succinyl-CoA synthetase subsunit alpha             370   8e-122   Rhodospirillum centenum
ref|WP_016916757.1|  succinyl-CoA synthetase subsunit alpha             370   9e-122   Rickettsia honei
ref|XP_005089236.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    372   1e-121   
ref|WP_027300105.1|  succinate--CoA ligase                              369   1e-121   Rhodospirillales bacterium URHD0088
emb|CDW71518.1|  succinyl-ligase                                        371   1e-121   Stylonychia lemnae
ref|WP_014419805.1|  succinyl-CoA ligase [ADP-forming] subunit alpha    369   1e-121   Rickettsia slovaca
ref|WP_014364693.1|  succinyl-CoA ligase [ADP-forming] subunit alpha    369   1e-121   Rickettsia philipii
ref|WP_044827266.1|  succinate--CoA ligase                              369   1e-121   Thalassospira sp. HJ
ref|WP_014410679.1|  succinyl-CoA ligase [ADP-forming] subunit alpha    369   1e-121   Rickettsia parkeri
ref|WP_010267151.1|  succinyl-CoA synthetase subsunit alpha             369   1e-121   Anaplasma
gb|ACO52022.1|  Succinyl-CoA ligase subunit alpha, mitochondrial ...    370   1e-121   Rana catesbeiana [bullfrog]
ref|XP_004415607.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    371   1e-121   Odobenus rosmarus divergens
ref|WP_024081748.1|  succinyl-CoA synthetase, alpha subunit, NAD(...    369   1e-121   Magnetospirillum gryphiswaldense
ref|WP_009770390.1|  succinyl-CoA synthetase subsunit alpha             369   1e-121   Paraburkholderia hospita
ref|WP_033068019.1|  succinate--CoA ligase                              369   1e-121   Thalassospira australica
ref|WP_022735557.1|  succinyl-CoA synthetase subsunit alpha             369   2e-121   
ref|WP_012150789.1|  succinyl-CoA ligase [ADP-forming] subunit alpha    369   2e-121   Rickettsia rickettsii
ref|WP_012880976.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    369   2e-121   Anaplasma
ref|WP_008889739.1|  succinyl-CoA synthetase subsunit alpha             369   2e-121   
ref|XP_007666525.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    370   2e-121   
ref|WP_010977229.1|  succinyl-CoA ligase [ADP-forming] subunit alpha    369   2e-121   
ref|WP_016770141.1|  succinyl-CoA ligase [ADP-forming] subunit alpha    369   2e-121   
ref|XP_011264080.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    370   2e-121   
ref|WP_014955396.1|  succinyl-CoA synthetase subsunit alpha             368   3e-121   
ref|XP_006557408.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    370   3e-121   
ref|XP_008167941.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    369   3e-121   
ref|WP_027839641.1|  succinate--CoA ligase                              368   3e-121   
ref|NP_001025589.1|  succinyl-CoA ligase [ADP/GDP-forming] subuni...    369   4e-121   
ref|WP_012736402.1|  succinyl-CoA synthetase subsunit alpha             368   4e-121   
dbj|BAB23804.1|  unnamed protein product                                369   4e-121   
ref|XP_005292517.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    369   5e-121   
ref|WP_017775324.1|  succinyl-CoA synthetase subsunit alpha             368   5e-121   
ref|NP_063932.2|  succinyl-CoA ligase [ADP/GDP-forming] subunit a...    370   6e-121   
ref|XP_005292518.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    369   7e-121   
gb|KIW09471.1|  hypothetical protein PV09_00350                         369   7e-121   
ref|WP_015466944.1|  Succinyl-CoA ligase [ADP-forming] alpha chain      367   7e-121   
ref|XP_002117441.1|  hypothetical protein TRIADDRAFT_61514              369   7e-121   
ref|NP_001126825.1|  succinyl-CoA ligase [ADP/GDP-forming] subuni...    369   8e-121   
ref|WP_015816124.1|  succinyl-CoA synthetase subsunit alpha             367   9e-121   
ref|WP_012975782.1|  succinyl-CoA synthetase subsunit alpha             367   1e-120   
emb|CCW71008.1|  unnamed protein product                                367   1e-120   
ref|WP_016926237.1|  succinyl-CoA synthetase subsunit alpha             367   1e-120   
ref|XP_011712075.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    369   1e-120   
ref|WP_011388967.1|  succinyl-CoA synthetase subunit alpha              367   1e-120   
ref|XP_011708358.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    368   1e-120   
ref|XP_004742358.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    369   1e-120   
gb|ACO12801.1|  Succinyl-CoA ligase subunit alpha, mitochondrial ...    368   1e-120   
ref|WP_029012089.1|  succinate--CoA ligase                              367   1e-120   
ref|WP_014102208.1|  succinyl-CoA synthetase subsunit alpha             367   1e-120   
ref|XP_005292516.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    368   1e-120   
ref|XP_010400527.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    369   1e-120   
ref|WP_029007879.1|  succinate--CoA ligase                              367   1e-120   
ref|WP_012719686.1|  succinyl-CoA synthetase subsunit alpha             366   2e-120   
ref|WP_042303375.1|  succinate--CoA ligase                              366   2e-120   
ref|XP_003106288.1|  hypothetical protein CRE_15309                     367   2e-120   
emb|CAX74373.1|  succinate-CoA ligase                                   367   2e-120   
emb|CDJ29687.1|  succinyl-CoA ligase alpha subunit, putative            368   2e-120   
dbj|BAB22331.1|  unnamed protein product                                368   2e-120   
gb|AAX27280.2|  SJCHGC04909 protein                                     367   2e-120   
gb|ACC73801.1|  succinyl-CoA synthetase, alpha subunit                  365   2e-120   
ref|WP_042704211.1|  succinate--CoA ligase                              366   2e-120   
ref|WP_014251286.1|  succinyl-CoA synthetase subsunit alpha             366   2e-120   
ref|WP_045584128.1|  succinate--CoA ligase                              366   3e-120   
ref|WP_004599470.1|  succinyl-CoA ligase [ADP-forming] subunit alpha    366   3e-120   
gb|EJY75338.1|  Succinyl-CoA ligase                                     367   3e-120   
ref|XP_006623784.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    367   3e-120   
ref|XP_009182789.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    368   3e-120   
ref|NP_001270301.1|  uncharacterized protein LOC101867049               367   4e-120   
ref|XP_001984386.1|  GH16428                                            367   4e-120   
ref|XP_011227722.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    370   4e-120   
ref|WP_014188059.1|  succinyl-CoA synthetase subsunit alpha             365   4e-120   
ref|XP_623800.2|  PREDICTED: succinyl-CoA ligase [ADP/GDP-forming...    367   5e-120   
ref|XP_011819208.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    367   5e-120   
ref|WP_035967511.1|  succinate--CoA ligase                              365   5e-120   
ref|XP_007675614.1|  hypothetical protein BAUCODRAFT_147215             367   5e-120   
ref|XP_011919434.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    367   5e-120   
ref|XP_008022993.1|  hypothetical protein SETTUDRAFT_167715             367   5e-120   
ref|XP_009973222.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    366   5e-120   
ref|XP_009469990.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    368   5e-120   
ref|WP_004274388.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    365   5e-120   
gb|AAD33927.2|AF144101_1  succinyl-CoA synthetase                       367   6e-120   
ref|XP_011142324.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    367   6e-120   
ref|NP_510450.1|  Protein SUCL-1                                        366   7e-120   
ref|WP_011451650.1|  succinyl-CoA synthetase subsunit alpha             365   8e-120   
ref|WP_045455016.1|  succinate--CoA ligase                              365   8e-120   
ref|XP_008698280.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    366   1e-119   
gb|EMD92563.1|  hypothetical protein COCHEDRAFT_1174674                 365   1e-119   
ref|XP_011349727.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    366   1e-119   
ref|XP_011866105.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    366   1e-119   
dbj|BAC40634.1|  unnamed protein product                                366   1e-119   
ref|XP_006128463.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    368   1e-119   
gb|KFQ16420.1|  hypothetical protein N330_09883                         365   1e-119   
emb|CCD79067.1|  succinyl-CoA synthetase-related                        366   1e-119   
ref|WP_028466118.1|  succinate--CoA ligase                              364   1e-119   
ref|XP_009880854.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    365   1e-119   
ref|XP_003420463.2|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    365   1e-119   
ref|XP_002046562.1|  GJ12416                                            365   2e-119   
ref|XP_003395160.1|  PREDICTED: succinyl-CoA ligase [GDP-forming]...    365   2e-119   
ref|XP_011167335.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    365   2e-119   
ref|XP_011866107.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    365   2e-119   
gb|ACO11392.1|  Succinyl-CoA ligase subunit alpha, mitochondrial ...    365   2e-119   
ref|XP_008643339.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    365   2e-119   
ref|XP_010156265.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    365   2e-119   
gb|EFX76555.1|  hypothetical protein DAPPUDRAFT_306118                  365   2e-119   
ref|XP_010011949.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    365   2e-119   
gb|EFZ13224.1|  hypothetical protein SINV_06825                         365   2e-119   
ref|WP_042087115.1|  succinate--CoA ligase                              363   2e-119   
gb|ETN59000.1|  Succinyl coenzyme A synthetase alpha subunit            365   2e-119   
ref|WP_035502491.1|  succinate--CoA ligase                              363   2e-119   
ref|XP_011866106.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    365   2e-119   
ref|XP_011587120.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    365   3e-119   
gb|KGB32013.1|  Succinyl-CoA ligase [ADP/GDP-forming] subunit alp...    365   3e-119   
ref|XP_007470656.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    365   3e-119   
ref|XP_006629220.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    364   3e-119   
ref|WP_008353897.1|  MULTISPECIES: succinyl-CoA synthetase subsun...    363   3e-119   
ref|WP_018985877.1|  hypothetical protein                               363   3e-119   
ref|XP_010164933.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    364   3e-119   
ref|NP_446204.2|  succinyl-CoA ligase [ADP/GDP-forming] subunit a...    365   3e-119   
ref|XP_006623783.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    365   3e-119   
ref|XP_007696583.1|  hypothetical protein COCSADRAFT_34282              364   3e-119   
gb|ACO14866.1|  Succinyl-CoA ligase subunit alpha, mitochondrial ...    364   3e-119   
ref|XP_321835.2|  AGAP001312-PA                                         364   3e-119   
ref|XP_005023343.1|  PREDICTED: LOW QUALITY PROTEIN: succinyl-CoA...    364   4e-119   
ref|XP_966490.1|  PREDICTED: succinyl-CoA ligase subunit alpha, m...    364   4e-119   
ref|XP_002188424.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    364   4e-119   
ref|XP_010366218.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    364   4e-119   
gb|ADI19715.1|  hypothetical protein                                    363   4e-119   
ref|XP_001971787.1|  GG15160                                            364   5e-119   
ref|WP_012520721.1|  succinyl-CoA synthetase subsunit alpha             363   5e-119   
ref|XP_010897979.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    364   5e-119   
gb|AAA41233.1|  succinyl-CoA synthetase alpha subunit (EC 6.2.1.4)      364   5e-119   
ref|XP_010124729.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    364   5e-119   
ref|XP_001744918.1|  hypothetical protein                               363   5e-119   
ref|XP_010284942.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    363   6e-119   
ref|XP_012064458.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    364   6e-119   
ref|XP_007790382.1|  putative succinyl- ligase subunit alpha protein    364   7e-119   
ref|XP_004469843.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    364   7e-119   
ref|XP_005517988.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    363   7e-119   
ref|XP_001931590.1|  succinyl-CoA ligase subunit alpha                  363   7e-119   
ref|XP_005078331.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    364   8e-119   
ref|XP_005717393.1|  succinyl-CoA synthetase alpha chain                363   8e-119   
ref|XP_008698282.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    363   9e-119   
ref|XP_008934823.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    363   9e-119   
ref|XP_002093588.1|  succinyl coenzyme A synthetase alpha subunit       363   9e-119   
gb|AAH00504.1|  SUCLG1 protein                                          363   9e-119   
ref|XP_007063243.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    363   9e-119   
ref|XP_002757610.3|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    364   9e-119   
ref|XP_010579045.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    363   9e-119   
ref|XP_008216372.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    363   9e-119   
ref|XP_009958005.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    363   9e-119   
ref|XP_003298377.1|  hypothetical protein PTT_09097                     363   1e-118   
ref|XP_005708256.1|  succinyl-CoA synthetase alpha subunit              363   1e-118   
ref|XP_003694335.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    363   1e-118   
ref|WP_037455602.1|  succinate--CoA ligase                              362   1e-118   
ref|WP_042484035.1|  succinate--CoA ligase                              362   1e-118   
ref|WP_040053690.1|  succinate--CoA ligase                              362   1e-118   
ref|WP_020697977.1|  succinyl-CoA synthetase subsunit alpha             362   1e-118   
ref|XP_001652258.1|  AAEL006833-PA                                      363   1e-118   
dbj|BAF83771.1|  unnamed protein product                                363   1e-118   
ref|XP_002068543.1|  GK20526                                            363   1e-118   
ref|XP_008500129.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    362   1e-118   
gb|EFN82692.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha, ...    363   1e-118   
ref|XP_009637900.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    365   1e-118   
ref|XP_003816644.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    363   1e-118   
ref|WP_012637389.1|  succinyl-CoA synthetase subunit alpha              361   1e-118   
ref|NP_003840.2|  succinyl-CoA ligase [ADP/GDP-forming] subunit a...    363   1e-118   
gb|EDL91059.1|  succinate-CoA ligase, GDP-forming, alpha subunit,...    364   1e-118   
ref|XP_009914650.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    363   1e-118   
ref|XP_009287692.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    364   2e-118   
ref|XP_002123295.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    363   2e-118   
ref|XP_005045683.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    362   2e-118   
ref|WP_041185489.1|  succinate--CoA ligase                              361   2e-118   
ref|XP_009933087.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    363   2e-118   
dbj|BAG36098.1|  unnamed protein product                                363   2e-118   
ref|XP_005510017.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    362   2e-118   
gb|KDR08649.1|  Succinyl-CoA ligase [GDP-forming] subunit alpha, ...    362   2e-118   
ref|XP_007781273.1|  succinyl-CoA ligase [GDP-forming] subunit al...    362   2e-118   
ref|WP_024929657.1|  succinyl-CoA synthetase subunit alpha              361   2e-118   
ref|XP_010193104.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    363   2e-118   
ref|WP_033102339.1|  succinyl-CoA synthetase subsunit alpha             361   2e-118   
ref|XP_007118275.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    363   2e-118   
ref|XP_001225085.1|  hypothetical protein CHGG_07429                    362   2e-118   
ref|WP_019881664.1|  MULTISPECIES: succinyl-CoA synthetase subuni...    361   2e-118   
ref|XP_011349725.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    363   2e-118   
ref|XP_004691641.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    363   2e-118   
ref|XP_007968242.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    365   2e-118   
gb|ETN77515.1|  succinate-CoA ligase, alpha subunit                     362   2e-118   
gb|AEE62179.1|  unknown                                                 362   3e-118   
ref|NP_001012910.1|  succinyl-CoA ligase [ADP/GDP-forming] subuni...    362   3e-118   
ref|WP_038559016.1|  succinate--CoA ligase                              361   3e-118   
ref|XP_003454252.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    362   3e-118   
ref|XP_009993919.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    363   3e-118   
ref|XP_009330174.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    363   3e-118   
ref|XP_003395161.1|  PREDICTED: succinyl-CoA ligase [GDP-forming]...    362   3e-118   
ref|XP_001164971.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    363   3e-118   
ref|WP_029133306.1|  succinyl-CoA synthetase subunit alpha              360   3e-118   
ref|XP_005144667.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    362   3e-118   
ref|XP_011829656.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    363   3e-118   
ref|XP_002007202.1|  GI12510                                            362   4e-118   
gb|EME43041.1|  hypothetical protein DOTSEDRAFT_72439                   362   4e-118   
ref|XP_009867186.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    364   4e-118   
gb|ACN58607.1|  Succinyl-CoA ligase subunit alpha, mitochondrial ...    362   4e-118   
ref|XP_006917745.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    362   4e-118   
ref|WP_042469416.1|  succinate--CoA ligase                              360   4e-118   
ref|NP_001153970.1|  succinate-CoA ligase GDP-forming alpha subunit     361   4e-118   
ref|WP_033073970.1|  succinate--CoA ligase                              360   4e-118   
ref|WP_037238491.1|  succinate--CoA ligase                              360   4e-118   
gb|ENN72632.1|  hypothetical protein YQE_10730                          361   5e-118   
ref|WP_041066241.1|  succinyl-CoA synthetase subunit alpha              360   5e-118   
ref|XP_005229934.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    361   5e-118   
ref|WP_027256408.1|  succinate--CoA ligase                              360   5e-118   
gb|AAD17940.2|  succinyl-CoA synthetase alpha subunit                   362   5e-118   
emb|CEI88671.1|  Putative Succinyl-CoA ligase [GDP-forming] subun...    361   6e-118   
ref|WP_007039745.1|  succinyl-CoA synthetase subunit alpha              360   7e-118   
ref|WP_022736271.1|  succinyl-CoA synthetase subsunit alpha             360   7e-118   
ref|XP_004549582.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    361   7e-118   
ref|WP_009605554.1|  succinyl-CoA synthetase subsunit alpha             360   7e-118   
ref|WP_007407146.1|  succinyl-CoA synthetase subsunit alpha             360   7e-118   
ref|XP_002021385.1|  GL25295                                            361   7e-118   
ref|WP_026071683.1|  succinate--CoA ligase                              360   7e-118   
gb|ACO09718.1|  Succinyl-CoA ligase subunit alpha, mitochondrial ...    361   7e-118   
ref|WP_005978934.1|  succinyl-CoA synthetase subsunit alpha             360   7e-118   
ref|XP_009059028.1|  hypothetical protein LOTGIDRAFT_218036             361   8e-118   
ref|XP_001627384.1|  predicted protein                                  361   8e-118   
ref|WP_045809227.1|  succinate--CoA ligase                              359   8e-118   
ref|WP_014952624.1|  succinyl-CoA synthetase subsunit alpha             359   8e-118   
ref|XP_006018074.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    364   8e-118   
ref|XP_011302934.1|  PREDICTED: succinyl-CoA ligase [ADP/GDP-form...    361   9e-118   
ref|XP_011647068.1|  PREDICTED: succinyl-CoA ligase subunit alpha...    361   9e-118   
ref|WP_011444840.1|  succinyl-CoA synthetase subsunit alpha             360   9e-118   
ref|WP_037446206.1|  succinate--CoA ligase                              359   9e-118   
sp|Q9YGD2.1|SUCA_COLLI  RecName: Full=Succinyl-CoA ligase subunit...    360   1e-117   
ref|WP_017970841.1|  succinyl-CoA synthetase subsunit alpha             359   1e-117   
ref|XP_001805534.1|  hypothetical protein SNOG_15384                    360   1e-117   
ref|WP_008652312.1|  MULTISPECIES: succinyl-CoA synthetase subuni...    359   1e-117   
ref|WP_018953020.1|  succinyl-CoA synthetase subunit alpha              359   1e-117   
emb|CEG68719.1|  Putative Succinyl-CoA ligase [GDP-forming] subun...    359   1e-117   
gb|AIL13334.1|  succinate--CoA ligase                                   359   1e-117   
ref|WP_013418331.1|  succinyl-CoA synthetase subsunit alpha             359   1e-117   



>ref|XP_006350379.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Solanum tuberosum]
Length=337

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/338 (88%), Positives = 314/338 (93%), Gaps = 8/338 (2%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRP----ITQSPLWQQQQHRLFGSPAP--EVFVDKNTRVICQGIT  1183
             MA Q  RLI+N+S K+ P    I+ SPLW Q  +R FGSP P   VFVDKNTRVICQGIT
Sbjct  1     MARQATRLISNLSTKLNPSSPTISASPLWHQ--YRYFGSPPPPPAVFVDKNTRVICQGIT  58

Query  1182  GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPF  1003
             GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASV+YVPPPF
Sbjct  59    GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVVYVPPPF  118

Query  1002  agaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIG  823
             A AAIMEAMEAELDLVVCITEGIPQHDMV+VKAALK+Q++TRLIGPNCPGIIKPGECKIG
Sbjct  119   AAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALKKQSRTRLIGPNCPGIIKPGECKIG  178

Query  822   IMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFV  643
             IMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERF+
Sbjct  179   IMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFI  238

Query  642   ADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGG  463
             ADPQTEGIVLIGEIGGTAEE+AAA IK SGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGG
Sbjct  239   ADPQTEGIVLIGEIGGTAEEDAAALIKASGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGG  298

Query  462   KGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGL  349
             KGTAQDKI+ LKEAGVTVCESPAK+G TMLDVF +RGL
Sbjct  299   KGTAQDKIKALKEAGVTVCESPAKIGVTMLDVFKQRGL  336



>ref|XP_009623368.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Nicotiana tomentosiformis]
Length=338

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/340 (88%), Positives = 314/340 (92%), Gaps = 9/340 (3%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVR-----PITQSPLWQQQQHRLFGSPAP--EVFVDKNTRVICQGI  1186
             MA Q  RLIAN+S K+      P   S LWQQ  +R FGSP P   VFVDKNTRVICQGI
Sbjct  1     MARQATRLIANLSAKLNSSNPTPSASSSLWQQ--YRFFGSPPPPPAVFVDKNTRVICQGI  58

Query  1185  TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPP  1006
             TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASV+YVPPP
Sbjct  59    TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVVYVPPP  118

Query  1005  FagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKI  826
             FA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAALK+Q+KTRLIGPNCPGIIKPGECKI
Sbjct  119   FAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALKKQSKTRLIGPNCPGIIKPGECKI  178

Query  825   GIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERF  646
             GIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F
Sbjct  179   GIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKF  238

Query  645   VADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSG  466
             VADPQTEGIVLIGEIGGTAEE+AAAFIKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSG
Sbjct  239   VADPQTEGIVLIGEIGGTAEEDAAAFIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSG  298

Query  465   GKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             GKGTAQDKI  LKEAGVTVCESPAK+G +MLDVF +RGL+
Sbjct  299   GKGTAQDKITALKEAGVTVCESPAKIGASMLDVFKQRGLV  338



>ref|NP_001234574.1| succinyl-CoA ligase [ADP-forming] subunit alpha-2, mitochondrial 
[Solanum lycopersicum]
 sp|Q6DQL1.1|SUCA2_SOLLC RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial; Short=SlSCoALalpha2; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAT67464.1| succinyl-CoA ligase alpha 2 subunit [Solanum lycopersicum]
Length=337

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/338 (88%), Positives = 313/338 (93%), Gaps = 8/338 (2%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRP----ITQSPLWQQQQHRLFGSPAP--EVFVDKNTRVICQGIT  1183
             MA Q  RLI+N+S K+ P    ++ SPLW Q  +R FGSP P   VFVDKNTRVICQGIT
Sbjct  1     MARQATRLISNLSTKLNPSSPTMSASPLWHQ--YRYFGSPPPPPAVFVDKNTRVICQGIT  58

Query  1182  GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPF  1003
             GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AK ETKANASV+YVPPPF
Sbjct  59    GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKVETKANASVVYVPPPF  118

Query  1002  agaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIG  823
             A AAIMEAMEAELDLVVCITEGIPQHDMV+VKAALK+Q +TRLIGPNCPGIIKPGECKIG
Sbjct  119   AAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALKKQLRTRLIGPNCPGIIKPGECKIG  178

Query  822   IMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFV  643
             IMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERF+
Sbjct  179   IMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFI  238

Query  642   ADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGG  463
             ADPQTEGIVLIGEIGGTAEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGG
Sbjct  239   ADPQTEGIVLIGEIGGTAEEDAAALIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGG  298

Query  462   KGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGL  349
             KGTAQDKI+ LKEAGVTVCESPAK+G TMLDVF +RGL
Sbjct  299   KGTAQDKIKALKEAGVTVCESPAKIGVTMLDVFKQRGL  336



>gb|AIS71903.1| mitochondrial succinyl-CoA ligase ADP-forming subunit alpha-2 
[Nicotiana tabacum]
Length=340

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/342 (87%), Positives = 315/342 (92%), Gaps = 11/342 (3%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRPIT-------QSPLWQQQQHRLFGSPAP--EVFVDKNTRVICQ  1192
             MA Q  RL++ +S K+ P +        SPLW Q  +R FGSP P   VFVDKNTRVICQ
Sbjct  1     MARQATRLVSKLSSKLSPNSPTISASPSSPLWHQ--YRYFGSPPPPPAVFVDKNTRVICQ  58

Query  1191  GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVP  1012
             GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASV+YVP
Sbjct  59    GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVVYVP  118

Query  1011  PPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGEC  832
             PPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAALK+Q+KTRLIGPNCPGIIKPGEC
Sbjct  119   PPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALKKQSKTRLIGPNCPGIIKPGEC  178

Query  831   KIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE  652
             KIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE
Sbjct  179   KIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE  238

Query  651   RFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIV  472
             +FVADPQTEGIVLIGEIGGTAEE+AAAFIKESGT+KPVVAFIAGLTAPPGRRMGHAGAIV
Sbjct  239   KFVADPQTEGIVLIGEIGGTAEEDAAAFIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIV  298

Query  471   SGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             SGGKGTAQDKI+ LKEAGVTVCESPAK+G +MLDVF +RGL+
Sbjct  299   SGGKGTAQDKIKALKEAGVTVCESPAKIGASMLDVFKQRGLV  340



>ref|XP_006348504.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Solanum tuberosum]
Length=332

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/335 (86%), Positives = 311/335 (93%), Gaps = 5/335 (1%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGS--PAPEVFVDKNTRVICQGITGKNG  1171
             MA Q  +LIAN+S K   ++ S      Q+RLFGS  P P VFVDKNTRVICQGITGKNG
Sbjct  1     MARQATKLIANLSTK---LSSSNPTLATQNRLFGSAPPPPAVFVDKNTRVICQGITGKNG  57

Query  1170  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  991
             TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVPPPFA AA
Sbjct  58    TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPPFAAAA  117

Query  990   imeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPG  811
             IME +EAELDL+VCITEGIPQHDMV+VKAALK+Q++TRLIGPNCPGIIKPGECKIGIMPG
Sbjct  118   IMEGLEAELDLIVCITEGIPQHDMVRVKAALKKQSRTRLIGPNCPGIIKPGECKIGIMPG  177

Query  810   YIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQ  631
             YIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F+ADPQ
Sbjct  178   YIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFIADPQ  237

Query  630   TEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTA  451
             TEGIVLIGEIGGTAEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTA
Sbjct  238   TEGIVLIGEIGGTAEEDAAALIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTA  297

Query  450   QDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             QDKI+ LKEAGVTVCESPAK+G +ML+VF +RGL+
Sbjct  298   QDKIKALKEAGVTVCESPAKIGVSMLEVFKQRGLV  332



>ref|XP_009781531.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Nicotiana sylvestris]
Length=338

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/340 (87%), Positives = 316/340 (93%), Gaps = 9/340 (3%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRPITQSP-----LWQQQQHRLFGSPAP--EVFVDKNTRVICQGI  1186
             MA Q  R+IAN+S K+   + +P     LWQQ  +R FGSP P   VFVDKNTRVICQGI
Sbjct  1     MARQATRVIANLSTKLNSSSPTPSASSSLWQQ--YRFFGSPLPPPAVFVDKNTRVICQGI  58

Query  1185  TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPP  1006
             TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASV+YVPPP
Sbjct  59    TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVVYVPPP  118

Query  1005  FagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKI  826
             FA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAALK+Q+KTRLIGPNCPGIIKPGECKI
Sbjct  119   FAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALKKQSKTRLIGPNCPGIIKPGECKI  178

Query  825   GIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERF  646
             GIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQS+CVGIGGDPFNGTNFVDCLE+F
Sbjct  179   GIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSSCVGIGGDPFNGTNFVDCLEKF  238

Query  645   VADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSG  466
             VADPQTEGIVLIGEIGGTAEE+AAAFIKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSG
Sbjct  239   VADPQTEGIVLIGEIGGTAEEDAAAFIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSG  298

Query  465   GKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             GKGTAQDKI+ LKEAGVTVCESPAK+G +MLDVF +RGL+
Sbjct  299   GKGTAQDKIKALKEAGVTVCESPAKIGASMLDVFKQRGLV  338



>gb|AFL48180.1| succinyl-CoA synthetase [Capsicum annuum]
 gb|AFL48181.1| succinyl-CoA synthetase [Capsicum annuum]
Length=326

 Score =   525 bits (1351),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/334 (87%), Positives = 307/334 (92%), Gaps = 11/334 (3%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGS--PAPEVFVDKNTRVICQGITGKNG  1171
             MA Q  R+I+  S K+ P          ++R FGS  P P VFVDKNTRVICQGITGKNG
Sbjct  1     MARQATRVISKWSTKLNP---------NEYRYFGSSAPPPAVFVDKNTRVICQGITGKNG  51

Query  1170  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  991
             TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASV+YVPPPFA AA
Sbjct  52    TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVVYVPPPFAAAA  111

Query  990   imeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPG  811
             IMEAMEAELDLVVCITEGIPQHDMV+VKAALK+Q++TRLIGPNCPGIIKPGECKIGIMPG
Sbjct  112   IMEAMEAELDLVVCITEGIPQHDMVRVKAALKKQSRTRLIGPNCPGIIKPGECKIGIMPG  171

Query  810   YIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQ  631
             YIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERF+ADPQ
Sbjct  172   YIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFIADPQ  231

Query  630   TEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTA  451
             TEGIVLIGEIGGTAEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTA
Sbjct  232   TEGIVLIGEIGGTAEEDAAALIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTA  291

Query  450   QDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGL  349
             QDKI+ LKEAGVTVCESPAK+G TMLDVF +RGL
Sbjct  292   QDKIKALKEAGVTVCESPAKIGITMLDVFKQRGL  325



>ref|NP_001234277.1| succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Solanum lycopersicum]
 sp|Q8GTQ9.1|SUCA1_SOLLC RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial; Short=SlSCoALalpha1; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAN86619.1| succinyl-CoA ligase alpha 1 subunit [Solanum lycopersicum]
Length=332

 Score =   523 bits (1347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/334 (85%), Positives = 309/334 (93%), Gaps = 3/334 (1%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRPITQSPLWQ-QQQHRLFGSPAPEVFVDKNTRVICQGITGKNGT  1168
             MA Q  +LIAN+SKK+   + +P  +  +Q    G+  P VFVDKNTRVICQGITGKNGT
Sbjct  1     MARQATKLIANLSKKLS--SSNPHTRCSEQTVWIGAAPPAVFVDKNTRVICQGITGKNGT  58

Query  1167  FHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaai  988
             FHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV +AKAETKANASVIYVPPPFA AAI
Sbjct  59    FHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVEEAKAETKANASVIYVPPPFAAAAI  118

Query  987   meameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGY  808
             ME +EAELDL+VCITEGIPQHDMV+VKAALK+Q++TRLIGPNCPGIIKPGECKIGIMPGY
Sbjct  119   MEGLEAELDLIVCITEGIPQHDMVRVKAALKKQSRTRLIGPNCPGIIKPGECKIGIMPGY  178

Query  807   IHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQT  628
             IHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F+ADPQT
Sbjct  179   IHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFIADPQT  238

Query  627   EGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQ  448
             EGIVLIGEIGGTAEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQ
Sbjct  239   EGIVLIGEIGGTAEEDAAALIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQ  298

Query  447   DKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             DKI+ LKEAGVTVCESPAK+G +ML+VF +RGL+
Sbjct  299   DKIKALKEAGVTVCESPAKIGVSMLEVFKQRGLV  332



>emb|CDP14400.1| unnamed protein product [Coffea canephora]
Length=333

 Score =   521 bits (1342),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 292/336 (87%), Positives = 311/336 (93%), Gaps = 6/336 (2%)
 Frame = -2

Query  1344  MAWQTAR-LIANVSKKVRPITQSPLWQQQQHRLFGSPAP--EVFVDKNTRVICQGITGKN  1174
             MA QT + LI N++ K   + Q+P  + QQ R FGSP P   VFVDKNTRVICQGITGKN
Sbjct  1     MARQTTKSLIGNLASK---LLQNPNGKSQQLRHFGSPPPPAAVFVDKNTRVICQGITGKN  57

Query  1173  GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFaga  994
             GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVPPPFA A
Sbjct  58    GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAA  117

Query  993   aimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMP  814
             AIMEAMEAELDLVVCITEGIPQHDMVKVKAALK+Q+KTRLIGPNCPGIIKPGECKIGIMP
Sbjct  118   AIMEAMEAELDLVVCITEGIPQHDMVKVKAALKKQSKTRLIGPNCPGIIKPGECKIGIMP  177

Query  813   GYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADP  634
             GYIHKPGR+GIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+FVADP
Sbjct  178   GYIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVADP  237

Query  633   QTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGT  454
             QTEGIVLIGEIGGTAEE+AAAFIKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGT
Sbjct  238   QTEGIVLIGEIGGTAEEDAAAFIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGT  297

Query  453   AQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             AQDKI+ LKEAGVTV ESPAK+G  + DVF +RGL+
Sbjct  298   AQDKIKILKEAGVTVVESPAKIGAAIFDVFKQRGLV  333



>ref|XP_009355925.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Pyrus x bretschneideri]
Length=334

 Score =   513 bits (1320),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 277/328 (84%), Positives = 304/328 (93%), Gaps = 1/328 (0%)
 Frame = -2

Query  1329  ARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQA  1150
             A+LI +++ + +P   + L Q++ +     P P VFVDKNTRVICQGITGKNGTFHTEQA
Sbjct  7     AKLIGSIASR-KPSLSTSLLQRRHYSPAPPPPPAVFVDKNTRVICQGITGKNGTFHTEQA  65

Query  1149  IEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeamea  970
             IEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVPPPFA AAI+EA+EA
Sbjct  66    IEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAILEAVEA  125

Query  969   ELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGR  790
             ELDLVVCITEGIPQHDMV+VKAA+ +Q+KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGR
Sbjct  126   ELDLVVCITEGIPQHDMVRVKAAINRQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGR  185

Query  789   IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLi  610
             IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC++RF+ DPQTEGIVLI
Sbjct  186   IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIDRFLQDPQTEGIVLI  245

Query  609   geiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTL  430
             GEIGGTAEE+AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL
Sbjct  246   GEIGGTAEEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTL  305

Query  429   KEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             +EAGVTV ESPAK+G  MLDVF +RGL+
Sbjct  306   REAGVTVVESPAKIGAAMLDVFKQRGLV  333



>ref|XP_011091459.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Sesamum indicum]
Length=330

 Score =   509 bits (1310),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 283/334 (85%), Positives = 306/334 (92%), Gaps = 7/334 (2%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGSPAP--EVFVDKNTRVICQGITGKNG  1171
             MA    RLI N+S+++      P  + QQHR FGSP P   VFVDKNTRVICQGITGKNG
Sbjct  1     MARHATRLIGNLSRRLL----CP-KELQQHRNFGSPPPPPAVFVDKNTRVICQGITGKNG  55

Query  1170  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  991
             TFHTEQAIEYGTKMVGGVTP KGGTEHLGLPVFN+VA+AKAETKANASVIYVPPPFA  A
Sbjct  56    TFHTEQAIEYGTKMVGGVTPGKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAKA  115

Query  990   imeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPG  811
             IME++EAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLIGPNCPGIIKPGECKIGIMPG
Sbjct  116   IMESLEAELDLVVCITEGIPQHDMVRVKAALNKQSKTRLIGPNCPGIIKPGECKIGIMPG  175

Query  810   YIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQ  631
             YIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+E+F+ DPQ
Sbjct  176   YIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKFLVDPQ  235

Query  630   TEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTA  451
             TEGI+LIGEIGGTAEE+AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTA
Sbjct  236   TEGIILIGEIGGTAEEDAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTA  295

Query  450   QDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGL  349
             QDKI+TL+EAGVTV ESPAK+GT ML+VF +RGL
Sbjct  296   QDKIKTLREAGVTVVESPAKIGTAMLEVFKQRGL  329



>gb|EPS68438.1| hypothetical protein M569_06331, partial [Genlisea aurea]
Length=329

 Score =   507 bits (1305),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 276/334 (83%), Positives = 302/334 (90%), Gaps = 7/334 (2%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGSPAP--EVFVDKNTRVICQGITGKNG  1171
             MA Q  RLI  +S +V      P  + Q  R FGSP P   VFVDKNTRVICQGITGKNG
Sbjct  1     MARQVNRLIGQLSSRVL----CP-GRIQNSRSFGSPPPPPAVFVDKNTRVICQGITGKNG  55

Query  1170  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  991
             TFHTEQA+EYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAET+ANASVIYVPPPFA  A
Sbjct  56    TFHTEQAVEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETRANASVIYVPPPFAAKA  115

Query  990   imeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPG  811
             I+EA+EAELDL+VCITEGIPQHDMV+VKAAL +Q+KTRLIGPNCPGIIKPGECKIGIMPG
Sbjct  116   ILEALEAELDLIVCITEGIPQHDMVRVKAALNKQSKTRLIGPNCPGIIKPGECKIGIMPG  175

Query  810   YIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQ  631
             YIHKPGR+GIVSRSGTLTYEAVFQT+AVGLGQSTCVGIGGDPFNGTNFVDC+++F+ DPQ
Sbjct  176   YIHKPGRVGIVSRSGTLTYEAVFQTSAVGLGQSTCVGIGGDPFNGTNFVDCIQKFLVDPQ  235

Query  630   TEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTA  451
             TEGIVLIGEIGGTAEE+AAA IKESGTEKPVV+FIAGLTAPPGRRMGHAGAIVSGGKGTA
Sbjct  236   TEGIVLIGEIGGTAEEDAAALIKESGTEKPVVSFIAGLTAPPGRRMGHAGAIVSGGKGTA  295

Query  450   QDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGL  349
             QDKI+TL+EAGVTV ESPAK+G  MLD F ++GL
Sbjct  296   QDKIKTLREAGVTVVESPAKIGVAMLDAFKQKGL  329



>ref|XP_008467310.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Cucumis melo]
Length=342

 Score =   507 bits (1306),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 272/308 (88%), Positives = 293/308 (95%), Gaps = 0/308 (0%)
 Frame = -2

Query  1269  QQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEH  1090
             Q + +    SP P VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEH
Sbjct  34    QIRHYSASPSPPPAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEH  93

Query  1089  LGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKV  910
             LGLPVFN+VA+AKAETKANASVIYVPPPFA AAI+EAMEAELDLVVCITEGIPQHDMV+V
Sbjct  94    LGLPVFNSVAEAKAETKANASVIYVPPPFAAAAILEAMEAELDLVVCITEGIPQHDMVRV  153

Query  909   KAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTA  730
             KAAL +Q+KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTA
Sbjct  154   KAALNKQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTA  213

Query  729   VGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGT  550
             VGLGQSTCVGIGGDPFNGTNFVDC+E+F+ADPQTEGIVLIGEIGGTAEE+AAA IKESGT
Sbjct  214   VGLGQSTCVGIGGDPFNGTNFVDCIEKFLADPQTEGIVLIGEIGGTAEEDAAALIKESGT  273

Query  549   EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLD  370
             +KP+V FIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV ESPAK+G +ML+
Sbjct  274   DKPIVGFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVESPAKIGVSMLE  333

Query  369   VFTKRGLL  346
             VF +RGL+
Sbjct  334   VFKQRGLV  341



>gb|KJB79846.1| hypothetical protein B456_013G069200 [Gossypium raimondii]
Length=335

 Score =   507 bits (1306),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 282/336 (84%), Positives = 302/336 (90%), Gaps = 5/336 (1%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGS---PAPEVFVDKNTRVICQGITGKN  1174
             MA Q +RL+ ++S +        L   Q  R F +   P P VFVDKNTRVICQGITGKN
Sbjct  1     MARQASRLLRSLSSQFS--HHKSLLSPQHSRSFSAAPAPQPAVFVDKNTRVICQGITGKN  58

Query  1173  GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFaga  994
             GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVPPPFA  
Sbjct  59    GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAP  118

Query  993   aimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMP  814
             AIMEAMEAELDLVVCITEGIPQHDMV+VKAAL QQ+KTRLIGPNCPGIIKPGECKIGIMP
Sbjct  119   AIMEAMEAELDLVVCITEGIPQHDMVRVKAALNQQSKTRLIGPNCPGIIKPGECKIGIMP  178

Query  813   GYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADP  634
             GYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+ +F+ADP
Sbjct  179   GYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTKFLADP  238

Query  633   QTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGT  454
             QTEGI+LIGEIGGTAEE+AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGT
Sbjct  239   QTEGIILIGEIGGTAEEDAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGT  298

Query  453   AQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             AQDKI+TL+EAGVTV ESPAK+G  M DVF +RGLL
Sbjct  299   AQDKIKTLREAGVTVVESPAKIGVAMHDVFKQRGLL  334



>gb|EYU19899.1| hypothetical protein MIMGU_mgv1a009825mg [Erythranthe guttata]
Length=330

 Score =   504 bits (1299),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 281/335 (84%), Positives = 305/335 (91%), Gaps = 7/335 (2%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGSPAP--EVFVDKNTRVICQGITGKNG  1171
             M+ Q  RLI ++S ++      P  Q QQHR F SP P   VFVDKNTRVICQGITGKNG
Sbjct  1     MSRQATRLIHSLSSRLF----CP-KQLQQHRNFASPPPPPAVFVDKNTRVICQGITGKNG  55

Query  1170  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  991
             TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANA+VIYVPPPFA  A
Sbjct  56    TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANATVIYVPPPFAAKA  115

Query  990   imeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPG  811
             IMEA+EAELDL VCITEGIPQHDM++VK+AL QQ+KTRLIGPNCPGIIKPGECKIGIMPG
Sbjct  116   IMEAIEAELDLAVCITEGIPQHDMIRVKSALNQQSKTRLIGPNCPGIIKPGECKIGIMPG  175

Query  810   YIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQ  631
             YIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCL++F+ DPQ
Sbjct  176   YIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLQKFLVDPQ  235

Query  630   TEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTA  451
             TEGI+LIGEIGGTAEE+AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTA
Sbjct  236   TEGIILIGEIGGTAEEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTA  295

Query  450   QDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             QDKI+TL+EAGVTV ESPAK+G  ML+VF +RGL+
Sbjct  296   QDKIKTLREAGVTVVESPAKIGIAMLEVFKQRGLV  330



>ref|XP_010934473.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Elaeis guineensis]
Length=340

 Score =   503 bits (1296),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 276/339 (81%), Positives = 304/339 (90%), Gaps = 6/339 (2%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKV----RPITQSPLWQQQQHRLFGSPAPE--VFVDKNTRVICQGIT  1183
             M+ Q A+L+ +++ ++    +P   SPL  Q +     +P P   VFVDKNTRVICQGIT
Sbjct  1     MSRQAAKLVGSLASRLVSEPKPFVSSPLSSQYRRHFAAAPPPPPAVFVDKNTRVICQGIT  60

Query  1182  GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPF  1003
             GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVPPPF
Sbjct  61    GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPPF  120

Query  1002  agaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIG  823
             A AAI+EAMEAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLIGPNCPGIIKPGECKIG
Sbjct  121   AAAAILEAMEAELDLVVCITEGIPQHDMVRVKAALNKQSKTRLIGPNCPGIIKPGECKIG  180

Query  822   IMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFV  643
             IMPGYIHKPG +G+VSRSGTLTYEAVFQTT VGLGQSTCVGIGGDPFNGTNFVDC+ RF+
Sbjct  181   IMPGYIHKPGHVGVVSRSGTLTYEAVFQTTTVGLGQSTCVGIGGDPFNGTNFVDCITRFL  240

Query  642   ADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGG  463
              DPQT+GIVLIGEIGGTAEE+AAA I+ES TEKPVVAFIAGLTAPPGRRMGHAGAIVSGG
Sbjct  241   EDPQTKGIVLIGEIGGTAEEDAAALIRESRTEKPVVAFIAGLTAPPGRRMGHAGAIVSGG  300

Query  462   KGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             KGTAQDKI+TL+EAGVTV ESPAK+G  MLDVF +RGL+
Sbjct  301   KGTAQDKIKTLREAGVTVVESPAKIGAAMLDVFKQRGLV  339



>ref|XP_004137529.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Cucumis sativus]
 gb|KGN64210.1| Succinyl-CoA ligase alpha 1 subunit [Cucumis sativus]
Length=342

 Score =   503 bits (1294),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 272/308 (88%), Positives = 292/308 (95%), Gaps = 0/308 (0%)
 Frame = -2

Query  1269  QQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEH  1090
             Q + +    SP P VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEH
Sbjct  34    QIRHYSAAPSPPPAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEH  93

Query  1089  LGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKV  910
             LGLPVFN+VA+AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+V
Sbjct  94    LGLPVFNSVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRV  153

Query  909   KAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTA  730
             KAAL +Q+KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTA
Sbjct  154   KAALNKQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTA  213

Query  729   VGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGT  550
             VGLGQSTCVGIGGDPFNGTNFVDC+E+F+ DPQTEGIVLIGEIGGTAEE+AAA IKESGT
Sbjct  214   VGLGQSTCVGIGGDPFNGTNFVDCIEKFLVDPQTEGIVLIGEIGGTAEEDAAALIKESGT  273

Query  549   EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLD  370
             +KP+V FIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV ESPAK+G +ML+
Sbjct  274   DKPIVGFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVESPAKIGVSMLE  333

Query  369   VFTKRGLL  346
             VF +RGL+
Sbjct  334   VFKQRGLV  341



>ref|XP_007152547.1| hypothetical protein PHAVU_004G139300g [Phaseolus vulgaris]
 gb|ESW24541.1| hypothetical protein PHAVU_004G139300g [Phaseolus vulgaris]
Length=324

 Score =   501 bits (1291),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 274/303 (90%), Positives = 288/303 (95%), Gaps = 0/303 (0%)
 Frame = -2

Query  1254  RLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPV  1075
             R F S  P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPV
Sbjct  21    RQFSSATPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPV  80

Query  1074  FNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALK  895
             FNTVA+AKAETKANASVIYVPPPFA AAIME+MEAELDLVVCITEGIPQHDMV+VKAAL 
Sbjct  81    FNTVAEAKAETKANASVIYVPPPFAAAAIMESMEAELDLVVCITEGIPQHDMVRVKAALN  140

Query  894   QQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQ  715
             QQ+KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQ
Sbjct  141   QQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQ  200

Query  714   STCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVV  535
             STCVGIGGDPFNGTNFVDCL +F+ DPQTEGI+LIGEIGGTAEE+AAA IKESGTEKP+V
Sbjct  201   STCVGIGGDPFNGTNFVDCLRKFIPDPQTEGIILIGEIGGTAEEDAAALIKESGTEKPIV  260

Query  534   AFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKR  355
             AFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTL+EAGVTV ESPAK+G  MLDVF +R
Sbjct  261   AFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLREAGVTVVESPAKIGAAMLDVFKRR  320

Query  354   GLL  346
             GL+
Sbjct  321   GLV  323



>gb|ABK95068.1| unknown [Populus trichocarpa]
Length=331

 Score =   501 bits (1291),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 267/294 (91%), Positives = 287/294 (98%), Gaps = 0/294 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+V++AKA
Sbjct  37    VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVSEAKA  96

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             ETKANASVIYVPPPFA AAI+EA+EAELDLVVCITEGIPQHDMV+VKAA+K+QTKTRLIG
Sbjct  97    ETKANASVIYVPPPFAAAAILEAVEAELDLVVCITEGIPQHDMVRVKAAIKKQTKTRLIG  156

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPGIIKPGECKIGIMPGYIHKPGR+GIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD
Sbjct  157   PNCPGIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  216

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             PFNGTNFVDC+E+F+ADPQTEGIVLIGEIGGTAEE+AA  IKESGTEKPVVAFIAG+TAP
Sbjct  217   PFNGTNFVDCVEKFLADPQTEGIVLIGEIGGTAEEDAATLIKESGTEKPVVAFIAGVTAP  276

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             PGRRMGHAGAIVSGGKGTAQDKI+TL++AGV V ESPAK+GT MLDVF +RGL+
Sbjct  277   PGRRMGHAGAIVSGGKGTAQDKIKTLRDAGVIVVESPAKIGTAMLDVFKERGLV  330



>ref|XP_008375061.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Malus domestica]
Length=334

 Score =   501 bits (1289),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 276/328 (84%), Positives = 304/328 (93%), Gaps = 1/328 (0%)
 Frame = -2

Query  1329  ARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQA  1150
             A+LI +++ + +P   + L Q++ +     P P VFVDKNTRVICQGITGKNGTFHTEQA
Sbjct  7     AKLIGSIASR-KPSPSTSLRQRRHYSPAPPPPPAVFVDKNTRVICQGITGKNGTFHTEQA  65

Query  1149  IEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeamea  970
             IEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVPPPFA AAI+EA+EA
Sbjct  66    IEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAILEAVEA  125

Query  969   ELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGR  790
             ELDLVVCITEGIPQHDMV+VKAA+ +Q+KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGR
Sbjct  126   ELDLVVCITEGIPQHDMVRVKAAINRQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGR  185

Query  789   IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLi  610
             IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC++RF+ DPQTEGI+LI
Sbjct  186   IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIDRFLQDPQTEGIILI  245

Query  609   geiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTL  430
             GEIGGTAEE+AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL
Sbjct  246   GEIGGTAEEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTL  305

Query  429   KEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             +EAGVTV ESPAK+G  MLDVF +RGL+
Sbjct  306   REAGVTVVESPAKIGAAMLDVFKQRGLV  333



>gb|KHG06820.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-2, mitochondrial 
[Gossypium arboreum]
Length=335

 Score =   501 bits (1289),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 281/335 (84%), Positives = 303/335 (90%), Gaps = 3/335 (1%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPE--VFVDKNTRVICQGITGKNG  1171
             MA Q +RL+ ++S +     +SPL          +PAP+  VFVDKNTRVICQGITGKNG
Sbjct  1     MARQASRLLRSLSSQFSH-RKSPLSPLHSRSFSAAPAPQPAVFVDKNTRVICQGITGKNG  59

Query  1170  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  991
             TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+A AETKANASVIYVPPPFA AA
Sbjct  60    TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEANAETKANASVIYVPPPFAAAA  119

Query  990   imeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPG  811
             IMEAMEAELDLVVCITEGIPQHDMV+VK AL QQ+KTRLIGPNCPGIIKPGECKIGIMPG
Sbjct  120   IMEAMEAELDLVVCITEGIPQHDMVRVKVALNQQSKTRLIGPNCPGIIKPGECKIGIMPG  179

Query  810   YIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQ  631
             YIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+ +F+ADPQ
Sbjct  180   YIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTKFLADPQ  239

Query  630   TEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTA  451
             TEGI+LIGEIGGTAEE+AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTA
Sbjct  240   TEGIILIGEIGGTAEEDAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTA  299

Query  450   QDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             QDKI+TL+EAGVTV ESPAK+G  M DVF +RGLL
Sbjct  300   QDKIKTLREAGVTVVESPAKIGVAMHDVFKQRGLL  334



>ref|XP_002514510.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2, mitochondrial 
precursor, putative [Ricinus communis]
 gb|EEF47910.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2, mitochondrial 
precursor, putative [Ricinus communis]
Length=334

 Score =   500 bits (1287),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 283/333 (85%), Positives = 305/333 (92%), Gaps = 2/333 (1%)
 Frame = -2

Query  1344  MAWQT-ARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGT  1168
             MA Q  A+LI +++ + +P   S   Q +Q+    SP   VFVDKNTRVICQGITGKNGT
Sbjct  1     MARQAVAKLIGSIASR-KPSLSSSAIQTRQYAAAASPPAAVFVDKNTRVICQGITGKNGT  59

Query  1167  FHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaai  988
             FHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVPPPFA AAI
Sbjct  60    FHTEQAIEYGTTMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPPFAAAAI  119

Query  987   meameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGY  808
             MEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLIGPNCPGIIKPGECKIGIMPGY
Sbjct  120   MEAMEAELDLVVCITEGIPQHDMVRVKAALNRQSKTRLIGPNCPGIIKPGECKIGIMPGY  179

Query  807   IHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQT  628
             IHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+E+F+ADPQT
Sbjct  180   IHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKFLADPQT  239

Query  627   EGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQ  448
             EGI+LIGEIGGTAEE+AAA IKESGT+KP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQ
Sbjct  240   EGIILIGEIGGTAEEDAAALIKESGTDKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQ  299

Query  447   DKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGL  349
             DKI+TLKEAGVTV ESPAK+G  MLDVF +RGL
Sbjct  300   DKIKTLKEAGVTVVESPAKIGVAMLDVFKQRGL  332



>ref|XP_009413310.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Musa acuminata subsp. malaccensis]
Length=336

 Score =   500 bits (1287),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 275/335 (82%), Positives = 302/335 (90%), Gaps = 2/335 (1%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKV--RPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNG  1171
             M+ Q ++L+ +++ K+   P    P     +H     PAP VFVDKNTRVICQGITGKNG
Sbjct  1     MSRQASKLVGSLASKIFANPTPVVPSSPLSRHFAAAPPAPAVFVDKNTRVICQGITGKNG  60

Query  1170  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  991
             TFH+EQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV++AKAETKANASVIYVPPPFA AA
Sbjct  61    TFHSEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVSEAKAETKANASVIYVPPPFAAAA  120

Query  990   imeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPG  811
             IMEA+EAELDLVVC+TEGIPQHDMV+VKAAL +Q+KTRLIGPNCPGIIKPGECKIGIMPG
Sbjct  121   IMEALEAELDLVVCVTEGIPQHDMVRVKAALDKQSKTRLIGPNCPGIIKPGECKIGIMPG  180

Query  810   YIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQ  631
             YIHKPGR+GIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCL +F+ DPQ
Sbjct  181   YIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLRKFLEDPQ  240

Query  630   TEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTA  451
             TEGIVLIGEIGGTAEE+AAA I+ES TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTA
Sbjct  241   TEGIVLIGEIGGTAEEDAAALIQESKTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTA  300

Query  450   QDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             QDKI+TL+EAGVTV ESPAK+G  MLDVF +R L+
Sbjct  301   QDKIKTLREAGVTVVESPAKIGVAMLDVFKQRRLV  335



>ref|XP_011022031.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Populus euphratica]
Length=331

 Score =   499 bits (1286),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 266/294 (90%), Positives = 287/294 (98%), Gaps = 0/294 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKA
Sbjct  37    VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKA  96

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             ETKANASVIYVPPPFA AAI+EA+EAELDLVVCITEGIPQHDMV+VKAA+K+Q+KTRLIG
Sbjct  97    ETKANASVIYVPPPFAAAAILEAVEAELDLVVCITEGIPQHDMVRVKAAIKKQSKTRLIG  156

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPGIIKPGECKIGIMPGYIHKPGR+GIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD
Sbjct  157   PNCPGIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  216

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             PFNGTNFVDC+++F+ADPQTEGIVLIGEIGGTAEE+AA  IKESGTEKPVVAFIAG+TAP
Sbjct  217   PFNGTNFVDCVKKFLADPQTEGIVLIGEIGGTAEEDAATLIKESGTEKPVVAFIAGVTAP  276

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             PGRRMGHAGAIVSGGKGTAQDKI+TL++AGV V ESPAK+GT MLDVF +RGL+
Sbjct  277   PGRRMGHAGAIVSGGKGTAQDKIKTLRDAGVIVVESPAKIGTAMLDVFKERGLV  330



>ref|XP_002307162.2| hypothetical protein POPTR_0005s09370g [Populus trichocarpa]
 gb|EEE94158.2| hypothetical protein POPTR_0005s09370g [Populus trichocarpa]
Length=331

 Score =   499 bits (1286),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 266/294 (90%), Positives = 287/294 (98%), Gaps = 0/294 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+V++AKA
Sbjct  37    VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVSEAKA  96

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             ETKANASVIYVPPPFA AAI+EA+EAELDLVVCITEGIPQHDMV+VKAA+K+QTKTRLIG
Sbjct  97    ETKANASVIYVPPPFAAAAILEAVEAELDLVVCITEGIPQHDMVRVKAAIKKQTKTRLIG  156

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPGIIKPGECKIGIMPGYIHKPGR+GIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD
Sbjct  157   PNCPGIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  216

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             PFNGTNFVDC+++F+ADPQTEGIVLIGEIGGTAEE+AA  IKESGTEKPVVAFIAG+TAP
Sbjct  217   PFNGTNFVDCVKKFLADPQTEGIVLIGEIGGTAEEDAATLIKESGTEKPVVAFIAGVTAP  276

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             PGRRMGHAGAIVSGGKGTAQDKI+TL++AGV V ESPAK+GT MLDVF +RGL+
Sbjct  277   PGRRMGHAGAIVSGGKGTAQDKIKTLRDAGVIVVESPAKIGTAMLDVFKERGLV  330



>emb|CDX81092.1| BnaC03g03460D [Brassica napus]
Length=346

 Score =   499 bits (1286),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 277/345 (80%), Positives = 296/345 (86%), Gaps = 13/345 (4%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVR-----------PITQSPLWQQQQHRLFGS-PAPEVFVDKNTRV  1201
             M+ Q ARLI ++S K R           P  QS L    Q R F S P   VFVDKNTRV
Sbjct  1     MSRQVARLIGSLSSKARRCSNGGGSEAFPSRQS-LSSLTQSRSFASDPPAAVFVDKNTRV  59

Query  1200  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  1021
             +CQGITGKNGTFHTEQAIEYGT MV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASVI
Sbjct  60    MCQGITGKNGTFHTEQAIEYGTNMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVI  119

Query  1020  YVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKP  841
             YVP PFA AAIME ++AELDLVVCITEGIPQHDMV+VK AL  Q+KTRLIGPNCPGIIKP
Sbjct  120   YVPAPFAAAAIMEGIQAELDLVVCITEGIPQHDMVRVKHALNSQSKTRLIGPNCPGIIKP  179

Query  840   GECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD  661
             GECKIGIMPGYIHKPG+IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD
Sbjct  180   GECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD  239

Query  660   CLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAG  481
             CLE+F  DPQTEGIVLIGEIGGTAEE+AAA IK SGTEKPVVAFIAGLTAPPGRRMGHAG
Sbjct  240   CLEKFFVDPQTEGIVLIGEIGGTAEEDAAALIKASGTEKPVVAFIAGLTAPPGRRMGHAG  299

Query  480   AIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             AIVSGGKGTAQDKI++L +AGV V ESPAK+G  M D+F +RGLL
Sbjct  300   AIVSGGKGTAQDKIKSLNDAGVKVVESPAKIGAAMYDLFKERGLL  344



>ref|XP_009136375.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Brassica rapa]
Length=346

 Score =   499 bits (1286),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 273/345 (79%), Positives = 298/345 (86%), Gaps = 12/345 (3%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRPITQSP---------LWQQQQHRLFGS---PAPEVFVDKNTRV  1201
             M+ Q A+L+ ++  K+R    S          L    + R FG+   P   VFVDKNTRV
Sbjct  1     MSRQVAKLVGSLPSKLRSSVASSELLYPSCSSLTSLTKSRSFGTTPPPPAAVFVDKNTRV  60

Query  1200  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  1021
             ICQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASVI
Sbjct  61    ICQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVI  120

Query  1020  YVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKP  841
             YVP PFA AAIME + AELDLVVCITEGIPQHDMV+VKAAL  QTKTRLIGPNCPGIIKP
Sbjct  121   YVPAPFAAAAIMEGVAAELDLVVCITEGIPQHDMVRVKAALNSQTKTRLIGPNCPGIIKP  180

Query  840   GECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD  661
             GECKIGIMPGYIHKPG+IGIVSRSGTLTYEAVFQT+AVGLGQSTCVGIGGDPFNGTNFVD
Sbjct  181   GECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTSAVGLGQSTCVGIGGDPFNGTNFVD  240

Query  660   CLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAG  481
             CL++F  DPQTEGIVLIGEIGGTAEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAG
Sbjct  241   CLDKFFVDPQTEGIVLIGEIGGTAEEDAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAG  300

Query  480   AIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             AIVSGGKGTAQDKI++L++AGV V ESPAK+G  M ++F +RGLL
Sbjct  301   AIVSGGKGTAQDKIKSLRDAGVKVVESPAKIGAAMFELFQERGLL  345



>ref|XP_004299462.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Fragaria vesca subsp. vesca]
Length=337

 Score =   499 bits (1285),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 281/336 (84%), Positives = 305/336 (91%), Gaps = 3/336 (1%)
 Frame = -2

Query  1344  MAWQT-ARLIANVS--KKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKN  1174
             MA Q+ A+LI +++  K   P T +    Q++H     P P VFVDKNTRVICQGITGKN
Sbjct  1     MARQSVAKLIGSIASRKLSSPSTSTTSIIQRRHYAAAPPPPAVFVDKNTRVICQGITGKN  60

Query  1173  GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFaga  994
             GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+V +AKAETKANA+VIYVPPPFA A
Sbjct  61    GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVVEAKAETKANATVIYVPPPFAAA  120

Query  993   aimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMP  814
             AIMEAMEAELDLVVCITEGIPQHDMV+VKAAL  Q+KTRLIGPNCPGIIKPGECKIGIMP
Sbjct  121   AIMEAMEAELDLVVCITEGIPQHDMVRVKAALNSQSKTRLIGPNCPGIIKPGECKIGIMP  180

Query  813   GYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADP  634
             GYIHKPGR+GIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+E+F+ADP
Sbjct  181   GYIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCMEKFLADP  240

Query  633   QTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGT  454
             QTEGIVLIGEIGGTAEE+AAA IK SGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGT
Sbjct  241   QTEGIVLIGEIGGTAEEDAAALIKASGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGT  300

Query  453   AQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             AQDKI+TL+EAGVTV ESPAK+G  MLDVF +RGL+
Sbjct  301   AQDKIKTLREAGVTVVESPAKIGVAMLDVFKQRGLV  336



>emb|CDY61908.1| BnaC07g49680D [Brassica napus]
Length=345

 Score =   499 bits (1285),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 274/344 (80%), Positives = 297/344 (86%), Gaps = 11/344 (3%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRPITQ--------SPLWQQQQHRLFGS---PAPEVFVDKNTRVI  1198
             M+ Q  RL+ ++  K+R            S L    + R FG+   P   VFVDKNTRVI
Sbjct  1     MSRQVTRLLGSLPSKLRSSVSSSELYPSCSSLTSLTKSRSFGTTPPPPAAVFVDKNTRVI  60

Query  1197  CQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIY  1018
             CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIY
Sbjct  61    CQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIY  120

Query  1017  VPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPG  838
             VP PFA AAIME + AELDLVVCITEGIPQHDMV+VKAAL  QTKTRLIGPNCPGIIKPG
Sbjct  121   VPAPFAAAAIMEGVAAELDLVVCITEGIPQHDMVRVKAALNSQTKTRLIGPNCPGIIKPG  180

Query  837   ECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC  658
             ECKIGIMPGYIHKPG+IGIVSRSGTLTYEAVFQT+AVGLGQSTCVGIGGDPFNGTNFVDC
Sbjct  181   ECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTSAVGLGQSTCVGIGGDPFNGTNFVDC  240

Query  657   LERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGA  478
             LE+F  DPQTEGIVLIGEIGGTAEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGA
Sbjct  241   LEKFFVDPQTEGIVLIGEIGGTAEEDAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGA  300

Query  477   IVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             IVSGGKGTAQDKI++L++AGV V ESPAK+G  M ++F +RGLL
Sbjct  301   IVSGGKGTAQDKIKSLRDAGVKVVESPAKIGAAMFELFQERGLL  344



>ref|XP_002460917.1| hypothetical protein SORBIDRAFT_02g037420 [Sorghum bicolor]
 gb|EER97438.1| hypothetical protein SORBIDRAFT_02g037420 [Sorghum bicolor]
Length=332

 Score =   498 bits (1283),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 266/298 (89%), Positives = 287/298 (96%), Gaps = 0/298 (0%)
 Frame = -2

Query  1239  PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA  1060
             P+P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA
Sbjct  34    PSPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVA  93

Query  1059  DAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKT  880
             +AKAETKANASVIYVPPPFA AAIMEAM+AELDLVVCITEGIPQHDMVKVKAAL +Q+KT
Sbjct  94    EAKAETKANASVIYVPPPFAAAAIMEAMDAELDLVVCITEGIPQHDMVKVKAALNRQSKT  153

Query  879   RLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVG  700
             RLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVG
Sbjct  154   RLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVG  213

Query  699   IGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAG  520
             IGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGTAEE+AA FI+ES T+KPVVAFIAG
Sbjct  214   IGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGTAEEDAATFIQESKTQKPVVAFIAG  273

Query  519   LTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             LTAPPGRRMGHAGAIV+GGKGTAQDKI+ L+EAGVTV ESPAK+G+TM ++F +RG++
Sbjct  274   LTAPPGRRMGHAGAIVAGGKGTAQDKIKALREAGVTVVESPAKIGSTMFEIFKQRGMV  331



>ref|XP_006399319.1| hypothetical protein EUTSA_v10013993mg [Eutrema salsugineum]
 gb|ESQ40772.1| hypothetical protein EUTSA_v10013993mg [Eutrema salsugineum]
Length=347

 Score =   499 bits (1285),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 276/346 (80%), Positives = 297/346 (86%), Gaps = 14/346 (4%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVR----------PITQSPLWQQQQHRLFGS---PAPEVFVDKNTR  1204
             M+ Q  RL+ ++S K R          P  QS L    Q R F S   P   VFVDKNTR
Sbjct  1     MSRQVTRLLGSLSSKARRCSIGGSEVFPSCQS-LSSLTQSRSFASDPPPPAAVFVDKNTR  59

Query  1203  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  1024
             V+CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASV
Sbjct  60    VMCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASV  119

Query  1023  IYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIK  844
             IYVP PFA AAIME ++AELDL+VCITEGIPQHDMV+VK AL  Q+KTRLIGPNCPGIIK
Sbjct  120   IYVPAPFAAAAIMEGIQAELDLIVCITEGIPQHDMVRVKHALNSQSKTRLIGPNCPGIIK  179

Query  843   PGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV  664
             PGECKIGIMPGYIHKPG+IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV
Sbjct  180   PGECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV  239

Query  663   DCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHA  484
             DCLE+F  DPQTEGIVLIGEIGGTAEE+AAA IKESGTEKPVVAFIAGLTAPPGRRMGHA
Sbjct  240   DCLEKFFVDPQTEGIVLIGEIGGTAEEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHA  299

Query  483   GAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             GAIVSGGKGTAQDKI++L +AGV V ESPAK+G  M D+F +RGLL
Sbjct  300   GAIVSGGKGTAQDKIKSLNDAGVKVVESPAKIGAAMYDLFQERGLL  345



>ref|XP_010423114.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Camelina sativa]
Length=343

 Score =   498 bits (1283),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 277/342 (81%), Positives = 298/342 (87%), Gaps = 10/342 (3%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVR------PITQSPLWQQQQHRLFGS---PAPEVFVDKNTRVICQ  1192
             M+ Q ARLI ++S K R      P  QS L    Q R F S   P   VFVDKNTRV+CQ
Sbjct  1     MSRQVARLIGSLSSKARGGSEVFPSCQS-LTSLTQSRSFASDPHPPAAVFVDKNTRVLCQ  59

Query  1191  GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVP  1012
             GITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVP
Sbjct  60    GITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVP  119

Query  1011  PPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGEC  832
              PFA AAIME +EAELDL+VCITEGIPQHDMV+VK AL  Q+KTRLIGPNCPGIIKPGEC
Sbjct  120   APFAAAAIMEGIEAELDLIVCITEGIPQHDMVRVKHALNGQSKTRLIGPNCPGIIKPGEC  179

Query  831   KIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE  652
             KIGIMPGYIHKPG+IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE
Sbjct  180   KIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE  239

Query  651   RFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIV  472
             +F  DPQTEGIVLIGEIGGTAEE+AAA IK SGTEKPVVAFIAGLTAPPGRRMGHAGAIV
Sbjct  240   KFFVDPQTEGIVLIGEIGGTAEEDAAALIKASGTEKPVVAFIAGLTAPPGRRMGHAGAIV  299

Query  471   SGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             SGGKGTAQDKI++L +AGV V ESPAK+G+ M ++F +RGLL
Sbjct  300   SGGKGTAQDKIKSLNDAGVKVVESPAKIGSAMYELFQERGLL  341



>ref|XP_006493424.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial-like [Citrus sinensis]
Length=347

 Score =   499 bits (1284),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 284/346 (82%), Positives = 307/346 (89%), Gaps = 15/346 (4%)
 Frame = -2

Query  1344  MAWQT-ARLIANVSKKVRPITQSPLWQQQ---------QHRLFGSPA----PEVFVDKNT  1207
             MA Q  A+LI ++  + RP T S +   +           R +GS A    P VFVDKNT
Sbjct  1     MARQALAKLIGSIGCR-RPSTASSVSHYRLSTSAAPAAHSRYYGSSAAASQPAVFVDKNT  59

Query  1206  RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANAS  1027
             RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANAS
Sbjct  60    RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANAS  119

Query  1026  VIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGII  847
             VIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLIGPNCPGII
Sbjct  120   VIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNRQSKTRLIGPNCPGII  179

Query  846   KPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNF  667
             KPGECKIGIMPGYIHKPGR+GIVSRSGTLTYEAVFQTT VGLGQSTCVGIGGDPFNGTNF
Sbjct  180   KPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTVVGLGQSTCVGIGGDPFNGTNF  239

Query  666   VDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGH  487
             VDCLE+F+ DPQTEGI+LIGEIGGTAEE+AAA IKESGTEKPVVAFIAGLTAPPGRRMGH
Sbjct  240   VDCLEKFLVDPQTEGIILIGEIGGTAEEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGH  299

Query  486   AGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGL  349
             AGAIVSGGKGTAQDKI+TL+EAGVTV ESPAK+G+ ML+VF +RGL
Sbjct  300   AGAIVSGGKGTAQDKIKTLREAGVTVVESPAKIGSAMLEVFKQRGL  345



>ref|XP_009125723.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Brassica rapa]
 emb|CDY40757.1| BnaAnng06200D [Brassica napus]
Length=342

 Score =   498 bits (1281),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 272/340 (80%), Positives = 296/340 (87%), Gaps = 7/340 (2%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRPITQSP----LWQQQQHRLFGS---PAPEVFVDKNTRVICQGI  1186
             M+ Q ARL+ ++S++    +       L    Q R F S   P   VFVDKNTRV+CQGI
Sbjct  1     MSRQVARLLGSLSRRCSSTSSEAIPPTLSSFTQSRSFASDPPPPAAVFVDKNTRVMCQGI  60

Query  1185  TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPP  1006
             TGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVP P
Sbjct  61    TGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPAP  120

Query  1005  FagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKI  826
             FA AAIME +EAELDL+VCITEGIPQHDMV+VK AL  Q+KTRLIGPNCPGIIKPGECKI
Sbjct  121   FAAAAIMEGIEAELDLIVCITEGIPQHDMVRVKHALNSQSKTRLIGPNCPGIIKPGECKI  180

Query  825   GIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERF  646
             GIMPGYIHKPG+IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F
Sbjct  181   GIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKF  240

Query  645   VADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSG  466
               DPQTEGIVLIGEIGGTAEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSG
Sbjct  241   FVDPQTEGIVLIGEIGGTAEEDAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSG  300

Query  465   GKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             GKGTAQDKI++L +AGV V ESPAK+G  M D+F +RGLL
Sbjct  301   GKGTAQDKIKSLNDAGVKVVESPAKIGAAMYDLFKERGLL  340



>ref|XP_002514509.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2, mitochondrial 
precursor, putative [Ricinus communis]
 gb|EEF47909.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2, mitochondrial 
precursor, putative [Ricinus communis]
Length=334

 Score =   497 bits (1280),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 282/333 (85%), Positives = 305/333 (92%), Gaps = 2/333 (1%)
 Frame = -2

Query  1344  MAWQT-ARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGT  1168
             MA Q  A+LI +++ + +P   S   Q +Q+    SP   VFVDKNT +ICQGITGKNGT
Sbjct  1     MARQAVAKLIGSIASR-KPSLSSSAIQTRQYAAAASPPAAVFVDKNTGLICQGITGKNGT  59

Query  1167  FHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaai  988
             FHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVPPPFA AAI
Sbjct  60    FHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPPFAAAAI  119

Query  987   meameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGY  808
             MEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLIGPNCPGIIKPGECKIGIMPGY
Sbjct  120   MEAMEAELDLVVCITEGIPQHDMVRVKAALNRQSKTRLIGPNCPGIIKPGECKIGIMPGY  179

Query  807   IHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQT  628
             IHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+E+F+ADPQT
Sbjct  180   IHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKFLADPQT  239

Query  627   EGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQ  448
             EGI+LIGEIGGTAEE+AAA IKESGT+KP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQ
Sbjct  240   EGIILIGEIGGTAEEDAAALIKESGTDKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQ  299

Query  447   DKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGL  349
             DKI+TLKEAGVTV ESPAK+G  MLDVF +RGL
Sbjct  300   DKIKTLKEAGVTVVESPAKIGVAMLDVFKQRGL  332



>ref|XP_010491456.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Camelina sativa]
Length=348

 Score =   498 bits (1281),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 275/346 (79%), Positives = 296/346 (86%), Gaps = 13/346 (4%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVR----------PITQSPLWQQQQHRLFGS---PAPEVFVDKNTR  1204
             M+ Q ARLI ++S K R          P     L    Q R F S   P   VFVDKNTR
Sbjct  1     MSRQVARLIGSLSSKARRCSTGGSEVFPSCHQSLTSLTQSRSFASDPHPPAAVFVDKNTR  60

Query  1203  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  1024
             V+CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASV
Sbjct  61    VLCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASV  120

Query  1023  IYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIK  844
             IYVP PFA AAIME +EAELDL+VCITEGIPQHDMV+VK AL  Q+KTRLIGPNCPGIIK
Sbjct  121   IYVPAPFAAAAIMEGIEAELDLIVCITEGIPQHDMVRVKHALNGQSKTRLIGPNCPGIIK  180

Query  843   PGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV  664
             PGECKIGIMPGYIHKPG+IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV
Sbjct  181   PGECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV  240

Query  663   DCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHA  484
             DCLE+F  DPQTEGIVLIGEIGGTAEE+AAA IK SGTEKPVVAFIAGLTAPPGRRMGHA
Sbjct  241   DCLEKFFVDPQTEGIVLIGEIGGTAEEDAAALIKASGTEKPVVAFIAGLTAPPGRRMGHA  300

Query  483   GAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             GAIVSGGKGTAQDKI++L +AGV V ESPAK+G+ M ++F +RGLL
Sbjct  301   GAIVSGGKGTAQDKIKSLNDAGVKVVESPAKIGSAMYELFQERGLL  346



>sp|Q6ZL94.1|SUCA_ORYSJ RecName: Full=Probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial; AltName: Full=Succinyl-CoA synthetase 
subunit alpha; Short=SCS-alpha; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAC83073.1| putative succinyl-CoA ligase alpha subunit [Oryza sativa Japonica 
Group]
 gb|EAZ40411.1| hypothetical protein OsJ_24862 [Oryza sativa Japonica Group]
 dbj|BAH01520.1| unnamed protein product [Oryza sativa Japonica Group]
Length=331

 Score =   497 bits (1279),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 269/298 (90%), Positives = 288/298 (97%), Gaps = 0/298 (0%)
 Frame = -2

Query  1239  PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA  1060
             P+P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA
Sbjct  33    PSPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTTMVGGVTPKKGGTEHLGLPVFNSVA  92

Query  1059  DAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKT  880
             +AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMVKVKAAL +Q+KT
Sbjct  93    EAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVKVKAALNKQSKT  152

Query  879   RLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVG  700
             RLIGPNCPGIIKPGECKIGIMPGYIHKPGR+GIVSRSGTLTYEAVFQTTAVGLGQSTCVG
Sbjct  153   RLIGPNCPGIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVG  212

Query  699   IGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAG  520
             IGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGTAEE+AAAFI+ES T+KPVVAFIAG
Sbjct  213   IGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGTAEEDAAAFIQESKTQKPVVAFIAG  272

Query  519   LTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             LTAPPGRRMGHAGAIVSGGKGTAQDKI+ L+EAGVTV ESPAK+G+TM ++F +RG+L
Sbjct  273   LTAPPGRRMGHAGAIVSGGKGTAQDKIKALREAGVTVVESPAKIGSTMFEIFKQRGML  330



>ref|XP_007209332.1| hypothetical protein PRUPE_ppa008341mg [Prunus persica]
 gb|EMJ10531.1| hypothetical protein PRUPE_ppa008341mg [Prunus persica]
Length=336

 Score =   497 bits (1280),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 279/329 (85%), Positives = 305/329 (93%), Gaps = 1/329 (0%)
 Frame = -2

Query  1329  ARLIANV-SKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQ  1153
             A+LI ++ S+K  P   + + Q++ +    SP P VFVDKNTRVICQGITGKNGTFHTEQ
Sbjct  7     AKLIGSIASRKPSPSPSTSILQRRHYSPAPSPPPAVFVDKNTRVICQGITGKNGTFHTEQ  66

Query  1152  AIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeame  973
             AIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVPPPFA AAIMEAME
Sbjct  67    AIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAIMEAME  126

Query  972   aELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPG  793
             AELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLIGPNCPGIIKPGECKIGIMPGYIHKPG
Sbjct  127   AELDLVVCITEGIPQHDMVRVKAALNRQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPG  186

Query  792   RIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVL  613
             R+GIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC++RF+ DPQTEGI+L
Sbjct  187   RVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIDRFLEDPQTEGIIL  246

Query  612   igeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRT  433
             IGEIGGTAEE+AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+T
Sbjct  247   IGEIGGTAEEDAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKT  306

Query  432   LKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             L+EAGVTV ESPAK+G  MLDVF +RGL+
Sbjct  307   LREAGVTVVESPAKIGVAMLDVFKQRGLV  335



>ref|XP_003562832.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Brachypodium distachyon]
Length=327

 Score =   497 bits (1279),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 268/299 (90%), Positives = 290/299 (97%), Gaps = 0/299 (0%)
 Frame = -2

Query  1242  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  1063
             +P+P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+V
Sbjct  28    APSPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSV  87

Query  1062  ADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTK  883
             A+AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMVKVKAAL +Q+K
Sbjct  88    AEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVKVKAALNRQSK  147

Query  882   TRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCV  703
             TRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCV
Sbjct  148   TRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCV  207

Query  702   GIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIA  523
             G+GGDPFNGTNFVDCLE+FVADPQTEGIV+IGEIGGTAEE+AAAFI+ES TEKPVVAFIA
Sbjct  208   GMGGDPFNGTNFVDCLEKFVADPQTEGIVVIGEIGGTAEEDAAAFIQESKTEKPVVAFIA  267

Query  522   GLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             GLTAPPGRRMGHAGAIVSGGKGTAQDKI+ L++AGVTV ESPAK+G+TM ++F +RG++
Sbjct  268   GLTAPPGRRMGHAGAIVSGGKGTAQDKIKALRDAGVTVVESPAKIGSTMFELFKQRGMV  326



>gb|KHG04322.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Gossypium arboreum]
Length=346

 Score =   497 bits (1280),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 283/345 (82%), Positives = 306/345 (89%), Gaps = 12/345 (3%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRP---------ITQSPLWQQQQHRLFGS---PAPEVFVDKNTRV  1201
             MA Q +RLI ++S ++ P          + S      Q R F +   P P VFVDKNTRV
Sbjct  1     MARQASRLIQSLSSRISPHKPQISPLTPSSSSSQLLTQSRSFSAAPAPQPAVFVDKNTRV  60

Query  1200  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  1021
             ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVI
Sbjct  61    ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVI  120

Query  1020  YVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKP  841
             YVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL QQ+KTRLIGPNCPGIIKP
Sbjct  121   YVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNQQSKTRLIGPNCPGIIKP  180

Query  840   GECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD  661
             GECKIGIMPGYIHKPGR+GIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD
Sbjct  181   GECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD  240

Query  660   CLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAG  481
             C+ +F+ADPQTEGI+LIGEIGGTAEE+AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAG
Sbjct  241   CVTKFLADPQTEGIILIGEIGGTAEEDAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAG  300

Query  480   AIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             AIVSGGKGTAQDKI+TL+EAGVTV ESPAK+G  M +VF +RGLL
Sbjct  301   AIVSGGKGTAQDKIKTLREAGVTVVESPAKIGVAMHEVFKQRGLL  345



>ref|XP_010452813.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial [Camelina sativa]
Length=347

 Score =   497 bits (1280),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 277/346 (80%), Positives = 298/346 (86%), Gaps = 14/346 (4%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVR----------PITQSPLWQQQQHRLFGS---PAPEVFVDKNTR  1204
             M+ Q ARLI ++S K R          P  QS L    Q R F S   P   VFVDKNTR
Sbjct  1     MSRQVARLIGSLSSKARRCSTGGSEVFPSCQS-LTSLTQSRSFASDPHPPAAVFVDKNTR  59

Query  1203  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  1024
             V+CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASV
Sbjct  60    VLCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASV  119

Query  1023  IYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIK  844
             IYVP PFA AAIME +EAELDL+VCITEGIPQHDMV+VK AL  Q+KTRLIGPNCPGIIK
Sbjct  120   IYVPAPFAAAAIMEGIEAELDLIVCITEGIPQHDMVRVKHALNGQSKTRLIGPNCPGIIK  179

Query  843   PGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV  664
             PGECKIGIMPGYIHKPG+IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV
Sbjct  180   PGECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV  239

Query  663   DCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHA  484
             DCLE+F  DPQTEGIVLIGEIGGTAEE+AAA IK SGTEKPVVAFIAGLTAPPGRRMGHA
Sbjct  240   DCLEKFFVDPQTEGIVLIGEIGGTAEEDAAALIKASGTEKPVVAFIAGLTAPPGRRMGHA  299

Query  483   GAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             GAIVSGGKGTAQDKI++L +AGV V ESPAK+G+ M ++F +RGLL
Sbjct  300   GAIVSGGKGTAQDKIKSLNDAGVKVVESPAKIGSAMYELFQERGLL  345



>ref|XP_008788992.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Phoenix dactylifera]
Length=341

 Score =   497 bits (1280),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 268/294 (91%), Positives = 283/294 (96%), Gaps = 0/294 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKA
Sbjct  47    VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKA  106

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             ETKANASVIYVPPPFA AAI+EAMEAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLIG
Sbjct  107   ETKANASVIYVPPPFAAAAILEAMEAELDLVVCITEGIPQHDMVRVKAALNKQSKTRLIG  166

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPGIIKPGECKIGIMPGYIHKPGR+GIVSRSGTLTYEAVFQTT VGLGQSTCVGIGGD
Sbjct  167   PNCPGIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTVVGLGQSTCVGIGGD  226

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             PFNGTNFVDC+ RF+ DPQTEGIVLIGEIGGTAEE+AAA I+ESGTEKPVVAFIAGLTAP
Sbjct  227   PFNGTNFVDCITRFLEDPQTEGIVLIGEIGGTAEEDAAALIRESGTEKPVVAFIAGLTAP  286

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             PGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV ESPAK+G  MLDVF + GL+
Sbjct  287   PGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVESPAKIGAAMLDVFKQGGLV  340



>ref|XP_002271746.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial [Vitis vinifera]
 emb|CBI29046.3| unnamed protein product [Vitis vinifera]
Length=329

 Score =   496 bits (1278),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 277/333 (83%), Positives = 301/333 (90%), Gaps = 5/333 (2%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTF  1165
             M  Q  RLI  V  +++    SPL    +H    +P P VFVDKNTRVICQGITGKNGTF
Sbjct  1     MVGQVRRLIPYVVSRIK----SPLAPPSRHLGTTAP-PAVFVDKNTRVICQGITGKNGTF  55

Query  1164  HTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaim  985
             HTEQAIEYGTKMVGGVTPKKGG EHLGLP+FNTVA+AKAET+ANASVIYVPPPFA AAIM
Sbjct  56    HTEQAIEYGTKMVGGVTPKKGGMEHLGLPIFNTVAEAKAETRANASVIYVPPPFAAAAIM  115

Query  984   eameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYI  805
             EA+EAELDLVVCITEGIPQHDMVKVKAAL +Q+KTRLIGPNCPGIIKPGECKIGIMPGYI
Sbjct  116   EAVEAELDLVVCITEGIPQHDMVKVKAALNRQSKTRLIGPNCPGIIKPGECKIGIMPGYI  175

Query  804   HKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTE  625
             HKPGR+GIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+++F+ADPQTE
Sbjct  176   HKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVKKFLADPQTE  235

Query  624   GIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQD  445
             GI+LIGEIGGTAEE+AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQD
Sbjct  236   GIILIGEIGGTAEEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQD  295

Query  444   KIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             KI+TL++ G TV ESPAK+G  MLDVF +RGL+
Sbjct  296   KIKTLRDVGATVVESPAKIGVAMLDVFKQRGLV  328



>ref|XP_008796686.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Phoenix dactylifera]
Length=340

 Score =   497 bits (1279),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 278/339 (82%), Positives = 304/339 (90%), Gaps = 6/339 (2%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKV----RPITQSPLWQQQQHRLFGSPAPE--VFVDKNTRVICQGIT  1183
             M+ Q ++L+ +++ K+    R    SPL  Q +     +P+P   VFVDKNTRVICQGIT
Sbjct  1     MSRQASKLVGSLASKLVSQPRFSASSPLSSQLRRHFAAAPSPPPAVFVDKNTRVICQGIT  60

Query  1182  GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPF  1003
             GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVPP F
Sbjct  61    GKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPAF  120

Query  1002  agaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIG  823
             A AAI+EA+EAELDLVVCITEGIPQHDMV+VKAAL QQ+KTRLIGPNCPGIIKPGECKIG
Sbjct  121   AAAAILEALEAELDLVVCITEGIPQHDMVRVKAALNQQSKTRLIGPNCPGIIKPGECKIG  180

Query  822   IMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFV  643
             IMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+ RF+
Sbjct  181   IMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTRFL  240

Query  642   ADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGG  463
              DPQTEGIVLIGEIGGTAEE+AA  I+ESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGG
Sbjct  241   EDPQTEGIVLIGEIGGTAEEDAAVLIQESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGG  300

Query  462   KGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             KGTAQDKI+TL+EA VTV ESPAK+G  MLDVF +RGL+
Sbjct  301   KGTAQDKIKTLREADVTVVESPAKIGAAMLDVFKQRGLV  339



>ref|XP_006394592.1| hypothetical protein EUTSA_v10004347mg [Eutrema salsugineum]
 gb|ESQ31878.1| hypothetical protein EUTSA_v10004347mg [Eutrema salsugineum]
Length=401

 Score =   499 bits (1285),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 276/344 (80%), Positives = 297/344 (86%), Gaps = 11/344 (3%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRPI--------TQSPLWQQQQHRLFGS---PAPEVFVDKNTRVI  1198
             MA Q  RL+ ++S KVR          +   L    Q R FG+   P   VFVDKNTRVI
Sbjct  57    MARQVTRLLGSLSSKVRSSGGVSEVYPSCCYLTSLTQSRSFGTTPPPPAAVFVDKNTRVI  116

Query  1197  CQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIY  1018
             CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIY
Sbjct  117   CQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIY  176

Query  1017  VPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPG  838
             VP PFA AAIME + AELDLVVCITEGIPQHDMV+VKAAL  Q+KTRLIGPNCPGIIKPG
Sbjct  177   VPAPFAAAAIMEGVAAELDLVVCITEGIPQHDMVRVKAALNSQSKTRLIGPNCPGIIKPG  236

Query  837   ECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC  658
             ECKIGIMPGYIHKPG+IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC
Sbjct  237   ECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC  296

Query  657   LERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGA  478
             LE+F  DPQTEGIVLIGEIGGTAEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGA
Sbjct  297   LEKFFVDPQTEGIVLIGEIGGTAEEDAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGA  356

Query  477   IVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             IVSGGKGTAQDKI++L++A V V ESPAK+G  M ++F +RGLL
Sbjct  357   IVSGGKGTAQDKIKSLRDAEVKVVESPAKIGAAMFELFQERGLL  400



>ref|XP_003548295.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial-like [Glycine max]
Length=325

 Score =   496 bits (1277),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 275/314 (88%), Positives = 295/314 (94%), Gaps = 2/314 (1%)
 Frame = -2

Query  1281  SPLWQQQQH--RLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPK  1108
             S +  ++ H  R F + +P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPK
Sbjct  11    SSIASRRHHGLRHFSAASPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPK  70

Query  1107  KGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQ  928
             KGGTEHLGLPVFNTVA+AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQ
Sbjct  71    KGGTEHLGLPVFNTVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQ  130

Query  927   HDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEA  748
             HDMV+VKAAL +Q+KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEA
Sbjct  131   HDMVRVKAALNRQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEA  190

Query  747   VFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaaf  568
             VFQTTAVGLGQSTCVGIGGDPFNGTNFVDCL++F+ DPQTEGI+LIGEIGGTAEE+AAA 
Sbjct  191   VFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLQKFLTDPQTEGIILIGEIGGTAEEDAAAL  250

Query  567   IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKL  388
             IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV ESPAK+
Sbjct  251   IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVESPAKI  310

Query  387   GTTMLDVFTKRGLL  346
             G  MLDVF +RGL+
Sbjct  311   GAAMLDVFKQRGLV  324



>ref|NP_196447.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-1 [Arabidopsis 
thaliana]
 sp|P68209.1|SUCA1_ARATH RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial; AltName: Full=Succinyl-CoA synthetase subunit 
alpha-1; Short=SCS-alpha-1; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA05023.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 emb|CAC08330.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 gb|AAL61940.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 gb|AAM47932.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 gb|AAM60889.1| succinyl-CoA-ligase alpha subunit [Arabidopsis thaliana]
 gb|AED91279.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-1 [Arabidopsis 
thaliana]
Length=347

 Score =   497 bits (1280),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 276/346 (80%), Positives = 298/346 (86%), Gaps = 14/346 (4%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVR----------PITQSPLWQQQQHRLFGS---PAPEVFVDKNTR  1204
             M+ Q ARLI ++S K R          P  QS L    Q R F S   P   VFVDKNTR
Sbjct  1     MSRQVARLIGSLSSKARRCSTGGSEVFPSCQS-LTSLTQSRSFASDPHPPAAVFVDKNTR  59

Query  1203  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  1024
             V+CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKA+TKANASV
Sbjct  60    VLCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKADTKANASV  119

Query  1023  IYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIK  844
             IYVP PFA AAIME +EAELDL+VCITEGIPQHDMV+VK AL  Q+KTRLIGPNCPGIIK
Sbjct  120   IYVPAPFAAAAIMEGIEAELDLIVCITEGIPQHDMVRVKHALNSQSKTRLIGPNCPGIIK  179

Query  843   PGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV  664
             PGECKIGIMPGYIHKPG+IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV
Sbjct  180   PGECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV  239

Query  663   DCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHA  484
             DCLE+F  DPQTEGIVLIGEIGGTAEE+AAA IK SGTEKPVVAFIAGLTAPPGRRMGHA
Sbjct  240   DCLEKFFVDPQTEGIVLIGEIGGTAEEDAAALIKASGTEKPVVAFIAGLTAPPGRRMGHA  299

Query  483   GAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             GAIVSGGKGTAQDKI++L +AGV V ESPAK+G+ M ++F +RGLL
Sbjct  300   GAIVSGGKGTAQDKIKSLNDAGVKVVESPAKIGSAMYELFQERGLL  345



>ref|XP_004958125.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial-like [Setaria italica]
Length=332

 Score =   496 bits (1277),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 268/298 (90%), Positives = 288/298 (97%), Gaps = 0/298 (0%)
 Frame = -2

Query  1239  PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA  1060
             P+P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA
Sbjct  34    PSPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVA  93

Query  1059  DAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKT  880
             +AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMVKVKAAL +Q+KT
Sbjct  94    EAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVKVKAALNRQSKT  153

Query  879   RLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVG  700
             RLIGPNCPGIIKPGECKIGIMPGYIHKPGR+GIVSRSGTLTYEAVFQTTAVGLGQSTCVG
Sbjct  154   RLIGPNCPGIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVG  213

Query  699   IGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAG  520
             IGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGTAEE+AAAFI+ES T+KPVVAFIAG
Sbjct  214   IGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGTAEEDAAAFIQESKTQKPVVAFIAG  273

Query  519   LTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             LTAPPGRRMGHAGAIVSGGKGTAQDKI+ L+EAGVTV ESPAK+G+TM ++F +RG++
Sbjct  274   LTAPPGRRMGHAGAIVSGGKGTAQDKIKALREAGVTVVESPAKIGSTMFEIFKQRGMV  331



>ref|XP_002871316.1| hypothetical protein ARALYDRAFT_487662 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47575.1| hypothetical protein ARALYDRAFT_487662 [Arabidopsis lyrata subsp. 
lyrata]
Length=347

 Score =   497 bits (1279),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 276/346 (80%), Positives = 297/346 (86%), Gaps = 14/346 (4%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVR----------PITQSPLWQQQQHRLFGS---PAPEVFVDKNTR  1204
             M+ Q ARLI ++S K R          P  QS L    Q R F S   P   VFVDKNTR
Sbjct  1     MSRQVARLIGSLSSKARRCSTGGSEVFPSCQS-LTSLTQSRSFASDPHPPAAVFVDKNTR  59

Query  1203  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  1024
             V+CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKA+TKANASV
Sbjct  60    VLCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKADTKANASV  119

Query  1023  IYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIK  844
             IYVP PFA AAIME +EAELDL+VCITEGIPQHDMV+VK AL  Q+KTRLIGPNCPGIIK
Sbjct  120   IYVPAPFAAAAIMEGIEAELDLIVCITEGIPQHDMVRVKHALNSQSKTRLIGPNCPGIIK  179

Query  843   PGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV  664
             PGECKIGIMPGYIHKPG+IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV
Sbjct  180   PGECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV  239

Query  663   DCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHA  484
             DCLE+F  DPQTEGIVLIGEIGGTAEE+AAA IK SGTEKPVVAFIAGLTAPPGRRMGHA
Sbjct  240   DCLEKFFVDPQTEGIVLIGEIGGTAEEDAAALIKASGTEKPVVAFIAGLTAPPGRRMGHA  299

Query  483   GAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             GAIVSGGKGTAQDKI++L +AGV V ESPAK+G  M ++F +RGLL
Sbjct  300   GAIVSGGKGTAQDKIKSLNDAGVKVVESPAKIGAAMYELFQERGLL  345



>ref|XP_012079367.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Jatropha curcas]
 gb|KDP45810.1| hypothetical protein JCGZ_17417 [Jatropha curcas]
Length=339

 Score =   496 bits (1277),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 270/293 (92%), Positives = 284/293 (97%), Gaps = 0/293 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             VFVDKNTR+ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKA
Sbjct  45    VFVDKNTRLICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKA  104

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             ETKANASVIYVPPPFA AAIMEA EAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLIG
Sbjct  105   ETKANASVIYVPPPFAAAAIMEATEAELDLVVCITEGIPQHDMVRVKAALNKQSKTRLIG  164

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD
Sbjct  165   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  224

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             PFNGTNFVDC+ERF+ADPQTEGI+LIGEIGGTAEE+AA  IKESGT+KPVVAFIAGLTAP
Sbjct  225   PFNGTNFVDCIERFLADPQTEGIILIGEIGGTAEEDAAKLIKESGTDKPVVAFIAGLTAP  284

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGL  349
             PGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV ESPAK+G  MLDVF +RGL
Sbjct  285   PGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVESPAKIGLAMLDVFKQRGL  337



>ref|XP_006441425.1| hypothetical protein CICLE_v10020931mg [Citrus clementina]
 gb|ESR54665.1| hypothetical protein CICLE_v10020931mg [Citrus clementina]
Length=347

 Score =   496 bits (1278),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 283/346 (82%), Positives = 307/346 (89%), Gaps = 15/346 (4%)
 Frame = -2

Query  1344  MAWQT-ARLIANVSKKVRPITQSPLWQQQ---------QHRLFGSPA----PEVFVDKNT  1207
             MA Q  A+LI ++  + RP T S +   +           R +GS A    P VFVDKNT
Sbjct  1     MARQALAKLIGSIGSR-RPSTASSVSHYRLSSSAAPAAHSRNYGSSAAASHPAVFVDKNT  59

Query  1206  RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANAS  1027
             RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANAS
Sbjct  60    RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANAS  119

Query  1026  VIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGII  847
             VIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLIGPNCPGII
Sbjct  120   VIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNRQSKTRLIGPNCPGII  179

Query  846   KPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNF  667
             KPGECKIGIMPGYIHKPGR+GIVSRSGTLTYEAVFQTT VGLGQSTCVG+GGDPFNGTNF
Sbjct  180   KPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTVVGLGQSTCVGVGGDPFNGTNF  239

Query  666   VDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGH  487
             VDCLE+F+ DPQTEGI+LIGEIGGTAEE+AAA IKESGTEKPVVAFIAGLTAPPGRRMGH
Sbjct  240   VDCLEKFLVDPQTEGIILIGEIGGTAEEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGH  299

Query  486   AGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGL  349
             AGAIVSGGKGTAQDKI+TL+EAGVTV ESPAK+G+ ML+VF +RGL
Sbjct  300   AGAIVSGGKGTAQDKIKTLREAGVTVVESPAKIGSAMLEVFKQRGL  345



>ref|XP_006288079.1| hypothetical protein CARUB_v10001317mg [Capsella rubella]
 gb|EOA20977.1| hypothetical protein CARUB_v10001317mg [Capsella rubella]
Length=347

 Score =   496 bits (1278),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 277/346 (80%), Positives = 297/346 (86%), Gaps = 14/346 (4%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVR----------PITQSPLWQQQQHRLFGS---PAPEVFVDKNTR  1204
             M+ Q ARLI ++S K R          P  QS L    Q R F S   P   VFVDKNTR
Sbjct  1     MSRQVARLIGSLSSKARRCSTGGSEVFPSCQS-LTSLTQSRSFASDPHPPAAVFVDKNTR  59

Query  1203  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  1024
             V+CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASV
Sbjct  60    VLCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASV  119

Query  1023  IYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIK  844
             IYVP PFA AAIME +EAELDL+VCITEGIPQHDMV+VK AL  Q+KTRLIGPNCPGIIK
Sbjct  120   IYVPAPFAAAAIMEGIEAELDLIVCITEGIPQHDMVRVKHALNGQSKTRLIGPNCPGIIK  179

Query  843   PGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV  664
             PGECKIGIMPGYIHKPG+IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV
Sbjct  180   PGECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV  239

Query  663   DCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHA  484
             DCLE+F  DPQTEGIVLIGEIGGTAEE+AAA IK SGTEKPVVAFIAGLTAPPGRRMGHA
Sbjct  240   DCLEKFFVDPQTEGIVLIGEIGGTAEEDAAALIKASGTEKPVVAFIAGLTAPPGRRMGHA  299

Query  483   GAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             GAIVSGGKGTAQDKI++L +AGV V ESPAK+G  M ++F +RGLL
Sbjct  300   GAIVSGGKGTAQDKIKSLNDAGVKVVESPAKIGAAMYELFQERGLL  345



>ref|XP_002872045.1| hypothetical protein ARALYDRAFT_489184 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48304.1| hypothetical protein ARALYDRAFT_489184 [Arabidopsis lyrata subsp. 
lyrata]
Length=339

 Score =   496 bits (1277),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 268/313 (86%), Positives = 286/313 (91%), Gaps = 3/313 (1%)
 Frame = -2

Query  1275  LWQQQQHRLFGS---PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKK  1105
             L    Q R FG+   P   VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMV GVTPKK
Sbjct  26    LTSLTQSRSFGTTPPPPAAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVAGVTPKK  85

Query  1104  GGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQH  925
             GGTEHLGLPVFNTVA+AKAETKANASVIYVP PFA AAIME + AELDL+VCITEGIPQH
Sbjct  86    GGTEHLGLPVFNTVAEAKAETKANASVIYVPAPFAAAAIMEGLAAELDLIVCITEGIPQH  145

Query  924   DMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAV  745
             DMV+VKAAL  Q+KTRLIGPNCPGIIKPGECKIGIMPGYIHKPG+IGIVSRSGTLTYEAV
Sbjct  146   DMVRVKAALNSQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGKIGIVSRSGTLTYEAV  205

Query  744   FQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafI  565
             FQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F ADPQTEGIVLIGEIGGTAEE+AAA I
Sbjct  206   FQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFADPQTEGIVLIGEIGGTAEEDAAALI  265

Query  564   KESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLG  385
             KESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L++AGV V ESPAK+G
Sbjct  266   KESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAGVKVVESPAKIG  325

Query  384   TTMLDVFTKRGLL  346
               M ++F +RGLL
Sbjct  326   AAMFEIFQERGLL  338



>ref|XP_008393504.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Malus domestica]
Length=334

 Score =   496 bits (1276),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 277/329 (84%), Positives = 302/329 (92%), Gaps = 3/329 (1%)
 Frame = -2

Query  1329  ARLIANV-SKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQ  1153
             A+LI ++ S +  P T   L Q++ +     P P VFVDKNTRVICQGITGKNGTFHTEQ
Sbjct  7     AKLIRSIASHRTSPSTS--LLQRRHYSPAPPPPPAVFVDKNTRVICQGITGKNGTFHTEQ  64

Query  1152  AIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeame  973
             AIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVPPPFA AAI+EA+E
Sbjct  65    AIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAILEAVE  124

Query  972   aELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPG  793
             AELDLVVCITEGIPQHDMV+VKAA+ +Q+KTRLIGPNCPGIIKPGECKIGIMPGYIHKPG
Sbjct  125   AELDLVVCITEGIPQHDMVRVKAAINRQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPG  184

Query  792   RIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVL  613
             RIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC++RF+ DPQTEGI+L
Sbjct  185   RIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIDRFLQDPQTEGIIL  244

Query  612   igeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRT  433
             IGEIGGTAEE+AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+T
Sbjct  245   IGEIGGTAEEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKT  304

Query  432   LKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             L+EA VTV ESPAK+G  MLDVF +RGL+
Sbjct  305   LREADVTVVESPAKIGLAMLDVFKQRGLV  333



>ref|XP_010547709.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial [Tarenaya hassleriana]
Length=348

 Score =   496 bits (1278),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 282/341 (83%), Positives = 304/341 (89%), Gaps = 9/341 (3%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVR--------PITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQG  1189
             M+ Q ARL+ ++S KVR        P  +S L Q +       P P VFVDKNTRVICQG
Sbjct  1     MSRQVARLLGSLSSKVRRSGNQEVFPSCRS-LTQSRSFTAAPPPPPAVFVDKNTRVICQG  59

Query  1188  ITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPP  1009
             ITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVP 
Sbjct  60    ITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPA  119

Query  1008  PFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECK  829
             PFA AAIMEA+EAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLIGPNCPGIIKPGECK
Sbjct  120   PFAAAAIMEAVEAELDLVVCITEGIPQHDMVRVKAALAKQSKTRLIGPNCPGIIKPGECK  179

Query  828   IGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLER  649
             IGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV+CLE+
Sbjct  180   IGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVNCLEK  239

Query  648   FVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVS  469
             F  DPQTEGI+LIGEIGGTAEEEAAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVS
Sbjct  240   FFVDPQTEGIILIGEIGGTAEEEAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVS  299

Query  468   GGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             GGKGTAQDKI++LK+AGVTV ESPAK+G+ M D+F +RGLL
Sbjct  300   GGKGTAQDKIKSLKDAGVTVVESPAKIGSAMHDIFQERGLL  340



>dbj|BAJ94034.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92411.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96493.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=329

 Score =   496 bits (1276),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 266/294 (90%), Positives = 285/294 (97%), Gaps = 0/294 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA+AKA
Sbjct  35    VFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVAEAKA  94

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             ETKANASVIYVPPPFA AAIMEA+EAELDLVVCITEGIPQHDMVKVKAAL +Q+KTRLIG
Sbjct  95    ETKANASVIYVPPPFAAAAIMEALEAELDLVVCITEGIPQHDMVKVKAALNRQSKTRLIG  154

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVG+GGD
Sbjct  155   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGMGGD  214

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             PFNGTNFVDCLE+FV DPQTEGIVLIGEIGGTAEE+AAAFI+ES TEKPVVAFIAGLTAP
Sbjct  215   PFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGTAEEDAAAFIRESKTEKPVVAFIAGLTAP  274

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             PGRRMGHAGAIVSGGKGTAQDKI+ L+EAGVTV ESPAK+G+TM ++F +RG++
Sbjct  275   PGRRMGHAGAIVSGGKGTAQDKIKALREAGVTVVESPAKIGSTMFEIFKQRGMV  328



>dbj|BAK03449.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=329

 Score =   495 bits (1275),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 265/294 (90%), Positives = 284/294 (97%), Gaps = 0/294 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA+AKA
Sbjct  35    VFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVAEAKA  94

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             ETKANASVIYVPPPFA A IMEA+EAELDLVVCITEGIPQHDMVKVKAAL +Q+KTRLIG
Sbjct  95    ETKANASVIYVPPPFAAATIMEALEAELDLVVCITEGIPQHDMVKVKAALNRQSKTRLIG  154

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVG+GGD
Sbjct  155   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGMGGD  214

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             PFNGTNFVDCLE+FV DPQTEGIVLIGEIGGTAEE+AAAFI+ES TEKPVVAFIAGLTAP
Sbjct  215   PFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGTAEEDAAAFIRESKTEKPVVAFIAGLTAP  274

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             PGRRMGHAGAIVSGGKGTAQDKI+ L+EAGVTV ESPAK+G+TM ++F +RG++
Sbjct  275   PGRRMGHAGAIVSGGKGTAQDKIKALREAGVTVVESPAKIGSTMFEIFKQRGMV  328



>emb|CDY02216.1| BnaA03g39510D [Brassica napus]
Length=346

 Score =   496 bits (1276),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 271/345 (79%), Positives = 297/345 (86%), Gaps = 12/345 (3%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRPITQSP---------LWQQQQHRLFGS---PAPEVFVDKNTRV  1201
             M+ +  +L+ ++  K+R    S          L    + R FG+   P   VFVDKNTRV
Sbjct  1     MSRRVTKLVGSLPSKLRSSVASSELLNPSCSSLTSLTKSRSFGTTPPPPAAVFVDKNTRV  60

Query  1200  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  1021
             ICQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASVI
Sbjct  61    ICQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVI  120

Query  1020  YVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKP  841
             YVP PFA AAIME + AELDLVVCITEGIPQHDMV+VKAAL  QTKTRLIGPNCPGIIKP
Sbjct  121   YVPAPFAAAAIMEGVAAELDLVVCITEGIPQHDMVRVKAALNSQTKTRLIGPNCPGIIKP  180

Query  840   GECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD  661
             GECKIGIMPGYIHKPG+IGIVSRSGTLTYEAVFQT+AVGLGQSTCVGIGGDPFNGTNFVD
Sbjct  181   GECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTSAVGLGQSTCVGIGGDPFNGTNFVD  240

Query  660   CLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAG  481
             CL++F  DPQTEGIVLIGEIGGTAEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAG
Sbjct  241   CLDKFFVDPQTEGIVLIGEIGGTAEEDAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAG  300

Query  480   AIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             AIVSGGKGTAQDKI++L++AGV V ESPAK+G  M ++F +RGLL
Sbjct  301   AIVSGGKGTAQDKIKSLRDAGVKVVESPAKIGAAMFELFQERGLL  345



>ref|XP_011047755.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Populus euphratica]
Length=342

 Score =   495 bits (1275),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 276/314 (88%), Positives = 295/314 (94%), Gaps = 0/314 (0%)
 Frame = -2

Query  1290  ITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTP  1111
             ++ SP+ Q + +     P P VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTP
Sbjct  27    LSPSPVAQTRHYAAAPPPPPAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTP  86

Query  1110  KKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIP  931
             KKGGTEHLGLPVFNTVA+AKAET+ANASVIYVPPPFA AAIMEAMEAEL+LVVCITEGIP
Sbjct  87    KKGGTEHLGLPVFNTVAEAKAETRANASVIYVPPPFAAAAIMEAMEAELNLVVCITEGIP  146

Query  930   QHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYE  751
             QHDMV+VKAAL +QTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYE
Sbjct  147   QHDMVRVKAALNRQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYE  206

Query  750   AVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaa  571
             AVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+E+F+ DPQTEGI+LIGEIGGTAEE+AAA
Sbjct  207   AVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKFLVDPQTEGIILIGEIGGTAEEDAAA  266

Query  570   fIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAK  391
              IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV ESPAK
Sbjct  267   LIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVESPAK  326

Query  390   LGTTMLDVFTKRGL  349
             +G  MLDVF +RGL
Sbjct  327   IGVAMLDVFKQRGL  340



>ref|NP_001136494.1| succinyl-CoA ligase alpha-chain 2 [Zea mays]
 gb|ACF82043.1| unknown [Zea mays]
 tpg|DAA63303.1| TPA: succinyl-CoA ligase alpha-chain 2 [Zea mays]
Length=331

 Score =   494 bits (1273),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 267/298 (90%), Positives = 287/298 (96%), Gaps = 0/298 (0%)
 Frame = -2

Query  1239  PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA  1060
             P+P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA
Sbjct  33    PSPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVA  92

Query  1059  DAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKT  880
             +AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMVKVKAAL +Q+KT
Sbjct  93    EAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVKVKAALNRQSKT  152

Query  879   RLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVG  700
             RLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVG
Sbjct  153   RLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVG  212

Query  699   IGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAG  520
             IGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGTAEE+AA FI+ES T+KPVVAFIAG
Sbjct  213   IGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGTAEEDAATFIQESKTQKPVVAFIAG  272

Query  519   LTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             LTAPPGRRMGHAGAIV+GGKGTAQDKI+ L+EAGVTV ESPAK+G+TM ++F +RG++
Sbjct  273   LTAPPGRRMGHAGAIVAGGKGTAQDKIKALREAGVTVVESPAKIGSTMFEIFKQRGMV  330



>ref|XP_009131054.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial [Brassica rapa]
Length=343

 Score =   495 bits (1275),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 276/342 (81%), Positives = 296/342 (87%), Gaps = 10/342 (3%)
 Frame = -2

Query  1344  MAWQTAR-LIANVSKKVR-------PITQSPLWQQQQHRLFGS-PAPEVFVDKNTRVICQ  1192
             M+ Q AR LI ++S K R       P  Q+ L    Q R F S P   VFVDKNTRV+CQ
Sbjct  1     MSRQVARRLIGSLSSKARRCSSEVFPSCQT-LSSLTQSRSFASDPPAAVFVDKNTRVMCQ  59

Query  1191  GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVP  1012
             GITGKNGTFHTEQAIEYGT MV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVP
Sbjct  60    GITGKNGTFHTEQAIEYGTNMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVP  119

Query  1011  PPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGEC  832
              PFA AAIME ++AELDLVVCITEGIPQHDMV+VK AL  Q+KTRLIGPNCPGIIKPGEC
Sbjct  120   APFAAAAIMEGIQAELDLVVCITEGIPQHDMVRVKHALNSQSKTRLIGPNCPGIIKPGEC  179

Query  831   KIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE  652
             KIGIMPGYIHKPG+IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE
Sbjct  180   KIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE  239

Query  651   RFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIV  472
             +F  DPQTEGIVLIGEIGGTAEE+AAA IK SGTEKPVVAFIAGLTAPPGRRMGHAGAIV
Sbjct  240   KFFVDPQTEGIVLIGEIGGTAEEDAAALIKASGTEKPVVAFIAGLTAPPGRRMGHAGAIV  299

Query  471   SGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             SGGKGTAQDKI++L +AGV V ESPAK+G  M D+F +RGLL
Sbjct  300   SGGKGTAQDKIKSLNDAGVKVVESPAKIGAAMYDLFKERGLL  341



>emb|CDX78333.1| BnaA03g02450D [Brassica napus]
Length=346

 Score =   495 bits (1274),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 275/345 (80%), Positives = 294/345 (85%), Gaps = 13/345 (4%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVR-----------PITQSPLWQQQQHRLFGS-PAPEVFVDKNTRV  1201
             M  Q ARLI ++S K R           P  Q+ L    Q R F S P   VFVDKNTRV
Sbjct  1     MFRQVARLIGSLSSKARRCSSGGGSEAFPSCQT-LSSLTQSRSFASDPPAAVFVDKNTRV  59

Query  1200  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  1021
             +CQGITGKNGTFHTEQAIEYGT MV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASVI
Sbjct  60    MCQGITGKNGTFHTEQAIEYGTNMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVI  119

Query  1020  YVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKP  841
             YVP PFA AAIME ++AELDLVVCITEGIPQHDMV+VK AL  Q+KTRLIGPNCPGIIKP
Sbjct  120   YVPAPFAAAAIMEGIQAELDLVVCITEGIPQHDMVRVKHALNSQSKTRLIGPNCPGIIKP  179

Query  840   GECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD  661
             GECKIGIMPGYIHKPG+IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD
Sbjct  180   GECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD  239

Query  660   CLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAG  481
             CLE+F  DPQTEGIVLIGEIGGTAEE+AAA IK SGTEKPVVAFIAGLTAPPGRRMGHAG
Sbjct  240   CLEKFFVDPQTEGIVLIGEIGGTAEEDAAALIKASGTEKPVVAFIAGLTAPPGRRMGHAG  299

Query  480   AIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             AIVSGGKGTAQDKI++L +AGV V ESPAK+G  M D+F +RG L
Sbjct  300   AIVSGGKGTAQDKIKSLNDAGVKVVESPAKIGAAMYDLFKERGFL  344



>ref|NP_001241205.1| uncharacterized protein LOC100782001 [Glycine max]
 gb|ACU24596.1| unknown [Glycine max]
Length=324

 Score =   494 bits (1272),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 272/303 (90%), Positives = 290/303 (96%), Gaps = 0/303 (0%)
 Frame = -2

Query  1254  RLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPV  1075
             RLF + +P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPV
Sbjct  21    RLFSAASPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPV  80

Query  1074  FNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALK  895
             FNTVA+AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL 
Sbjct  81    FNTVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALN  140

Query  894   QQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQ  715
             +Q+KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQ
Sbjct  141   RQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQ  200

Query  714   STCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVV  535
             STCVGIGGDPFNGTNFVDCL++F+ DPQTEGI+LIGEIGGTAEE+AAA IK+SGTEKPVV
Sbjct  201   STCVGIGGDPFNGTNFVDCLQKFLTDPQTEGIILIGEIGGTAEEDAAALIKDSGTEKPVV  260

Query  534   AFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKR  355
             AFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGV V ESPAK+G  MLDVF +R
Sbjct  261   AFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVMVVESPAKIGAAMLDVFKQR  320

Query  354   GLL  346
             GL+
Sbjct  321   GLV  323



>gb|ABK94372.1| unknown [Populus trichocarpa]
Length=331

 Score =   494 bits (1272),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 263/294 (89%), Positives = 286/294 (97%), Gaps = 0/294 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+V++AKA
Sbjct  37    VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVSEAKA  96

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             ETKANASVIYV PPFA AAI+EA+EAELDLVVCITEGIPQHD+V+VKAA+K+Q+KTRLIG
Sbjct  97    ETKANASVIYVTPPFAAAAILEAVEAELDLVVCITEGIPQHDVVRVKAAIKKQSKTRLIG  156

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPGIIKPGECKIGIMPGYIHKPGR+GIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD
Sbjct  157   PNCPGIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  216

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             PFNGTNFVDC+++F+ADPQTEGIVLIGEIGGTAEE+AA  IKESGTEKPVVAFIAG+TAP
Sbjct  217   PFNGTNFVDCVKKFLADPQTEGIVLIGEIGGTAEEDAATIIKESGTEKPVVAFIAGVTAP  276

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             PGRRMGHAGAIVSGGKGTAQDKI+TL++AGV V ESPAK+GT MLDVF +RGL+
Sbjct  277   PGRRMGHAGAIVSGGKGTAQDKIKTLRDAGVIVVESPAKIGTAMLDVFKERGLV  330



>emb|CDY21531.1| BnaC09g47610D [Brassica napus]
Length=347

 Score =   494 bits (1273),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 273/346 (79%), Positives = 296/346 (86%), Gaps = 14/346 (4%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVR----------PITQSPLWQQQQHRLFGS---PAPEVFVDKNTR  1204
             M+ Q  RL+ ++S   R          P  QS L    Q R F S   P   VFVDKNTR
Sbjct  1     MSRQVTRLLGSLSSNARRCSIGFSEVSPSCQS-LTSLTQSRSFASDPSPPAAVFVDKNTR  59

Query  1203  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  1024
             V+CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASV
Sbjct  60    VMCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASV  119

Query  1023  IYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIK  844
             IYVP PFA AAIME ++AELDL+VCITEGIPQHDMV+VK AL  Q+KTRLIGPNCPGIIK
Sbjct  120   IYVPAPFAAAAIMEGIQAELDLIVCITEGIPQHDMVRVKHALNSQSKTRLIGPNCPGIIK  179

Query  843   PGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV  664
             PGECKIGIMPGYIHKPG+IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV
Sbjct  180   PGECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV  239

Query  663   DCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHA  484
             DCLE+F  DPQTEGIVLIGEIGGTAEE+AAA IK SGT+KPVVAFIAGLTAPPGRRMGHA
Sbjct  240   DCLEKFFVDPQTEGIVLIGEIGGTAEEDAAALIKASGTQKPVVAFIAGLTAPPGRRMGHA  299

Query  483   GAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             GAIVSGGKGTAQDKI++L +AGV V ESPAK+G+ M D+F +RGLL
Sbjct  300   GAIVSGGKGTAQDKIKSLNDAGVKVVESPAKIGSAMYDLFKERGLL  345



>emb|CDX69957.1| BnaA10g23060D [Brassica napus]
Length=347

 Score =   494 bits (1272),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 275/346 (79%), Positives = 296/346 (86%), Gaps = 14/346 (4%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVR----------PITQSPLWQQQQHRLFGS---PAPEVFVDKNTR  1204
             M+ Q  RL+ ++S K R          P  QS L    Q R F S   P   VFVDKNTR
Sbjct  1     MSRQFTRLLGSLSSKARRCSIGFSEVSPSCQS-LTSLTQSRSFASDPPPPAAVFVDKNTR  59

Query  1203  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  1024
             V+CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASV
Sbjct  60    VMCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASV  119

Query  1023  IYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIK  844
             IYVP PFA AAIME ++AELDLVVCITEGIPQHDMV+VK AL  Q+KTRLIGPNCPGIIK
Sbjct  120   IYVPAPFAAAAIMEGIQAELDLVVCITEGIPQHDMVRVKHALNSQSKTRLIGPNCPGIIK  179

Query  843   PGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV  664
             PGECKIGIMPGYIHKPG+IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV
Sbjct  180   PGECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV  239

Query  663   DCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHA  484
             DCLE+F  DPQTEGIVLIGEIGGTAEE+AAA IK SGTEKPVVAFIAGLTAPPGRRMGHA
Sbjct  240   DCLEKFFVDPQTEGIVLIGEIGGTAEEDAAALIKASGTEKPVVAFIAGLTAPPGRRMGHA  299

Query  483   GAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             GAIVSGGKGTAQDKI++L +AGV V ESPAK+G  M ++F +RGLL
Sbjct  300   GAIVSGGKGTAQDKIKSLNDAGVKVVESPAKIGAAMYELFKERGLL  345



>ref|XP_006437603.1| hypothetical protein CICLE_v10032075mg [Citrus clementina]
 gb|ESR50843.1| hypothetical protein CICLE_v10032075mg [Citrus clementina]
Length=331

 Score =   493 bits (1269),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 275/323 (85%), Positives = 294/323 (91%), Gaps = 3/323 (1%)
 Frame = -2

Query  1308  SKKVRPITQSPLWQQQQHRLFGS---PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYG  1138
             S+ VR +  S      Q R F +   PAP VFVDKNTRVICQGITGKNGTFHT QAIEYG
Sbjct  7     SRVVRSLYMSSEICCGQSRSFTTAPPPAPAVFVDKNTRVICQGITGKNGTFHTAQAIEYG  66

Query  1137  TKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDL  958
             TKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANAS IYVPPPFA AAI+EAMEAELDL
Sbjct  67    TKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASAIYVPPPFAAAAILEAMEAELDL  126

Query  957   VVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIV  778
             VVCITEGIPQHDMV+VKAAL  Q+KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIV
Sbjct  127   VVCITEGIPQHDMVRVKAALNNQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIV  186

Query  777   SRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeig  598
             SRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+ +F+ADPQTEGI+LIGEIG
Sbjct  187   SRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTKFIADPQTEGIILIGEIG  246

Query  597   gtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAG  418
             GTAEE+AAA IKES TEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAG
Sbjct  247   GTAEEDAAALIKESRTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAG  306

Query  417   VTVCESPAKLGTTMLDVFTKRGL  349
             VTV ESPAK+G  ML+VF +RGL
Sbjct  307   VTVVESPAKIGAAMLEVFKQRGL  329



>emb|CBI35274.3| unnamed protein product [Vitis vinifera]
Length=336

 Score =   493 bits (1268),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 276/335 (82%), Positives = 299/335 (89%), Gaps = 3/335 (1%)
 Frame = -2

Query  1344  MAWQTA--RLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNG  1171
             MA + A  +LI +++ K+   T S   Q +       P P VFVDKNTRVICQGITGKNG
Sbjct  1     MARRAAAQQLIDSIASKLSSATASS-AQTRGFAAAAHPPPAVFVDKNTRVICQGITGKNG  59

Query  1170  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  991
             TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKAN SVIYVPPPFA AA
Sbjct  60    TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANTSVIYVPPPFAAAA  119

Query  990   imeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPG  811
             IMEAMEAELDLVVCITEGIPQHDMVKVKAAL +QTKTRLIGPNCPGIIKPGECKIGIMPG
Sbjct  120   IMEAMEAELDLVVCITEGIPQHDMVKVKAALNRQTKTRLIGPNCPGIIKPGECKIGIMPG  179

Query  810   YIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQ  631
             YIHKPGR+GIVSRSGTLTYEAVFQTTAVGLGQST VGIGGDPFNGTNFVDC+++F+ DPQ
Sbjct  180   YIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTSVGIGGDPFNGTNFVDCIKKFLVDPQ  239

Query  630   TEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTA  451
             TEGIVLIGEIGGTAEE+AA  IKES TEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTA
Sbjct  240   TEGIVLIGEIGGTAEEDAAQLIKESKTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTA  299

Query  450   QDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             QDKI+TL+EAGVTV ESPAK+G  ML+ F ++GL+
Sbjct  300   QDKIKTLREAGVTVVESPAKMGVAMLEAFKQKGLI  334



>ref|XP_006484523.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Citrus sinensis]
Length=331

 Score =   493 bits (1268),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 273/323 (85%), Positives = 294/323 (91%), Gaps = 3/323 (1%)
 Frame = -2

Query  1308  SKKVRPITQSPLWQQQQHRLFGS---PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYG  1138
             S+ VR +  S      Q R F +   PAP VFVDKNTRVICQGITGKNGTFHT Q IEYG
Sbjct  7     SRVVRSLYMSSEICCGQSRSFTTAPPPAPAVFVDKNTRVICQGITGKNGTFHTAQGIEYG  66

Query  1137  TKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDL  958
             TKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANAS IYVPPPFA AAI+EAMEAELDL
Sbjct  67    TKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASAIYVPPPFAAAAILEAMEAELDL  126

Query  957   VVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIV  778
             VVCITEGIPQHDMV+VKAAL  Q+KTRL+GPNCPG+IKPGECKIGIMPGYIHKPGRIGIV
Sbjct  127   VVCITEGIPQHDMVRVKAALNNQSKTRLVGPNCPGVIKPGECKIGIMPGYIHKPGRIGIV  186

Query  777   SRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeig  598
             SRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+ +F+ADPQTEGI+LIGEIG
Sbjct  187   SRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTKFIADPQTEGIILIGEIG  246

Query  597   gtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAG  418
             GTAEE+AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAG
Sbjct  247   GTAEEDAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAG  306

Query  417   VTVCESPAKLGTTMLDVFTKRGL  349
             VTV ESPAK+G  ML+VF +RGL
Sbjct  307   VTVVESPAKIGAAMLEVFKQRGL  329



>ref|XP_002268479.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Vitis vinifera]
Length=340

 Score =   492 bits (1267),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 276/335 (82%), Positives = 299/335 (89%), Gaps = 3/335 (1%)
 Frame = -2

Query  1344  MAWQTA--RLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNG  1171
             MA + A  +LI +++ K+   T S   Q +       P P VFVDKNTRVICQGITGKNG
Sbjct  5     MARRAAAQQLIDSIASKLSSATASS-AQTRGFAAAAHPPPAVFVDKNTRVICQGITGKNG  63

Query  1170  TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaa  991
             TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKAN SVIYVPPPFA AA
Sbjct  64    TFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANTSVIYVPPPFAAAA  123

Query  990   imeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPG  811
             IMEAMEAELDLVVCITEGIPQHDMVKVKAAL +QTKTRLIGPNCPGIIKPGECKIGIMPG
Sbjct  124   IMEAMEAELDLVVCITEGIPQHDMVKVKAALNRQTKTRLIGPNCPGIIKPGECKIGIMPG  183

Query  810   YIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQ  631
             YIHKPGR+GIVSRSGTLTYEAVFQTTAVGLGQST VGIGGDPFNGTNFVDC+++F+ DPQ
Sbjct  184   YIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTSVGIGGDPFNGTNFVDCIKKFLVDPQ  243

Query  630   TEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTA  451
             TEGIVLIGEIGGTAEE+AA  IKES TEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTA
Sbjct  244   TEGIVLIGEIGGTAEEDAAQLIKESKTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTA  303

Query  450   QDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             QDKI+TL+EAGVTV ESPAK+G  ML+ F ++GL+
Sbjct  304   QDKIKTLREAGVTVVESPAKMGVAMLEAFKQKGLI  338



>gb|ACG31861.1| succinyl-CoA ligase alpha-chain 2 [Zea mays]
Length=320

 Score =   491 bits (1265),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 264/294 (90%), Positives = 284/294 (97%), Gaps = 0/294 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA+AKA
Sbjct  26    VFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVAEAKA  85

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             ETKANASVIYVPPPFA AAIME+MEAELDLVVCITEGIPQHDMVKVKAAL +Q+KTRLIG
Sbjct  86    ETKANASVIYVPPPFAAAAIMESMEAELDLVVCITEGIPQHDMVKVKAALNRQSKTRLIG  145

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD
Sbjct  146   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  205

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             PFNGTNFVDCLE+FV DPQTEGIVLIGEIGGTAEE+AA FI+ES T+KPVVAFIAGLTAP
Sbjct  206   PFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGTAEEDAATFIQESKTQKPVVAFIAGLTAP  265

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             PGRRMGHAGAIV+GGKGTAQDKI+ L+EAGVTV ESPAK+G+TM ++F +RG++
Sbjct  266   PGRRMGHAGAIVAGGKGTAQDKIKALREAGVTVVESPAKIGSTMFEIFKQRGMV  319



>ref|NP_001149702.1| succinyl-CoA ligase alpha-chain 2 [Zea mays]
 gb|ACG36440.1| succinyl-CoA ligase alpha-chain 2 [Zea mays]
 tpg|DAA41208.1| TPA: succinyl-CoA ligase alpha-chain 2 [Zea mays]
Length=331

 Score =   492 bits (1266),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 265/298 (89%), Positives = 285/298 (96%), Gaps = 0/298 (0%)
 Frame = -2

Query  1239  PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA  1060
             P+P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA
Sbjct  33    PSPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVA  92

Query  1059  DAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKT  880
             +AKAETKANA+VIYVPPPFA AAIMEAMEAELDL VCITEGIPQHDMVKVKAAL  Q+KT
Sbjct  93    EAKAETKANATVIYVPPPFAAAAIMEAMEAELDLAVCITEGIPQHDMVKVKAALNSQSKT  152

Query  879   RLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVG  700
             RLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVG
Sbjct  153   RLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVG  212

Query  699   IGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAG  520
             IGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGTAEE+AA FI+ES T+KPVVAFIAG
Sbjct  213   IGGDPFNGTNFVDCLEKFVNDPQTEGIVLIGEIGGTAEEDAATFIQESKTQKPVVAFIAG  272

Query  519   LTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             LTAPPGRRMGHAGAIV+GGKGTAQDKI+ L+EAGVTV ESPAK+G+TM ++F +RG++
Sbjct  273   LTAPPGRRMGHAGAIVAGGKGTAQDKIKALREAGVTVVESPAKIGSTMFEIFKQRGMV  330



>ref|NP_197716.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2 [Arabidopsis 
thaliana]
 sp|Q8LAD2.2|SUCA2_ARATH RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial; AltName: Full=Succinyl-CoA synthetase subunit 
alpha-2; Short=SCS-alpha-2; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB11180.1| succinyl-CoA synthetase, alpha subunit [Arabidopsis thaliana]
 gb|AAM12993.1| succinyl-CoA synthetase, alpha subunit [Arabidopsis thaliana]
 gb|AAM47926.1| succinyl-CoA synthetase alpha subunit [Arabidopsis thaliana]
 gb|AED93141.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2 [Arabidopsis 
thaliana]
Length=341

 Score =   492 bits (1266),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 271/340 (80%), Positives = 295/340 (87%), Gaps = 7/340 (2%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRPITQS----PLWQQQQHRLFGS---PAPEVFVDKNTRVICQGI  1186
             M+ Q  RL+ ++       + S     L    Q R FG+   P   VFVDKNTRVICQGI
Sbjct  1     MSRQVTRLLGSLRHSGGGCSGSSKVCSLTSLVQSRSFGTTPPPPAAVFVDKNTRVICQGI  60

Query  1185  TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPP  1006
             TGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVP P
Sbjct  61    TGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPAP  120

Query  1005  FagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKI  826
             FA AAIME + AELDL+VCITEGIPQHDMV+VKAAL  Q+KTRLIGPNCPGIIKPGECKI
Sbjct  121   FAAAAIMEGLAAELDLIVCITEGIPQHDMVRVKAALNSQSKTRLIGPNCPGIIKPGECKI  180

Query  825   GIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERF  646
             GIMPGYIHKPG+IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F
Sbjct  181   GIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKF  240

Query  645   VADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSG  466
               DPQTEGIVLIGEIGGTAEE+AAA IKE+GT+KPVVAFIAGLTAPPGRRMGHAGAIVSG
Sbjct  241   FVDPQTEGIVLIGEIGGTAEEDAAALIKENGTDKPVVAFIAGLTAPPGRRMGHAGAIVSG  300

Query  465   GKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             GKGTAQDKI++L++AGV V ESPAK+G  M ++F +RGLL
Sbjct  301   GKGTAQDKIKSLRDAGVKVVESPAKIGAAMFELFQERGLL  340



>ref|XP_011624630.1| PREDICTED: LOW QUALITY PROTEIN: probable succinyl-CoA ligase 
[ADP-forming] subunit alpha, mitochondrial [Amborella trichopoda]
Length=339

 Score =   491 bits (1265),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 265/294 (90%), Positives = 283/294 (96%), Gaps = 0/294 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKA
Sbjct  45    VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKA  104

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             ETKANASVIYVPPPFA AAIMEAMEAELDL+VCITEGIPQHDMV+VKAAL +Q+KTRLIG
Sbjct  105   ETKANASVIYVPPPFAAAAIMEAMEAELDLIVCITEGIPQHDMVRVKAALNKQSKTRLIG  164

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPGIIKPGECKIGIMPGYIHKPGR+GIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD
Sbjct  165   PNCPGIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  224

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             PFNGTNFVDC+++F+ DPQTEGIVLIGEIGGTAEE+AAA IKESGTEKPVVAFIAGLTAP
Sbjct  225   PFNGTNFVDCIKKFLEDPQTEGIVLIGEIGGTAEEDAAALIKESGTEKPVVAFIAGLTAP  284

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             PGRRMGHAGAIV+GGKGTAQDKI+TL+E G TV ESPAK+G  M +VF +RGLL
Sbjct  285   PGRRMGHAGAIVAGGKGTAQDKIKTLREVGATVVESPAKIGAAMHEVFKQRGLL  338



>ref|XP_007043270.1| Succinyl-CoA ligase, alpha subunit [Theobroma cacao]
 gb|EOX99101.1| Succinyl-CoA ligase, alpha subunit [Theobroma cacao]
Length=351

 Score =   492 bits (1266),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 281/350 (80%), Positives = 305/350 (87%), Gaps = 17/350 (5%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRP---------------ITQSPLWQQQQHRLFGSPAPE--VFVD  1216
             MA Q +RLI ++S K+ P                + S            +PAP+  VFVD
Sbjct  1     MARQASRLIKSMSSKISPRNPQISPLSPFSSTSSSSSSSSLTLSRSFSAAPAPQPAVFVD  60

Query  1215  KNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKA  1036
             KNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKA
Sbjct  61    KNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKA  120

Query  1035  NASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCP  856
             NASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL QQ+KTRLIGPNCP
Sbjct  121   NASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNQQSKTRLIGPNCP  180

Query  855   GIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNG  676
             GIIKPGECKIGIMPGYIHKPGR+GIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNG
Sbjct  181   GIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNG  240

Query  675   TNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRR  496
             TNFVDC+ +F+ DPQTEGIV+IGEIGGTAEE+AAA IKESGT+KP+VAFIAGLTAPPGRR
Sbjct  241   TNFVDCVTKFLDDPQTEGIVIIGEIGGTAEEDAAALIKESGTKKPIVAFIAGLTAPPGRR  300

Query  495   MGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             MGHAGAIVSGGKGTAQDKI+TL+EAGVTV ESPAK+G  ML+VF +RGL+
Sbjct  301   MGHAGAIVSGGKGTAQDKIKTLREAGVTVVESPAKIGVAMLNVFKERGLV  350



>ref|XP_012079379.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Jatropha curcas]
 gb|KDP45811.1| hypothetical protein JCGZ_17418 [Jatropha curcas]
Length=341

 Score =   491 bits (1264),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 270/294 (92%), Positives = 284/294 (97%), Gaps = 0/294 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKA
Sbjct  47    VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKA  106

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             ETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLIG
Sbjct  107   ETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNKQSKTRLIG  166

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD
Sbjct  167   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  226

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             PFNGTNFVDC+ERF+ DPQTEGI+LIGEIGGTAEE+AA  IKESGT+KPVVAFIAGLTAP
Sbjct  227   PFNGTNFVDCIERFLVDPQTEGIILIGEIGGTAEEDAAQLIKESGTDKPVVAFIAGLTAP  286

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             PGRRMGHAGAIVSGGKGTAQDKIRTL+EAG TV ESPAK+G  MLD+F +RGL+
Sbjct  287   PGRRMGHAGAIVSGGKGTAQDKIRTLREAGATVVESPAKIGVAMLDIFKQRGLV  340



>ref|XP_003620150.1| Succinyl-CoA ligase [Medicago truncatula]
 gb|AES76368.1| succinyl-CoA ligase [ADP-forming] subunit alpha-2 [Medicago truncatula]
Length=323

 Score =   490 bits (1261),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 266/312 (85%), Positives = 289/312 (93%), Gaps = 0/312 (0%)
 Frame = -2

Query  1281  SPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKG  1102
             S +    +     +P+P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKG
Sbjct  11    SSIASNNRRNFSSTPSPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKG  70

Query  1101  GTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHD  922
             GTEHLGLPVFN+VA+AK ETKANASVIYVPPPFA AAIMEA+EAELDLVVCITEGIPQHD
Sbjct  71    GTEHLGLPVFNSVAEAKTETKANASVIYVPPPFAAAAIMEAVEAELDLVVCITEGIPQHD  130

Query  921   MVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVF  742
             MV+VKAAL +Q+KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAV+
Sbjct  131   MVRVKAALNRQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVY  190

Query  741   QTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIK  562
             QTTAVGLGQSTCVGIGGDPFNGTNFVDCL +F+ADPQTEGI+LIGEIGGTAEE+AAA IK
Sbjct  191   QTTAVGLGQSTCVGIGGDPFNGTNFVDCLTKFLADPQTEGIILIGEIGGTAEEDAAALIK  250

Query  561   ESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGT  382
             ESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI TL+EAGVTV ESPAK+G 
Sbjct  251   ESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKISTLREAGVTVVESPAKIGA  310

Query  381   TMLDVFTKRGLL  346
              M ++F ++GL+
Sbjct  311   AMFEIFKQKGLV  322



>gb|KJB31853.1| hypothetical protein B456_005G211200 [Gossypium raimondii]
Length=346

 Score =   491 bits (1263),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 282/345 (82%), Positives = 305/345 (88%), Gaps = 12/345 (3%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRP---------ITQSPLWQQQQHRLFGS---PAPEVFVDKNTRV  1201
             MA Q +RLI ++S ++ P          + S      Q R F +   P P VFVDKNTRV
Sbjct  1     MARQASRLIQSLSSRISPHKPQLSPLTPSSSSSQLLTQSRSFSAAPAPQPAVFVDKNTRV  60

Query  1200  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  1021
             ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVI
Sbjct  61    ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVI  120

Query  1020  YVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKP  841
             YVPP FA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL QQ+KTRLIGPNCPGIIKP
Sbjct  121   YVPPAFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNQQSKTRLIGPNCPGIIKP  180

Query  840   GECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD  661
             GECKIGIMPGYIHKPGR+GIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD
Sbjct  181   GECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD  240

Query  660   CLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAG  481
             C+ +F+ADPQTEGI+LIGEIGGTAEE+AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAG
Sbjct  241   CVTKFLADPQTEGIILIGEIGGTAEEDAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAG  300

Query  480   AIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             AIVSGGKGTAQDKI+TL+EAGVTV ESPAK+G  M +VF +RGLL
Sbjct  301   AIVSGGKGTAQDKIKTLREAGVTVVESPAKIGVAMHEVFKQRGLL  345



>ref|XP_004515280.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial-like [Cicer arietinum]
Length=327

 Score =   489 bits (1259),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 265/296 (90%), Positives = 285/296 (96%), Gaps = 0/296 (0%)
 Frame = -2

Query  1233  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  1054
             P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFNTV++A
Sbjct  31    PAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNTVSEA  90

Query  1053  KAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRL  874
             KAETKANASVIYVPPPFA AAIME++EAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRL
Sbjct  91    KAETKANASVIYVPPPFAAAAIMESLEAELDLVVCITEGIPQHDMVRVKAALNRQSKTRL  150

Query  873   IGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIG  694
             IGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAV+QTTAVGLGQSTCVGIG
Sbjct  151   IGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVYQTTAVGLGQSTCVGIG  210

Query  693   GDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLT  514
             GDPFNGTNFVDCL +F+ADPQTEGI+LIGEIGGTAEE+AAA IKESGTEKP+VAFIAGLT
Sbjct  211   GDPFNGTNFVDCLTKFIADPQTEGIILIGEIGGTAEEDAAALIKESGTEKPIVAFIAGLT  270

Query  513   APPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             APPGRRMGHAGAIVSGGKGTAQDKIRTL+EAGVTV ESPAK+G  M D+F ++GL+
Sbjct  271   APPGRRMGHAGAIVSGGKGTAQDKIRTLREAGVTVVESPAKIGAAMFDIFKQKGLV  326



>gb|AAM65450.1| succinyl-CoA synthetase, alpha subunit [Arabidopsis thaliana]
Length=341

 Score =   490 bits (1261),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 270/340 (79%), Positives = 294/340 (86%), Gaps = 7/340 (2%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRPITQS----PLWQQQQHRLFGS---PAPEVFVDKNTRVICQGI  1186
             M+ Q  RL+ ++       + S     L    Q R FG+   P   VFVDKNTRVICQGI
Sbjct  1     MSRQVTRLLGSLRHSGGGCSGSSKVCSLTSLVQSRSFGTTPPPPAAVFVDKNTRVICQGI  60

Query  1185  TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPP  1006
             TGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVP P
Sbjct  61    TGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPAP  120

Query  1005  FagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKI  826
             FA AAIME + AELDL+VCITEGIPQHDMV+VKAAL  Q+KTRLIGPNCPGIIKPGECKI
Sbjct  121   FAAAAIMEGLAAELDLIVCITEGIPQHDMVRVKAALNSQSKTRLIGPNCPGIIKPGECKI  180

Query  825   GIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERF  646
             GIMPGYIHKPG+IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F
Sbjct  181   GIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKF  240

Query  645   VADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSG  466
               DPQTEGIVLIGEIGGTAEE+AAA IKE+GT+KPVVAFIAGLTAPPGRRMGHAGAIVSG
Sbjct  241   FVDPQTEGIVLIGEIGGTAEEDAAALIKENGTDKPVVAFIAGLTAPPGRRMGHAGAIVSG  300

Query  465   GKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             GKGTAQDK ++L++AGV V ESPAK+G  M ++F +RGLL
Sbjct  301   GKGTAQDKTKSLRDAGVKVVESPAKIGAAMFELFQERGLL  340



>gb|AGT16123.1| succinyl-CoA ligase [Saccharum hybrid cultivar R570]
Length=458

 Score =   494 bits (1272),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 267/298 (90%), Positives = 287/298 (96%), Gaps = 0/298 (0%)
 Frame = -2

Query  1239  PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA  1060
             P+P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA
Sbjct  33    PSPVVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVA  92

Query  1059  DAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKT  880
             +AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMVKVKAAL +Q+KT
Sbjct  93    EAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVKVKAALNRQSKT  152

Query  879   RLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVG  700
             RLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVG
Sbjct  153   RLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVG  212

Query  699   IGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAG  520
             IGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGTAEE+AA FI+ES T+KPVVAFIAG
Sbjct  213   IGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGTAEEDAATFIQESKTQKPVVAFIAG  272

Query  519   LTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             LTAPPGRRMGHAGAIV+GGKGTAQDKI+ L+EAGVTV ESPAK+G+TM ++F +RG++
Sbjct  273   LTAPPGRRMGHAGAIVAGGKGTAQDKIKALREAGVTVVESPAKIGSTMFEIFKQRGMV  330



>ref|XP_011003681.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Populus euphratica]
 ref|XP_011003682.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Populus euphratica]
Length=373

 Score =   491 bits (1263),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 277/332 (83%), Positives = 303/332 (91%), Gaps = 6/332 (2%)
 Frame = -2

Query  1329  ARLIANVSKKVRPITQSPLWQ--QQQHRLFGSPAPE---VFVDKNTRVICQGITGKNGTF  1165
             A+L+ +++ + +P +   L+   + Q R + +P P    VFVDKNTRVICQGITGKNGTF
Sbjct  41    AKLLGSIASR-KPSSTPSLFNLSRSQTRYYAAPPPPPPAVFVDKNTRVICQGITGKNGTF  99

Query  1164  HTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaim  985
             HTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVPPPFA AAI+
Sbjct  100   HTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPPFAAAAIL  159

Query  984   eameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYI  805
             EAMEAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLIGPNCPGIIKPGECKIGIMPGYI
Sbjct  160   EAMEAELDLVVCITEGIPQHDMVRVKAALNRQSKTRLIGPNCPGIIKPGECKIGIMPGYI  219

Query  804   HKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTE  625
             HKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+E+F+AD QTE
Sbjct  220   HKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIEKFLADSQTE  279

Query  624   GIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQD  445
             GI+LIGEIGGTAEE+AAA IKESGTEKPV AFIAG TAPPGRRMGHAGAIVSGGKGTAQD
Sbjct  280   GIILIGEIGGTAEEDAAALIKESGTEKPVAAFIAGQTAPPGRRMGHAGAIVSGGKGTAQD  339

Query  444   KIRTLKEAGVTVCESPAKLGTTMLDVFTKRGL  349
             KI+TL+EAGVTV ESPAK+G  MLDVF +RGL
Sbjct  340   KIKTLREAGVTVVESPAKIGVAMLDVFKQRGL  371



>ref|XP_006658733.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial-like, partial [Oryza brachyantha]
Length=294

 Score =   488 bits (1255),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 266/293 (91%), Positives = 284/293 (97%), Gaps = 0/293 (0%)
 Frame = -2

Query  1224  FVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAE  1045
             FVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA+AKAE
Sbjct  1     FVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVAEAKAE  60

Query  1044  TKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGP  865
             TKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMVKVKAAL +Q+KTRLIGP
Sbjct  61    TKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVKVKAALNKQSKTRLIGP  120

Query  864   NCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDP  685
             NCPGIIKPGECKIGIMPGYIHKPGR+GIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDP
Sbjct  121   NCPGIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDP  180

Query  684   FNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPP  505
             FNGTNFVDCLE+FV DPQTEGIVLIGEIGGTAEE+AAAFI+ES T+KPVVAFIAGLTAPP
Sbjct  181   FNGTNFVDCLEKFVDDPQTEGIVLIGEIGGTAEEDAAAFIQESKTQKPVVAFIAGLTAPP  240

Query  504   GRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             GRRMGHAGAIVSGGKGTAQDKI+ L+EAGVTV ESPAK+G+TM ++F +RG+L
Sbjct  241   GRRMGHAGAIVSGGKGTAQDKIKALREAGVTVVESPAKIGSTMFEIFKQRGML  293



>gb|KFK27646.1| hypothetical protein AALP_AA8G410300 [Arabis alpina]
Length=347

 Score =   488 bits (1257),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 276/346 (80%), Positives = 297/346 (86%), Gaps = 13/346 (4%)
 Frame = -2

Query  1344  MAWQTARLIANVSKK----------VRPITQSPLWQQQQHRLFGS---PAPEVFVDKNTR  1204
             M+ Q  RL+ ++S K          V P   S L    Q R FG+   P   VFVDKNTR
Sbjct  1     MSRQVTRLLGSLSSKALRSGSSSSEVYPSCSSSLTSLTQSRSFGTTPPPPAAVFVDKNTR  60

Query  1203  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  1024
             VICQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKA ASV
Sbjct  61    VICQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKATASV  120

Query  1023  IYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIK  844
             IYVP PFA AAIME + AELDL+VCITEGIPQHDMV+VKAAL  Q+KTRLIGPNCPGIIK
Sbjct  121   IYVPAPFAAAAIMEGLAAELDLIVCITEGIPQHDMVRVKAALNSQSKTRLIGPNCPGIIK  180

Query  843   PGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV  664
             PGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV
Sbjct  181   PGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV  240

Query  663   DCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHA  484
             DCLE+F  DPQTEGI+LIGEIGGTAEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHA
Sbjct  241   DCLEKFFVDPQTEGIILIGEIGGTAEEDAAALIKESGTDKPVVAFIAGLTAPPGRRMGHA  300

Query  483   GAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             GAIVSGGKGTAQDKI++L++AGV V ESPAK+G  M D+F +RGLL
Sbjct  301   GAIVSGGKGTAQDKIKSLRDAGVKVVESPAKIGAAMFDIFQERGLL  346



>ref|XP_010546242.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Tarenaya hassleriana]
Length=346

 Score =   488 bits (1256),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 276/340 (81%), Positives = 298/340 (88%), Gaps = 7/340 (2%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRPITQSPLW-------QQQQHRLFGSPAPEVFVDKNTRVICQGI  1186
             M+    RL+ ++S  VR    S ++       Q +       P P VFVDKNTRVICQGI
Sbjct  1     MSRLVTRLLGSLSSNVRRSGNSEVFPSCPLLTQSRSFTAAPPPPPAVFVDKNTRVICQGI  60

Query  1185  TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPP  1006
             TGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVP P
Sbjct  61    TGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPAP  120

Query  1005  FagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKI  826
             FA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL  Q+KTRLIGPNCPGIIKPGECKI
Sbjct  121   FAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNSQSKTRLIGPNCPGIIKPGECKI  180

Query  825   GIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERF  646
             GIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F
Sbjct  181   GIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKF  240

Query  645   VADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSG  466
               DPQTEGI+LIGEIGGTAEE+AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSG
Sbjct  241   FVDPQTEGIILIGEIGGTAEEDAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSG  300

Query  465   GKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             GKGTAQDKI++L++AGVTV ESPAK+G  MLD+F  RGL+
Sbjct  301   GKGTAQDKIKSLRDAGVTVVESPAKIGAAMLDIFQDRGLV  340



>ref|XP_010241497.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Nelumbo nucifera]
 ref|XP_010241498.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Nelumbo nucifera]
 ref|XP_010241499.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Nelumbo nucifera]
Length=346

 Score =   488 bits (1256),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 266/291 (91%), Positives = 282/291 (97%), Gaps = 0/291 (0%)
 Frame = -2

Query  1218  DKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETK  1039
             DKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETK
Sbjct  55    DKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETK  114

Query  1038  ANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNC  859
             ANASVIYVPPPFA AAIMEA+EAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLIGPNC
Sbjct  115   ANASVIYVPPPFAAAAIMEALEAELDLVVCITEGIPQHDMVRVKAALNKQSKTRLIGPNC  174

Query  858   PGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFN  679
             PGIIKPGECKIGIMPGYIHKPGR+GIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFN
Sbjct  175   PGIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFN  234

Query  678   GTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGR  499
             GTNFVDC+ +F+ DPQTEGI+LIGEIGGTAEE+AAA IKESGTEKP+VAFIAGLTAPPGR
Sbjct  235   GTNFVDCMNKFLVDPQTEGIILIGEIGGTAEEDAAALIKESGTEKPIVAFIAGLTAPPGR  294

Query  498   RMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             RMGHAGAIVSGGKGTAQDKI+TL+EAGVTV ESPAK+G  MLDVF +RGLL
Sbjct  295   RMGHAGAIVSGGKGTAQDKIKTLREAGVTVVESPAKIGAAMLDVFKQRGLL  345



>ref|XP_010493442.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Camelina sativa]
Length=345

 Score =   486 bits (1252),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 275/345 (80%), Positives = 298/345 (86%), Gaps = 13/345 (4%)
 Frame = -2

Query  1344  MAWQTARLIANV---------SKKVRPITQSPLWQQQQHRLFGS---PAPEVFVDKNTRV  1201
             M+ Q  RL+ ++         S+ V P + S L      R FG+   P   VFVDKNTRV
Sbjct  1     MSRQVTRLLGSLRRCSGGGGSSELVIP-SCSSLTSLTHSRSFGTTPPPPAAVFVDKNTRV  59

Query  1200  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  1021
             ICQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASVI
Sbjct  60    ICQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVI  119

Query  1020  YVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKP  841
             YVP PFA AAIME + AELDLVVCITEGIPQHDMV+VKAAL  Q+KTRLIGPNCPGIIKP
Sbjct  120   YVPAPFAAAAIMEGVAAELDLVVCITEGIPQHDMVRVKAALNSQSKTRLIGPNCPGIIKP  179

Query  840   GECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD  661
             GECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD
Sbjct  180   GECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD  239

Query  660   CLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAG  481
             CLE+F  DPQTEGI+LIGEIGGTAEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAG
Sbjct  240   CLEKFFVDPQTEGIILIGEIGGTAEEDAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAG  299

Query  480   AIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             AIVSGGKGTAQDKI++L++AGV V ESPAK+G  M ++F +RGLL
Sbjct  300   AIVSGGKGTAQDKIKSLRDAGVKVVESPAKIGAAMFEIFQERGLL  344



>emb|CAA48891.1| succinate--CoA ligase (GDP-forming) [Arabidopsis thaliana]
Length=345

 Score =   486 bits (1252),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 260/295 (88%), Positives = 278/295 (94%), Gaps = 0/295 (0%)
 Frame = -2

Query  1230  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  1051
             +VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AK
Sbjct  50    QVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAK  109

Query  1050  AETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  871
             AETKANASVIYVP PFA AAIME + AELDL+VCITEGIPQHDMV+VKAAL  Q+KTRLI
Sbjct  110   AETKANASVIYVPAPFAAAAIMEGLAAELDLIVCITEGIPQHDMVRVKAALNSQSKTRLI  169

Query  870   GPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGG  691
             GPNCPGIIKPGECKIGIMPGYIHKPG+IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGG
Sbjct  170   GPNCPGIIKPGECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGG  229

Query  690   DPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTA  511
             DPFNGTNFVDCLE+F  DPQTEGIVLIGEIGGTAEE+AAA IKE+GT+KPVVAFIAGLTA
Sbjct  230   DPFNGTNFVDCLEKFFVDPQTEGIVLIGEIGGTAEEDAAALIKENGTDKPVVAFIAGLTA  289

Query  510   PPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             PPGRRMGHAG IVSGGKGTAQDKI++L++AGV V ESPAKLG  M ++F +RGLL
Sbjct  290   PPGRRMGHAGRIVSGGKGTAQDKIKSLRDAGVKVVESPAKLGAAMFELFQERGLL  344



>ref|XP_010454606.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Camelina sativa]
Length=346

 Score =   486 bits (1251),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 274/345 (79%), Positives = 297/345 (86%), Gaps = 12/345 (3%)
 Frame = -2

Query  1344  MAWQTARLIANV---------SKKVRPITQSPLWQQQQHRLFGS---PAPEVFVDKNTRV  1201
             M+ Q  RL+ ++         S+ V   + S L    Q R FG+   P   VFVDKNTRV
Sbjct  1     MSRQVTRLLGSLRRCSGGGGSSELVVVPSCSSLTSLTQSRSFGTTHPPPAAVFVDKNTRV  60

Query  1200  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  1021
             ICQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASV 
Sbjct  61    ICQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVS  120

Query  1020  YVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKP  841
             YVP PFA AAIME + AELDLVVCITEGIPQHDMV+VKAAL  Q+KTRLIGPNCPGIIKP
Sbjct  121   YVPAPFAAAAIMEGVAAELDLVVCITEGIPQHDMVRVKAALNSQSKTRLIGPNCPGIIKP  180

Query  840   GECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD  661
             GECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD
Sbjct  181   GECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD  240

Query  660   CLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAG  481
             CLE+F  DPQTEGI+LIGEIGGTAEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAG
Sbjct  241   CLEKFFVDPQTEGIILIGEIGGTAEEDAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAG  300

Query  480   AIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             AIVSGGKGTAQDKI++L++AGV V ESPAK+G  M ++F +RGLL
Sbjct  301   AIVSGGKGTAQDKIKSLRDAGVKVVESPAKIGAAMFEIFQERGLL  345



>ref|XP_009122444.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Brassica rapa]
Length=347

 Score =   486 bits (1251),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 270/345 (78%), Positives = 293/345 (85%), Gaps = 12/345 (3%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRPIT-----QSPLWQQ----QQHRLFGS---PAPEVFVDKNTRV  1201
             M+ Q  RL+ ++S   R  +      SP  Q      Q R F S   P   VFVDKNTRV
Sbjct  1     MSRQVTRLLGSLSSNARRCSIGFSEVSPSCQYLTSLTQSRSFASDPPPPAAVFVDKNTRV  60

Query  1200  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  1021
             +CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASVI
Sbjct  61    MCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVI  120

Query  1020  YVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKP  841
             YVP PFA AAIME ++AELDLVVCITEGIPQHDMV+VK AL  Q+KTRLIGPNCPGIIKP
Sbjct  121   YVPAPFAAAAIMEGIQAELDLVVCITEGIPQHDMVRVKHALNSQSKTRLIGPNCPGIIKP  180

Query  840   GECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD  661
             GECKIGIMPGYIHKPG+IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD
Sbjct  181   GECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD  240

Query  660   CLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAG  481
             CLE+F  DPQTEGIVLIGEIGGTAEE+AAA IK +GT  PVV+FIAGLTAPPGRRMGHAG
Sbjct  241   CLEKFFVDPQTEGIVLIGEIGGTAEEDAAALIKANGTVNPVVSFIAGLTAPPGRRMGHAG  300

Query  480   AIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             AIVSGGKGTAQDKI++L +AGV V ESPAK+G  M D+F +RGLL
Sbjct  301   AIVSGGKGTAQDKIKSLNDAGVKVVESPAKIGAAMYDLFKERGLL  345



>ref|XP_001765853.1| predicted protein [Physcomitrella patens]
 gb|EDQ69444.1| predicted protein [Physcomitrella patens]
Length=324

 Score =   484 bits (1246),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 265/328 (81%), Positives = 292/328 (89%), Gaps = 6/328 (2%)
 Frame = -2

Query  1326  RLIANVSKKV-RPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQA  1150
             R +A +++++ R  T S   ++Q      S  P VFVDK TRVICQGITGKNGTFHTEQA
Sbjct  2     RRVAGIARQLGRLATHSDGGRRQL-----SSRPAVFVDKTTRVICQGITGKNGTFHTEQA  56

Query  1149  IEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeamea  970
             I+YGT MVGGVTPKKGGTEHLGLPVFNTVA+AK ETKANASVIYVP   A  AI+EA++A
Sbjct  57    IDYGTNMVGGVTPKKGGTEHLGLPVFNTVAEAKKETKANASVIYVPASLAANAILEALDA  116

Query  969   ELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGR  790
             ELDLVVCITEGIPQHDMVKVK+AL QQ+KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGR
Sbjct  117   ELDLVVCITEGIPQHDMVKVKSALLQQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGR  176

Query  789   IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLi  610
             IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGIVLI
Sbjct  177   IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVDDPQTEGIVLI  236

Query  609   geiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTL  430
             GEIGG+AEE+AAAFI+ESGT+KPVV+FIAGLTAPPGRRMGHAGAI+SGGKGTA DKI  L
Sbjct  237   GEIGGSAEEDAAAFIRESGTQKPVVSFIAGLTAPPGRRMGHAGAIISGGKGTATDKINAL  296

Query  429   KEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             + AGVTVCESPA++G TML VF +R L+
Sbjct  297   RAAGVTVCESPAQIGATMLKVFEERALI  324



>ref|XP_006288023.1| hypothetical protein CARUB_v10001256mg, partial [Capsella rubella]
 gb|EOA20921.1| hypothetical protein CARUB_v10001256mg, partial [Capsella rubella]
Length=359

 Score =   486 bits (1250),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 274/343 (80%), Positives = 298/343 (87%), Gaps = 11/343 (3%)
 Frame = -2

Query  1344  MAWQTARLIANV-------SKKVRPITQSPLWQQQQHRLFGS---PAPEVFVDKNTRVIC  1195
             M+ Q  RL+ ++       S +V P   S L    Q R FG+   P   VFVDKNTRVIC
Sbjct  17    MSRQITRLLGSLRRSCGGGSSEVVPSCCS-LTSLTQSRSFGTTPPPPAAVFVDKNTRVIC  75

Query  1194  QGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYV  1015
             QGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYV
Sbjct  76    QGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYV  135

Query  1014  PPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGE  835
             P PFA AAIME + AELDL+VCITEGIPQHDMV+VKAAL  Q+KTRLIGPNCPGIIKPGE
Sbjct  136   PAPFAAAAIMEGIAAELDLIVCITEGIPQHDMVRVKAALNSQSKTRLIGPNCPGIIKPGE  195

Query  834   CKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCL  655
             CKIGIMPGYIHKPG+IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCL
Sbjct  196   CKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCL  255

Query  654   ERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAI  475
             E+F  DPQTEGI+LIGEIGGTAEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAI
Sbjct  256   EKFFVDPQTEGIILIGEIGGTAEEDAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGAI  315

Query  474   VSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             VSGGKGTAQDKI++L++AGV V ESPAK+G  M ++F +RGLL
Sbjct  316   VSGGKGTAQDKIKSLRDAGVKVVESPAKIGAAMFEIFQERGLL  358



>ref|XP_010421123.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Camelina sativa]
Length=345

 Score =   484 bits (1246),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 268/315 (85%), Positives = 285/315 (90%), Gaps = 3/315 (1%)
 Frame = -2

Query  1281  SPLWQQQQHRLFGS---PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTP  1111
             S L    Q R FG+   P   VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMV GVTP
Sbjct  30    SSLTSLTQSRSFGTTPPPPAAVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVAGVTP  89

Query  1110  KKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIP  931
             KKGGTEHLGLPVFNTVA+AKAETKANASVIYVP PFA AAIME + AELDLVVCITEGIP
Sbjct  90    KKGGTEHLGLPVFNTVAEAKAETKANASVIYVPAPFAAAAIMEGVAAELDLVVCITEGIP  149

Query  930   QHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYE  751
             QHDMV+VKAAL  Q+KTRLIGPNCPGIIKPGECKIGIMPGYIHK GRIGIVSRSGTLTYE
Sbjct  150   QHDMVRVKAALNSQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKSGRIGIVSRSGTLTYE  209

Query  750   AVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaa  571
             AVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F  DPQTEGI+LIGEIGGTAEE+AAA
Sbjct  210   AVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFFVDPQTEGIILIGEIGGTAEEDAAA  269

Query  570   fIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAK  391
              IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI++L++AGV V ESPAK
Sbjct  270   LIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKSLRDAGVKVVESPAK  329

Query  390   LGTTMLDVFTKRGLL  346
             +G  M ++F +RGLL
Sbjct  330   IGAAMFEIFQERGLL  344



>ref|XP_001762925.1| predicted protein [Physcomitrella patens]
 gb|EDQ72130.1| predicted protein [Physcomitrella patens]
Length=324

 Score =   483 bits (1244),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 258/296 (87%), Positives = 278/296 (94%), Gaps = 0/296 (0%)
 Frame = -2

Query  1233  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  1054
             P VFVDK TRVICQGITGKNGTFHTEQAI+YGT MVGGVTPKKGGTEHLGLPVFNTVA+A
Sbjct  29    PAVFVDKTTRVICQGITGKNGTFHTEQAIDYGTNMVGGVTPKKGGTEHLGLPVFNTVAEA  88

Query  1053  KAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRL  874
             K ET+ANASVIYVP   A  AI+EA++AELDLVVCITEGIPQHDMVKVK+AL QQ+KTRL
Sbjct  89    KKETRANASVIYVPASLAANAILEALDAELDLVVCITEGIPQHDMVKVKSALLQQSKTRL  148

Query  873   IGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIG  694
             IGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIG
Sbjct  149   IGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIG  208

Query  693   GDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLT  514
             GDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGG+AEE+AAAFIKESGT+KPVV+FIAGLT
Sbjct  209   GDPFNGTNFVDCLEKFVNDPQTEGIVLIGEIGGSAEEDAAAFIKESGTQKPVVSFIAGLT  268

Query  513   APPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             APPGRRMGHAGAI+SGGKGTA DKI  L+ AGVTVCESPA++G+TML VF +R L+
Sbjct  269   APPGRRMGHAGAIISGGKGTATDKINALRAAGVTVCESPAQIGSTMLRVFQERALI  324



>gb|KHN23614.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Glycine soja]
Length=345

 Score =   483 bits (1242),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 274/341 (80%), Positives = 296/341 (87%), Gaps = 21/341 (6%)
 Frame = -2

Query  1305  KKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMV  1126
             + V  +  S   ++   RLF + +P VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MV
Sbjct  4     QAVTKLLSSIASRRHGLRLFSAASPAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMV  63

Query  1125  GGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCI  946
             GGVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCI
Sbjct  64    GGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCI  123

Query  945   TEGIPQHDM---------------------VKVKAALKQQTKTRLIGPNCPGIIKPGECK  829
             TEGIPQHDM                     V+VKAAL +Q+KTRLIGPNCPGIIKPGECK
Sbjct  124   TEGIPQHDMASRFGILNSGEMYLAPLNGGKVRVKAALNRQSKTRLIGPNCPGIIKPGECK  183

Query  828   IGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLER  649
             IGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCL++
Sbjct  184   IGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLQK  243

Query  648   FVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVS  469
             F+ DPQTEGI+LIGEIGGTAEE+AAA IK+SGTEKPVVAFIAGLTAPPGRRMGHAGAIVS
Sbjct  244   FLTDPQTEGIILIGEIGGTAEEDAAALIKDSGTEKPVVAFIAGLTAPPGRRMGHAGAIVS  303

Query  468   GGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             GGKGTAQDKI+TL+EAGV V ESPAK+G  MLDVF +RGL+
Sbjct  304   GGKGTAQDKIKTLREAGVMVVESPAKIGAAMLDVFKQRGLV  344



>ref|XP_010923343.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Elaeis guineensis]
Length=340

 Score =   482 bits (1241),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 280/340 (82%), Positives = 306/340 (90%), Gaps = 8/340 (2%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKV----RPITQSPLWQQQQHRLFGSPAPE---VFVDKNTRVICQGI  1186
             M+ Q A+L+ +++ K+    +    SPL  Q + R FG+  P    VFVDKNTR+ICQGI
Sbjct  1     MSRQAAKLVGSLASKLVSQPKLSASSPLASQSR-RHFGAAPPPAPAVFVDKNTRIICQGI  59

Query  1185  TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPP  1006
             TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAE KANASVIYVPPP
Sbjct  60    TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAEAKANASVIYVPPP  119

Query  1005  FagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKI  826
             FA AAI+EA+EAELDLVVCITEGIPQHDMV+VKAAL QQ+KTRLIGPNCPGIIKPGECKI
Sbjct  120   FAAAAILEALEAELDLVVCITEGIPQHDMVRVKAALNQQSKTRLIGPNCPGIIKPGECKI  179

Query  825   GIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERF  646
             GIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+ RF
Sbjct  180   GIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTRF  239

Query  645   VADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSG  466
             + DPQTEGIVLIGEIGGTAEE+AAA I+ESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSG
Sbjct  240   LDDPQTEGIVLIGEIGGTAEEDAAALIRESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSG  299

Query  465   GKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             GKGTAQDKI+TL+EAGVTV ESPAK+G  MLDVF + GL+
Sbjct  300   GKGTAQDKIKTLREAGVTVVESPAKIGVAMLDVFKQHGLV  339



>ref|XP_010069514.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Eucalyptus grandis]
 gb|KCW57892.1| hypothetical protein EUGRSUZ_H00643 [Eucalyptus grandis]
Length=339

 Score =   482 bits (1240),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 269/296 (91%), Positives = 283/296 (96%), Gaps = 0/296 (0%)
 Frame = -2

Query  1233  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  1054
             P VFVDK+TRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+A
Sbjct  42    PAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEA  101

Query  1053  KAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRL  874
             KAETKANASV+YVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRL
Sbjct  102   KAETKANASVVYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNRQSKTRL  161

Query  873   IGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIG  694
             IGPNCPGIIKPGECKIGIMPGYIHKPGR+GIVSRSGTLTYEAVFQTTAVGLGQSTCVGIG
Sbjct  162   IGPNCPGIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIG  221

Query  693   GDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLT  514
             GDPFNGTNFVDCLERFV DPQTEGI+LIGEIGGTAEE+AAAFIKES TEKPVVAFIAGLT
Sbjct  222   GDPFNGTNFVDCLERFVVDPQTEGIILIGEIGGTAEEDAAAFIKESKTEKPVVAFIAGLT  281

Query  513   APPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             APPGRRMGHAGAIVSGGKGTAQ KI  L+EAGVTV ESPAK+G  MLDV  ++GL+
Sbjct  282   APPGRRMGHAGAIVSGGKGTAQGKIEALREAGVTVVESPAKIGAAMLDVLKQKGLV  337



>ref|XP_010031908.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Eucalyptus grandis]
 gb|KCW51304.1| hypothetical protein EUGRSUZ_J00864 [Eucalyptus grandis]
Length=333

 Score =   481 bits (1237),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 262/294 (89%), Positives = 281/294 (96%), Gaps = 0/294 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             VFVDK+TRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKA
Sbjct  39    VFVDKSTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKA  98

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             ETKANAS +YVPPPFA AAIMEA+EAELDLVVCITEGIPQHDMV+VKAA+  Q+KTRLIG
Sbjct  99    ETKANASAVYVPPPFAAAAIMEAVEAELDLVVCITEGIPQHDMVRVKAAINSQSKTRLIG  158

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD
Sbjct  159   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  218

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             PFNGTNFVDC+ +F+ DPQTEGI+LIGEIGGTAEE+AAA IKES TEKPVV FIAGLTAP
Sbjct  219   PFNGTNFVDCIRKFLVDPQTEGIILIGEIGGTAEEDAAALIKESKTEKPVVGFIAGLTAP  278

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             PGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVTV ESPAK+G  ML+VF +RGL+
Sbjct  279   PGRRMGHAGAIVSGGKGTAQDKIKTLREAGVTVVESPAKIGAAMLEVFKQRGLV  332



>ref|XP_010688675.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial [Beta vulgaris subsp. vulgaris]
Length=342

 Score =   480 bits (1236),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 271/341 (79%), Positives = 295/341 (87%), Gaps = 8/341 (2%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRPITQSPLWQQQQH----RLFGS----PAPEVFVDKNTRVICQG  1189
             MA Q +RL+A +S K++    S            R FG+    P P VFVDK+TRVICQG
Sbjct  1     MARQASRLVATLSSKIQSPKSSISSSISSSSPKTRDFGTVARHPPPAVFVDKHTRVICQG  60

Query  1188  ITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPP  1009
             ITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLG+PVFN+VA+AK  T A ASVIYVPP
Sbjct  61    ITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGVPVFNSVAEAKEATGAQASVIYVPP  120

Query  1008  PFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECK  829
             PFA  AIME +EAELDL+VCITEGIPQHDMV+VKAAL  Q+KTRLIGPNCPGIIKPGECK
Sbjct  121   PFAAKAIMEGLEAELDLIVCITEGIPQHDMVRVKAALNSQSKTRLIGPNCPGIIKPGECK  180

Query  828   IGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLER  649
             IGIMPGYIHKPGRIGIVSRSGTLTYEAVFQT+AVGLGQST VGIGGDPFNGTNFVDCLE+
Sbjct  181   IGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTSAVGLGQSTVVGIGGDPFNGTNFVDCLEK  240

Query  648   FVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVS  469
             F+ DPQTEGI+LIGEIGGTAEE+AAA IKES TEKPVV+FIAGLTAPPGRRMGHAGAIVS
Sbjct  241   FIEDPQTEGIILIGEIGGTAEEDAAAVIKESKTEKPVVSFIAGLTAPPGRRMGHAGAIVS  300

Query  468   GGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             GGKGTAQDKI TL+ AGVTV ESPA++G  MLDVF +RGLL
Sbjct  301   GGKGTAQDKITTLRGAGVTVVESPAQMGAAMLDVFKQRGLL  341



>gb|EMT17065.1| Putative succinyl-CoA ligase (GDP-forming) subunit alpha, mitochondrial 
[Aegilops tauschii]
Length=356

 Score =   480 bits (1235),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 265/320 (83%), Positives = 285/320 (89%), Gaps = 26/320 (8%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             VFVDK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPVFN+VA+AKA
Sbjct  36    VFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPVFNSVAEAKA  95

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             ETKANASVIYVPPPFA AAIMEA+EAELDLVVCITEGIPQHDMVKVKAAL +Q+KTRLIG
Sbjct  96    ETKANASVIYVPPPFAAAAIMEALEAELDLVVCITEGIPQHDMVKVKAALNRQSKTRLIG  155

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVG+GGD
Sbjct  156   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGMGGD  215

Query  687   PFNGTNFVDCLERFVADPQTE--------------------------GIVLigeiggtae  586
             PFNGTNFVDCLE+FV DPQTE                          GIVLIGEIGGTAE
Sbjct  216   PFNGTNFVDCLEKFVDDPQTEVMFSSVNAVISLLSIILIGKIGMCLLGIVLIGEIGGTAE  275

Query  585   eeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVC  406
             E+AAAFI+ES TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ L++AGVTV 
Sbjct  276   EDAAAFIRESKTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALRDAGVTVV  335

Query  405   ESPAKLGTTMLDVFTKRGLL  346
             ESPAK+G+TM ++F +RG++
Sbjct  336   ESPAKIGSTMFELFKQRGMV  355



>ref|XP_008240339.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial [Prunus mume]
Length=329

 Score =   478 bits (1230),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 272/329 (83%), Positives = 297/329 (90%), Gaps = 8/329 (2%)
 Frame = -2

Query  1329  ARLIANV-SKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQ  1153
             A+LI ++ S+K  P   + + Q++ +     P P VFVDKNTRVICQGITGKNGTFHTEQ
Sbjct  7     AKLIGSIASRKPSPSPSTSILQRRHYSPAPPPPPAVFVDKNTRVICQGITGKNGTFHTEQ  66

Query  1152  AIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeame  973
             AIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVPPPFA AAIMEAME
Sbjct  67    AIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAIMEAME  126

Query  972   aELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPG  793
             AELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLIGPNCPGIIKPGECKIGIMPGYIHKP 
Sbjct  127   AELDLVVCITEGIPQHDMVRVKAALNRQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKP-  185

Query  792   RIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVL  613
                   RSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC++RF+ DPQTEGI+L
Sbjct  186   ------RSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCIDRFLEDPQTEGIIL  239

Query  612   igeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRT  433
             IGEIGGTAEE+AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+T
Sbjct  240   IGEIGGTAEEDAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKT  299

Query  432   LKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             L+EAGVTV ESPAK+G  MLDVF +RGL+
Sbjct  300   LREAGVTVVESPAKIGVAMLDVFKQRGLV  328



>ref|XP_009389047.1| PREDICTED: probable succinyl-CoA ligase [ADP-forming] subunit 
alpha, mitochondrial [Musa acuminata subsp. malaccensis]
Length=341

 Score =   478 bits (1230),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 275/339 (81%), Positives = 298/339 (88%), Gaps = 7/339 (2%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKV--RP-----ITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGI  1186
             M  Q +RLI  ++ K+  RP      + +     +       P P VFVDKNTRVICQGI
Sbjct  1     MNRQASRLIGTLASKIFSRPNPSAASSSTLSSPSRHFAAAPPPPPAVFVDKNTRVICQGI  60

Query  1185  TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPP  1006
             TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVPPP
Sbjct  61    TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPP  120

Query  1005  FagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKI  826
             FA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLIGPNCPGIIKPGECKI
Sbjct  121   FAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNKQSKTRLIGPNCPGIIKPGECKI  180

Query  825   GIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERF  646
             GIMPGYIHKPGR+GIVSRSGTLTYEAVFQTT VGLGQSTCVGIGGDPFNGTNFVDC+ +F
Sbjct  181   GIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTNVGLGQSTCVGIGGDPFNGTNFVDCITKF  240

Query  645   VADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSG  466
             + DPQTEGI+LIGEIGGTAEE+AAA I ESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSG
Sbjct  241   LDDPQTEGIILIGEIGGTAEEDAAALILESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSG  300

Query  465   GKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGL  349
             GKGTAQDKI+TL+EAGV V ESPAK+G  ML+VF +RGL
Sbjct  301   GKGTAQDKIKTLREAGVMVVESPAKIGVAMLEVFKQRGL  339



>emb|CDY44764.1| BnaC02g01230D [Brassica napus]
Length=343

 Score =   474 bits (1221),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 270/341 (79%), Positives = 295/341 (87%), Gaps = 8/341 (2%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRPITQSPL-----WQQQQHRLFGS---PAPEVFVDKNTRVICQG  1189
             M+ Q ARL+ ++S++    T   +         Q R F S   P   VFVDKNTRV+CQG
Sbjct  1     MSRQVARLLGSLSRRCSSTTSEAIPPTLSSLTTQSRSFASDPPPPAAVFVDKNTRVMCQG  60

Query  1188  ITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPP  1009
             ITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAE KANASVIYVP 
Sbjct  61    ITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAEAKANASVIYVPA  120

Query  1008  PFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECK  829
             PFA AAIME ++AELDL+VCITEGIPQHDMV+VK AL  Q+KTRLIGPNCPGIIKPGECK
Sbjct  121   PFAAAAIMEGIQAELDLIVCITEGIPQHDMVRVKHALNSQSKTRLIGPNCPGIIKPGECK  180

Query  828   IGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLER  649
             IGIMPGYIHKPG+IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+
Sbjct  181   IGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEK  240

Query  648   FVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVS  469
             F  DPQTEGIVLIGEIGGTAEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVS
Sbjct  241   FFVDPQTEGIVLIGEIGGTAEEDAAALIKESGTDKPVVAFIAGLTAPPGRRMGHAGAIVS  300

Query  468   GGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             GGKGTAQDKI++L +AGV V ESPAK+G  M D+F +RGLL
Sbjct  301   GGKGTAQDKIKSLNDAGVKVVESPAKIGAAMYDLFKERGLL  341



>gb|KHN24503.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Glycine soja]
Length=352

 Score =   470 bits (1210),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 271/335 (81%), Positives = 288/335 (86%), Gaps = 36/335 (11%)
 Frame = -2

Query  1254  RLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPV  1075
             RLF + +P    DK+TRVICQGITGKNGTFHTEQAIEYGT MVGGVTPKKGGTEHLGLPV
Sbjct  21    RLFSAASP----DKSTRVICQGITGKNGTFHTEQAIEYGTNMVGGVTPKKGGTEHLGLPV  76

Query  1074  FNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDM--------  919
             FNTVA+AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDM        
Sbjct  77    FNTVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMASRFGILN  136

Query  918   ------------------------VKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPG  811
                                     V+VKAAL +Q+KTRLIGPNCPGIIKPGECKIGIMPG
Sbjct  137   STYFKKAAYGEVYPDRAEITLPFKVRVKAALNRQSKTRLIGPNCPGIIKPGECKIGIMPG  196

Query  810   YIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQ  631
             YIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCL++F+ DPQ
Sbjct  197   YIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLQKFLTDPQ  256

Query  630   TEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTA  451
             TEGI+LIGEIGGTAEE+AAA IKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTA
Sbjct  257   TEGIILIGEIGGTAEEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTA  316

Query  450   QDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             QDKI+TL+EAGVTV ESPAK+G  MLDVF +RGL+
Sbjct  317   QDKIKTLREAGVTVVESPAKIGAAMLDVFKQRGLV  351



>gb|EMS53891.1| putative succinyl-CoA ligase [ADP-forming] subunit alpha, mitochondrial 
[Triticum urartu]
Length=383

 Score =   468 bits (1205),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 265/347 (76%), Positives = 285/347 (82%), Gaps = 53/347 (15%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKM---------------------------  1129
             VFVDK+TRVICQGITGKNGTFHTEQAIEYGT M                           
Sbjct  36    VFVDKSTRVICQGITGKNGTFHTEQAIEYGTNMGHSSVCSQDFEFFNKWGGDIESYFTFD  95

Query  1128  --------------------------VGGVTPKKGGTEHLGLPVFNTVADAKAETKANAS  1027
                                       VGGVTPKKGGTEHLGLPVFN+VA+AKAETKANAS
Sbjct  96    IIGSNSGRAYEENAGAYEEKKTVMWMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANAS  155

Query  1026  VIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGII  847
             VIYVPPPFA AAIMEA+EAELDLVVCITEGIPQHDMVKVKAAL +Q+KTRLIGPNCPGII
Sbjct  156   VIYVPPPFAAAAIMEALEAELDLVVCITEGIPQHDMVKVKAALNRQSKTRLIGPNCPGII  215

Query  846   KPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNF  667
             KPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVG+GGDPFNGTNF
Sbjct  216   KPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGMGGDPFNGTNF  275

Query  666   VDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGH  487
             VDCLE+FV DPQTEGIVLIGEIGGTAEE+AAAFI+ES TEKPVVAFIAGLTAPPGRRMGH
Sbjct  276   VDCLEKFVDDPQTEGIVLIGEIGGTAEEDAAAFIQESKTEKPVVAFIAGLTAPPGRRMGH  335

Query  486   AGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             AGAIVSGGKGTAQDKI+ L++AGVTV ESPAK+G+TM ++F +RG++
Sbjct  336   AGAIVSGGKGTAQDKIKALRDAGVTVVESPAKIGSTMFELFKQRGMV  382



>ref|XP_001693108.1| succinyl-coa ligase alpha chain [Chlamydomonas reinhardtii]
 ref|XP_001693109.1| succinyl-CoA ligase [Chlamydomonas reinhardtii]
 gb|EDP03134.1| succinyl-coa ligase alpha chain [Chlamydomonas reinhardtii]
 gb|EDP03135.1| succinyl-CoA ligase [Chlamydomonas reinhardtii]
Length=329

 Score =   446 bits (1148),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 249/305 (82%), Positives = 275/305 (90%), Gaps = 3/305 (1%)
 Frame = -2

Query  1254  RLFGSPA---PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLG  1084
             R F S A   P VFVDKNT+VICQG+TGKNGTFHTEQAI YGT+MVGGVTPKKGGT HLG
Sbjct  24    RGFASQAAHNPAVFVDKNTKVICQGLTGKNGTFHTEQAIAYGTQMVGGVTPKKGGTSHLG  83

Query  1083  LPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKA  904
             LPVFNTVA+AKA T  +A+VIYVPPPFA  AI+EA+EAEL+LVVCITEGIPQHDMV+VK 
Sbjct  84    LPVFNTVAEAKAATGCHATVIYVPPPFAAKAILEAVEAELELVVCITEGIPQHDMVRVKK  143

Query  903   ALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVG  724
             A++ QTKTRLIGPNCPGIIKPGECKIGIMPGYIH PG+IGIVSRSGTLTYEAVFQTT  G
Sbjct  144   AMQGQTKTRLIGPNCPGIIKPGECKIGIMPGYIHTPGKIGIVSRSGTLTYEAVFQTTNQG  203

Query  723   LGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEK  544
             LGQST VGIGGDPFNGTNFVDCLERFV DPQTEGI++IGEIGGTAEEEAA FI++SGT+K
Sbjct  204   LGQSTVVGIGGDPFNGTNFVDCLERFVKDPQTEGIIMIGEIGGTAEEEAAEFIRKSGTKK  263

Query  543   PVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             PVV+FIAGLTAPPGRRMGHAGAI+SGGKGTA DKI+ L+EAGVTV  SPA++G TM+ V 
Sbjct  264   PVVSFIAGLTAPPGRRMGHAGAIISGGKGTATDKIKALEEAGVTVTRSPAQMGVTMMRVM  323

Query  363   TKRGL  349
              +RGL
Sbjct  324   KERGL  328



>ref|XP_003078495.1| putative succinyl-CoA ligase alpha subunit (ISS) [Ostreococcus 
tauri]
 emb|CAL53236.1| Succinyl-CoA synthetase-like [Ostreococcus tauri]
Length=331

 Score =   445 bits (1144),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 248/332 (75%), Positives = 281/332 (85%), Gaps = 10/332 (3%)
 Frame = -2

Query  1341  AWQTARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFH  1162
             A ++ R +AN       +T+S + +   +    S AP VFVD NTRVI QG TGKNGTFH
Sbjct  10    ARESQRGVANA------LTRSSIARTADY----STAPAVFVDGNTRVIVQGFTGKNGTFH  59

Query  1161  TEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaime  982
             +EQAI YGTK+VGGVTPKKGGT HLGLPVF+TV +A  ETKANASVIYVPPPFA  AIME
Sbjct  60    SEQAIAYGTKVVGGVTPKKGGTTHLGLPVFDTVREAVVETKANASVIYVPPPFAAKAIME  119

Query  981   ameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIH  802
             A+EAE+DLVVCITEG+PQHDMV+VK AL  Q+KTRLIGPNCPGIIKPGECKIGIMPGYIH
Sbjct  120   AVEAEIDLVVCITEGVPQHDMVRVKRALMSQSKTRLIGPNCPGIIKPGECKIGIMPGYIH  179

Query  801   KPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEG  622
             KPGRIG+VSRSGTLTYEAV+QTT  GLGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEG
Sbjct  180   KPGRIGVVSRSGTLTYEAVYQTTVTGLGQSTCVGIGGDPFNGTNFVDCLEKFVKDPQTEG  239

Query  621   IVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDK  442
             I++IGEIGGTAEEEAA FI+ SGT+KP+V+FIAGLTAPPGRRMGHAGAI+SGGKG A DK
Sbjct  240   IIMIGEIGGTAEEEAAEFIRASGTDKPIVSFIAGLTAPPGRRMGHAGAIISGGKGGASDK  299

Query  441   IRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             I  L+ AGV V +SPAK+G  M D+F +R +L
Sbjct  300   IAALEAAGVRVVKSPAKMGQAMYDMFAERKML  331



>gb|ABB29950.1| succinyl-CoA ligase alpha 1 subunit-like [Solanum tuberosum]
Length=262

 Score =   441 bits (1135),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 239/262 (91%), Positives = 256/262 (98%), Gaps = 0/262 (0%)
 Frame = -2

Query  1131  MVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVV  952
             MVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVPPPFA AAIME +EAELDL+V
Sbjct  1     MVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPPFAAAAIMEGLEAELDLIV  60

Query  951   CITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSR  772
             CITEGIPQHDMV+VKAALK+Q++TRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSR
Sbjct  61    CITEGIPQHDMVRVKAALKKQSRTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSR  120

Query  771   SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  592
             SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F+ADPQTEGIVLIGEIGGT
Sbjct  121   SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFIADPQTEGIVLIGEIGGT  180

Query  591   aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  412
             AEE+AAA IKESGT+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ LKEAGVT
Sbjct  181   AEEDAAALIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALKEAGVT  240

Query  411   VCESPAKLGTTMLDVFTKRGLL  346
             VCESPAK+G +ML+VF +RGL+
Sbjct  241   VCESPAKIGVSMLEVFKQRGLV  262



>ref|XP_002957241.1| succinate-coa ligase alpha chain, succinyl-CoA synthetase mitochondrial 
precursor [Volvox carteri f. nagariensis]
 gb|EFJ41739.1| succinate-coa ligase alpha chain, succinyl-CoA synthetase mitochondrial 
precursor [Volvox carteri f. nagariensis]
Length=328

 Score =   442 bits (1137),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 247/305 (81%), Positives = 271/305 (89%), Gaps = 3/305 (1%)
 Frame = -2

Query  1254  RLFGSPA---PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLG  1084
             R F S A   P VFVDKNT+VICQGITGKNGTFHTEQAI YGT+MVGGVTPKKGG+ HLG
Sbjct  23    RGFASQAAYNPAVFVDKNTKVICQGITGKNGTFHTEQAIAYGTQMVGGVTPKKGGSTHLG  82

Query  1083  LPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKA  904
             LPVFN+V +AK+ T  +ASVIYVPPPFA  AI+EA+EAELDLVVCITEGIPQHDMVKVK 
Sbjct  83    LPVFNSVKEAKSATGCHASVIYVPPPFAARAILEAVEAELDLVVCITEGIPQHDMVKVKK  142

Query  903   ALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVG  724
              L++Q+KTRLIGPNCPGIIKPGECKIGIMPGYIH PG+IGIVSRSGTLTYEAVFQTT  G
Sbjct  143   TLQEQSKTRLIGPNCPGIIKPGECKIGIMPGYIHTPGKIGIVSRSGTLTYEAVFQTTNQG  202

Query  723   LGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEK  544
             LGQST VGIGGDPFNGTNFVDCLERFV DPQTEGI++IGEIGGTAEEEAA FIK SGT+K
Sbjct  203   LGQSTVVGIGGDPFNGTNFVDCLERFVKDPQTEGIIMIGEIGGTAEEEAAEFIKASGTQK  262

Query  543   PVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             PVV+FIAGLTAPPGRRMGHAGAI+SGGKG A DKI  L+ AGVTV  SPA++G+TM+ V 
Sbjct  263   PVVSFIAGLTAPPGRRMGHAGAIISGGKGRASDKIEALESAGVTVTRSPAQMGSTMMRVM  322

Query  363   TKRGL  349
              +RGL
Sbjct  323   RERGL  327



>gb|KDD74604.1| hypothetical protein H632_c1190p0 [Helicosporidium sp. ATCC 50920]
Length=326

 Score =   441 bits (1135),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 245/304 (81%), Positives = 271/304 (89%), Gaps = 2/304 (1%)
 Frame = -2

Query  1254  RLFGS-PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLP  1078
             RL+ S P P VFVDKNTRVICQG TGKNGTFH+EQA+ YGTKMVGGVTPKKGG+ HLGLP
Sbjct  24    RLYSSVPPPAVFVDKNTRVICQGFTGKNGTFHSEQAVAYGTKMVGGVTPKKGGSTHLGLP  83

Query  1077  VFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAAL  898
             VFN+V +AK  T ANA+VIYVPPPFA AAI+EA+EAELDLVVCITEG+PQHDMV+VK AL
Sbjct  84    VFNSVREAKEATNANATVIYVPPPFAAAAILEAVEAELDLVVCITEGVPQHDMVRVKQAL  143

Query  897   KQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLG  718
               ++KTRLIGPNCPGIIKPGECKIGIMPGYIH  GRIG+VSRSGTLTYEAV+QTTA GLG
Sbjct  144   -ARSKTRLIGPNCPGIIKPGECKIGIMPGYIHTKGRIGVVSRSGTLTYEAVYQTTAEGLG  202

Query  717   QSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPV  538
             QST VGIGGDPFNGTNFVDCLERFV DPQTEGI++IGEIGGTAEEEAA FI+ SGT+KPV
Sbjct  203   QSTVVGIGGDPFNGTNFVDCLERFVEDPQTEGIIMIGEIGGTAEEEAAEFIRASGTDKPV  262

Query  537   VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTK  358
             V+FIAGLTAPPGRRMGHAGAIVSGGKGTA DKI  L+ AGVTV +SPA++G  M  +F +
Sbjct  263   VSFIAGLTAPPGRRMGHAGAIVSGGKGTAADKIAALEAAGVTVSQSPAQMGAAMKRIFKE  322

Query  357   RGLL  346
             R LL
Sbjct  323   RNLL  326



>ref|XP_001416813.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95106.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=344

 Score =   437 bits (1123),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 235/297 (79%), Positives = 266/297 (90%), Gaps = 0/297 (0%)
 Frame = -2

Query  1236  APEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAD  1057
             +P VFVDKNTRVI QG TGKNGTFH+EQAI YGT++VGGVTP+KGGT HL LPVF+TV +
Sbjct  48    SPAVFVDKNTRVIVQGFTGKNGTFHSEQAIAYGTQVVGGVTPRKGGTTHLNLPVFDTVRE  107

Query  1056  AKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTR  877
             AK  TKANASVIYVPPPFA  A+MEA+EAE++LVVCITEGIPQHDMV+VK AL  Q+KTR
Sbjct  108   AKESTKANASVIYVPPPFAARAVMEAIEAEVELVVCITEGIPQHDMVRVKQALMSQSKTR  167

Query  876   LIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGI  697
             LIGPNCPGIIKPGECKIGIMPGYIHKPGR+G+VSRSGTLTYEAV+QTT  GLGQSTCVGI
Sbjct  168   LIGPNCPGIIKPGECKIGIMPGYIHKPGRVGVVSRSGTLTYEAVYQTTVAGLGQSTCVGI  227

Query  696   GGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGL  517
             GGDPFNGTNFVDCLE+FV DPQTEGI++IGEIGGTAEEEAA FI+ SGTEKP+V+FIAGL
Sbjct  228   GGDPFNGTNFVDCLEKFVKDPQTEGIIMIGEIGGTAEEEAAEFIRASGTEKPIVSFIAGL  287

Query  516   TAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             TAPPGRRMGHAGAI+SGGKG+A DKI  L+  GV V +SPAK+G  M ++F +R +L
Sbjct  288   TAPPGRRMGHAGAIISGGKGSAGDKIAALERVGVRVVKSPAKMGQAMYEMFGERNML  344



>ref|XP_001780609.1| predicted protein [Physcomitrella patens]
 gb|EDQ54592.1| predicted protein [Physcomitrella patens]
Length=299

 Score =   431 bits (1109),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 234/294 (80%), Positives = 261/294 (89%), Gaps = 0/294 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             VFVDK TR+I QGITGKNGTFHTEQAI YGT++VGGVTP KGGT+HLGLPVFNTVA+AK 
Sbjct  6     VFVDKATRLIVQGITGKNGTFHTEQAIAYGTQVVGGVTPNKGGTQHLGLPVFNTVAEAKQ  65

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
               +ANA+VIYVPP  A  AI+EA++AELDLVVCITEGIPQ DM +VKAAL  Q+KTRLIG
Sbjct  66    GVQANATVIYVPPKMACNAILEALDAELDLVVCITEGIPQQDMARVKAALLSQSKTRLIG  125

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTT VGLGQSTC+GIGGD
Sbjct  126   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTRVGLGQSTCIGIGGD  185

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             PF+GT+FVDCL  FV DPQTEG+VLIGEIGG+ EE+AA FI  SGT+KPVVAF+AGLTAP
Sbjct  186   PFSGTSFVDCLRCFVKDPQTEGVVLIGEIGGSGEEDAARFIVSSGTQKPVVAFVAGLTAP  245

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             PGRRMGHAGAI++GG+GTAQ K++ L+ AGVTV ESPA LG T+L VF  R LL
Sbjct  246   PGRRMGHAGAIIAGGRGTAQAKMKALRAAGVTVVESPAHLGKTILKVFRDRRLL  299



>ref|NP_001119263.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2 [Arabidopsis 
thaliana]
 gb|AED93142.1| Succinyl-CoA ligase [GDP-forming] subunit alpha-2 [Arabidopsis 
thaliana]
Length=297

 Score =   427 bits (1099),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 240/295 (81%), Positives = 256/295 (87%), Gaps = 7/295 (2%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRPITQS----PLWQQQQHRLFGS---PAPEVFVDKNTRVICQGI  1186
             M+ Q  RL+ ++       + S     L    Q R FG+   P   VFVDKNTRVICQGI
Sbjct  1     MSRQVTRLLGSLRHSGGGCSGSSKVCSLTSLVQSRSFGTTPPPPAAVFVDKNTRVICQGI  60

Query  1185  TGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPP  1006
             TGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFNTVA+AKAETKANASVIYVP P
Sbjct  61    TGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPAP  120

Query  1005  FagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKI  826
             FA AAIME + AELDL+VCITEGIPQHDMV+VKAAL  Q+KTRLIGPNCPGIIKPGECKI
Sbjct  121   FAAAAIMEGLAAELDLIVCITEGIPQHDMVRVKAALNSQSKTRLIGPNCPGIIKPGECKI  180

Query  825   GIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERF  646
             GIMPGYIHKPG+IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+F
Sbjct  181   GIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKF  240

Query  645   VADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAG  481
               DPQTEGIVLIGEIGGTAEE+AAA IKE+GT+KPVVAFIAGLTAPPGRRMGHAG
Sbjct  241   FVDPQTEGIVLIGEIGGTAEEDAAALIKENGTDKPVVAFIAGLTAPPGRRMGHAG  295



>ref|XP_002507022.1| succinate-coa ligase [Micromonas sp. RCC299]
 gb|ACO68280.1| succinate-coa ligase [Micromonas sp. RCC299]
Length=326

 Score =   427 bits (1097),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 243/296 (82%), Positives = 268/296 (91%), Gaps = 0/296 (0%)
 Frame = -2

Query  1233  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  1054
             P VFV+K+T+VICQG TGKNGTFH+EQAI YGT MVGGVTPKKGGT HLGLPVFNTVA+A
Sbjct  31    PAVFVNKHTKVICQGFTGKNGTFHSEQAIAYGTNMVGGVTPKKGGTTHLGLPVFNTVAEA  90

Query  1053  KAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRL  874
             KAET ANAS IYVPPPFA  AIMEAMEAE+DLVVCITEGIPQHDMV+VK AL +Q+KTRL
Sbjct  91    KAETGANASAIYVPPPFAAKAIMEAMEAEIDLVVCITEGIPQHDMVRVKQALMRQSKTRL  150

Query  873   IGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIG  694
             IGPNCPGIIKPGECKIGIMPGYIHKPGRIG+VSRSGTLTYEAVFQTT VGLGQSTCVGIG
Sbjct  151   IGPNCPGIIKPGECKIGIMPGYIHKPGRIGVVSRSGTLTYEAVFQTTQVGLGQSTCVGIG  210

Query  693   GDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLT  514
             GDPFNGT+FVDCLERFV D +TEGI++IGEIGG AEE+AA FIK SGT KPVV+FIAGLT
Sbjct  211   GDPFNGTDFVDCLERFVKDDETEGIIMIGEIGGNAEEQAAEFIKASGTTKPVVSFIAGLT  270

Query  513   APPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             APPGRRMGHAGAI++GGKG AQDKI  L+ AGVTV +SPA++G  M D+F +R +L
Sbjct  271   APPGRRMGHAGAIIAGGKGGAQDKINALESAGVTVVKSPAQMGNVMYDIFKERNML  326



>ref|XP_005643816.1| succinyl-CoA ligase alpha chain [Coccomyxa subellipsoidea C-169]
 gb|EIE19272.1| succinyl-CoA ligase alpha chain [Coccomyxa subellipsoidea C-169]
Length=299

 Score =   425 bits (1093),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 234/294 (80%), Positives = 262/294 (89%), Gaps = 1/294 (0%)
 Frame = -2

Query  1230  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  1051
             EV  DK T+VICQG TGKNGTFH+EQAI YGT+MVGGVTPKKGGT+HLGLPVF+TV +A 
Sbjct  6     EVSEDKTTKVICQGFTGKNGTFHSEQAIAYGTQMVGGVTPKKGGTKHLGLPVFDTVKEAV  65

Query  1050  AETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  871
             AET A ASVIYVPPPFA  AI+E ++A LDLVVCITEGIPQHDMVKVK  LK+ +KTRLI
Sbjct  66    AETGATASVIYVPPPFAAKAILEGVDAGLDLVVCITEGIPQHDMVKVKKVLKE-SKTRLI  124

Query  870   GPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGG  691
             GPNCPGIIKPGECKIGIMPGYIH+PG+IGIVSRSGTLTYEAVFQTT  GLGQST VGIGG
Sbjct  125   GPNCPGIIKPGECKIGIMPGYIHQPGKIGIVSRSGTLTYEAVFQTTQQGLGQSTVVGIGG  184

Query  690   DPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTA  511
             DPFNGTNFVDCLERF+ DPQTEGI++IGEIGGTAEEEAA  IK SGT+KP+++FIAGLTA
Sbjct  185   DPFNGTNFVDCLERFLKDPQTEGIIMIGEIGGTAEEEAAELIKASGTDKPILSFIAGLTA  244

Query  510   PPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGL  349
             PPGRRMGHAGAI+SGGKGTA DKI  L+ AGVTV +SPA++GT M  + ++RGL
Sbjct  245   PPGRRMGHAGAIISGGKGTATDKINALESAGVTVVKSPAQMGTAMKKIMSERGL  298



>gb|ERN09415.1| hypothetical protein AMTR_s00029p00055000 [Amborella trichopoda]
Length=314

 Score =   426 bits (1094),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 240/294 (82%), Positives = 258/294 (88%), Gaps = 25/294 (9%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             VFVDKNTRV                         GGVTPKKGGTEHLGLPVFN+VA+AKA
Sbjct  45    VFVDKNTRV-------------------------GGVTPKKGGTEHLGLPVFNSVAEAKA  79

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             ETKANASVIYVPPPFA AAIMEAMEAELDL+VCITEGIPQHDMV+VKAAL +Q+KTRLIG
Sbjct  80    ETKANASVIYVPPPFAAAAIMEAMEAELDLIVCITEGIPQHDMVRVKAALNKQSKTRLIG  139

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPGIIKPGECKIGIMPGYIHKPGR+GIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD
Sbjct  140   PNCPGIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  199

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             PFNGTNFVDC+++F+ DPQTEGIVLIGEIGGTAEE+AAA IKESGTEKPVVAFIAGLTAP
Sbjct  200   PFNGTNFVDCIKKFLEDPQTEGIVLIGEIGGTAEEDAAALIKESGTEKPVVAFIAGLTAP  259

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             PGRRMGHAGAIV+GGKGTAQDKI+TL+E G TV ESPAK+G  M +VF +RGLL
Sbjct  260   PGRRMGHAGAIVAGGKGTAQDKIKTLREVGATVVESPAKIGAAMHEVFKQRGLL  313



>gb|ACN28789.1| unknown [Zea mays]
Length=263

 Score =   422 bits (1085),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 233/262 (89%), Positives = 251/262 (96%), Gaps = 0/262 (0%)
 Frame = -2

Query  1131  MVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVV  952
             MVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANA+VIYVPPPFA AAIMEAMEAELDL V
Sbjct  1     MVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANATVIYVPPPFAAAAIMEAMEAELDLAV  60

Query  951   CITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSR  772
             CITEGIPQHDMVKVKAAL  Q+KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSR
Sbjct  61    CITEGIPQHDMVKVKAALNSQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSR  120

Query  771   SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  592
             SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGT
Sbjct  121   SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVNDPQTEGIVLIGEIGGT  180

Query  591   aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  412
             AEE+AA FI+ES T+KPVVAFIAGLTAPPGRRMGHAGAIV+GGKGTAQDKI+ L+EAGVT
Sbjct  181   AEEDAATFIQESKTQKPVVAFIAGLTAPPGRRMGHAGAIVAGGKGTAQDKIKALREAGVT  240

Query  411   VCESPAKLGTTMLDVFTKRGLL  346
             V ESPAK+G+TM ++F +RG++
Sbjct  241   VVESPAKIGSTMFEIFKQRGMV  262



>gb|EEC82322.1| hypothetical protein OsI_26601 [Oryza sativa Indica Group]
Length=432

 Score =   426 bits (1094),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 236/261 (90%), Positives = 253/261 (97%), Gaps = 0/261 (0%)
 Frame = -2

Query  1128  VGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVC  949
             VGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVPPPFA AAIMEAMEAELDLVVC
Sbjct  171   VGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDLVVC  230

Query  948   ITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRS  769
             ITEGIPQHDMVKVKAAL +Q+KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGR+GIVSRS
Sbjct  231   ITEGIPQHDMVKVKAALNKQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRVGIVSRS  290

Query  768   GTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggta  589
             GTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE+FV DPQTEGIVLIGEIGGTA
Sbjct  291   GTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLEKFVDDPQTEGIVLIGEIGGTA  350

Query  588   eeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTV  409
             EE+AAAFI+ES T+KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+ L+EAGVTV
Sbjct  351   EEDAAAFIQESKTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALREAGVTV  410

Query  408   CESPAKLGTTMLDVFTKRGLL  346
              ESPAK+G+TM ++F +RG+L
Sbjct  411   VESPAKIGSTMFEIFKQRGML  431



>ref|XP_011398589.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Auxenochlorella protothecoides]
 gb|KFM25693.1| Succinyl-CoA ligase [ADP-forming] subunit alpha-1, mitochondrial 
[Auxenochlorella protothecoides]
Length=321

 Score =   417 bits (1072),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 237/296 (80%), Positives = 265/296 (90%), Gaps = 0/296 (0%)
 Frame = -2

Query  1233  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  1054
             P VFVDK TRVI QG TGKNGTFH++QAI+YGT MVGGVTPKKGGT HLGLPVF+TVA+A
Sbjct  26    PAVFVDKTTRVIVQGFTGKNGTFHSQQAIDYGTNMVGGVTPKKGGTTHLGLPVFDTVAEA  85

Query  1053  KAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRL  874
             +A T A A+ IYVPPPFA AAIMEA+EAE+ L+VCITEGIPQHDMV+VK AL QQ+ +RL
Sbjct  86    RAATGATATAIYVPPPFAAAAIMEALEAEIPLIVCITEGIPQHDMVRVKKALSQQSASRL  145

Query  873   IGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIG  694
             IGPNCPGIIKPGECKIGIMPGYIH PGR+G+VSRSGTLTYEAVFQTT  GLGQST VGIG
Sbjct  146   IGPNCPGIIKPGECKIGIMPGYIHTPGRVGVVSRSGTLTYEAVFQTTQQGLGQSTVVGIG  205

Query  693   GDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLT  514
             GDPFNGTNFVDCLERFVADPQTEGI++IGEIGGTAEEEAA F++ SGT+KPVV+FIAGLT
Sbjct  206   GDPFNGTNFVDCLERFVADPQTEGIIMIGEIGGTAEEEAADFLRASGTDKPVVSFIAGLT  265

Query  513   APPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             APPGRRMGHAGAI+SGGKGTA DKI  L+ AGVTV +SPA++G  M  +F +RGLL
Sbjct  266   APPGRRMGHAGAIISGGKGTAGDKIAALEAAGVTVSQSPAQMGVAMKKLFEERGLL  321



>ref|XP_005843440.1| hypothetical protein CHLNCDRAFT_141133 [Chlorella variabilis]
 gb|EFN51338.1| hypothetical protein CHLNCDRAFT_141133 [Chlorella variabilis]
Length=330

 Score =   417 bits (1071),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 231/295 (78%), Positives = 258/295 (87%), Gaps = 0/295 (0%)
 Frame = -2

Query  1233  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  1054
             P VFVDK+T+VI QG TGKNGTFH+EQAI+YGT++VGGV PKKGGT HLGLPVF +V +A
Sbjct  35    PAVFVDKDTKVIVQGFTGKNGTFHSEQAIQYGTQVVGGVNPKKGGTTHLGLPVFASVREA  94

Query  1053  KAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRL  874
             K  T  +A+ IYVPPP A  AI+EA+EAELDLVVCITE IPQHDMV+VK  L +Q+KTRL
Sbjct  95    KEATGCHATAIYVPPPGAAKAILEAVEAELDLVVCITEAIPQHDMVRVKKVLSEQSKTRL  154

Query  873   IGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIG  694
             IGPNCPGIIKPGECKIGIMPGYIH PG+IGIVSRSGTLTYEAVFQTT  GLGQST VGIG
Sbjct  155   IGPNCPGIIKPGECKIGIMPGYIHTPGKIGIVSRSGTLTYEAVFQTTNEGLGQSTVVGIG  214

Query  693   GDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLT  514
             GDPFNGTNFVDCLERFV DPQTEGI++IGEIGG+AEEEAA F+  SGT KPVV+FIAGLT
Sbjct  215   GDPFNGTNFVDCLERFVLDPQTEGIIMIGEIGGSAEEEAAEFLIASGTTKPVVSFIAGLT  274

Query  513   APPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGL  349
             APPGRRMGHAGAI+SGGKGTAQDKI+ L+ AGVTV  SPA++G TM  V  +RGL
Sbjct  275   APPGRRMGHAGAIISGGKGTAQDKIKALEAAGVTVTNSPAQMGVTMKRVMQERGL  329



>gb|EYU45725.1| hypothetical protein MIMGU_mgv1a012075mg [Erythranthe guttata]
Length=262

 Score =   410 bits (1055),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 234/262 (89%), Positives = 251/262 (96%), Gaps = 0/262 (0%)
 Frame = -2

Query  1131  MVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVV  952
             MVGGVTP KGGTEHLGLPVFN+VA+AKAE KANASVIYVPPPFA  AIME++EAELDL+V
Sbjct  1     MVGGVTPGKGGTEHLGLPVFNSVAEAKAEAKANASVIYVPPPFAAKAIMESLEAELDLIV  60

Query  951   CITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSR  772
             CITEGIPQHDMV+VKAAL QQ+KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSR
Sbjct  61    CITEGIPQHDMVRVKAALNQQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSR  120

Query  771   SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  592
             SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCL +F+ DPQTEGIVLIGEIGGT
Sbjct  121   SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLRKFLVDPQTEGIVLIGEIGGT  180

Query  591   aeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  412
             AEE+AAA IKESGTEKP+VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI+TL+EAGVT
Sbjct  181   AEEDAAALIKESGTEKPIVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAGVT  240

Query  411   VCESPAKLGTTMLDVFTKRGLL  346
             V ESPAK+GT ML+VF +RGL+
Sbjct  241   VVESPAKIGTAMLEVFKQRGLV  262



>dbj|GAM28077.1| hypothetical protein SAMD00019534_112530 [Acytostelium subglobosum 
LB1]
Length=320

 Score =   411 bits (1056),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 229/293 (78%), Positives = 260/293 (89%), Gaps = 0/293 (0%)
 Frame = -2

Query  1233  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  1054
             P V +DKNT+VICQG TGK GTFH++QAIEYGTKMVGGV+P KGG+ HL LPVFNTVADA
Sbjct  27    PYVLIDKNTKVICQGFTGKQGTFHSQQAIEYGTKMVGGVSPGKGGSTHLQLPVFNTVADA  86

Query  1053  KAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRL  874
             K  T ANASVIYVPPP A AAI+EA+EAE++LVVCITEGIPQ DMV+VK+ L +QTKTRL
Sbjct  87    KKGTGANASVIYVPPPGAAAAIIEAIEAEMELVVCITEGIPQQDMVRVKSILNRQTKTRL  146

Query  873   IGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIG  694
             IGPNCPGIIKPGECKIGIMPG+IH+PG+IGIVSRSGTLTYEAV QTTAVGLGQSTCVGIG
Sbjct  147   IGPNCPGIIKPGECKIGIMPGHIHRPGKIGIVSRSGTLTYEAVAQTTAVGLGQSTCVGIG  206

Query  693   GDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLT  514
             GDPFNGTNFVDCL+ F  DPQTEGI+LIGEIGG AEEEAA +++++ T KPVV+FIAGLT
Sbjct  207   GDPFNGTNFVDCLKLFTQDPQTEGIILIGEIGGEAEEEAAQWLRDNPTNKPVVSFIAGLT  266

Query  513   APPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKR  355
             APPGRRMGHAGAI+SGGKG A  K++ L++AGV +  SPAKLGTTML+V   R
Sbjct  267   APPGRRMGHAGAIISGGKGGADSKMKALQDAGVVMSLSPAKLGTTMLEVMNSR  319



>ref|XP_004351803.1| succinate-CoA ligase [Dictyostelium fasciculatum]
 gb|EGG15083.1| succinate-CoA ligase [Dictyostelium fasciculatum]
Length=320

 Score =   408 bits (1048),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 228/318 (72%), Positives = 270/318 (85%), Gaps = 1/318 (0%)
 Frame = -2

Query  1305  KKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMV  1126
             KK + + +S + +Q   R + S  P V V+K+T+VICQG TGK GTFH++QAI+YGT+MV
Sbjct  2     KKRKMLARSSILRQAFVRGYAS-KPFVMVNKDTKVICQGFTGKQGTFHSQQAIDYGTQMV  60

Query  1125  GGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCI  946
             GGV+P KGG++HL LPVFN+V +AK  T ANASVIYVPPP+A  AI+EA+EAE++LVVCI
Sbjct  61    GGVSPGKGGSKHLDLPVFNSVKEAKKATDANASVIYVPPPYAAQAIIEAIEAEMELVVCI  120

Query  945   TEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSG  766
             TEGIPQ DMV+VK  L +Q KTRLIGPNCPGIIKPGECKIGIMPG+IH+PG+IGIVSRSG
Sbjct  121   TEGIPQQDMVRVKYLLNRQNKTRLIGPNCPGIIKPGECKIGIMPGHIHRPGKIGIVSRSG  180

Query  765   TLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtae  586
             TLTYEAV QTTAVGLGQSTCVGIGGDPFNGTNFVDCL+ F  DPQTEGI+LIGEIGG AE
Sbjct  181   TLTYEAVAQTTAVGLGQSTCVGIGGDPFNGTNFVDCLKLFTKDPQTEGIILIGEIGGEAE  240

Query  585   eeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVC  406
             EEAA ++KE+ T+KPVV+FIAGLTAPPGRRMGHAGAI+SGGKG A  K++ L++AGV + 
Sbjct  241   EEAALWLKENPTDKPVVSFIAGLTAPPGRRMGHAGAIISGGKGGADSKMKALQDAGVIMS  300

Query  405   ESPAKLGTTMLDVFTKRG  352
              SPAKLG TML+   K G
Sbjct  301   LSPAKLGVTMLEAMKKIG  318



>ref|XP_009775900.1| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-2, 
mitochondrial-like [Nicotiana sylvestris]
Length=251

 Score =   403 bits (1036),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 212/250 (85%), Positives = 225/250 (90%), Gaps = 11/250 (4%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRPIT-------QSPLWQQQQHRLFGSPAP--EVFVDKNTRVICQ  1192
             MA Q  RL++ +S K+ P +        SPLW Q  +R FGSP P   VFVDKNTRVICQ
Sbjct  1     MARQATRLVSKLSSKLSPNSPTISASPSSPLWHQ--YRYFGSPPPPPAVFVDKNTRVICQ  58

Query  1191  GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVP  1012
             GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV +AKAETKANASV+YVP
Sbjct  59    GITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVEEAKAETKANASVVYVP  118

Query  1011  PPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGEC  832
             PPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAALK+Q+KTRLIGPNCPGIIKPGEC
Sbjct  119   PPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALKKQSKTRLIGPNCPGIIKPGEC  178

Query  831   KIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE  652
             KIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE
Sbjct  179   KIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLE  238

Query  651   RFVADPQTEG  622
             +F+ADPQTEG
Sbjct  239   KFIADPQTEG  248



>emb|CBJ28950.1| Succinate--CoA ligase (GDP-forming), alpha subunit [Ectocarpus 
siliculosus]
Length=322

 Score =   406 bits (1043),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 219/299 (73%), Positives = 255/299 (85%), Gaps = 1/299 (0%)
 Frame = -2

Query  1242  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  1063
             S + +V++D+NT+VI QG TGK GTFH EQAIEYG++ VGGVTPKKGG  HLG PVFNTV
Sbjct  22    SSSAKVWIDQNTKVIVQGFTGKQGTFHAEQAIEYGSQYVGGVTPKKGGQTHLGKPVFNTV  81

Query  1062  ADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTK  883
             A+AK   K +ASV+YVPPPFAGAA+++A+E E+ LVVCITEGIPQ DM KVK AL+QQT 
Sbjct  82    AEAKEGVKPDASVVYVPPPFAGAAVLDAIENEIPLVVCITEGIPQKDMAKVKHALRQQTA  141

Query  882   TRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCV  703
             TRLIGPNCPGIIKPGECKIGIMPGYIHK G+IGIVSRSGTLTYEAV+QTT  G+GQSTCV
Sbjct  142   TRLIGPNCPGIIKPGECKIGIMPGYIHKKGKIGIVSRSGTLTYEAVWQTTVTGMGQSTCV  201

Query  702   GIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGT-EKPVVAFI  526
             GIGGDPFNGTNF+DCLERF  DP+TEGIV+IGEIGG AEE+AA ++ E G   KPVV+FI
Sbjct  202   GIGGDPFNGTNFIDCLERFTKDPETEGIVMIGEIGGQAEEDAAEWLMEHGDPAKPVVSFI  261

Query  525   AGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGL  349
             AG TAPPGRRMGHAGAI+SGGKGTA  K   L++AGV +  SPA+LG+TM+  F +RG+
Sbjct  262   AGSTAPPGRRMGHAGAIISGGKGTAAAKFAALEDAGVYISRSPAQLGSTMVRAFEERGM  320



>ref|XP_007512066.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66154.1| predicted protein [Bathycoccus prasinos]
Length=391

 Score =   407 bits (1045),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 224/294 (76%), Positives = 255/294 (87%), Gaps = 0/294 (0%)
 Frame = -2

Query  1233  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  1054
             P+VFV+K+T+V+CQG TGKNGTFH+EQAI+YGTK+VGGVTPKKGGT HL LPVFNTV +A
Sbjct  96    PKVFVNKDTKVVCQGFTGKNGTFHSEQAIKYGTKLVGGVTPKKGGTMHLNLPVFNTVREA  155

Query  1053  KAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRL  874
             K +T A+A+ IYVPPPFA +AI+EA+EAELDL+VCITEG+PQHDM++VK AL  Q+++RL
Sbjct  156   KEQTGASATSIYVPPPFAASAILEALEAELDLIVCITEGVPQHDMIRVKDALMSQSRSRL  215

Query  873   IGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIG  694
             IGPNCPGIIKPGECKIGIMPGYIHKPG+IGIVSRSGTLTYEAVFQTT  GLGQST VGIG
Sbjct  216   IGPNCPGIIKPGECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTEYGLGQSTVVGIG  275

Query  693   GDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLT  514
             GDPFNGTNFVDCLERFV D +TEGI++IGEIGGTAEEEAA FIK SGT KPVV FIAGLT
Sbjct  276   GDPFNGTNFVDCLERFVEDDETEGIIMIGEIGGTAEEEAAEFIKASGTNKPVVGFIAGLT  335

Query  513   APPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRG  352
             APPGRRMGHAGAI  G  GTA  KI  L++A V V  SPAK+G  M  +  + G
Sbjct  336   APPGRRMGHAGAITQGKAGTAIGKIEALEQASVNVVRSPAKMGEAMHRMMVELG  389



>ref|XP_009524111.1| hypothetical protein PHYSODRAFT_557468 [Phytophthora sojae]
 gb|EGZ21394.1| hypothetical protein PHYSODRAFT_557468 [Phytophthora sojae]
Length=316

 Score =   402 bits (1034),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 218/297 (73%), Positives = 253/297 (85%), Gaps = 1/297 (0%)
 Frame = -2

Query  1242  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  1063
             S + +V+++K+T+VICQG TGK GTFH++QAIEYGT MVGGVTPKKGG+ HLGLPVFNTV
Sbjct  19    SASAKVWINKDTKVICQGFTGKQGTFHSQQAIEYGTNMVGGVTPKKGGSTHLGLPVFNTV  78

Query  1062  ADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTK  883
             A+AK ET A+ASVIYVPPPF  A+I+EA+EAE+ LVV ITEGIPQ DMVKVK  L+ Q K
Sbjct  79    AEAKQETGADASVIYVPPPFCAASIIEAIEAEIPLVVAITEGIPQQDMVKVKWHLRNQNK  138

Query  882   TRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCV  703
             TRLIGPNCPGIIKPGECK+GIMPGYIH+ G+IGIVSRSGTLTYEAV QTTA+GLGQST +
Sbjct  139   TRLIGPNCPGIIKPGECKMGIMPGYIHQKGKIGIVSRSGTLTYEAVAQTTALGLGQSTVI  198

Query  702   GIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGT-EKPVVAFI  526
             GIGGDPFNGTNF+DCLERF  DP+TEGI+++GEIGG+AEEEAA ++   G   KPVV+FI
Sbjct  199   GIGGDPFNGTNFIDCLERFTNDPETEGIIMVGEIGGSAEEEAAEWLMAHGDPNKPVVSFI  258

Query  525   AGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKR  355
             AG TAPPGRRMGHAGAIVSGGKGTA  K   L+ AGV V  SPA+LG T+ +   KR
Sbjct  259   AGTTAPPGRRMGHAGAIVSGGKGTAAGKFAALEAAGVAVTRSPARLGATLFEEMKKR  315



>gb|KDO21510.1| succinyl-CoA ligase subunit alpha [Saprolegnia parasitica CBS 
223.65]
Length=312

 Score =   401 bits (1030),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 227/311 (73%), Positives = 266/311 (86%), Gaps = 2/311 (1%)
 Frame = -2

Query  1275  LWQQQQHRLFG-SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGG  1099
             + +Q +H +   S + +V+++K+T+VICQG TGK GTFH+EQAI YGT MVGGVTPKKGG
Sbjct  1     MLRQPKHAVRAMSASAKVWINKDTKVICQGFTGKQGTFHSEQAIAYGTNMVGGVTPKKGG  60

Query  1098  TEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDM  919
             T HLGLPVFNTVA+AK ET+A+ASVIYVPPPF  AAI++A+EAE+ L+V ITEGIPQ DM
Sbjct  61    TTHLGLPVFNTVAEAKKETQADASVIYVPPPFCAAAIIDAIEAEIPLIVAITEGIPQQDM  120

Query  918   VKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQ  739
             VKVK AL QQ  +RLIGPNCPGIIKPGECK+GIMPGYIH PG+IGIVSRSGTLTYEAV Q
Sbjct  121   VKVKWALAQQNISRLIGPNCPGIIKPGECKMGIMPGYIHTPGKIGIVSRSGTLTYEAVHQ  180

Query  738   TTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKE  559
             TT+ GLGQST +GIGGDPFNGT+F+DCLERF  DP+TEGI++IGEIGGTAEEEAA ++KE
Sbjct  181   TTSTGLGQSTVIGIGGDPFNGTDFIDCLERFTNDPETEGIIMIGEIGGTAEEEAAEWLKE  240

Query  558   SGT-EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGT  382
              G   KPVV+FIAG+TAPPGRRMGHAGAIVSGGKGTA+ K   L+ AGVTV  SP++LGT
Sbjct  241   FGNPNKPVVSFIAGITAPPGRRMGHAGAIVSGGKGTAEGKFAALEGAGVTVTRSPSRLGT  300

Query  381   TMLDVFTKRGL  349
             TML    +RGL
Sbjct  301   TMLQQMARRGL  311



>ref|XP_003054766.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60018.1| predicted protein [Micromonas pusilla CCMP1545]
Length=312

 Score =   401 bits (1030),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 233/296 (79%), Positives = 260/296 (88%), Gaps = 0/296 (0%)
 Frame = -2

Query  1233  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  1054
             P VFVDK+T+V+ QG TGKNGTFH++QAI YGT+MVGGVTPKKGG+ HLGLPVFNTVA+A
Sbjct  17    PAVFVDKDTKVLVQGFTGKNGTFHSQQAIAYGTRMVGGVTPKKGGSTHLGLPVFNTVAEA  76

Query  1053  KAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRL  874
             K  T ANAS IYVPPPFA  AI+EA+EAELDLVVCITEGIPQHDM++VK A+  Q+KTRL
Sbjct  77    KTATGANASAIYVPPPFAAKAILEAVEAELDLVVCITEGIPQHDMIRVKQAMMTQSKTRL  136

Query  873   IGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIG  694
             IGPNCPGIIKPGECKIGIMPGYIH PGRIG+VSRSGTLTYEAV+QTTA GLGQST VGIG
Sbjct  137   IGPNCPGIIKPGECKIGIMPGYIHTPGRIGVVSRSGTLTYEAVYQTTACGLGQSTVVGIG  196

Query  693   GDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLT  514
             GDPFNGTNFVDCLE+FV D QTEGI++IGEIGGTAEEEAA FIK SGT KPVV+FIAGLT
Sbjct  197   GDPFNGTNFVDCLEKFVKDDQTEGIIMIGEIGGTAEEEAAEFIKASGTTKPVVSFIAGLT  256

Query  513   APPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRGLL  346
             APPGRRMGHAGAI++GGKG A DKI  LK AGVTV  SPA +G  M  +F +R ++
Sbjct  257   APPGRRMGHAGAIIAGGKGGAGDKIAALKAAGVTVVPSPAGMGEAMHQIFKERKMV  312



>ref|XP_002610474.1| hypothetical protein BRAFLDRAFT_124275 [Branchiostoma floridae]
 gb|EEN66484.1| hypothetical protein BRAFLDRAFT_124275 [Branchiostoma floridae]
Length=323

 Score =   401 bits (1031),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 220/312 (71%), Positives = 256/312 (82%), Gaps = 3/312 (1%)
 Frame = -2

Query  1275  LWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGT  1096
             L Q      + +  P + + K+T+VICQG TGK GTFH++Q+IEYG++MVGGV+P KGG 
Sbjct  12    LQQLGVRHCYTATRPNIAIGKDTKVICQGFTGKQGTFHSQQSIEYGSQMVGGVSPGKGGK  71

Query  1095  EHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMV  916
              HLGLPVFN+VA+AK  T A ASVIYVPPPFAG AI+EA+ AE+ LVVCITEGIPQ DMV
Sbjct  72    THLGLPVFNSVAEAKEATGAVASVIYVPPPFAGKAILEAINAEMSLVVCITEGIPQQDMV  131

Query  915   KVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQT  736
             KVK  L +Q KTRLIGPNCPGIIKPGECKIGIMPG+IH+PG IGIVSRSGTLTYEAV QT
Sbjct  132   KVKHRLVRQDKTRLIGPNCPGIIKPGECKIGIMPGHIHQPGNIGIVSRSGTLTYEAVHQT  191

Query  735   TAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKES  556
             T  GLGQ+ C+GIGGDPFNGTNFVDCLE F+ DP T+GIV+IGEIGG+ EE AA ++KE 
Sbjct  192   TRAGLGQTLCIGIGGDPFNGTNFVDCLEVFLGDPATKGIVMIGEIGGSMEESAAEYLKEH  251

Query  555   GT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLG  385
              T   +KPVV+FIAG+TAPPGRRMGHAGAI+SGGKG AQDKI+ L+EAGV V  SPA++G
Sbjct  252   NTGPNKKPVVSFIAGVTAPPGRRMGHAGAIISGGKGAAQDKIQALQEAGVEVTMSPAQMG  311

Query  384   TTMLDVFTKRGL  349
             TTML    K GL
Sbjct  312   TTMLQEMQKLGL  323



>ref|XP_008905429.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica INRA-310]
 gb|ETI47142.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica P1569]
 gb|ETK87077.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica]
 gb|ETL40492.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica]
 gb|ETL93622.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica]
 gb|ETM46890.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica]
 gb|ETN09596.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica INRA-310]
 gb|ETO75838.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica P1976]
 gb|ETP16936.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica CJ01A1]
Length=318

 Score =   400 bits (1028),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 216/297 (73%), Positives = 253/297 (85%), Gaps = 1/297 (0%)
 Frame = -2

Query  1242  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  1063
             S + +V+++K+T+VICQG TGK GTFH++QAIEYGT MVGGVTPKKGG+ HLGLPVFNTV
Sbjct  21    SASAKVWINKDTKVICQGFTGKQGTFHSQQAIEYGTNMVGGVTPKKGGSTHLGLPVFNTV  80

Query  1062  ADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTK  883
             A+AK ET A+ASVIYVPPPF  A+I+EA+EAE+ LVV ITEGIPQ DMVKVK  L+ Q+ 
Sbjct  81    AEAKKETGADASVIYVPPPFCAASIIEAIEAEIPLVVAITEGIPQQDMVKVKWHLRNQST  140

Query  882   TRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCV  703
             TRLIGPNCPGIIKPGECK+GIMPGYIH+ G++GIVSRSGTLTYEAV QTTA+GLGQST +
Sbjct  141   TRLIGPNCPGIIKPGECKMGIMPGYIHQKGKVGIVSRSGTLTYEAVAQTTALGLGQSTVI  200

Query  702   GIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGT-EKPVVAFI  526
             GIGGDPFNGTNF+DCLERF  DP+TEGI+++GEIGG+AEEEAA ++   G   KPVV+FI
Sbjct  201   GIGGDPFNGTNFIDCLERFTNDPETEGIIMVGEIGGSAEEEAAEWLMAHGDPNKPVVSFI  260

Query  525   AGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKR  355
             AG TAPPGRRMGHAGAIVSGGKGTA  K   L+ AGV V  SPA+LG T+ +   KR
Sbjct  261   AGTTAPPGRRMGHAGAIVSGGKGTAAGKFAALEAAGVAVTRSPARLGVTLYEEMQKR  317



>ref|XP_002908607.1| succinyl-CoA ligase subunit alpha, mitochondrial precursor [Phytophthora 
infestans T30-4]
 gb|EEY61690.1| succinyl-CoA ligase subunit alpha, mitochondrial precursor [Phytophthora 
infestans T30-4]
Length=339

 Score =   400 bits (1029),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 216/297 (73%), Positives = 253/297 (85%), Gaps = 1/297 (0%)
 Frame = -2

Query  1242  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  1063
             S + +V+++K+T+VICQG TGK GTFH++QAIEYGT MVGGVTPKKGG+ HLGLPVFNTV
Sbjct  42    SASAKVWINKDTKVICQGFTGKQGTFHSQQAIEYGTNMVGGVTPKKGGSTHLGLPVFNTV  101

Query  1062  ADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTK  883
             A+AK ET A+ASVIYVPPPF  A+I+EA+EA++ LVV ITEGIPQ DMVKVK  L+ Q+ 
Sbjct  102   AEAKKETGADASVIYVPPPFCAASIIEAIEAKIPLVVAITEGIPQQDMVKVKWHLRNQST  161

Query  882   TRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCV  703
             TRLIGPNCPGIIKPGECK+GIMPGYIH+ G+IGIVSRSGTLTYEAV QTTA+GLGQST +
Sbjct  162   TRLIGPNCPGIIKPGECKMGIMPGYIHQKGKIGIVSRSGTLTYEAVAQTTALGLGQSTVI  221

Query  702   GIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGT-EKPVVAFI  526
             GIGGDPFNGTNF+DCLERF  DP+TEGI+++GEIGG+AEEEAA ++   G   KPVV+FI
Sbjct  222   GIGGDPFNGTNFIDCLERFTNDPETEGIIMVGEIGGSAEEEAAEWLMAHGDPNKPVVSFI  281

Query  525   AGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKR  355
             AG TAPPGRRMGHAGAIVSGGKGTA  K   L+ AGV V  SPA+LG T+ +   KR
Sbjct  282   AGTTAPPGRRMGHAGAIVSGGKGTAAGKFAALEAAGVAVTRSPARLGVTLYEEMQKR  338



>ref|XP_008608930.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Saprolegnia diclina VS20]
 gb|EQC37410.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Saprolegnia diclina VS20]
Length=312

 Score =   399 bits (1025),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 226/311 (73%), Positives = 265/311 (85%), Gaps = 2/311 (1%)
 Frame = -2

Query  1275  LWQQQQHRLFG-SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGG  1099
             + +Q +H +   S + +V+++K+T+VICQG TGK GTFH+EQAI YGT MVGGVTPKKGG
Sbjct  1     MLRQPKHAVRAMSASAKVWINKDTKVICQGFTGKQGTFHSEQAIAYGTNMVGGVTPKKGG  60

Query  1098  TEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDM  919
             T HLGLPVFNTVA+AK  T+A+ASVIYVPPPF  AAI++A+EAE+ L+V ITEGIPQ DM
Sbjct  61    TTHLGLPVFNTVAEAKTATQADASVIYVPPPFCAAAIIDAIEAEIPLIVAITEGIPQQDM  120

Query  918   VKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQ  739
             VKVK AL QQ  +RLIGPNCPGIIKPGECK+GIMPGYIH PG+IGIVSRSGTLTYEAV Q
Sbjct  121   VKVKWALAQQNISRLIGPNCPGIIKPGECKMGIMPGYIHTPGKIGIVSRSGTLTYEAVHQ  180

Query  738   TTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKE  559
             TT+ GLGQST +GIGGDPFNGT+F+DCLERF  DP+TEGI++IGEIGGTAEEEAA ++KE
Sbjct  181   TTSTGLGQSTVIGIGGDPFNGTDFIDCLERFTNDPETEGIIMIGEIGGTAEEEAAEWLKE  240

Query  558   SGT-EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGT  382
              G   KPVV+FIAG+TAPPGRRMGHAGAIVSGGKGTA+ K   L+ AGVTV  SP++LGT
Sbjct  241   FGNPNKPVVSFIAGITAPPGRRMGHAGAIVSGGKGTAEGKFAALEGAGVTVTRSPSRLGT  300

Query  381   TMLDVFTKRGL  349
             TML    +RGL
Sbjct  301   TMLQQMARRGL  311



>ref|XP_005837665.1| hypothetical protein GUITHDRAFT_157241 [Guillardia theta CCMP2712]
 gb|EKX50685.1| hypothetical protein GUITHDRAFT_157241 [Guillardia theta CCMP2712]
Length=297

 Score =   399 bits (1024),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 216/295 (73%), Positives = 245/295 (83%), Gaps = 0/295 (0%)
 Frame = -2

Query  1242  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  1063
             S  P  FV+K+TRVICQG TG  GTFH+EQ+I YGTKMVGGVTPKKGGT HLGLPVFNTV
Sbjct  2     SQRPPPFVNKDTRVICQGFTGSQGTFHSEQSIAYGTKMVGGVTPKKGGTTHLGLPVFNTV  61

Query  1062  ADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTK  883
              +AK   K +ASVIYVPPPFA  A ++A+EAE+ LVV ITEGIPQ DMV+VK AL   TK
Sbjct  62    REAKEAVKPDASVIYVPPPFAMRAALDAIEAEIPLVVVITEGIPQQDMVRVKHALNMSTK  121

Query  882   TRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCV  703
             TR+IGPNCPGIIKPGECK+GIMPGYIH  G+IGIVSRSGTLTYEAV+QTT +GLGQS  V
Sbjct  122   TRMIGPNCPGIIKPGECKMGIMPGYIHSKGKIGIVSRSGTLTYEAVYQTTQMGLGQSIVV  181

Query  702   GIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIA  523
             GIGGDPFNGT+  DC+E F+ DP TEGIVLIGEIGG++EEEAA  +K S  +KP V+FIA
Sbjct  182   GIGGDPFNGTSHKDCVEFFLQDPDTEGIVLIGEIGGSSEEEAAEVMKNSKIKKPAVSFIA  241

Query  522   GLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTK  358
             GLTAPPGRRMGHAGAI+SGGKGTAQDKI+ L+ AGV V  SPAK+G TM+    K
Sbjct  242   GLTAPPGRRMGHAGAIISGGKGTAQDKIKALESAGVYVTNSPAKIGETMMKAMGK  296



>gb|ETP44985.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Phytophthora parasitica P10297]
Length=318

 Score =   399 bits (1025),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 215/297 (72%), Positives = 253/297 (85%), Gaps = 1/297 (0%)
 Frame = -2

Query  1242  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  1063
             S + +V+++K+T+VICQG TGK GTFH++QAIEYGT MVGGVTPKKGG+ HLGLPVFNTV
Sbjct  21    SASAKVWINKDTKVICQGFTGKQGTFHSQQAIEYGTNMVGGVTPKKGGSTHLGLPVFNTV  80

Query  1062  ADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTK  883
             A+AK +T A+ASVIYVPPPF  A+I+EA+EAE+ LVV ITEGIPQ DMVKVK  L+ Q+ 
Sbjct  81    AEAKKDTGADASVIYVPPPFCAASIIEAIEAEIPLVVAITEGIPQQDMVKVKWHLRNQST  140

Query  882   TRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCV  703
             TRLIGPNCPGIIKPGECK+GIMPGYIH+ G++GIVSRSGTLTYEAV QTTA+GLGQST +
Sbjct  141   TRLIGPNCPGIIKPGECKMGIMPGYIHQKGKVGIVSRSGTLTYEAVAQTTALGLGQSTVI  200

Query  702   GIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGT-EKPVVAFI  526
             GIGGDPFNGTNF+DCLERF  DP+TEGI+++GEIGG+AEEEAA ++   G   KPVV+FI
Sbjct  201   GIGGDPFNGTNFIDCLERFTNDPETEGIIMVGEIGGSAEEEAAEWLMAHGDPNKPVVSFI  260

Query  525   AGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKR  355
             AG TAPPGRRMGHAGAIVSGGKGTA  K   L+ AGV V  SPA+LG T+ +   KR
Sbjct  261   AGTTAPPGRRMGHAGAIVSGGKGTAAGKFAALEAAGVAVTRSPARLGVTLYEEMQKR  317



>ref|XP_636263.1| succinate-CoA ligase [Dictyostelium discoideum AX4]
 sp|P36967.3|SUCA_DICDI RecName: Full=Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial; AltName: Full=Succinyl-CoA synthetase subunit 
alpha; Short=SCS-alpha; AltName: Full=p36; Flags: Precursor 
[Dictyostelium discoideum]
 gb|EAL62749.1| succinate-CoA ligase [Dictyostelium discoideum AX4]
Length=315

 Score =   396 bits (1018),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 221/300 (74%), Positives = 254/300 (85%), Gaps = 0/300 (0%)
 Frame = -2

Query  1254  RLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPV  1075
             + F S  P V ++K+T+VICQG TG  GTFH++QAIEYGT MVGGV+P KGG +HL LPV
Sbjct  13    KRFFSTKPSVLINKHTKVICQGFTGNQGTFHSKQAIEYGTNMVGGVSPGKGGQKHLDLPV  72

Query  1074  FNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALK  895
             FNTV +AK  T ANA+VIYVPPP A AAI EA++AE++LVVCITEGIPQ DMVKVK  L 
Sbjct  73    FNTVKEAKEATGANATVIYVPPPHAAAAIKEAIDAEMELVVCITEGIPQQDMVKVKYLLN  132

Query  894   QQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQ  715
             +Q KTRLIGPNCPGIIKPGECKIGIMPG+IHKPG+IGIVSRSGTLTYEAV QTTAVGLGQ
Sbjct  133   KQNKTRLIGPNCPGIIKPGECKIGIMPGHIHKPGKIGIVSRSGTLTYEAVAQTTAVGLGQ  192

Query  714   STCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVV  535
             STC+GIGGDPFNGTNF+DCL+ F  DPQTEGI+LIGEIGG AEEEAA ++ ++ T+KPVV
Sbjct  193   STCIGIGGDPFNGTNFIDCLKMFTQDPQTEGIILIGEIGGEAEEEAAQWLIDNPTDKPVV  252

Query  534   AFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKR  355
             +FIAGL+APPGRRMGHAGAI+SGGKG A  KI  LK AGVTV  SPAKLG T+L    ++
Sbjct  253   SFIAGLSAPPGRRMGHAGAIISGGKGDANSKIEALKAAGVTVTFSPAKLGETILQKMNEK  312



>gb|AAA85724.1| succinyl coenzyme A synthetase alpha subunit [Dictyostelium discoideum 
AX2]
Length=310

 Score =   395 bits (1015),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 221/294 (75%), Positives = 251/294 (85%), Gaps = 0/294 (0%)
 Frame = -2

Query  1254  RLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPV  1075
             + F S  P V ++KNT+VICQG TG  GTFH++QAIEYGT MVGGV+P KGG +HL LP 
Sbjct  13    KRFFSTKPSVLINKNTKVICQGFTGNQGTFHSKQAIEYGTNMVGGVSPGKGGQKHLDLPA  72

Query  1074  FNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALK  895
             FNTV +AK  T ANA+VIYVPPP A AAI EA++AE++LVVCITEGIPQ DMVKVK  L 
Sbjct  73    FNTVKEAKEATGANATVIYVPPPHAAAAIKEAIDAEMELVVCITEGIPQQDMVKVKYLLN  132

Query  894   QQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQ  715
             +Q KTRLIGPNCPGIIKPGECKIGIMPG+IHKPG+IGIVSRSGTLTYEAV QTTAVGLGQ
Sbjct  133   KQNKTRLIGPNCPGIIKPGECKIGIMPGHIHKPGKIGIVSRSGTLTYEAVAQTTAVGLGQ  192

Query  714   STCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVV  535
             STC+GIGGDPFNGTNF+DCL+ F  DPQTEGI+LIGEIGG AEEEAA ++ ++ T+KPVV
Sbjct  193   STCIGIGGDPFNGTNFIDCLKMFTQDPQTEGIILIGEIGGEAEEEAAQWLIDNPTDKPVV  252

Query  534   AFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTML  373
             +FIAGL+APPGRRMGHAGAI+SGGKG A  KI  LK AGVTV  SPAKLG T+L
Sbjct  253   SFIAGLSAPPGRRMGHAGAIISGGKGDANSKIEALKAAGVTVTFSPAKLGETIL  306



>gb|ABW76150.1| succinyl-CoA synthetase alpha subunit [Blastocystis sp. NandII]
 gb|ABY62723.1| mitochondrial succinyl-CoA synthetase alpha subunit [Blastocystis 
sp. ATCC 50177]
Length=318

 Score =   395 bits (1014),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 216/298 (72%), Positives = 246/298 (83%), Gaps = 1/298 (0%)
 Frame = -2

Query  1242  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  1063
             S    V+VDKNTRVI QGITGKNGTFHT+QAIEYGTKMVGGV PKK GT HLGLP+F +V
Sbjct  19    SSTARVWVDKNTRVIGQGITGKNGTFHTQQAIEYGTKMVGGVNPKKAGTTHLGLPIFASV  78

Query  1062  ADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTK  883
              +AK  T A+A+VIYVPP  A  AI+EA+ AE+ L+VCITEGIPQHDM++VK  +K Q K
Sbjct  79    EEAKKATNADATVIYVPPSGAAGAILEAVAAEIPLIVCITEGIPQHDMLRVKDIMKSQNK  138

Query  882   TRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCV  703
             +RLIGPNCPGIIKP ECKIGIMPGYIHK G+IGIVSRSGTLTYEAV QTT  GLGQST V
Sbjct  139   SRLIGPNCPGIIKPEECKIGIMPGYIHKKGKIGIVSRSGTLTYEAVHQTTMYGLGQSTVV  198

Query  702   GIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGT-EKPVVAFI  526
             GIGGDPFNGTNF+DCLERF  DPQTEGIV+IGEIGGTAEE+AA ++K+ G   KPVV+FI
Sbjct  199   GIGGDPFNGTNFIDCLERFTNDPQTEGIVMIGEIGGTAEEDAAEWLKQYGNPNKPVVSFI  258

Query  525   AGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRG  352
             AG TAPPGRRMGHAGAI+SGGKGTA+ K+  L  AGV V E+PA +G  M ++    G
Sbjct  259   AGRTAPPGRRMGHAGAIISGGKGTAKAKMEALTSAGVKVVETPAMIGEAMFNMMKAAG  316



>ref|XP_003294260.1| succinyl coenzyme A synthetase alpha subunit [Dictyostelium purpureum]
 gb|EGC29214.1| succinyl coenzyme A synthetase alpha subunit [Dictyostelium purpureum]
Length=312

 Score =   394 bits (1013),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 218/293 (74%), Positives = 251/293 (86%), Gaps = 0/293 (0%)
 Frame = -2

Query  1248  FGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN  1069
             F S  P V +DKNT+VICQG TG  GTFH++QAIEYGT+MVGGV+P KGG +HL LPVFN
Sbjct  12    FFSTKPHVLIDKNTKVICQGFTGNQGTFHSKQAIEYGTQMVGGVSPGKGGQKHLELPVFN  71

Query  1068  TVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQ  889
             TV +AK +T ANA+VIYVPPPFA AAI EA++A+++L+VCITEGIPQ DMVKVK  L ++
Sbjct  72    TVQEAKQQTGANATVIYVPPPFAAAAIKEAIDADMELIVCITEGIPQQDMVKVKKYLNEK  131

Query  888   TKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQST  709
               TRLIGPNCPGIIKPGECKIGIMPG+IHK G+IGIVSRSGTLTYEAV QTTAVGLGQST
Sbjct  132   PTTRLIGPNCPGIIKPGECKIGIMPGHIHKKGKIGIVSRSGTLTYEAVAQTTAVGLGQST  191

Query  708   CVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAF  529
             C+GIGGDPFNGTNFVDCL+ F  DPQTEGI+LIGEIGG AEEEAA ++ ++ T+KPVV+F
Sbjct  192   CIGIGGDPFNGTNFVDCLKMFTKDPQTEGIILIGEIGGEAEEEAAQWLIDNPTDKPVVSF  251

Query  528   IAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLD  370
             IAG +APPGRRMGHAGAI+SGGKG A  KI  LK AGVT+  SPAKLG  ML+
Sbjct  252   IAGTSAPPGRRMGHAGAIISGGKGDANSKINALKAAGVTISPSPAKLGEAMLE  304



>ref|XP_008871215.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Aphanomyces invadans]
 gb|ETW00190.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Aphanomyces invadans]
Length=312

 Score =   393 bits (1010),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 221/308 (72%), Positives = 254/308 (82%), Gaps = 1/308 (0%)
 Frame = -2

Query  1275  LWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGT  1096
             L +Q Q     S + +V+++K+T+VICQG TGK GTFH+EQAI YGT  VGGVTPKKGGT
Sbjct  2     LSRQTQAVRRMSASAKVWINKDTKVICQGFTGKQGTFHSEQAIAYGTNYVGGVTPKKGGT  61

Query  1095  EHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMV  916
              HLGLPVFNTV +AK E  A AS+IYVPPP+   AI++A+ AE+ L+V ITEGIPQ DMV
Sbjct  62    THLGLPVFNTVQEAKDEVGAEASIIYVPPPYCAQAIIDAIHAEIPLIVAITEGIPQQDMV  121

Query  915   KVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQT  736
             KVK  LKQQ  +RLIGPNCPGIIKPGECK+GIMPGYIH  G+IGIVSRSGTLTYEAV QT
Sbjct  122   KVKWHLKQQKTSRLIGPNCPGIIKPGECKMGIMPGYIHSKGKIGIVSRSGTLTYEAVHQT  181

Query  735   TAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKES  556
             T  GLGQST +GIGGDPFNGTNF+DCLERF  DP+TEGI++IGEIGGTAEEEAA ++ E 
Sbjct  182   TTTGLGQSTVIGIGGDPFNGTNFIDCLERFTNDPETEGIIMIGEIGGTAEEEAAEWLMEH  241

Query  555   GT-EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTT  379
             G   KPVV+FIAG+TAPPGRRMGHAGAIVSGGKGTA+ K   L++AGVTV  SPA+LGTT
Sbjct  242   GDPNKPVVSFIAGITAPPGRRMGHAGAIVSGGKGTAEGKFAALEKAGVTVTRSPARLGTT  301

Query  378   MLDVFTKR  355
             ML  F KR
Sbjct  302   MLQQFAKR  309



>gb|KJB31856.1| hypothetical protein B456_005G211200 [Gossypium raimondii]
Length=288

 Score =   391 bits (1004),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 232/285 (81%), Positives = 250/285 (88%), Gaps = 12/285 (4%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRP---------ITQSPLWQQQQHRLFGS---PAPEVFVDKNTRV  1201
             MA Q +RLI ++S ++ P          + S      Q R F +   P P VFVDKNTRV
Sbjct  1     MARQASRLIQSLSSRISPHKPQLSPLTPSSSSSQLLTQSRSFSAAPAPQPAVFVDKNTRV  60

Query  1200  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  1021
             ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVI
Sbjct  61    ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVI  120

Query  1020  YVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKP  841
             YVPP FA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL QQ+KTRLIGPNCPGIIKP
Sbjct  121   YVPPAFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNQQSKTRLIGPNCPGIIKP  180

Query  840   GECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD  661
             GECKIGIMPGYIHKPGR+GIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD
Sbjct  181   GECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD  240

Query  660   CLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFI  526
             C+ +F+ADPQTEGI+LIGEIGGTAEE+AAA IKESGTEKP+VAFI
Sbjct  241   CVTKFLADPQTEGIILIGEIGGTAEEDAAALIKESGTEKPIVAFI  285



>gb|KJB79847.1| hypothetical protein B456_013G069200 [Gossypium raimondii]
Length=268

 Score =   389 bits (999),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 201/242 (83%), Positives = 214/242 (88%), Gaps = 5/242 (2%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRPITQSPLWQQQQHRLFGS---PAPEVFVDKNTRVICQGITGKN  1174
             MA Q +RL+ ++S +        L   Q  R F +   P P VFVDKNTRVICQGITGKN
Sbjct  1     MARQASRLLRSLSSQFS--HHKSLLSPQHSRSFSAAPAPQPAVFVDKNTRVICQGITGKN  58

Query  1173  GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFaga  994
             GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVIYVPPPFA  
Sbjct  59    GTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVIYVPPPFAAP  118

Query  993   aimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMP  814
             AIMEAMEAELDLVVCITEGIPQHDMV+VKAAL QQ+KTRLIGPNCPGIIKPGECKIGIMP
Sbjct  119   AIMEAMEAELDLVVCITEGIPQHDMVRVKAALNQQSKTRLIGPNCPGIIKPGECKIGIMP  178

Query  813   GYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADP  634
             GYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+ +F+ADP
Sbjct  179   GYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTKFLADP  238

Query  633   QT  628
             QT
Sbjct  239   QT  240



>emb|CCI47060.1| unnamed protein product [Albugo candida]
Length=301

 Score =   390 bits (1002),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 214/297 (72%), Positives = 253/297 (85%), Gaps = 1/297 (0%)
 Frame = -2

Query  1242  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  1063
             S + +V+++K T+VICQG TGK GTFH+EQAI YGTKMVGGVTPKKGG+ HLGLPVFNTV
Sbjct  2     STSAKVWINKETKVICQGFTGKQGTFHSEQAISYGTKMVGGVTPKKGGSTHLGLPVFNTV  61

Query  1062  ADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTK  883
             ++AK  T A+ASVIYVPPPF   AI++A+EAE+ L+V ITEGIPQ DMV+VK  L+QQ  
Sbjct  62    SEAKRATNADASVIYVPPPFCAQAIIDAIEAEIPLIVAITEGIPQQDMVRVKWHLRQQKV  121

Query  882   TRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCV  703
             TRLIGPNCPGIIKPGECK+GIMPGYIH+ G+IGIVSRSGTLTYEAV QTT+ GLGQST +
Sbjct  122   TRLIGPNCPGIIKPGECKMGIMPGYIHQKGKIGIVSRSGTLTYEAVAQTTSTGLGQSTVI  181

Query  702   GIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGT-EKPVVAFI  526
             GIGGDPFNGTNF+DCLERF  DP+TEGI++IGEIGG+AEEEAA ++++ G   KPVV+FI
Sbjct  182   GIGGDPFNGTNFIDCLERFTNDPETEGIIMIGEIGGSAEEEAADWLQQYGDRNKPVVSFI  241

Query  525   AGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKR  355
             AG+TAPPGRRMGHAGAIVSGGKGTA+ K R L+ AGV V  SPA+LG  M ++   R
Sbjct  242   AGMTAPPGRRMGHAGAIVSGGKGTAEGKFRALEAAGVAVTRSPARLGELMAELMKDR  298



>emb|CCI47059.1| unnamed protein product [Albugo candida]
Length=322

 Score =   390 bits (1002),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 214/297 (72%), Positives = 253/297 (85%), Gaps = 1/297 (0%)
 Frame = -2

Query  1242  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  1063
             S + +V+++K T+VICQG TGK GTFH+EQAI YGTKMVGGVTPKKGG+ HLGLPVFNTV
Sbjct  23    STSAKVWINKETKVICQGFTGKQGTFHSEQAISYGTKMVGGVTPKKGGSTHLGLPVFNTV  82

Query  1062  ADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTK  883
             ++AK  T A+ASVIYVPPPF   AI++A+EAE+ L+V ITEGIPQ DMV+VK  L+QQ  
Sbjct  83    SEAKRATNADASVIYVPPPFCAQAIIDAIEAEIPLIVAITEGIPQQDMVRVKWHLRQQKV  142

Query  882   TRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCV  703
             TRLIGPNCPGIIKPGECK+GIMPGYIH+ G+IGIVSRSGTLTYEAV QTT+ GLGQST +
Sbjct  143   TRLIGPNCPGIIKPGECKMGIMPGYIHQKGKIGIVSRSGTLTYEAVAQTTSTGLGQSTVI  202

Query  702   GIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTE-KPVVAFI  526
             GIGGDPFNGTNF+DCLERF  DP+TEGI++IGEIGG+AEEEAA ++++ G   KPVV+FI
Sbjct  203   GIGGDPFNGTNFIDCLERFTNDPETEGIIMIGEIGGSAEEEAADWLQQYGDRNKPVVSFI  262

Query  525   AGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKR  355
             AG+TAPPGRRMGHAGAIVSGGKGTA+ K R L+ AGV V  SPA+LG  M ++   R
Sbjct  263   AGMTAPPGRRMGHAGAIVSGGKGTAEGKFRALEAAGVAVTRSPARLGELMAELMKDR  319



>ref|WP_028099766.1| succinate--CoA ligase [Dongia sp. URHE0060]
Length=291

 Score =   387 bits (995),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 214/291 (74%), Positives = 245/291 (84%), Gaps = 1/291 (0%)
 Frame = -2

Query  1230  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  1051
              V VDK+T+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGGT+HL LPVF+TVA+A 
Sbjct  2     SVLVDKSTKVICQGFTGAQGTFHSEQAIAYGTKMVGGVTPGKGGTKHLDLPVFDTVAEAV  61

Query  1050  AETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  871
             A+T ANASVIYVPPPFA  AI+EA++A + LVVCITEGIP  DM++VK AL   T TRLI
Sbjct  62    AKTGANASVIYVPPPFAADAILEAIDARIPLVVCITEGIPVLDMLRVKRAL-SGTGTRLI  120

Query  870   GPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGG  691
             GPNCPGII P ECKIGIMPG+IHK G+IGIVSRSGTLTYEAV QTTA GLGQSTC+GIGG
Sbjct  121   GPNCPGIITPEECKIGIMPGHIHKKGKIGIVSRSGTLTYEAVAQTTAAGLGQSTCIGIGG  180

Query  690   DPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTA  511
             DP NGTNFVDCL+ F+ DP+T+GIV+IGEIGG+AEEEAA F+K S  +KPVV FIAG+TA
Sbjct  181   DPVNGTNFVDCLDLFLGDPETQGIVMIGEIGGSAEEEAATFLKASKVKKPVVGFIAGVTA  240

Query  510   PPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTK  358
             PPGRRMGHAGAI+SGGKG A DKI  +K AG++V ESPA LG+ M+    K
Sbjct  241   PPGRRMGHAGAIISGGKGGAGDKIEAMKSAGISVAESPASLGSAMVKAMGK  291



>ref|XP_001007751.3| succinyl-CoA synthetase, alpha subunit family protein [Tetrahymena 
thermophila]
 gb|EAR87506.3| succinyl-CoA synthetase alpha subunit [Tetrahymena thermophila 
SB210]
Length=310

 Score =   388 bits (996),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 215/298 (72%), Positives = 246/298 (83%), Gaps = 1/298 (0%)
 Frame = -2

Query  1254  RLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPV  1075
               F S  P V+++K+T+VICQGITG  GT HT+QA+EYGTKMVGGV P K G  HLGLPV
Sbjct  8     NFFSSTKPYVWINKHTKVICQGITGNQGTLHTQQALEYGTKMVGGVNPAKAGQTHLGLPV  67

Query  1074  FNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALK  895
             F    +AK  T  +ASVIYVPPP A  AIMEA+EAE+ LVV IT+GIPQHDMVKVK AL+
Sbjct  68    FKNCQEAKKVTGCDASVIYVPPPHAAKAIMEAIEAEIPLVVVITDGIPQHDMVKVKHALR  127

Query  894   QQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQ  715
             QQ  TR+IGPNCPGIIKP ECKIGIMPGYIHKPG+IGIVSRSGTLTYEAV QTT  GLGQ
Sbjct  128   QQKITRIIGPNCPGIIKPNECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVDQTTKAGLGQ  187

Query  714   STCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESG-TEKPV  538
             ST VGIGGDPFNGTNF+D LERFV DP+TEGI+LIGEIGG AEE+AAA++K +  T KPV
Sbjct  188   STVVGIGGDPFNGTNFIDVLERFVEDPETEGILLIGEIGGEAEEQAAAWLKANNKTNKPV  247

Query  537   VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             V+FIAG+TAPP RRMGHAGAIVSGGKG+A +KI+ L+ AG+ VC SPA LG  ML++ 
Sbjct  248   VSFIAGVTAPPERRMGHAGAIVSGGKGSATEKIKALESAGIKVCRSPATLGQEMLNLM  305



>emb|CBK25395.2| Succinyl-CoA Synthetase subunit ? (SCS?) [Blastocystis hominis]
Length=318

 Score =   388 bits (996),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 208/298 (70%), Positives = 248/298 (83%), Gaps = 1/298 (0%)
 Frame = -2

Query  1242  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  1063
             S    V++DKNT+VI QGITGKNGTFHT+QAIEYGTKMVGGV PKK G+ HLGLP+F++V
Sbjct  19    SSTARVWIDKNTKVIGQGITGKNGTFHTQQAIEYGTKMVGGVNPKKAGSTHLGLPIFSSV  78

Query  1062  ADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTK  883
              +AK  T A+A+VIYVPP  A +AI+EA+ AE+ L+VCITEGIPQHDM++VK  +K Q+K
Sbjct  79    EEAKKATNADATVIYVPPSGAASAILEAVAAEIPLIVCITEGIPQHDMLRVKDIMKSQSK  138

Query  882   TRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCV  703
             +RLIGPNCPGIIKPGECKIGIMPGYIHK G+IG+VSRSGTLTYEAV QTT  GLGQST V
Sbjct  139   SRLIGPNCPGIIKPGECKIGIMPGYIHKKGKIGVVSRSGTLTYEAVAQTTKYGLGQSTVV  198

Query  702   GIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGT-EKPVVAFI  526
             GIGGDPFNGTNF+DCLERF  DPQTEGIV+IGEIGGTAEE+AA ++K+ G   KPVV FI
Sbjct  199   GIGGDPFNGTNFIDCLERFTNDPQTEGIVMIGEIGGTAEEDAAEWLKQYGDPSKPVVGFI  258

Query  525   AGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRG  352
             AG TAPPGRRMGHAGAI+SGGKGTA+ K+  +   G+ V ++PA++G  +  +    G
Sbjct  259   AGRTAPPGRRMGHAGAIISGGKGTAKAKMEAMTAVGIKVVDTPAQIGEAIYGLMKAAG  316



>ref|XP_002289446.1| precursor of synthetase [Thalassiosira pseudonana CCMP1335]
 gb|EED92983.1| precursor of synthetase [Thalassiosira pseudonana CCMP1335]
Length=299

 Score =   387 bits (994),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 216/291 (74%), Positives = 246/291 (85%), Gaps = 1/291 (0%)
 Frame = -2

Query  1242  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  1063
             S   +V++DK+TRVICQG TGK GTFH+ QAIEYGT MVGGVTPKKGG EHLGLPVF++V
Sbjct  2     SANAKVWIDKDTRVICQGFTGKQGTFHSTQAIEYGTNMVGGVTPKKGGQEHLGLPVFDSV  61

Query  1062  ADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTK  883
             ADA  E K +ASVIYVPPP+  AAI++A+E E+ LVV ITEG+PQ DMV+VK AL  Q K
Sbjct  62    ADAVLEVKPDASVIYVPPPYCAAAILDAIENEIPLVVAITEGVPQQDMVRVKKALLSQDK  121

Query  882   TRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCV  703
             TRLIGPNCPGIIKPGECKIGIMPGYIHK G+IG+VSRSGTLTYEAV QTT  GLGQSTCV
Sbjct  122   TRLIGPNCPGIIKPGECKIGIMPGYIHKAGKIGVVSRSGTLTYEAVHQTTVTGLGQSTCV  181

Query  702   GIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGT-EKPVVAFI  526
             GIGGDPFNGTNF+DCLERF  DPQTEGI++IGEIGG+AEEEAA +   +G   KPVV FI
Sbjct  182   GIGGDPFNGTNFIDCLERFRDDPQTEGIIMIGEIGGSAEEEAAEWWANNGDPNKPVVGFI  241

Query  525   AGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTML  373
             AG+TAPPGRRMGHAGAIV+GGKG A +K   L+ AG+ V  SPA+LGTTM+
Sbjct  242   AGMTAPPGRRMGHAGAIVAGGKGGANEKFAALEAAGIHVTRSPAQLGTTMM  292



>ref|WP_046022538.1| succinate--CoA ligase [Magnetospira sp. QH-2]
 emb|CCQ75435.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Magnetospira 
sp. QH-2]
Length=291

 Score =   386 bits (992),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 209/285 (73%), Positives = 244/285 (86%), Gaps = 1/285 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             V VDKNT+V+CQG TG  GTFH+EQAI YGT MVGGVTP KGGT HL LPVF+TVADA  
Sbjct  3     VLVDKNTKVVCQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGTSHLDLPVFDTVADAVE  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T ANASVIYVPPPFA  AI+EA++A +DL VCITEGIP  DMV+VK  + + +KTRLIG
Sbjct  63    KTGANASVIYVPPPFAADAILEAVDAGVDLAVCITEGIPVIDMVRVKRGM-EGSKTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPGII P ECKIGIMPG+IH+ G+IGIVSRSGTLTYEAV QTT  GLGQSTC+GIGGD
Sbjct  122   PNCPGIITPDECKIGIMPGHIHQRGKIGIVSRSGTLTYEAVAQTTTAGLGQSTCIGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNF+DCL+ F+ADP+T+GIV+IGEIGG+AEE+AA FIK+S T+KPVV FIAG+TAP
Sbjct  182   PVNGTNFIDCLDLFLADPETQGIVMIGEIGGSAEEDAAEFIKQSKTKKPVVGFIAGVTAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTML  373
             PG+RMGHAGAI+SGGKGTA  KI  ++ AG+ V +SPA LG+TML
Sbjct  242   PGKRMGHAGAIISGGKGTADAKIEAMRSAGIEVADSPAALGSTML  286



>emb|CBK19683.2| Succinyl-CoA Synthetase subunit ? (SCS?) [Blastocystis hominis]
Length=318

 Score =   387 bits (995),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 208/298 (70%), Positives = 248/298 (83%), Gaps = 1/298 (0%)
 Frame = -2

Query  1242  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  1063
             S    V++DKNT+VI QGITGKNGTFHT+QAIEYGTKMVGGV PKK G+ HLGLP+F++V
Sbjct  19    SSTARVWIDKNTKVIGQGITGKNGTFHTQQAIEYGTKMVGGVNPKKAGSTHLGLPIFSSV  78

Query  1062  ADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTK  883
              +AK  T A+A+VIYVPP  A +AI+EA+ AE+ L+VCITEGIPQHDM++VK  +K Q+K
Sbjct  79    EEAKKATNADATVIYVPPSGAASAILEAVAAEIPLIVCITEGIPQHDMLRVKDIMKSQSK  138

Query  882   TRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCV  703
             +RLIGPNCPGIIKPGECKIGIMPGYIHK G+IG+VSRSGTLTYEAV QTT  GLGQST V
Sbjct  139   SRLIGPNCPGIIKPGECKIGIMPGYIHKKGKIGVVSRSGTLTYEAVAQTTKYGLGQSTVV  198

Query  702   GIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGT-EKPVVAFI  526
             GIGGDPFNGTNF+DCLERF  DPQTEGIV+IGEIGGTAEE+AA ++K+ G   KPVV FI
Sbjct  199   GIGGDPFNGTNFIDCLERFTNDPQTEGIVMIGEIGGTAEEDAAEWLKQYGDPSKPVVGFI  258

Query  525   AGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRG  352
             AG TAPPGRRMGHAGAI+SGGKGTA+ K+  +   G+ V ++PA++G  +  +    G
Sbjct  259   AGRTAPPGRRMGHAGAIISGGKGTAKAKMEAMTAVGIKVVDTPAQIGEAIYGLMKAAG  316



>ref|WP_038538362.1| MULTISPECIES: succinate--CoA ligase [unclassified Holosporaceae]
 gb|AIF80946.1| succinyl-CoA synthetase subunit alpha [endosymbiont of Acanthamoeba 
sp. UWC8]
 gb|KIE05138.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [endosymbiont 
of Acanthamoeba sp. UWC36]
Length=292

 Score =   386 bits (991),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 210/292 (72%), Positives = 243/292 (83%), Gaps = 1/292 (0%)
 Frame = -2

Query  1230  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  1051
              + V+ NT+VICQG TG  GTFH+EQA+ YGTKMVGGVTP KGGT HL LPVFNTV +A 
Sbjct  2     SILVNSNTKVICQGFTGAQGTFHSEQAVAYGTKMVGGVTPGKGGTTHLNLPVFNTVDEAV  61

Query  1050  AETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  871
              +T+ANASVIYVPP FA  AI+EA++A+++L+VCITEGIP  DMV+VK AL   +K+RLI
Sbjct  62    KKTQANASVIYVPPAFAADAILEAIDAQVELIVCITEGIPVLDMVRVKRAL-VGSKSRLI  120

Query  870   GPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGG  691
             GPNCPG+I P +CKIGIMPGYIHKPG+IGIVSRSGTLTYEAV QTTAV LGQSTCVGIGG
Sbjct  121   GPNCPGVITPDQCKIGIMPGYIHKPGKIGIVSRSGTLTYEAVAQTTAVNLGQSTCVGIGG  180

Query  690   DPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTA  511
             DP NGTNFVD LE FV D +TE I++IGEIGGTAE + A FIKES T+KPVV FIAG+TA
Sbjct  181   DPVNGTNFVDVLELFVKDEETEAIIMIGEIGGTAEVDGANFIKESKTKKPVVGFIAGITA  240

Query  510   PPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKR  355
             PPG+RMGHAGAIVSGG+ TA+ KI  +K AG+ V ESPA LGTTMLD    +
Sbjct  241   PPGKRMGHAGAIVSGGQDTAESKIEAMKSAGIFVSESPASLGTTMLDALKSK  292



>emb|CBK23557.2| Succinyl-CoA Synthetase subunit ? (SCS?) [Blastocystis hominis]
Length=318

 Score =   387 bits (993),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 208/298 (70%), Positives = 247/298 (83%), Gaps = 1/298 (0%)
 Frame = -2

Query  1242  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  1063
             S    V++DKNT+VI QGITGKNGTFHT+QAIEYGTKMVGGV PKK G+ HLGLP+F +V
Sbjct  19    SSTARVWIDKNTKVIGQGITGKNGTFHTQQAIEYGTKMVGGVNPKKAGSTHLGLPIFASV  78

Query  1062  ADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTK  883
              +AK  T A+A+VIYVPP  A +AI+EA+ AE+ L+VCITEGIPQHDM++VK  +K Q+K
Sbjct  79    EEAKKATNADATVIYVPPSGAASAILEAVAAEIPLIVCITEGIPQHDMLRVKDIMKSQSK  138

Query  882   TRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCV  703
             +RLIGPNCPGIIKPGECKIGIMPGYIHK G+IG+VSRSGTLTYEAV QTT  GLGQST V
Sbjct  139   SRLIGPNCPGIIKPGECKIGIMPGYIHKKGKIGVVSRSGTLTYEAVAQTTKYGLGQSTVV  198

Query  702   GIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGT-EKPVVAFI  526
             GIGGDPFNGTNF+DCLERF  DPQTEGIV+IGEIGGTAEE+AA ++K+ G   KPVV FI
Sbjct  199   GIGGDPFNGTNFIDCLERFTNDPQTEGIVMIGEIGGTAEEDAAEWLKQYGDPSKPVVGFI  258

Query  525   AGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRG  352
             AG TAPPGRRMGHAGAI+SGGKGTA+ K+  +   G+ V ++PA++G  +  +    G
Sbjct  259   AGRTAPPGRRMGHAGAIISGGKGTAKAKMEAMTAVGIKVVDTPAQIGEAIYGLMKAAG  316



>ref|XP_009831202.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Aphanomyces astaci]
 gb|ETV79361.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Aphanomyces astaci]
Length=312

 Score =   386 bits (992),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 218/308 (71%), Positives = 254/308 (82%), Gaps = 1/308 (0%)
 Frame = -2

Query  1275  LWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGT  1096
             L +Q Q     S + +V+++K+T+VICQG TGK GTFH+EQAI YGT  VGGVTPKKGGT
Sbjct  2     LSRQTQAVRRMSASAKVWINKDTKVICQGFTGKQGTFHSEQAIAYGTNYVGGVTPKKGGT  61

Query  1095  EHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMV  916
              HLGLPVFNTV +AK E  A AS+I+VPPP+   AI++A+ AE+ L+V ITEGIPQ DMV
Sbjct  62    THLGLPVFNTVQEAKDEVGAEASIIFVPPPYCAQAIIDAIHAEIPLIVAITEGIPQQDMV  121

Query  915   KVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQT  736
             KVK  L QQ+ +RLIGPNCPGIIKPGECK+GIMPGYIH  G+IGIVSRSGTLTYEAV QT
Sbjct  122   KVKWHLNQQSASRLIGPNCPGIIKPGECKMGIMPGYIHSKGKIGIVSRSGTLTYEAVHQT  181

Query  735   TAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKES  556
             T+ GLGQST +GIGGDPFNGTNF+DCLERF  DP+TEGI++IGEIGGTAEEEAA ++ E 
Sbjct  182   TSTGLGQSTVIGIGGDPFNGTNFIDCLERFTNDPETEGIIMIGEIGGTAEEEAAEWLAEY  241

Query  555   GT-EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTT  379
             G   KPVV+FIAG+TAPPGRRMGHAGAIVSGGKGTA+ K   L++AGV V  SPA+LGTT
Sbjct  242   GDPNKPVVSFIAGITAPPGRRMGHAGAIVSGGKGTAEGKFAALEKAGVAVTRSPARLGTT  301

Query  378   MLDVFTKR  355
             ML  F KR
Sbjct  302   MLQQFAKR  309



>emb|CCA20859.1| unnamed protein product [Albugo laibachii Nc14]
Length=325

 Score =   385 bits (990),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 213/297 (72%), Positives = 252/297 (85%), Gaps = 1/297 (0%)
 Frame = -2

Query  1242  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  1063
             S + +V+++++TRVICQG TGK GTFH+EQAI YGTKMVGGVTPKKGG+ HLGLPVFN+V
Sbjct  23    SSSAKVWINEDTRVICQGFTGKQGTFHSEQAIAYGTKMVGGVTPKKGGSTHLGLPVFNSV  82

Query  1062  ADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTK  883
             ++AK  T A+ASVIYVPPPF   AI++A+EAE+ LVV ITEGIPQ DMVKVK  L+QQ  
Sbjct  83    SEAKRATNADASVIYVPPPFCAQAIIDAIEAEIPLVVAITEGIPQQDMVKVKWHLRQQKV  142

Query  882   TRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCV  703
             TRLIGPNCPGIIKPGECK+GIMPGYIH  G+IGIVSRSGTLTYEAV QTT+ GLGQST +
Sbjct  143   TRLIGPNCPGIIKPGECKMGIMPGYIHLKGKIGIVSRSGTLTYEAVAQTTSTGLGQSTVI  202

Query  702   GIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTE-KPVVAFI  526
             GIGGDPFNGTNF+DCLERF  DP+TEGI++IGEIGG+AEEEAA ++++ G   KPVV+FI
Sbjct  203   GIGGDPFNGTNFIDCLERFTNDPETEGIIMIGEIGGSAEEEAADWLQQYGDRNKPVVSFI  262

Query  525   AGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKR  355
             AG TAPPGRRMGHAGAIVSGGKGTA+ K + L+ AGV V  SPA+LG  M ++   +
Sbjct  263   AGTTAPPGRRMGHAGAIVSGGKGTAEGKFKALEAAGVAVTRSPARLGELMAELMKDK  319



>ref|WP_021777427.1| 3-oxoacyl-Acyl-carrier protein reductase [alpha proteobacterium 
RS24]
 gb|ERL46449.1| 3-oxoacyl-Acyl-carrier protein reductase [alpha proteobacterium 
RS24]
Length=291

 Score =   384 bits (986),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 207/288 (72%), Positives = 244/288 (85%), Gaps = 1/288 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             V V K+T+VICQG TG  GTFH+EQAI YGT+MVGGVTPK+GG  HLGLPVF+TVA+A  
Sbjct  3     VLVGKDTKVICQGFTGSQGTFHSEQAIAYGTQMVGGVTPKRGGETHLGLPVFDTVAEAVD  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T A AS IYVPPPFA  AI+EA+EAE++L VCITEGIP  DM+KVK+AL Q +KTRL+G
Sbjct  63    KTGATASAIYVPPPFAANAILEAIEAEIELAVCITEGIPVMDMIKVKSAL-QGSKTRLVG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IH+PG +GIVSRSGTLTYEAV QTTA GLGQSTC+GIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHRPGSVGIVSRSGTLTYEAVAQTTAAGLGQSTCIGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNF+DCLE F+ D QTE I++IGEIGG+AEEEAA F+K S  +KPVV FIAG+TAP
Sbjct  182   PVNGTNFIDCLELFLGDDQTESIIMIGEIGGSAEEEAAEFLKSSSVKKPVVGFIAGVTAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             PGRRMGHAGAI+SGGKG A+DK+  ++ AG+TV  SPA LGTT+  + 
Sbjct  242   PGRRMGHAGAIISGGKGGAEDKMEAMRSAGITVSPSPAALGTTLSQIL  289



>ref|WP_009540580.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Caenispirillum 
salinarum]
 gb|EKV30513.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Caenispirillum 
salinarum AK4]
Length=291

 Score =   384 bits (985),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 209/285 (73%), Positives = 245/285 (86%), Gaps = 1/285 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             V +D NT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGGT+HL LPVF+TVADAK 
Sbjct  3     VLIDSNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTKHLDLPVFDTVADAKE  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
              T ANA+VIYVPPPFA  AI+EA++AE+DL VCITEGIP  DMVKVK AL + +KTRL+G
Sbjct  63    ATGANATVIYVPPPFAADAILEAIDAEMDLAVCITEGIPVLDMVKVKRAL-ENSKTRLVG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IH+ G+IG+VSRSGTLTYEAV QTTA GLGQSTC+GIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHQRGKIGVVSRSGTLTYEAVAQTTAAGLGQSTCIGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNF+DCL+ F+ DP+TEGI++IGEIGG+AEEEAA F+K    +KP V FIAG+TAP
Sbjct  182   PVNGTNFIDCLDMFLKDPETEGIIMIGEIGGSAEEEAAEFLKAQKVKKPTVGFIAGVTAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTML  373
             PG+RMGHAGAI+SGGKGTA DK+  +K AG+ V +SPA LG+TML
Sbjct  242   PGKRMGHAGAIISGGKGTAADKMEAMKSAGIMVADSPAALGSTML  286



>ref|XP_002160938.2| PREDICTED: succinyl-CoA ligase [ADP-forming] subunit alpha-1, 
mitochondrial-like [Hydra vulgaris]
Length=332

 Score =   385 bits (989),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 204/293 (70%), Positives = 242/293 (83%), Gaps = 3/293 (1%)
 Frame = -2

Query  1233  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  1054
             P + ++KNT+VICQG TGK GTFH +QAI YGTK+VGGV+P KGG+ HLG PVFN+V +A
Sbjct  28    PNLSINKNTKVICQGFTGKQGTFHCQQAISYGTKIVGGVSPNKGGSVHLGRPVFNSVKEA  87

Query  1053  KAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRL  874
             K  TK +ASVIYVPPP A AAI+EA+EAE+ L+VCITEGIPQ DMVKVK  L++Q+ +RL
Sbjct  88    KENTKCDASVIYVPPPGAAAAIIEAIEAEVGLIVCITEGIPQQDMVKVKHVLERQSVSRL  147

Query  873   IGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIG  694
             +GPNCPGIIKPGECKIGIMPG+IHKPG IGIVSRSGTLTYEAV QT+ VGLGQS CVGIG
Sbjct  148   LGPNCPGIIKPGECKIGIMPGHIHKPGCIGIVSRSGTLTYEAVHQTSTVGLGQSLCVGIG  207

Query  693   GDPFNGTNFVDCLERFVADPQTEGIVLigei--ggtaeeeaaafIKESG-TEKPVVAFIA  523
             GDPFNGTNF+DCLE F+ DP+T+G+++IGEI                SG  +KP+V FIA
Sbjct  208   GDPFNGTNFIDCLEVFLKDPETKGMIMIGEIGGAAEERAAEYLLKYNSGPNKKPIVGFIA  267

Query  522   GLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             GLTAPPGRRMGHAGAI+SGGKG A+DKI+ L+EAGVTV  SPA++GTT+  VF
Sbjct  268   GLTAPPGRRMGHAGAIISGGKGGAEDKIKALEEAGVTVTRSPAQMGTTLRTVF  320



>ref|WP_008519360.1| succinyl-CoA synthetase subsunit alpha [alpha proteobacterium 
IMCC14465]
 gb|EJW21264.1| hypothetical protein IMCC14465_10600 [alpha proteobacterium IMCC14465]
Length=291

 Score =   383 bits (984),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 206/288 (72%), Positives = 243/288 (84%), Gaps = 1/288 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             V + K T+VICQG TG  GTFH+EQAI YGT+MVGGVTPK+GG  HLGLPVF+TVA+A  
Sbjct  3     VLIGKETKVICQGFTGSQGTFHSEQAIAYGTQMVGGVTPKRGGETHLGLPVFDTVAEAVD  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T A AS IYVPPPFA  AI+EA+EAE++L VCITEGIP  DM+KVK+AL Q +KTRL+G
Sbjct  63    KTGATASAIYVPPPFAANAILEAIEAEIELAVCITEGIPVMDMIKVKSAL-QGSKTRLVG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IH+PG +GIVSRSGTLTYEAV QTTA GLGQSTC+GIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHRPGSVGIVSRSGTLTYEAVAQTTAAGLGQSTCIGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNF+DCLE F+ D QTE I++IGEIGG+AEEEAA F+K S  +KPVV FIAG+TAP
Sbjct  182   PVNGTNFIDCLELFLGDEQTESIIMIGEIGGSAEEEAAEFLKSSAVKKPVVGFIAGVTAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             PGRRMGHAGAI+SGGKG A+DK+  ++ AG+TV  SPA LGTT+  + 
Sbjct  242   PGRRMGHAGAIISGGKGGAEDKMEAMRSAGITVSPSPAALGTTLSQIL  289



>ref|WP_012110353.1| succinyl-CoA synthetase subsunit alpha [Parvibaculum lavamentivorans]
 gb|ABS63073.1| succinyl-CoA synthetase, alpha subunit [Parvibaculum lavamentivorans 
DS-1]
Length=291

 Score =   383 bits (984),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 204/289 (71%), Positives = 243/289 (84%), Gaps = 1/289 (0%)
 Frame = -2

Query  1230  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  1051
              V VDKNT+VICQG TG  GTFH+EQAI YGTKMVGGV+P KGG++HL LPVFNTVA+A 
Sbjct  2     SVLVDKNTKVICQGFTGNQGTFHSEQAIAYGTKMVGGVSPGKGGSKHLDLPVFNTVAEAV  61

Query  1050  AETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  871
              +T A AS IYVPPPFA  AI+EA++A ++L VCITEGIP  DMVKVK AL Q + TRL+
Sbjct  62    EKTGATASAIYVPPPFAADAILEAIDAGIELAVCITEGIPVLDMVKVKRAL-QGSNTRLV  120

Query  870   GPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGG  691
             GPNCPG+I P ECKIGIMPG+IHKPG +GIVSRSGTLTYEAV QTTA GLGQSTC+GIGG
Sbjct  121   GPNCPGVITPDECKIGIMPGHIHKPGSVGIVSRSGTLTYEAVAQTTAAGLGQSTCIGIGG  180

Query  690   DPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTA  511
             DP NGTNF+DCLE F+ DP T  I++IGEIGG+AEE+AA F+K S  +KP+V FIAG+TA
Sbjct  181   DPVNGTNFIDCLEMFLGDPDTTSIIMIGEIGGSAEEDAAEFLKASKVKKPIVGFIAGVTA  240

Query  510   PPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             PPGRRMGHAGAI+SGGKG A+DK+  ++ AG+TV +SP+ LGTT+++V 
Sbjct  241   PPGRRMGHAGAIISGGKGGAEDKMEAMRSAGITVAKSPSALGTTLVEVL  289



>gb|KDO52721.1| hypothetical protein CISIN_1g0195001mg, partial [Citrus sinensis]
 gb|KDO52722.1| hypothetical protein CISIN_1g0195001mg, partial [Citrus sinensis]
Length=237

 Score =   381 bits (978),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 197/231 (85%), Positives = 209/231 (90%), Gaps = 3/231 (1%)
 Frame = -2

Query  1308  SKKVRPITQSPLWQQQQHRLFGS---PAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYG  1138
             S+ VR +  S      Q R F +   PAP VFVDKNTRVICQGITGKNGTFHTEQAIEYG
Sbjct  7     SRVVRSLYMSSEICCGQSRSFTTAPPPAPAVFVDKNTRVICQGITGKNGTFHTEQAIEYG  66

Query  1137  TKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDL  958
             TKMVGGVTPKKGGTEHLGLPVFNTVA+AKAETKANAS IYVPPPFA AAI+EAMEAELDL
Sbjct  67    TKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASAIYVPPPFAAAAILEAMEAELDL  126

Query  957   VVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIV  778
             VVCITEGIPQHDMV+VKAAL  Q+KTRL+GPNCPG+IKPGECKIGIMPGYIHKPGRIGIV
Sbjct  127   VVCITEGIPQHDMVRVKAALNNQSKTRLVGPNCPGVIKPGECKIGIMPGYIHKPGRIGIV  186

Query  777   SRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTE  625
             SRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDC+ +F+ADPQTE
Sbjct  187   SRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCVTKFIADPQTE  237



>ref|XP_008889195.1| succinyl-CoA-synthetase alpha SCSA [Hammondia hammondi]
 gb|KEP60333.1| succinyl-CoA-synthetase alpha SCSA [Hammondia hammondi]
Length=333

 Score =   384 bits (986),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 214/305 (70%), Positives = 244/305 (80%), Gaps = 7/305 (2%)
 Frame = -2

Query  1242  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTE------HLGL  1081
             S    VFVDKNT+VICQG+TGK G+FHTEQ + YGT+ VGGV P K G+          L
Sbjct  28    SSTARVFVDKNTKVICQGLTGKQGSFHTEQCLAYGTQFVGGVNPSKKGSTWQSSDGKFSL  87

Query  1080  PVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAA  901
             PVF TV +AK  T  +AS+I+VPPPFA  AIM+ +  E+ L VCITEGIPQ DMV+VK A
Sbjct  88    PVFGTVKEAKEATGCDASMIFVPPPFAAQAIMDCIAEEIPLAVCITEGIPQQDMVRVKQA  147

Query  900   LKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGL  721
             L  Q+KTRLIGPNCPGIIKPGECKIGIMPGYIH  G+IG+VSRSGTLTYEAV QTT  GL
Sbjct  148   LLSQSKTRLIGPNCPGIIKPGECKIGIMPGYIHAKGKIGVVSRSGTLTYEAVNQTTQTGL  207

Query  720   GQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTE-K  544
             GQSTCVGIGGDPFNGTNF+DCLERFV DP+T+GIVLIGEIGG+AEEEAAA++KE   E K
Sbjct  208   GQSTCVGIGGDPFNGTNFIDCLERFVNDPETKGIVLIGEIGGSAEEEAAAWLKEHNKERK  267

Query  543   PVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             PVV+FIAGLTAPPGRRMGHAGAIVSGGKGTA+ KI  L++AGV V  +PA +G  ML+V 
Sbjct  268   PVVSFIAGLTAPPGRRMGHAGAIVSGGKGTAEGKIAALEDAGVHVVRNPAAMGQKMLEVM  327

Query  363   TKRGL  349
                GL
Sbjct  328   QAAGL  332



>ref|XP_004029838.1| succinyl-CoA synthetase, alpha subunit, putative [Ichthyophthirius 
multifiliis]
 gb|EGR28602.1| succinyl-CoA synthetase, alpha subunit, putative [Ichthyophthirius 
multifiliis]
Length=311

 Score =   383 bits (983),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 209/303 (69%), Positives = 247/303 (82%), Gaps = 1/303 (0%)
 Frame = -2

Query  1254  RLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPV  1075
             + F S  P V+++K+T+VICQGITG  GT HTEQA+ YGTKMVGGV PKK G  HLGLPV
Sbjct  8     KYFFSNKPYVWINKHTKVICQGITGNQGTLHTEQALAYGTKMVGGVNPKKAGQTHLGLPV  67

Query  1074  FNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALK  895
             F    +AK  T+ +ASVIYVPP FA A+IMEA++A+++LVV IT+GIPQHDM++VK AL+
Sbjct  68    FKNCEEAKKHTQCDASVIYVPPAFAAASIMEAIQAQIELVVVITDGIPQHDMIRVKHALR  127

Query  894   QQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQ  715
              Q  TR+IGPNCPGIIKP ECKIGIMPGYIHK G+IGIVSRSGTLTYEAV QTT  GLGQ
Sbjct  128   AQNVTRVIGPNCPGIIKPNECKIGIMPGYIHKQGKIGIVSRSGTLTYEAVDQTTKAGLGQ  187

Query  714   STCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTE-KPV  538
             ST VGIGGDPFNGTNF+D LERFV DP+T+GI++IGEIGG AEE+AA ++KE  T+ KPV
Sbjct  188   STVVGIGGDPFNGTNFIDVLERFVHDPETKGIMMIGEIGGEAEEQAAYWLKEHNTQNKPV  247

Query  537   VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTK  358
             V+FIAG+TAPP RRMGHAGAIVSGGKG+A +KI+TL+  G+ V  SPA LG  ML     
Sbjct  248   VSFIAGVTAPPERRMGHAGAIVSGGKGSAPEKIKTLESVGIKVSRSPATLGEEMLKAMKA  307

Query  357   RGL  349
              GL
Sbjct  308   AGL  310



>ref|XP_009038265.1| hypothetical protein AURANDRAFT_28269 [Aureococcus anophagefferens]
 gb|EGB07028.1| hypothetical protein AURANDRAFT_28269 [Aureococcus anophagefferens]
Length=310

 Score =   383 bits (983),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 215/302 (71%), Positives = 251/302 (83%), Gaps = 2/302 (1%)
 Frame = -2

Query  1254  RLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPV  1075
             R F + A +V+++K T+VICQG TGK GTFH+EQA+ YGT +VGGVTPKKGG EHLGLPV
Sbjct  3     RSFSASA-KVWINKETKVICQGFTGKQGTFHSEQALAYGTNVVGGVTPKKGGQEHLGLPV  61

Query  1074  FNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALK  895
             F+TV DAK     +AS+IYVPPPF  AAIM+A+EAE+ LVV ITEG+PQ DMV+VK  L 
Sbjct  62    FDTVMDAKKAVNPDASMIYVPPPFCKAAIMDAIEAEIPLVVAITEGVPQQDMVEVKYHLT  121

Query  894   QQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQ  715
             +Q+ TRLIGPNCPGIIKPGECKIGIMPGYIHK G+IG+VSRSGTLTYEAV QTT  GLGQ
Sbjct  122   RQSATRLIGPNCPGIIKPGECKIGIMPGYIHKKGKIGVVSRSGTLTYEAVHQTTVTGLGQ  181

Query  714   STCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGT-EKPV  538
             STCVGIGGDPFNGTNF+DCLERF  DP+TEGI++IGEIGG+AEEEAA ++K  G  +KPV
Sbjct  182   STCVGIGGDPFNGTNFIDCLERFTNDPETEGIIMIGEIGGSAEEEAAEWLKAHGDPDKPV  241

Query  537   VAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTK  358
             V FIAG TAPPGRRMGHAGAIVSGGKGTA  K    ++AGV +  SPA+LG+TM+  F +
Sbjct  242   VGFIAGTTAPPGRRMGHAGAIVSGGKGTAAAKFAAFEDAGVFISRSPAQLGSTMIQAFKE  301

Query  357   RG  352
              G
Sbjct  302   HG  303



>ref|XP_002368454.1| succinyl-CoA ligase alpha subunit, putative [Toxoplasma gondii 
ME49]
 gb|EPR59792.1| succinyl-CoA-synthetase alpha SCSA [Toxoplasma gondii GT1]
 gb|EPT28025.1| succinyl-CoA-synthetase alpha SCSA [Toxoplasma gondii ME49]
 gb|ESS33942.1| succinyl-CoA-synthetase alpha SCSA [Toxoplasma gondii VEG]
 gb|KFG27848.1| succinyl-CoA-synthetase alpha SCSA [Toxoplasma gondii p89]
 gb|KFG42366.1| succinyl-CoA-synthetase alpha SCSA [Toxoplasma gondii GAB2-2007-GAL-DOM2]
 gb|KFG53411.1| succinyl-CoA-synthetase alpha SCSA [Toxoplasma gondii FOU]
 gb|KFG62784.1| succinyl-CoA-synthetase alpha SCSA [Toxoplasma gondii RUB]
 gb|KFH09138.1| succinyl-CoA-synthetase alpha SCSA [Toxoplasma gondii VAND]
Length=333

 Score =   383 bits (984),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 214/305 (70%), Positives = 243/305 (80%), Gaps = 7/305 (2%)
 Frame = -2

Query  1242  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTE------HLGL  1081
             S    VFVDKNT+VICQG+TGK G+FHTEQ + YGT+ VGGV P K G+          L
Sbjct  28    SSTARVFVDKNTKVICQGLTGKQGSFHTEQCLAYGTQFVGGVNPSKKGSTWQSSDGKFSL  87

Query  1080  PVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAA  901
             PVF TV +AK  T  +AS+I+VPPPFA  AIM+ +  E+ L VCITEGIPQ DMV+VK A
Sbjct  88    PVFGTVKEAKEATGCDASMIFVPPPFAAQAIMDCIAEEIPLAVCITEGIPQQDMVRVKQA  147

Query  900   LKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGL  721
             L  Q KTRLIGPNCPGIIKPGECKIGIMPGYIH  G+IG+VSRSGTLTYEAV QTT  GL
Sbjct  148   LLSQNKTRLIGPNCPGIIKPGECKIGIMPGYIHAKGKIGVVSRSGTLTYEAVNQTTQTGL  207

Query  720   GQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTE-K  544
             GQSTCVGIGGDPFNGTNF+DCLERFV DP+T+GIVLIGEIGG+AEEEAAA++KE   E K
Sbjct  208   GQSTCVGIGGDPFNGTNFIDCLERFVNDPETKGIVLIGEIGGSAEEEAAAWLKEHNKEQK  267

Query  543   PVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             PVV+FIAGLTAPPGRRMGHAGAIVSGGKGTA+ KI  L++AGV V  +PA +G  ML+V 
Sbjct  268   PVVSFIAGLTAPPGRRMGHAGAIVSGGKGTAEGKIAALEDAGVHVVRNPAAMGQKMLEVM  327

Query  363   TKRGL  349
                GL
Sbjct  328   QAAGL  332



>ref|XP_001425910.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK58512.1| unnamed protein product [Paramecium tetraurelia]
Length=312

 Score =   382 bits (982),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 213/308 (69%), Positives = 253/308 (82%), Gaps = 2/308 (1%)
 Frame = -2

Query  1266  QQQHRLFGSP-APEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEH  1090
             +Q  R F S  AP V+V+K+T+VICQGITG  GTF TEQA+ Y TKMVGGV+PKK G+ H
Sbjct  4     KQIFRAFSSTTAPYVWVNKHTKVICQGITGNQGTFQTEQALNYFTKMVGGVSPKKAGSTH  63

Query  1089  LGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKV  910
             LGLPVF    +AK  T  +ASVIYVPPP A +AI+EA+EA++ LVV IT+GIPQHDM+KV
Sbjct  64    LGLPVFKNCQEAKQNTGCDASVIYVPPPTAASAIIEAIEAQIGLVVVITDGIPQHDMIKV  123

Query  909   KAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTA  730
             K AL+ Q+ TR+IGPNCPGIIKP ECKIGIMPGYIH+ G+IGIVSRSGTLTYEAV QTT 
Sbjct  124   KHALRSQSVTRVIGPNCPGIIKPNECKIGIMPGYIHQNGKIGIVSRSGTLTYEAVDQTTR  183

Query  729   VGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESG-  553
              GLGQST VGIGGDPFNGTNF+D LERF+ DP+TEGIV+IGEIGG  EE AA +IK++  
Sbjct  184   AGLGQSTVVGIGGDPFNGTNFIDVLERFMVDPETEGIVMIGEIGGENEEMAAEWIKQNNP  243

Query  552   TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTML  373
               KPVV FIAG+TAPP RRMGHAGAIVS GKG+A +KIR L++AG+ V +SPA++G TML
Sbjct  244   KNKPVVGFIAGITAPPERRMGHAGAIVSKGKGSAPEKIRALEQAGIRVVKSPAQIGKTML  303

Query  372   DVFTKRGL  349
             +V  +RGL
Sbjct  304   EVMKERGL  311



>ref|WP_028879580.1| succinate--CoA ligase [Terasakiella pusilla]
Length=290

 Score =   381 bits (979),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 205/288 (71%), Positives = 246/288 (85%), Gaps = 1/288 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             V ++K+T+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGG++HL LPVF+TVADA+ 
Sbjct  3     VLINKDTKVICQGFTGAQGTFHSEQAIAYGTKMVGGVTPGKGGSKHLDLPVFDTVADARE  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T ANASVIYVPPPFA  AI+EA++AE++L VCITEGIP  DMVKVK AL   +KTRLIG
Sbjct  63    KTGANASVIYVPPPFAADAILEAIDAEIELAVCITEGIPVMDMVKVKRAL-AGSKTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IHK G +GIVSRSGTLTYEAV QTTA G+GQSTC+GIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHKRGTVGIVSRSGTLTYEAVAQTTAAGMGQSTCIGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNF+DCLE F+AD +TE IV+IGEIGGTAEEEA  F+K+S  +KPVV FIAG+TAP
Sbjct  182   PVNGTNFIDCLEMFLADDETESIVMIGEIGGTAEEEACEFLKQSKVKKPVVGFIAGVTAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             PG+RMGHAGAI+SGG+GTA  K+  ++ AG+ V +SPA +G+TM+ + 
Sbjct  242   PGKRMGHAGAIISGGQGTADAKMEAMRSAGIAVADSPASIGSTMVKLL  289



>ref|XP_001442597.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK75200.1| unnamed protein product [Paramecium tetraurelia]
Length=337

 Score =   382 bits (982),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 215/322 (67%), Positives = 259/322 (80%), Gaps = 8/322 (2%)
 Frame = -2

Query  1290  ITQSPLWQQQQ------HRLFGSP-APEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTK  1132
              +Q  L+Q +Q       R F S  AP V+V+K+T+VICQGITG  GTF TEQA+ Y TK
Sbjct  15    FSQQMLYQIKQMIGRQIFRAFSSTTAPYVWVNKHTKVICQGITGNQGTFQTEQALNYFTK  74

Query  1131  MVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVV  952
             MVGGV+PKK G+ HLGLPVF    +AK+ T  +ASVIYVPPP A +AI+EA+EA++ LVV
Sbjct  75    MVGGVSPKKAGSTHLGLPVFKDCKEAKSATGCDASVIYVPPPTAASAIIEAIEAQIGLVV  134

Query  951   CITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSR  772
              IT+GIPQHDM+KVK AL+ Q+ TR+IGPNCPGIIKP ECKIGIMPGYIH+ G+IGIVSR
Sbjct  135   VITDGIPQHDMIKVKHALRSQSVTRVIGPNCPGIIKPNECKIGIMPGYIHQNGKIGIVSR  194

Query  771   SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  592
             SGTLTYEAV QTT  GLGQST VGIGGDPFNGTNF+D LERF+ DP+TEGIV+IGEIGG 
Sbjct  195   SGTLTYEAVDQTTRAGLGQSTVVGIGGDPFNGTNFIDVLERFMVDPETEGIVMIGEIGGE  254

Query  591   aeeeaaafIKESG-TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  415
              EE AA +IK++    KPVV FIAG+TAPP RRMGHAGAIVS GKG+A +KIR L++AG+
Sbjct  255   NEEMAADWIKKNNPKNKPVVGFIAGITAPPERRMGHAGAIVSKGKGSAPEKIRALEQAGI  314

Query  414   TVCESPAKLGTTMLDVFTKRGL  349
              V +SPA++G TML+V  ++GL
Sbjct  315   RVVKSPAQIGKTMLEVMKEKGL  336



>ref|WP_014415904.1| succinyl-CoA synthetase subsunit alpha [Rhodospirillum photometricum]
 emb|CCG09274.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Rhodospirillum 
photometricum DSM 122]
Length=291

 Score =   380 bits (977),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 209/288 (73%), Positives = 245/288 (85%), Gaps = 1/288 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             V V K+TRVICQG TG  GTFH+EQAI YGTKMVGGVTP KGGT HL LPVF+TVA+A+ 
Sbjct  3     VLVGKDTRVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLDLPVFDTVAEARE  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
              T  NA+VIYVPPPFA  AI+EA++AELDL VCITEGIP  DMVKVK AL+  +KTRL+G
Sbjct  63    RTGCNATVIYVPPPFAADAILEAIDAELDLAVCITEGIPVLDMVKVKRALRN-SKTRLVG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IHK G+IGIVSRSGTLTYEAV QTTA GLGQSTC+GIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHKRGKIGIVSRSGTLTYEAVAQTTAAGLGQSTCIGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNF+DCLE F+ DP+TEGI++IGEIGG+AEEEAA F+K+S   KP+  FIAG+TAP
Sbjct  182   PVNGTNFIDCLEMFLGDPETEGIIMIGEIGGSAEEEAAEFLKQSKIRKPMCGFIAGVTAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             PGRRMGHAGAI++GGKGTA+DK+  ++ AG+ V +SP+ LG+TML   
Sbjct  242   PGRRMGHAGAIIAGGKGTAEDKMEAMRSAGILVADSPSALGSTMLQAL  289



>dbj|GAA49470.1| succinyl-CoA synthetase alpha subunit [Clonorchis sinensis]
Length=342

 Score =   382 bits (981),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 204/308 (66%), Positives = 250/308 (81%), Gaps = 3/308 (1%)
 Frame = -2

Query  1290  ITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTP  1111
             I Q  + +     ++      + +D+NT++ICQG TGK GTFH +Q ++YGTK+VGGV+P
Sbjct  27    IQQYEVMKTSSRNVYADTRKHLMLDQNTKLICQGFTGKQGTFHCQQTLDYGTKLVGGVSP  86

Query  1110  KKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIP  931
              KGGT+HLGLPVFNTV +AK  T A ASVIYVPPPFA AAI EA+++E+ L+VCITEGIP
Sbjct  87    GKGGTKHLGLPVFNTVKEAKEATGATASVIYVPPPFAPAAINEAIDSEIPLIVCITEGIP  146

Query  930   QHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYE  751
             QHDM+++K  L +Q+ +RLIGPNCPGIIKP  CKIGIMPG+IH PG+IGIVSRSGTLTYE
Sbjct  147   QHDMIRIKKRLMEQSSSRLIGPNCPGIIKPNVCKIGIMPGHIHTPGKIGIVSRSGTLTYE  206

Query  750   AVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaa  571
             AVFQT+  G GQS C+GIGGDPFNGTNF+DCLE F+ DPQTEGI+L+GEIGG AEE+AAA
Sbjct  207   AVFQTSQEGHGQSLCIGIGGDPFNGTNFIDCLEVFLKDPQTEGILLLGEIGGEAEEKAAA  266

Query  570   fIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCES  400
             ++KE  +    KPV AFIAGLTAPPGRRMGHAGAI+S GKG A++K+  L++AGV V  S
Sbjct  267   YLKEHNSGPNRKPVAAFIAGLTAPPGRRMGHAGAIISMGKGGAKEKMACLEDAGVWVTAS  326

Query  399   PAKLGTTM  376
             PA+LG TM
Sbjct  327   PAQLGATM  334



>gb|ELU05339.1| hypothetical protein CAPTEDRAFT_170724 [Capitella teleta]
Length=334

 Score =   382 bits (980),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 211/304 (69%), Positives = 249/304 (82%), Gaps = 3/304 (1%)
 Frame = -2

Query  1254  RLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPV  1075
             +++ +  P + ++K+TRVICQG TG+ GT H++QAIEYGTKMVGGV+P K G  HLGLPV
Sbjct  29    KIYHNSRPNLKINKDTRVICQGFTGRQGTVHSQQAIEYGTKMVGGVSPAKAGQTHLGLPV  88

Query  1074  FNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALK  895
             F +V DAK  T A+ASVIYVPP FA AAI EA++AE+ LVV ITEGIPQ DMV+VK  L 
Sbjct  89    FASVKDAKEATGADASVIYVPPRFAAAAIEEAIDAEIGLVVVITEGIPQQDMVRVKYKLL  148

Query  894   QQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQ  715
             +Q KTR+IGPNCPGII+PG CKIGIMPG+IHKPG+IGIVSRSGTLTYEAV QT+ VGLGQ
Sbjct  149   RQDKTRMIGPNCPGIIQPGGCKIGIMPGHIHKPGKIGIVSRSGTLTYEAVHQTSLVGLGQ  208

Query  714   STCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGT---EK  544
             + CVGIGGDPFNGTNF+DCL+ F+ DP+TEGIVLIGEIGG AEE AA F+KE  +    K
Sbjct  209   TVCVGIGGDPFNGTNFIDCLDVFLKDPETEGIVLIGEIGGQAEERAADFLKEHNSGPNAK  268

Query  543   PVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             PVV+FIAGLTAPPGRRMGHAGAI+SGGKG AQ+KI  L+ AGV V  SPA++G+TML   
Sbjct  269   PVVSFIAGLTAPPGRRMGHAGAIISGGKGGAQEKIAALENAGVLVTRSPAQMGSTMLKAM  328

Query  363   TKRG  352
                G
Sbjct  329   QDAG  332



>ref|XP_001452638.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK85241.1| unnamed protein product [Paramecium tetraurelia]
Length=312

 Score =   380 bits (977),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 212/308 (69%), Positives = 254/308 (82%), Gaps = 2/308 (1%)
 Frame = -2

Query  1266  QQQHRLFGSP-APEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEH  1090
             +Q  R F S  AP V+V+K+T+VICQGITG  GTF TEQA+ Y TKMVGGV+PKK G+ H
Sbjct  4     KQIFRAFSSTTAPYVWVNKHTKVICQGITGNQGTFQTEQALNYFTKMVGGVSPKKAGSTH  63

Query  1089  LGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKV  910
             LGLPVF    +AK+ T  +ASVIYVPPP A +AI+EA+EA++ LVV IT+GIPQHDM+KV
Sbjct  64    LGLPVFKDCQEAKSATGCDASVIYVPPPTAASAIIEAIEAQIGLVVVITDGIPQHDMIKV  123

Query  909   KAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTA  730
             K AL+ Q+ TR+IGPNCPGIIKP ECKIGIMPGYIH+ G+IGIVSRSGTLTYEAV QTT 
Sbjct  124   KHALRSQSVTRVIGPNCPGIIKPNECKIGIMPGYIHQNGKIGIVSRSGTLTYEAVDQTTR  183

Query  729   VGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESG-  553
              GLGQST VGIGGDPFNGTNF+D LERF+ DP+TEGIV+IGEIGG  EE AA +IK++  
Sbjct  184   AGLGQSTVVGIGGDPFNGTNFIDVLERFMVDPETEGIVMIGEIGGENEEMAADWIKKNNP  243

Query  552   TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTML  373
               KPVV FIAG+TAPP RRMGHAGAIVS GKG+A +KIR L++AG+ V +SPA++G TML
Sbjct  244   KNKPVVGFIAGITAPPERRMGHAGAIVSKGKGSAPEKIRALEQAGIRVVKSPAQIGKTML  303

Query  372   DVFTKRGL  349
             +V  ++GL
Sbjct  304   EVMKEKGL  311



>gb|ABE76513.1| mitochondrial putative GDP-forming succinate-CoA ligase alpha 
subunit [Toxoplasma gondii]
Length=333

 Score =   381 bits (978),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 213/305 (70%), Positives = 242/305 (79%), Gaps = 7/305 (2%)
 Frame = -2

Query  1242  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTE------HLGL  1081
             S    VFVDKNT+VICQG+TGK G+FHTEQ + YGT+ VGGV P K G+          L
Sbjct  28    SSTARVFVDKNTKVICQGLTGKQGSFHTEQCLAYGTQFVGGVNPSKKGSTWQSSDGKFSL  87

Query  1080  PVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAA  901
             PVF TV +AK  T  +AS+I+VPPPFA  AIM+ +  E+ L VCITEGIPQ DMV+VK A
Sbjct  88    PVFGTVKEAKEATGCDASMIFVPPPFAAQAIMDCIAEEIPLAVCITEGIPQQDMVRVKQA  147

Query  900   LKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGL  721
             L  Q KTRLIGPNCPGIIKPGECKIGIMPGYIH  G+IG+VSRSGTLTYEAV QTT  GL
Sbjct  148   LLSQNKTRLIGPNCPGIIKPGECKIGIMPGYIHAKGKIGVVSRSGTLTYEAVNQTTQTGL  207

Query  720   GQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTE-K  544
             GQSTCVGIGGDPFNGTNF+DCLERFV DP+T+GIVLIGEIGG+AEEEAAA++KE   E K
Sbjct  208   GQSTCVGIGGDPFNGTNFIDCLERFVNDPETKGIVLIGEIGGSAEEEAAAWLKEHNKEQK  267

Query  543   PVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             PVV+FIAGLTAPPGRRMGHAGAIVSGGKGTA+ KI  L++AGV V  +PA +G  ML+V 
Sbjct  268   PVVSFIAGLTAPPGRRMGHAGAIVSGGKGTAEGKIAALEDAGVHVVRNPAAMGQKMLEVM  327

Query  363   TKRGL  349
                 L
Sbjct  328   QAADL  332



>ref|WP_020401362.1| succinyl-CoA synthetase subsunit alpha [Kordiimonas gwangyangensis]
Length=291

 Score =   379 bits (973),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 207/286 (72%), Positives = 241/286 (84%), Gaps = 1/286 (0%)
 Frame = -2

Query  1230  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  1051
              V V K+T+VICQG TG  GTFH+EQAI YGT+MVGGVTP KGG++HL LPVF+TVADA+
Sbjct  2     SVLVGKHTKVICQGFTGAQGTFHSEQAIAYGTQMVGGVTPGKGGSKHLDLPVFDTVADAR  61

Query  1050  AETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  871
               T ANASVIYVPPPFA  AI+EA++AEL+LVVCITEGIP  DMV+VK ALK  + TRLI
Sbjct  62    EATDANASVIYVPPPFAADAILEAIDAELELVVCITEGIPVMDMVRVKRALKN-SGTRLI  120

Query  870   GPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGG  691
             GPNCPG+I PGECKIGIMPG+IHK G +GIVSRSGTLTYEAV QTTA GLGQSTC+GIGG
Sbjct  121   GPNCPGVITPGECKIGIMPGHIHKRGNVGIVSRSGTLTYEAVAQTTAAGLGQSTCIGIGG  180

Query  690   DPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTA  511
             DP NGTNF+DCL+ F+ D +T+ I++IGEIGG+AEEEAA F+K S  +KP+  FIAG TA
Sbjct  181   DPVNGTNFIDCLDMFLGDDETQAIIMIGEIGGSAEEEAAEFLKHSKVKKPIAGFIAGRTA  240

Query  510   PPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTML  373
             PPGR MGHAGAIVSGGKG A+DKI  +K AG+ V +SPA LGTT+L
Sbjct  241   PPGRTMGHAGAIVSGGKGGAEDKIEAMKSAGIVVSDSPAALGTTLL  286



>ref|WP_014363954.1| succinyl-CoA synthetase subsunit alpha [Rickettsia canadensis]
 gb|AFB21145.1| succinyl-CoA synthetase subunit alpha [Rickettsia canadensis 
str. CA410]
Length=292

 Score =   379 bits (972),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 203/290 (70%), Positives = 246/290 (85%), Gaps = 1/290 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             + ++K T+VICQG TG  GTFH+EQAI YGT MVGGVTP KGG  HL LPV+NTV +AKA
Sbjct  3     ILINKKTKVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGDTHLDLPVYNTVHEAKA  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T ANASVIYVPP FA  +I+EA++AE+++VVCITEGIP  DMVKVK AL   +KTRLIG
Sbjct  63    KTGANASVIYVPPGFAADSILEAIDAEIEVVVCITEGIPVLDMVKVKRAL-VGSKTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPGYIH+ G +GIVSRSGTLTYEAV QTTAVGLGQSTCVGIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGYIHQRGIVGIVSRSGTLTYEAVAQTTAVGLGQSTCVGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNFVDC+E F+ D +T+ I++IGEIGG AEE+A+ FIK+S  +KP+V+FIAG+TAP
Sbjct  182   PVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEEDASDFIKQSKIKKPIVSFIAGITAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTK  358
             PG+RMGHAGAI++GGKG+A+DK+  L+ AG+T+  SPA +G TMLD+  K
Sbjct  242   PGKRMGHAGAIIAGGKGSAEDKLEALQSAGITITRSPADIGKTMLDLLNK  291



>ref|XP_004995026.1| succinyl-CoA ligase subunit alpha [Salpingoeca rosetta]
 gb|EGD83522.1| succinyl-CoA ligase subunit alpha [Salpingoeca rosetta]
Length=322

 Score =   379 bits (974),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 208/302 (69%), Positives = 253/302 (84%), Gaps = 3/302 (1%)
 Frame = -2

Query  1251  LFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVF  1072
             ++ +  P + ++K+T+VICQG TG+ GTFH+E AIEYGT+MVGGV+PKK G EHLGLPVF
Sbjct  20    MYTATRPNLLINKDTKVICQGFTGRQGTFHSEAAIEYGTRMVGGVSPKKAGQEHLGLPVF  79

Query  1071  NTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQ  892
              +V +AK ET A+A+V+YVPPP A AA++EAMEAE+ L+VCITEGIPQ DMV+VK AL Q
Sbjct  80    GSVEEAKRETNADATVVYVPPPGAAAAVLEAMEAEVPLIVCITEGIPQQDMVRVKHALLQ  139

Query  891   QTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQS  712
             Q K+RL+GPNCPGIIKPGECKIGIMPG+IH PG IG+VSRSGTLTYEAV QTT VGLGQS
Sbjct  140   QDKSRLVGPNCPGIIKPGECKIGIMPGHIHTPGNIGVVSRSGTLTYEAVGQTTTVGLGQS  199

Query  711   TCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGT---EKP  541
              CVGIGGDPFNGT+F+DCL+ F+ DP T GI++IGEIGG+AEEEAA F+K++ +    KP
Sbjct  200   LCVGIGGDPFNGTDFIDCLDVFLKDPDTHGIIMIGEIGGSAEEEAAEFLKQNNSGPNRKP  259

Query  540   VVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFT  361
             VV+FIAGLTAPPGRRMGHAGAI+SGGKG A +KI  L++AGV V +SPA++GT M     
Sbjct  260   VVSFIAGLTAPPGRRMGHAGAIISGGKGGAAEKIAALEDAGVIVAKSPAQMGTLMKQAME  319

Query  360   KR  355
              R
Sbjct  320   DR  321



>ref|WP_045774326.1| succinate--CoA ligase [Elstera litoralis]
 gb|KJV10941.1| succinate--CoA ligase [Elstera litoralis]
Length=292

 Score =   378 bits (971),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 210/291 (72%), Positives = 242/291 (83%), Gaps = 1/291 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             V V+KNT+VICQG TG  GTFH+EQAI YGT+MVGGVTP KGGT+HL LPVF+TVADA A
Sbjct  3     VLVNKNTKVICQGFTGAQGTFHSEQAIAYGTQMVGGVTPGKGGTKHLDLPVFDTVADAVA  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T ANA+VIYVPPPFA  AI+EA++AE++L VCITEGIP  DM++VK AL   +KTRLIG
Sbjct  63    KTGANATVIYVPPPFAADAILEAIDAEIELAVCITEGIPVQDMIRVKRAL-LGSKTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPGII PGECKIGIMPG+IHK G+IGIVSRSGTLTYEAV QTTA GLGQ+TCVGIGGD
Sbjct  122   PNCPGIITPGECKIGIMPGHIHKRGKIGIVSRSGTLTYEAVAQTTATGLGQTTCVGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNFVD LE FV DP+TEGI++IGEIGG AE     F++ SGT+KPVV FIAG TAP
Sbjct  182   PVNGTNFVDTLELFVKDPETEGIIMIGEIGGDAEVRGVEFLQASGTKKPVVGFIAGRTAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKR  355
             PGRRMGHAGA++SGG  TA  K+  +K AG+ V ESPA LG+TML +   R
Sbjct  242   PGRRMGHAGAVISGGNDTADFKVDAMKAAGIAVAESPADLGSTMLSLMNAR  292



>ref|XP_006441424.1| hypothetical protein CICLE_v10020931mg [Citrus clementina]
 gb|ESR54664.1| hypothetical protein CICLE_v10020931mg [Citrus clementina]
Length=281

 Score =   378 bits (970),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 202/253 (80%), Positives = 218/253 (86%), Gaps = 15/253 (6%)
 Frame = -2

Query  1344  MAWQT-ARLIANVSKKVRPITQSPLWQQQ---------QHRLFGSPA----PEVFVDKNT  1207
             MA Q  A+LI ++  + RP T S +   +           R +GS A    P VFVDKNT
Sbjct  1     MARQALAKLIGSIGSR-RPSTASSVSHYRLSSSAAPAAHSRNYGSSAAASHPAVFVDKNT  59

Query  1206  RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANAS  1027
             RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANAS
Sbjct  60    RVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANAS  119

Query  1026  VIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGII  847
             VIYVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRLIGPNCPGII
Sbjct  120   VIYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNRQSKTRLIGPNCPGII  179

Query  846   KPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNF  667
             KPGECKIGIMPGYIHKPGR+GIVSRSGTLTYEAVFQTT VGLGQSTCVG+GGDPFNGTNF
Sbjct  180   KPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTVVGLGQSTCVGVGGDPFNGTNF  239

Query  666   VDCLERFVADPQT  628
             VDCLE+F+ DPQT
Sbjct  240   VDCLEKFLVDPQT  252



>gb|EGV93208.1| Succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Cricetulus griseus]
Length=333

 Score =   380 bits (975),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 218/322 (68%), Positives = 261/322 (81%), Gaps = 5/322 (2%)
 Frame = -2

Query  1296  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  1123
             R ++++ L Q    +H  + +    +++DKNT+VICQG TGK GTFH++QA+EYGTK+VG
Sbjct  12    RLLSRTFLLQHNGIRHASYDASRKHIYIDKNTKVICQGFTGKQGTFHSQQALEYGTKLVG  71

Query  1122  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCIT  943
             G +P KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCIT
Sbjct  72    GTSPGKGGKTHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAITEAVDAEIPLVVCIT  131

Query  942   EGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGT  763
             EGIPQ DMV+V+  L  Q KTRLIGPNCPGII PGECKIGIMPG+IHK G+IGIVSRSGT
Sbjct  132   EGIPQQDMVRVRHTLSHQGKTRLIGPNCPGIINPGECKIGIMPGHIHKKGKIGIVSRSGT  191

Query  762   LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  583
             LTYEAV QTT VGLGQS C+GIGGDPFNGTNF+DCLE F+ DP TEGIVLIGEIGG AEE
Sbjct  192   LTYEAVHQTTQVGLGQSLCIGIGGDPFNGTNFIDCLEVFLNDPATEGIVLIGEIGGNAEE  251

Query  582   eaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  412
             +A+ F+KE  +    KPVV+FIAG+TAPPGRRMGHAGAI++GGKG A++KI  L+ AGV 
Sbjct  252   DASEFLKEHNSGPNAKPVVSFIAGVTAPPGRRMGHAGAIIAGGKGGAKEKISALQSAGVV  311

Query  411   VCESPAKLGTTMLDVFTKRGLL  346
             V  SPA+LG+T+   F KR +L
Sbjct  312   VSMSPAQLGSTIYKEFEKRKML  333



>ref|WP_040257675.1| MULTISPECIES: succinate--CoA ligase [spotted fever group]
 gb|KIJ89270.1| succinate--CoA ligase [Candidatus Rickettsia asemboensis]
 gb|KJV80962.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Rickettsia hoogstraalii str. RCCE3]
Length=292

 Score =   378 bits (971),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 205/290 (71%), Positives = 246/290 (85%), Gaps = 1/290 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             + ++K T+VICQG TG  GTFH+EQAI YGT MVGGVTP KGG  HL LPV+NTV +AKA
Sbjct  3     ILINKKTKVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGHTHLDLPVYNTVHEAKA  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T ANASVIYVPP FA  +I+EA++AE+++VVCITEGIP  DMVKVK AL   +KTRLIG
Sbjct  63    KTGANASVIYVPPGFAADSILEAIDAEIEVVVCITEGIPVLDMVKVKRAL-VGSKTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IHK G IGIVSRSGTLTYEAV QTTAVGLGQSTCVGIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVAQTTAVGLGQSTCVGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNFVDC++ F+ D +T+ I++IGEIGG AEE+AA FIK+S  +KP+V+FIAG+TAP
Sbjct  182   PVNGTNFVDCIDMFLKDDETKAIIMIGEIGGNAEEDAAEFIKQSKIKKPIVSFIAGITAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTK  358
             PG+RMGHAGAI++GGKG+A+DK+  L+ AGVT+  SPA +G TMLD+  K
Sbjct  242   PGKRMGHAGAIIAGGKGSAEDKLEALQSAGVTITRSPADIGKTMLDLLNK  291



>gb|EFA80958.1| Endo-beta-N-acetylglucosaminidase [Polysphondylium pallidum PN500]
Length=1362

 Score =   407 bits (1046),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 228/309 (74%), Positives = 263/309 (85%), Gaps = 4/309 (1%)
 Frame = -2

Query  1263  QQHRLFGSPA-PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHL  1087
             Q  R F S + P V VDKNT+VICQG+ GK GTFHT QAI+YGT+MVGGV+P KGGT+H 
Sbjct  14    QSARSFSSASKPFVLVDKNTKVICQGL-GKQGTFHTLQAIDYGTQMVGGVSPNKGGTKHE  72

Query  1086  G--LPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVK  913
                LP+FN+VADAK ET ANASVIYVPPP A  AI+EA+EAE++L+VCITEGIPQ DMV+
Sbjct  73    ATKLPLFNSVADAKRETGANASVIYVPPPGAADAIIEAIEAEMELIVCITEGIPQKDMVR  132

Query  912   VKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTT  733
             VK  L +Q KTRLIGPNCPGIIKPGECKIGIMPG+IH+PG+IGIVSRSGTLTYEAV QTT
Sbjct  133   VKYLLNRQNKTRLIGPNCPGIIKPGECKIGIMPGHIHRPGKIGIVSRSGTLTYEAVAQTT  192

Query  732   AVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESG  553
             AVGLGQSTCVGIGGDPFNGTNFVDCL+ F  DPQTEGI+LIGEIGG AEEEAA +++E+ 
Sbjct  193   AVGLGQSTCVGIGGDPFNGTNFVDCLKLFTKDPQTEGIILIGEIGGEAEEEAAQWLRENP  252

Query  552   TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTML  373
             T+KPVV+FIAGLTAPPGRRMGHAGAI+SGGKG A  K++ L++AGV +  SPAKLGTTML
Sbjct  253   TDKPVVSFIAGLTAPPGRRMGHAGAIISGGKGGADSKMKALQDAGVIMSLSPAKLGTTML  312

Query  372   DVFTKRGLL  346
             +   +R   
Sbjct  313   EAMNRRNFF  321



>ref|XP_002772148.1| Succinyl-CoA ligase, putative [Perkinsus marinus ATCC 50983]
 gb|EER03964.1| Succinyl-CoA ligase, putative [Perkinsus marinus ATCC 50983]
Length=332

 Score =   379 bits (974),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 225/320 (70%), Positives = 255/320 (80%), Gaps = 7/320 (2%)
 Frame = -2

Query  1296  RPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGV  1117
             R I  S      + R F S A  V+VDKNT+VICQG+TGK GTFHT QAIEYGTKMVGGV
Sbjct  8     RGIAASVPLSSLKGRAFSSTA-RVWVDKNTKVICQGLTGKQGTFHTAQAIEYGTKMVGGV  66

Query  1116  TPKKGGTEH----LGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVC  949
              PKK GT H      LP+F  V +A+  T A+ASV+YVPP  A +A +EA+EAE+ L+VC
Sbjct  67    NPKKAGTTHNVGDKNLPIFANVMEARQATGADASVVYVPPFAAASACLEAIEAEIPLLVC  126

Query  948   ITEGIPQHDMVKVKAALKQQT-KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSR  772
             ITEGIPQHDMVKVKAALK    KTRLIGPNCPGIIKPGECKIGIMPGYIHK G+IG+VSR
Sbjct  127   ITEGIPQHDMVKVKAALKMAGGKTRLIGPNCPGIIKPGECKIGIMPGYIHKKGKIGVVSR  186

Query  771   SGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggt  592
             SGTLTYEAV QTT VGLGQST VGIGGDPFNGTNF+DCLERFV DPQTEGI+LIGEIGG 
Sbjct  187   SGTLTYEAVNQTTEVGLGQSTVVGIGGDPFNGTNFIDCLERFVQDPQTEGIILIGEIGGA  246

Query  591   aeeeaaafIKESGTE-KPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGV  415
             AEEEAA ++KE+  + KPVV+FIAG+TAPPGRRMGHAGAI+SGGKGTA  KI  L+  G 
Sbjct  247   AEEEAAEWLKENNKDNKPVVSFIAGVTAPPGRRMGHAGAIISGGKGTAATKIAALEACGA  306

Query  414   TVCESPAKLGTTMLDVFTKR  355
              V  SPA LG  ML+++ +R
Sbjct  307   NVVRSPADLGIKMLEMYKQR  326



>ref|WP_012151579.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Rickettsia bellii]
 gb|ABV78618.1| succinyl-CoA synthetase subunit alpha [Rickettsia bellii OSU 
85-389]
Length=291

 Score =   377 bits (969),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 202/289 (70%), Positives = 243/289 (84%), Gaps = 1/289 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             + V+K T+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGG  HL LP++NTV +AKA
Sbjct  3     ILVNKKTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGKTHLDLPIYNTVHEAKA  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T ANASVIYVPPPFA  +I+EA++A +++VVCITEGIP  DMV+VK AL   ++TRLIG
Sbjct  63    KTGANASVIYVPPPFAADSILEAIDAGIEIVVCITEGIPVLDMVRVKRAL-VGSRTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPGII P ECKIGIMPG+IH+ G IGIVSRSGTLTYEAV QTTAVGLGQSTCVGIGGD
Sbjct  122   PNCPGIITPDECKIGIMPGHIHRKGSIGIVSRSGTLTYEAVAQTTAVGLGQSTCVGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNFVDC++ F+ D +T+ I++IGEIGG AEE AA FIK S  +KP+V+FIAG+TAP
Sbjct  182   PINGTNFVDCIDMFLQDDETKAIIMIGEIGGDAEENAADFIKHSKIKKPIVSFIAGITAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFT  361
             PG+RMGHAGAI++GGKG+A+DK+  L+ AGVT+  SPA +G TMLD+  
Sbjct  242   PGKRMGHAGAIIAGGKGSAEDKLEALQSAGVTITRSPADIGKTMLDLLN  290



>ref|WP_014746522.1| succinyl-CoA synthetase subsunit alpha [Tistrella mobilis]
 gb|AFK54845.1| Succinyl-CoA synthetase alpha chain [Tistrella mobilis KA081020-065]
Length=291

 Score =   377 bits (969),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 203/288 (70%), Positives = 244/288 (85%), Gaps = 1/288 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             V V+  T+VICQG TG+ GTFH+EQAI YGT+MVGGVTP KGGT HL LPVF+TVADA  
Sbjct  3     VLVNAQTKVICQGFTGQQGTFHSEQAIAYGTRMVGGVTPGKGGTTHLDLPVFDTVADAVE  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T A+ASVIYVPPP+A  AI+EA++AE+ LVVCITEGIP  DMV+VK AL +++KTRLIG
Sbjct  63    KTGADASVIYVPPPYAADAILEAVDAEVQLVVCITEGIPVLDMVRVKRAL-ERSKTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IH+ G+IGIVSRSGTLTYEAV QTTA GLGQSTC+GIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHQRGKIGIVSRSGTLTYEAVAQTTAAGLGQSTCIGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNF+D L+ F+ DP+TE I++IGEIGG+AEE+AA F+K+S  +KP V FIAG TAP
Sbjct  182   PINGTNFIDALDLFLKDPETEAIIMIGEIGGSAEEDAAEFLKQSKVKKPTVGFIAGRTAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             PGRRMGHAGAI+SGGKG A DK+  ++ AG+ + ESPA LG+TM+ V 
Sbjct  242   PGRRMGHAGAIISGGKGGADDKLEAMRSAGIVIAESPAALGSTMVQVL  289



>ref|WP_011477883.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Rickettsia bellii]
 sp|Q1RH56.1|SUCD_RICBR RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha; 
AltName: Full=Succinyl-CoA synthetase subunit alpha; Short=SCS-alpha 
[Rickettsia bellii RML369-C]
 gb|ABE05308.1| Succinyl-CoA synthetase alpha chain [Rickettsia bellii RML369-C]
 gb|KJV90339.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Rickettsia bellii str. RML An4]
 gb|KJV92834.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Rickettsia bellii str. RML Mogi]
Length=291

 Score =   377 bits (969),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 202/289 (70%), Positives = 243/289 (84%), Gaps = 1/289 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             + V+K T+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGG  HL LP++NTV +AKA
Sbjct  3     ILVNKKTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGKTHLDLPIYNTVHEAKA  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T ANASVIYVPPPFA  +I+EA++A +++VVCITEGIP  DMV+VK AL   ++TRLIG
Sbjct  63    KTGANASVIYVPPPFAADSILEAIDAGIEIVVCITEGIPVLDMVRVKRAL-VGSRTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPGII P ECKIGIMPG+IH+ G IGIVSRSGTLTYEAV QTTAVGLGQSTCVGIGGD
Sbjct  122   PNCPGIITPDECKIGIMPGHIHRKGSIGIVSRSGTLTYEAVAQTTAVGLGQSTCVGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNFVDC++ F+ D +T+ I++IGEIGG AEE AA FIK S  +KP+V+FIAG+TAP
Sbjct  182   PVNGTNFVDCIDMFLQDDETKAIIMIGEIGGDAEENAADFIKHSKIKKPIVSFIAGITAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFT  361
             PG+RMGHAGAI++GGKG+A+DK+  L+ AGVT+  SPA +G TMLD+  
Sbjct  242   PGKRMGHAGAIIAGGKGSAEDKLEALQSAGVTITRSPADIGKTMLDLLN  290



>ref|XP_007625515.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Cricetulus griseus]
Length=346

 Score =   379 bits (974),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 218/322 (68%), Positives = 261/322 (81%), Gaps = 5/322 (2%)
 Frame = -2

Query  1296  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  1123
             R ++++ L Q    +H  + +    +++DKNT+VICQG TGK GTFH++QA+EYGTK+VG
Sbjct  25    RLLSRTFLLQHNGIRHASYDASRKHIYIDKNTKVICQGFTGKQGTFHSQQALEYGTKLVG  84

Query  1122  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCIT  943
             G +P KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCIT
Sbjct  85    GTSPGKGGKTHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAITEAVDAEIPLVVCIT  144

Query  942   EGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGT  763
             EGIPQ DMV+V+  L  Q KTRLIGPNCPGII PGECKIGIMPG+IHK G+IGIVSRSGT
Sbjct  145   EGIPQQDMVRVRHTLSHQGKTRLIGPNCPGIINPGECKIGIMPGHIHKKGKIGIVSRSGT  204

Query  762   LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  583
             LTYEAV QTT VGLGQS C+GIGGDPFNGTNF+DCLE F+ DP TEGIVLIGEIGG AEE
Sbjct  205   LTYEAVHQTTQVGLGQSLCIGIGGDPFNGTNFIDCLEVFLNDPATEGIVLIGEIGGNAEE  264

Query  582   eaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  412
             +A+ F+KE  +    KPVV+FIAG+TAPPGRRMGHAGAI++GGKG A++KI  L+ AGV 
Sbjct  265   DASEFLKEHNSGPNAKPVVSFIAGVTAPPGRRMGHAGAIIAGGKGGAKEKISALQSAGVV  324

Query  411   VCESPAKLGTTMLDVFTKRGLL  346
             V  SPA+LG+T+   F KR +L
Sbjct  325   VSMSPAQLGSTIYKEFEKRKML  346



>ref|XP_003505683.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Cricetulus griseus]
Length=346

 Score =   379 bits (974),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 218/322 (68%), Positives = 261/322 (81%), Gaps = 5/322 (2%)
 Frame = -2

Query  1296  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  1123
             R ++++ L Q    +H  + +    +++DKNT+VICQG TGK GTFH++QA+EYGTK+VG
Sbjct  25    RLLSRTFLLQHNGIRHASYDASRKHIYIDKNTKVICQGFTGKQGTFHSQQALEYGTKLVG  84

Query  1122  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCIT  943
             G +P KGG  HLGLPVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCIT
Sbjct  85    GTSPGKGGKTHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAITEAVDAEIPLVVCIT  144

Query  942   EGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGT  763
             EGIPQ DMV+V+  L  Q KTRLIGPNCPGII PGECKIGIMPG+IHK G+IGIVSRSGT
Sbjct  145   EGIPQQDMVRVRHTLSHQGKTRLIGPNCPGIINPGECKIGIMPGHIHKKGKIGIVSRSGT  204

Query  762   LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  583
             LTYEAV QTT VGLGQS C+GIGGDPFNGTNF+DCLE F+ DP TEGIVLIGEIGG AEE
Sbjct  205   LTYEAVHQTTQVGLGQSLCIGIGGDPFNGTNFIDCLEVFLNDPATEGIVLIGEIGGNAEE  264

Query  582   eaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  412
             +A+ F+KE  +    KPVV+FIAG+TAPPGRRMGHAGAI++GGKG A++KI  L+ AGV 
Sbjct  265   DASEFLKEHNSGPNAKPVVSFIAGVTAPPGRRMGHAGAIIAGGKGGAKEKISALQSAGVV  324

Query  411   VCESPAKLGTTMLDVFTKRGLL  346
             V  SPA+LG+T+   F KR +L
Sbjct  325   VSMSPAQLGSTIYKEFEKRKML  346



>ref|XP_006675876.1| hypothetical protein BATDEDRAFT_36456 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF83302.1| hypothetical protein BATDEDRAFT_36456 [Batrachochytrium dendrobatidis 
JAM81]
Length=342

 Score =   379 bits (973),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 208/299 (70%), Positives = 246/299 (82%), Gaps = 4/299 (1%)
 Frame = -2

Query  1248  FGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN  1069
             + + A  + +DKNT+VICQG TGK GT H++ AIEYGT+MVGG +P K GT HLGLPVF 
Sbjct  37    YNNTALNMMIDKNTKVICQGFTGKMGTLHSKAAIEYGTRMVGGTSPSKAGTTHLGLPVFG  96

Query  1068  TVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQ  889
             +V +A +E K +ASVIYVPPP A AAI+EA++AE+ LVVCITEGIPQ DMVKVK  L  Q
Sbjct  97    SVKEAVSEVKPDASVIYVPPPGAAAAIIEAIQAEIPLVVCITEGIPQQDMVKVKKILLNQ  156

Query  888   TKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQST  709
              K+RLIGPNCPGIIKP +CKIGIMPG+IH+PG+IGIVSRSGTLTYEAV QTTA GLGQ+ 
Sbjct  157   NKSRLIGPNCPGIIKPDQCKIGIMPGHIHRPGKIGIVSRSGTLTYEAVAQTTAAGLGQTL  216

Query  708   CVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTE----KP  541
             CVGIGGDPFNGTNFVDCL+ F+ADP+TEGIVLIGEIGG+AEE+AA ++ +        KP
Sbjct  217   CVGIGGDPFNGTNFVDCLKVFLADPETEGIVLIGEIGGSAEEDAAEYLMQHNMSRSNPKP  276

Query  540   VVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             VV+FIAGL+APPGRRMGHAGAI+SGGKG A+DK+  L+ AGV V +SPAKLG  M   F
Sbjct  277   VVSFIAGLSAPPGRRMGHAGAIISGGKGKAEDKVAALQRAGVIVSQSPAKLGYYMKKAF  335



>ref|XP_009162469.1| hypothetical protein T265_00432 [Opisthorchis viverrini]
 gb|KER33751.1| hypothetical protein T265_00432 [Opisthorchis viverrini]
Length=326

 Score =   379 bits (972),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 201/303 (66%), Positives = 248/303 (82%), Gaps = 3/303 (1%)
 Frame = -2

Query  1275  LWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGT  1096
             + +     ++      + +D+NT++ICQG TGK GTFH +Q ++YGTK+VGGV+P KGG+
Sbjct  16    IMKTASRNVYADTRKHLMLDQNTKLICQGFTGKQGTFHCQQTLDYGTKLVGGVSPGKGGS  75

Query  1095  EHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMV  916
             +HLGLPVFNTV +AK  T A ASVIYVPPPFA AAI EA+++E+ L+VCITEGIPQHDM+
Sbjct  76    KHLGLPVFNTVKEAKEATGATASVIYVPPPFAPAAINEAIDSEIPLIVCITEGIPQHDMI  135

Query  915   KVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQT  736
             ++K  L +Q+ +RLIGPNCPGIIKP  CKIGIMPG+IH PG+IGIVSRSGTLTYEAVFQT
Sbjct  136   RIKKRLMEQSSSRLIGPNCPGIIKPNVCKIGIMPGHIHTPGKIGIVSRSGTLTYEAVFQT  195

Query  735   TAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKES  556
             +  G GQS C+GIGGDPFNGTNF+DCLE F+ DPQTEGI+L+GEIGG AEE+AAA++KE 
Sbjct  196   SQEGHGQSLCIGIGGDPFNGTNFIDCLEVFLKDPQTEGILLLGEIGGEAEEKAAAYLKEH  255

Query  555   GT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLG  385
              +    KPV AFIAGLTAPPGRRMGHAGAI+S GKG A++K+  L++AGV V  SPA+LG
Sbjct  256   NSGPNRKPVAAFIAGLTAPPGRRMGHAGAIISMGKGGAKEKMACLEDAGVCVTASPAQLG  315

Query  384   TTM  376
              TM
Sbjct  316   ATM  318



>ref|WP_039594975.1| succinate--CoA ligase [Rickettsia felis]
 gb|KHO03566.1| succinate--CoA ligase [Rickettsia felis]
Length=292

 Score =   377 bits (968),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 204/290 (70%), Positives = 245/290 (84%), Gaps = 1/290 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             + ++K T+VICQG TG  GTFH+EQAI YGT MVGGVTP KGG  HL LPV+NTV +AKA
Sbjct  3     ILINKKTKVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGHTHLDLPVYNTVHEAKA  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T ANASVIYVPP FA  +I+EA++AE+++VVCITEGIP  DMVKVK AL   +KTRLIG
Sbjct  63    KTGANASVIYVPPSFAADSILEAIDAEIEVVVCITEGIPVLDMVKVKRAL-VGSKTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IHK G IGIVSRSGTLTYEAV QTTAVGLGQSTCVGIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVAQTTAVGLGQSTCVGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNFVDC++ F+ D +T+ I++IGEIGG AEE+AA FIK+S  +KP+V+FIAG+TAP
Sbjct  182   PVNGTNFVDCIDMFLKDDETKAIIMIGEIGGNAEEDAAEFIKQSKIKKPIVSFIAGITAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTK  358
             PG+RMGHAGAI++GGKG+A+DK+  L+ AGVT+  SPA +G TM D+  K
Sbjct  242   PGKRMGHAGAIIAGGKGSAEDKLEALQSAGVTITRSPADIGKTMFDLLNK  291



>ref|WP_014014291.1| MULTISPECIES: succinyl-CoA synthetase subsunit alpha [spotted 
fever group]
 gb|AEK74640.1| succinyl-CoA synthetase subunit alpha [Rickettsia heilongjiangensis 
054]
 dbj|BAK96677.1| succinyl-CoA synthetase alpha subunit [Rickettsia japonica YH]
 gb|KJW04433.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Rickettsia argasii T170-B]
Length=292

 Score =   377 bits (968),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 206/290 (71%), Positives = 245/290 (84%), Gaps = 1/290 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             + ++K T+VICQG TG  GTFH+EQAI YGT MVGGVTP KGG  HL LPV+NTV +AKA
Sbjct  3     ILINKKTQVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGHTHLDLPVYNTVHEAKA  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T ANASVIYVPP FA  +I+EA++AE+++VVCITEGIP  DMVKVK AL   +KTRLIG
Sbjct  63    KTGANASVIYVPPGFAADSILEAIDAEIEVVVCITEGIPVLDMVKVKRAL-VGSKTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IHK G IGIVSRSGTLTYEAV QTTAVGLGQSTCVGIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVAQTTAVGLGQSTCVGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNFVDC+E F+ D +T+ I++IGEIGG AEE+AA FIK+S  +KP+V+FIAG+TAP
Sbjct  182   PVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEEDAAEFIKQSKIKKPIVSFIAGITAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTK  358
             PG+RMGHAGAI+ GG G+A+DK+ TL+ AGVT+  SPA +G TMLD+  K
Sbjct  242   PGKRMGHAGAIIVGGTGSAEDKLETLQSAGVTITRSPADIGKTMLDLLNK  291



>ref|WP_022731741.1| succinyl-CoA synthetase subsunit alpha [Thalassospira lucentensis]
Length=291

 Score =   377 bits (968),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 208/288 (72%), Positives = 244/288 (85%), Gaps = 1/288 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             V VDKNT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGGT+HL LPVFNTVA+AK 
Sbjct  3     VLVDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTKHLDLPVFNTVAEAKH  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
              T+ANASVIYVPPPFA  AI+EA++A+++L VCITEGIP  DMV+VK AL + + TRLIG
Sbjct  63    VTEANASVIYVPPPFAADAILEAIDAKIELAVCITEGIPVADMVRVKRAL-EGSSTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I P ECKIGIMPG+IH+ G+IGIVSRSGTLTYEAV QTTA GLGQSTC+GIGGD
Sbjct  122   PNCPGVITPDECKIGIMPGHIHRRGKIGIVSRSGTLTYEAVAQTTAAGLGQSTCIGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNF+DCL+ F+ DP+TEGI++IGEIGGTAEEEA  F+K S  +KPV  FIAG+TAP
Sbjct  182   PVNGTNFIDCLDLFLRDPETEGIIMIGEIGGTAEEEACEFLKASAVKKPVAGFIAGVTAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             PG+RMGHAGAI+SGG+GTA  K+  ++ AGV V +SPA LG+TML   
Sbjct  242   PGKRMGHAGAIISGGQGTADAKMEAMRSAGVLVADSPASLGSTMLKAL  289



>ref|WP_008579810.1| MULTISPECIES: succinyl-CoA synthetase subsunit alpha [Rickettsia]
 gb|EER21581.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Rickettsia endosymbiont 
of Ixodes scapularis]
 gb|KDO03309.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Rickettsia sp. 
ISO7]
 gb|KJW02767.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Rickettsia endosymbiont of Ixodes pacificus]
Length=292

 Score =   377 bits (968),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 205/290 (71%), Positives = 245/290 (84%), Gaps = 1/290 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             + ++K T+VICQG TG  GTFH+EQAI YGT MVGGVTP KGG  HL LPV+NTV +AKA
Sbjct  3     ILINKKTKVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGHTHLDLPVYNTVHEAKA  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T ANASVIYVPP FA  +I+EA++AE+++VVCITEGIP  DMVKVK AL   +KTRLIG
Sbjct  63    KTGANASVIYVPPGFAADSILEAIDAEIEVVVCITEGIPVLDMVKVKRAL-VGSKTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IHK G IGIVSRSGTLTYEAV QTTAVGLGQSTCVGIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVAQTTAVGLGQSTCVGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P N TNFVDC+E F+ D +T+ I++IGEIGG AEE+AA FIK+S  +KP+V+FIAG+TAP
Sbjct  182   PVNDTNFVDCIEMFLKDDETKAIIMIGEIGGNAEEDAAEFIKQSKIKKPIVSFIAGITAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTK  358
             PG+RMGHAGAI++GGKG+A+DK+  L+ AGVT+  SPA +G TMLD+  K
Sbjct  242   PGKRMGHAGAIIAGGKGSAEDKLEALQSAGVTITRSPADIGKTMLDLLNK  291



>ref|XP_004660591.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial [Jaculus jaculus]
Length=348

 Score =   379 bits (973),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 218/322 (68%), Positives = 263/322 (82%), Gaps = 5/322 (2%)
 Frame = -2

Query  1296  RPITQSPLWQQQ--QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVG  1123
             R ++++ L QQ   +H  + +    ++VDKNT+VICQG TGK GTFH++QA+EYGTK+VG
Sbjct  27    RLLSRTFLLQQNGIRHSSYVASRKNLYVDKNTKVICQGFTGKQGTFHSQQALEYGTKLVG  86

Query  1122  GVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCIT  943
             G TP KGG  HLGLPVF++V +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCIT
Sbjct  87    GTTPGKGGMTHLGLPVFDSVKEAKEKTGATASVIYVPPPFAAAAITEAIDAEIPLVVCIT  146

Query  942   EGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGT  763
             EGIPQ DMV+V+  L  Q KTRL+GPNCPG+I PGECKIGIMPG+IHK GRIGIVSRSGT
Sbjct  147   EGIPQQDMVRVRHKLSHQGKTRLVGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGT  206

Query  762   LTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaee  583
             LTYEAV QTT VGLGQS C+GIGGDPFNGT+F+DCLE F+ DP+TEG++LIGEIGG AEE
Sbjct  207   LTYEAVHQTTEVGLGQSLCIGIGGDPFNGTDFIDCLELFLNDPRTEGVILIGEIGGHAEE  266

Query  582   eaaafIKESG---TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVT  412
              AA F+K+     T KPVV+FIAGLTAPPGRRMGHAGAI++GGKG A++KI  L++AGV 
Sbjct  267   HAAEFLKQHNAGPTAKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKIAALQDAGVV  326

Query  411   VCESPAKLGTTMLDVFTKRGLL  346
             V  SPA+LGTT+   F KR +L
Sbjct  327   VTMSPAQLGTTLYKEFEKRKML  348



>ref|WP_014241630.1| succinyl-CoA synthetase subsunit alpha [Azospirillum brasilense]
 emb|CCC99459.1| succinyl-CoA synthetase, alpha subunit,NAD(P)-binding [Azospirillum 
brasilense Sp245]
 gb|EZQ09513.1| succinate--CoA ligase [Azospirillum brasilense]
 gb|AIB12739.1| succinate--CoA ligase [Azospirillum brasilense]
Length=291

 Score =   377 bits (967),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 213/288 (74%), Positives = 242/288 (84%), Gaps = 1/288 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             V VDKNT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGGT+HL LPVF+TVADA  
Sbjct  3     VLVDKNTKVICQGFTGAQGTFHSEQAIAYGTKMVGGVTPGKGGTKHLDLPVFDTVADAVE  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T ANASVIYVPPPFA  AI+EA++AE+ LVVCITEGIP  DMV+VK AL   +KTRLIG
Sbjct  63    KTGANASVIYVPPPFAADAILEAIDAEIPLVVCITEGIPVLDMVRVKRAL-GNSKTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPGII P ECKIGIMPG+IHK G+IGIVSRSGTLTYEAV QTTA GLGQ+TC+GIGGD
Sbjct  122   PNCPGIITPDECKIGIMPGHIHKRGKIGIVSRSGTLTYEAVAQTTAAGLGQTTCIGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNFVD LE F+ DP+TEGI++IGEIGG AE + A FI++SGT+KPVV FIAG TAP
Sbjct  182   PVNGTNFVDSLELFLKDPETEGIIMIGEIGGDAEVKGAEFIRDSGTKKPVVGFIAGRTAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             PGRRMGHAGA++SGG  TA  KI  +K  G+ V +SPA LG+TML VF
Sbjct  242   PGRRMGHAGAVISGGNDTADFKIEFMKSVGIAVADSPASLGSTMLKVF  289



>ref|WP_017443052.1| succinyl-CoA synthetase subsunit alpha [Candidatus Rickettsia 
gravesii]
Length=292

 Score =   377 bits (967),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 204/290 (70%), Positives = 245/290 (84%), Gaps = 1/290 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             + ++K T+VICQG TG  GTFH+EQAI YGT MVGGVTP KGG  HL LPV+NTV +AKA
Sbjct  3     ILINKKTQVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGHTHLDLPVYNTVHEAKA  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T ANASVIYVPP FA  +I+EA++A++++VVCITEGIP  DMVKVK AL   +KTRLIG
Sbjct  63    KTGANASVIYVPPGFAADSILEAIDAKIEVVVCITEGIPVLDMVKVKRAL-VGSKTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IHK G IGIVSRSGTLTYEAV QTTAVGLGQSTCVGIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVAQTTAVGLGQSTCVGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNFVDC+E F+ D +T+ I++IGEIGG AEE+AA FIK+S  +KP+V+FIAG+TAP
Sbjct  182   PVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEEDAAEFIKQSKIKKPIVSFIAGITAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTK  358
             PG+RMGHAGAI++GG G+A+DK+  L+ AGVT+  SPA +G TMLD+  K
Sbjct  242   PGKRMGHAGAIIAGGTGSAEDKLEALQSAGVTITRSPADIGKTMLDLLNK  291



>ref|WP_045800311.1| succinate--CoA ligase [Candidatus Rickettsia amblyommii]
Length=292

 Score =   377 bits (967),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 205/290 (71%), Positives = 245/290 (84%), Gaps = 1/290 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             + ++K T+VICQG TG  GTFH+EQAI YGT MVGGVTP KGG  HL LPV+NTV +AKA
Sbjct  3     ILINKKTQVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGHTHLDLPVYNTVHEAKA  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T ANASVIYVPP FA  +I+EA++AE+++VVCITEGIP  DMVKVK AL   +KTRLIG
Sbjct  63    KTGANASVIYVPPGFAADSILEAIDAEIEVVVCITEGIPVLDMVKVKRAL-VGSKTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IHK G IGIVSRSGTLTYEAV QTTAVGLGQSTCVGIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVAQTTAVGLGQSTCVGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNFVDC+E F+ D +T+ I++IGEIGG AEE+AA FIK+S  +KP+V+FIAG+TAP
Sbjct  182   PVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEEDAAEFIKQSKIKKPIVSFIAGITAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTK  358
             PG+RMGHAGAI++GG G+A+DK+  L+ AGVT+  SPA +G TMLD+  K
Sbjct  242   PGKRMGHAGAIITGGTGSAEDKLEALQSAGVTITRSPADIGKTMLDLLNK  291



>ref|WP_014392217.1| succinyl-CoA synthetase subsunit alpha [Candidatus Rickettsia 
amblyommii]
 gb|AFC69698.1| succinyl-CoA synthetase subunit alpha [Candidatus Rickettsia 
amblyommii str. GAT-30V]
Length=292

 Score =   377 bits (967),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 204/290 (70%), Positives = 245/290 (84%), Gaps = 1/290 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             + ++K T+VICQG TG  GTFH+EQAI YGT MVGGVTP KGG  HL LPV+NTV +AKA
Sbjct  3     ILINKKTQVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGHTHLDLPVYNTVHEAKA  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T ANASVIYVPP FA  +I+EA++A++++VVCITEGIP  DMVKVK AL   +KTRLIG
Sbjct  63    KTGANASVIYVPPGFAADSILEAIDAKIEVVVCITEGIPVLDMVKVKRAL-VGSKTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IHK G IGIVSRSGTLTYEAV QTTAVGLGQSTCVGIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVAQTTAVGLGQSTCVGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNFVDC+E F+ D +T+ I++IGEIGG AEE+AA FIK+S  +KP+V+FIAG+TAP
Sbjct  182   PVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEEDAAEFIKQSKIKKPIVSFIAGITAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTK  358
             PG+RMGHAGAI++GG G+A+DK+  L+ AGVT+  SPA +G TMLD+  K
Sbjct  242   PGKRMGHAGAIITGGTGSAEDKLEALQSAGVTITRSPADIGKTMLDLLNK  291



>ref|WP_012148768.1| succinyl-CoA synthetase subsunit alpha [Rickettsia canadensis]
 gb|ABV73572.1| succinyl-CoA synthetase alpha subunit [Rickettsia canadensis 
str. McKiel]
Length=292

 Score =   377 bits (967),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 202/291 (69%), Positives = 245/291 (84%), Gaps = 1/291 (0%)
 Frame = -2

Query  1230  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  1051
              + ++K T+VICQG TG  GTFH+EQAI YGT MVGGVTP KGG  HL LPV+NTV +AK
Sbjct  2     SILINKKTKVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGDTHLDLPVYNTVHEAK  61

Query  1050  AETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  871
             A+T ANASVIYVPP FA  +I+EA++AE+++VVCITEGIP  DMVKVK AL   +KTRLI
Sbjct  62    AKTGANASVIYVPPGFAADSILEAIDAEIEVVVCITEGIPVLDMVKVKRAL-VGSKTRLI  120

Query  870   GPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGG  691
             GPNCPG+I PGECKIGIMPGYIH+ G +GIVSRSGTLTYEAV QTTAVGLGQSTCVGIGG
Sbjct  121   GPNCPGVITPGECKIGIMPGYIHQRGIVGIVSRSGTLTYEAVAQTTAVGLGQSTCVGIGG  180

Query  690   DPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTA  511
             DP NGTNFVDC+E F+ D +T+ I++IGEIGG AEE+A+ FIK+S  +KP+V+FIAG+TA
Sbjct  181   DPVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEEDASDFIKQSKIKKPIVSFIAGITA  240

Query  510   PPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTK  358
             PPG+RMGHAGAI++GGKG+A+DK+  L+ AG+T+   PA +G TMLD+  K
Sbjct  241   PPGKRMGHAGAIIAGGKGSAEDKLEALQSAGITITRCPADIGKTMLDLLNK  291



>ref|WP_011270994.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Rickettsia felis]
 sp|Q4ULQ8.1|SUCD_RICFE RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha; 
AltName: Full=Succinyl-CoA synthetase subunit alpha; Short=SCS-alpha 
[Rickettsia felis URRWXCal2]
 gb|AAY61515.1| Succinyl-CoA synthetase alpha chain [Rickettsia felis URRWXCal2]
 gb|KHO02928.1| succinate--CoA ligase [Rickettsia felis str. LSU]
 gb|KJV57771.1| succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial 
[Rickettsia felis str. Pedreira]
Length=292

 Score =   376 bits (966),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 204/290 (70%), Positives = 245/290 (84%), Gaps = 1/290 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             + ++K T+VICQG TG  GTFH+EQAI YGT MVGGVTP KGG  HL LPV+NTV +AKA
Sbjct  3     ILINKKTKVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGHTHLDLPVYNTVHEAKA  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T ANASVIYVPP FA  +I+EA++AE+++VVCITEGIP  DMVKVK AL   +KTRLIG
Sbjct  63    KTGANASVIYVPPGFAADSILEAIDAEIEVVVCITEGIPVLDMVKVKRAL-VGSKTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IHK G IGIVSRSGTLTYEAV QTTAVGLGQSTCVGIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVAQTTAVGLGQSTCVGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNFVDC++ F+ D +T+ I++IGEIGG AEE+AA FIK+S  +KP+V+FIAG+TAP
Sbjct  182   PVNGTNFVDCIDMFLKDDETKAIIMIGEIGGNAEEDAAEFIKQSKIKKPIVSFIAGITAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTK  358
             PG+RMGHAGAI++GGKG+A+DK+  L+ AGVT+  SPA +G TM D+  K
Sbjct  242   PGKRMGHAGAIIAGGKGSAEDKLEALQSAGVTITRSPADIGKTMFDLLNK  291



>ref|WP_008621975.1| succinyl-CoA synthetase subunit alpha [Magnetospirillum sp. SO-1]
 gb|EME67765.1| succinyl-CoA synthetase subunit alpha [Magnetospirillum sp. SO-1]
Length=291

 Score =   376 bits (966),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 203/288 (70%), Positives = 236/288 (82%), Gaps = 1/288 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             V V+ NT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGGT HL LPVFNTVA+AKA
Sbjct  3     VLVNANTKVICQGFTGAQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLDLPVFNTVAEAKA  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T  NASVIYVPPPFA  AI+EA++AE++L VCITEGIP  DM+ VK AL Q +KTRLIG
Sbjct  63    KTGCNASVIYVPPPFAADAILEAIDAEIELAVCITEGIPVADMLAVKRAL-QGSKTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IH  G+IGIVSRSGTLTYEAV QTTA GLGQ+TC+GIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHMRGKIGIVSRSGTLTYEAVAQTTATGLGQTTCIGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNFVD LE F+ADP+T+ I++IGEIGG AE + A  +K S  +KP V FIAG TAP
Sbjct  182   PINGTNFVDSLELFLADPETQAIIMIGEIGGDAEVQGAELLKRSKIKKPTVGFIAGRTAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             PGRRMGHAGA++SGG  TA  K+  LK AG+ V +SPA LG+TM+ + 
Sbjct  242   PGRRMGHAGAVISGGNDTADFKVEALKSAGIAVADSPASLGSTMVQLL  289



>ref|WP_012152767.1| MULTISPECIES: succinyl-CoA synthetase subsunit alpha [spotted 
fever group]
 gb|ABV84792.1| Succinyl-CoA synthetase alpha chain [Rickettsia massiliae MTU5]
 gb|AFB31772.1| succinyl-CoA synthetase subunit alpha [Rickettsia massiliae str. 
AZT80]
 gb|AFC72363.1| succinyl-CoA synthetase subunit alpha [Rickettsia rhipicephali 
str. 3-7-female6-CWPP]
Length=292

 Score =   376 bits (966),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 204/290 (70%), Positives = 245/290 (84%), Gaps = 1/290 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             + ++K T+VICQG TG  GTFH+EQAI YGT MVGGVTP KGG  HL LPV+NTV +AKA
Sbjct  3     ILINKKTQVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGHTHLDLPVYNTVHEAKA  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T ANASVIYVPP FA  +I+EA++A++++VVCITEGIP  DMVKVK AL   +KTRLIG
Sbjct  63    KTGANASVIYVPPGFAADSILEAIDAKIEVVVCITEGIPVLDMVKVKRAL-VGSKTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IHK G IGIVSRSGTLTYEAV QTTAVGLGQSTCVGIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVAQTTAVGLGQSTCVGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNFVDC+E F+ D +T+ I++IGEIGG AEE+AA FIK+S  +KP+V+FIAG+TAP
Sbjct  182   PVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEEDAAEFIKQSKIKKPIVSFIAGITAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTK  358
             PG+RMGHAGAI++GG G+A+DK+  L+ AGVT+  SPA +G TMLD+  K
Sbjct  242   PGKRMGHAGAIIAGGTGSAKDKLEALQSAGVTITRSPADIGKTMLDLLNK  291



>ref|WP_038528120.1| succinate--CoA ligase [Azospirillum brasilense]
 gb|EZQ08744.1| succinate--CoA ligase [Azospirillum brasilense]
 gb|AIB11866.1| succinate--CoA ligase [Azospirillum brasilense]
Length=291

 Score =   376 bits (965),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 213/288 (74%), Positives = 241/288 (84%), Gaps = 1/288 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             V VDKNT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGGT+HL LPVF+TVADA  
Sbjct  3     VLVDKNTKVICQGFTGAQGTFHSEQAIAYGTKMVGGVTPGKGGTKHLDLPVFDTVADAVE  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T ANASVIYVPPPFA  AI+EA++AE+ LVVCITEGIP  DMV+VK AL   +KTRLIG
Sbjct  63    KTGANASVIYVPPPFAADAILEAIDAEIPLVVCITEGIPVLDMVRVKRAL-GNSKTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPGII P ECKIGIMPG+IHK G+IGIVSRSGTLTYEAV QTTA GLGQ+TC+GIGGD
Sbjct  122   PNCPGIITPDECKIGIMPGHIHKRGKIGIVSRSGTLTYEAVAQTTAAGLGQTTCIGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNFVD LE F+ DP+TEGI++IGEIGG AE + A FI++SGT KPVV FIAG TAP
Sbjct  182   PVNGTNFVDSLELFLKDPETEGIIMIGEIGGDAEVKGAEFIRDSGTRKPVVGFIAGRTAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             PGRRMGHAGA++SGG  TA  KI  +K  G+ V +SPA LG+TML VF
Sbjct  242   PGRRMGHAGAVISGGNDTADFKIDFMKSVGIAVADSPASLGSTMLKVF  289



>ref|WP_011386313.1| succinyl-CoA synthetase subsunit alpha [Magnetospirillum magneticum]
 dbj|BAE52763.1| Succinyl-CoA synthetase [Magnetospirillum magneticum AMB-1]
Length=291

 Score =   376 bits (965),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 203/288 (70%), Positives = 236/288 (82%), Gaps = 1/288 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             V V+ NT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGGT HL LPVFNTVA+AKA
Sbjct  3     VLVNSNTKVICQGFTGAQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLDLPVFNTVAEAKA  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T  NASVIYVPPPFA  AI+EA++AE++L VCITEGIP  DM+ VK AL Q +KTRLIG
Sbjct  63    KTGCNASVIYVPPPFAADAILEAIDAEIELAVCITEGIPVADMLAVKRAL-QGSKTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IH  G+IGIVSRSGTLTYEAV QTTA GLGQ+TC+GIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHMRGKIGIVSRSGTLTYEAVAQTTATGLGQTTCIGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNFVD LE F+ADP+T+ I++IGEIGG AE + A  +K S  +KP V FIAG TAP
Sbjct  182   PINGTNFVDSLELFLADPETQAIIMIGEIGGDAEVQGAELLKRSKIKKPTVGFIAGRTAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             PGRRMGHAGA++SGG  TA  K+  LK AG+ V +SPA LG+TM+ + 
Sbjct  242   PGRRMGHAGAVISGGNDTADFKVEALKSAGIAVADSPASLGSTMVKLL  289



>gb|KCW57893.1| hypothetical protein EUGRSUZ_H00643 [Eucalyptus grandis]
Length=255

 Score =   374 bits (961),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 200/204 (98%), Gaps = 0/204 (0%)
 Frame = -2

Query  1233  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  1054
             P VFVDK+TRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVA+A
Sbjct  42    PAVFVDKSTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVAEA  101

Query  1053  KAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRL  874
             KAETKANASV+YVPPPFA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL +Q+KTRL
Sbjct  102   KAETKANASVVYVPPPFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNRQSKTRL  161

Query  873   IGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIG  694
             IGPNCPGIIKPGECKIGIMPGYIHKPGR+GIVSRSGTLTYEAVFQTTAVGLGQSTCVGIG
Sbjct  162   IGPNCPGIIKPGECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIG  221

Query  693   GDPFNGTNFVDCLERFVADPQTEG  622
             GDPFNGTNFVDCLERFV DPQTEG
Sbjct  222   GDPFNGTNFVDCLERFVVDPQTEG  245



>ref|WP_014409142.1| succinyl-CoA synthetase subsunit alpha [Rickettsia montanensis]
 emb|CAC33597.1| Succinyl-CoA synthetase alpha subunit [Rickettsia montanensis]
 gb|AFC72998.1| succinyl-CoA synthetase subunit alpha [Rickettsia montanensis 
str. OSU 85-930]
Length=292

 Score =   375 bits (964),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 205/290 (71%), Positives = 244/290 (84%), Gaps = 1/290 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             + ++K T+VICQG TG  GTFH+EQAI YGT MVGGVTP KGG  HL LPV+NTV +AKA
Sbjct  3     ILINKKTQVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGHTHLDLPVYNTVHEAKA  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T ANASVIYVPP FA  +I+EA++AE+++VVCITEGIP  DMVKVK AL   +KTRLIG
Sbjct  63    KTGANASVIYVPPGFAADSILEAIDAEIEVVVCITEGIPVLDMVKVKRAL-VGSKTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IHK G IGIVSRSGTLTYEAV QTT VGLGQSTCVGIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVAQTTTVGLGQSTCVGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNFVDC+E F+ D +T+ I++IGEIGG AEE+AA FIK+S  +KP+V+FIAG+TAP
Sbjct  182   PVNGTNFVDCIEMFLKDDETKAIIMIGEIGGNAEEDAAEFIKQSKIKKPIVSFIAGITAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTK  358
             PG+RMGHAGAI++GG G+A+DKI  L+ AGVT+  SPA +G TMLD+  K
Sbjct  242   PGKRMGHAGAIIAGGTGSAEDKIEALQSAGVTITRSPADIGKTMLDLLNK  291



>ref|XP_786544.2| PREDICTED: succinyl-CoA ligase subunit alpha, mitochondrial [Strongylocentrotus 
purpuratus]
Length=326

 Score =   377 bits (968),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 214/297 (72%), Positives = 244/297 (82%), Gaps = 3/297 (1%)
 Frame = -2

Query  1233  PEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADA  1054
             P + ++K T+VICQGITGK G FHT QAIEYGT MVGGVTP K G    GLPVF++  +A
Sbjct  28    PNLGINKTTKVICQGITGKQGAFHTTQAIEYGTNMVGGVTPGKSGQVSCGLPVFDSCHEA  87

Query  1053  KAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRL  874
             KA+T  +ASVIYVP PFA  AIMEA++AE+ LVVCITEGIPQ DMVKVK  L +Q+KTRL
Sbjct  88    KAKTGCDASVIYVPAPFAAPAIMEAIDAEIGLVVCITEGIPQQDMVKVKHRLSRQSKTRL  147

Query  873   IGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIG  694
             +GPNCPGII PG CKIGIMPG+IHK G+IGIVSRSGTLTYEAV QTTAVGLGQ+ CVGIG
Sbjct  148   VGPNCPGIIAPGACKIGIMPGHIHKEGKIGIVSRSGTLTYEAVAQTTAVGLGQTLCVGIG  207

Query  693   GDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGT---EKPVVAFIA  523
             GDPFNGTNFVDCLE F+ DP TEGIVLIGEIGG AEE+AA F+K+  +    KPV AFIA
Sbjct  208   GDPFNGTNFVDCLEIFLNDPATEGIVLIGEIGGGAEEKAAEFLKQHNSGPDAKPVAAFIA  267

Query  522   GLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKRG  352
             GLTAPPGRRMGHAGAI+SGGKG A +KI+ LK+AGV V  SPA++GTT+L    K G
Sbjct  268   GLTAPPGRRMGHAGAIISGGKGGATEKIQALKDAGVVVTMSPAQMGTTILKEMEKIG  324



>ref|WP_012149562.1| succinyl-CoA synthetase subsunit alpha [Rickettsia akari]
 gb|ABV74929.1| succinyl-CoA synthetase subunit alpha [Rickettsia akari str. 
Hartford]
Length=292

 Score =   375 bits (964),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 201/290 (69%), Positives = 246/290 (85%), Gaps = 1/290 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             + ++K T+VICQG TG  GTFH+EQAI YGT MVGG+TP KGG  HL LPV+NTV +AKA
Sbjct  3     ILINKKTKVICQGFTGSQGTFHSEQAIAYGTNMVGGITPGKGGHTHLDLPVYNTVHEAKA  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T ANASVIYVPP FA  +I+EA++A++++VVCITEGIP  DMVKVK AL   +KTRLIG
Sbjct  63    KTGANASVIYVPPSFAADSILEAIDAKIEVVVCITEGIPILDMVKVKRAL-VGSKTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IHK G IGIVSRSGTLTYEAV QTTAVGLGQSTCVGIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVAQTTAVGLGQSTCVGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNFVDC++ F+ D +T+ I++IGEIGG AEE+AA FIK+S  +KP+V+FIAG+TAP
Sbjct  182   PVNGTNFVDCIDMFLKDDETKAIIMIGEIGGNAEEDAAEFIKQSKIKKPIVSFIAGITAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTK  358
             PG+RMGHAGAI++GG+G+A+DK+  L+ AGVT+ +SPA +G TM D+  K
Sbjct  242   PGKRMGHAGAIIAGGQGSAEDKLEVLQSAGVTITKSPADIGKTMFDLLNK  291



>ref|WP_032138585.1| succinate--CoA ligase [Rickettsia tamurae]
Length=292

 Score =   375 bits (963),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 204/290 (70%), Positives = 244/290 (84%), Gaps = 1/290 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             + ++K T+VICQG TG  GTFH+EQAI YGT MVGGVTP KGG  HL LPV+NTV +AKA
Sbjct  3     ILINKKTKVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGHTHLDLPVYNTVHEAKA  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T ANASVIYVPP FA  +I+EA++AE+++VVCITEGIP  DMVKVK  L   +KTRLIG
Sbjct  63    KTGANASVIYVPPGFAADSILEAIDAEIEVVVCITEGIPVLDMVKVKRVL-VGSKTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IHK G IGIVSRSGTLTYEAV QTTAVGLGQSTCVGIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVAQTTAVGLGQSTCVGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P N TNFVDC+E F+ D +T+ I++IGEIGG AEE+AA FIK+S  +KP+V+FIAG+TAP
Sbjct  182   PVNDTNFVDCIEMFLKDDETKAIIMIGEIGGNAEEDAAEFIKQSKIKKPIVSFIAGITAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTK  358
             PG+RMGHAGAI++GGKG+A+DK+  L+ AGVT+  SPA +G TMLD+  K
Sbjct  242   PGKRMGHAGAIIAGGKGSAEDKLEALQSAGVTITRSPADIGKTMLDLLNK  291



>ref|WP_009868831.1| Succinyl-CoA synthetase, alpha subunit [Magnetospirillum magnetotacticum]
 gb|KIL99734.1| Succinyl-CoA ligase ADP-forming alpha chain [Magnetospirillum 
magnetotacticum MS-1]
Length=291

 Score =   375 bits (962),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 202/288 (70%), Positives = 236/288 (82%), Gaps = 1/288 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             V V+ NT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGGT HL LPVFNTVA+AKA
Sbjct  3     VLVNANTKVICQGFTGAQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLDLPVFNTVAEAKA  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T  NASVIYVPPPFA  AI+EA++AE++L VCITEGIP  DM+ VK AL Q +KTRLIG
Sbjct  63    KTGCNASVIYVPPPFAADAILEAIDAEIELAVCITEGIPVADMLAVKRAL-QGSKTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IH  G++GIVSRSGTLTYEAV QTTA GLGQ+TC+GIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHLRGKVGIVSRSGTLTYEAVAQTTATGLGQTTCIGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNFVD LE F+ADP+T+ I++IGEIGG AE + A  +K S  +KP V FIAG TAP
Sbjct  182   PINGTNFVDSLELFLADPETQAIIMIGEIGGDAEVQGAELLKRSKIKKPTVGFIAGRTAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             PGRRMGHAGA++SGG  TA  K+  LK AG+ V +SPA LG+TM+ + 
Sbjct  242   PGRRMGHAGAVISGGNDTADFKVEALKSAGIAVADSPASLGSTMVKLL  289



>ref|WP_045363367.1| succinate--CoA ligase [Methyloceanibacter caenitepidi]
 dbj|BAQ15578.1| succinyl-CoA ligase [ADP-forming] alpha chain [Methyloceanibacter 
caenitepidi]
Length=290

 Score =   375 bits (962),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 204/290 (70%), Positives = 238/290 (82%), Gaps = 1/290 (0%)
 Frame = -2

Query  1230  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  1051
              V V+KNTRVICQG TG  GTFHTEQAI YGTKMVGGVTP KGGT HL LPVF+TV DA 
Sbjct  2     SVLVNKNTRVICQGFTGSQGTFHTEQAIAYGTKMVGGVTPGKGGTTHLDLPVFDTVRDAV  61

Query  1050  AETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  871
             A T A AS IYVPPPFA  AI+EA++A ++L VCITEG+P  DMVKVK AL   + TRLI
Sbjct  62    AATGATASAIYVPPPFAADAILEAIDAGIELAVCITEGVPVLDMVKVKRALIG-SGTRLI  120

Query  870   GPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGG  691
             GPNCPGII PGECKIGIMPG+IHKPGR+GIVSRSGTLTYEAV QTTAVG GQ+TC+GIGG
Sbjct  121   GPNCPGIITPGECKIGIMPGHIHKPGRVGIVSRSGTLTYEAVAQTTAVGFGQTTCIGIGG  180

Query  690   DPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTA  511
             DP NGTNF+D L  F+ D  TE I++IGEIGG+AEEEAA F+ ++G +KP+V F+AG TA
Sbjct  181   DPVNGTNFIDALSLFLEDDATEAIIMIGEIGGSAEEEAAEFLVKAGNKKPIVGFVAGATA  240

Query  510   PPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFT  361
             PPGRRMGHAGA++SGGKG A+ KI  +++AG+ V  SPA LGTT+  +F+
Sbjct  241   PPGRRMGHAGAVISGGKGDAKSKIEAMQDAGIVVSHSPAALGTTLAGIFS  290



>emb|CDH53782.1| probable succinyl-coa synthetase alpha gdp-forming [Lichtheimia 
corymbifera JMRC:FSU:9682]
Length=332

 Score =   376 bits (966),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 213/305 (70%), Positives = 250/305 (82%), Gaps = 4/305 (1%)
 Frame = -2

Query  1248  FGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN  1069
             + S A  + ++K+T+VICQG TGK GTFH+EQAIEYGTKMVGGV+PKK G  HLGLPVF 
Sbjct  28    YESTAKNLMINKDTKVICQGFTGKQGTFHSEQAIEYGTKMVGGVSPKKAGQTHLGLPVFG  87

Query  1068  TVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQ  889
             +V +A  ETK +ASVIYVPPP A AAI+EA+E E+ LVV ITEGIPQHDMV+VK AL  Q
Sbjct  88    SVREAVQETKPDASVIYVPPPGAAAAILEAIENEVPLVVAITEGIPQHDMVRVKQALMTQ  147

Query  888   TKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQST  709
              KTRL+GPNCPGII P +CKIGIMPG+IHK G++GIVSRSGTLTYEAV QTT  GLGQ+ 
Sbjct  148   NKTRLVGPNCPGIIAPEQCKIGIMPGHIHKRGKVGIVSRSGTLTYEAVNQTTEAGLGQTL  207

Query  708   CVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTE----KP  541
             CVGIGGDP NGTNF+DCL+ F+ D +TEGIV+IGEIGGTAEEEAAAF++E        KP
Sbjct  208   CVGIGGDPLNGTNFIDCLKIFLEDDKTEGIVMIGEIGGTAEEEAAAFLQEYNLSRENPKP  267

Query  540   VVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFT  361
             VV+FIAGLTAPPGRRMGHAGAI+SGGKG AQDKI  L++AGV V  SPAKLG+ + +  +
Sbjct  268   VVSFIAGLTAPPGRRMGHAGAIISGGKGGAQDKIAALEKAGVIVSPSPAKLGSKLKEAMS  327

Query  360   KRGLL  346
               GL+
Sbjct  328   AAGLV  332



>ref|XP_002779820.1| Succinyl-CoA ligase, putative [Perkinsus marinus ATCC 50983]
 gb|EER11615.1| Succinyl-CoA ligase, putative [Perkinsus marinus ATCC 50983]
Length=333

 Score =   376 bits (966),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 223/306 (73%), Positives = 252/306 (82%), Gaps = 7/306 (2%)
 Frame = -2

Query  1254  RLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGT-EHLG--  1084
             R F S A  V+VDKNT+VICQG+TGK GTFHT QAIEYGTKMVGGV PKK GT  H+G  
Sbjct  23    RAFSSTA-RVWVDKNTKVICQGLTGKQGTFHTAQAIEYGTKMVGGVNPKKAGTTHHVGGK  81

Query  1083  -LPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVK  907
              LP+F  V +A+  T A+ASVIYVPP  A +A +EA+EAE+ LVVCITEGIPQHDMVKVK
Sbjct  82    DLPIFANVMEAREATGADASVIYVPPSGAASACLEAIEAEIPLVVCITEGIPQHDMVKVK  141

Query  906   AALKQQT-KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTA  730
             AALK    +TRLIGPNCPGIIKP ECKIGIMPGYIHK G+IG+VSRSGTLTYEAV QTT 
Sbjct  142   AALKMAGGRTRLIGPNCPGIIKPEECKIGIMPGYIHKKGKIGVVSRSGTLTYEAVNQTTE  201

Query  729   VGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESG-  553
             VGLGQST VGIGGDPFNGTNF+DCLERFV DPQTEGI+LIGEIGG AEEEAA ++KE+  
Sbjct  202   VGLGQSTVVGIGGDPFNGTNFIDCLERFVQDPQTEGIILIGEIGGAAEEEAAEWLKENNK  261

Query  552   TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTML  373
               KPVV+FIAG+TAPPGRRMGHAGAI+SGGKGTA  KI  L+  G +V  SPA LG  ML
Sbjct  262   NNKPVVSFIAGVTAPPGRRMGHAGAIISGGKGTAATKIAALEGCGASVVRSPADLGVRML  321

Query  372   DVFTKR  355
             +++ +R
Sbjct  322   EMYKQR  327



>gb|ERE66319.1| succinyl-CoA ligase [GDP-forming] subunit alpha [Cricetulus griseus]
Length=341

 Score =   377 bits (967),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 215/308 (70%), Positives = 254/308 (82%), Gaps = 3/308 (1%)
 Frame = -2

Query  1260  QHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGL  1081
             +H  + +    +++DKNT+VICQG TGK GTFH++QA+EYGTK+VGG +P KGG  HLGL
Sbjct  34    RHASYDASRKHIYIDKNTKVICQGFTGKQGTFHSQQALEYGTKLVGGTSPGKGGKTHLGL  93

Query  1080  PVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAA  901
             PVFNTV +AK +T A ASVIYVPPPFA AAI EA++AE+ LVVCITEGIPQ DMV+V+  
Sbjct  94    PVFNTVKEAKEKTGATASVIYVPPPFAAAAITEAVDAEIPLVVCITEGIPQQDMVRVRHT  153

Query  900   LKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGL  721
             L  Q KTRLIGPNCPGII PGECKIGIMPG+IHK G+IGIVSRSGTLTYEAV QTT VGL
Sbjct  154   LSHQGKTRLIGPNCPGIINPGECKIGIMPGHIHKKGKIGIVSRSGTLTYEAVHQTTQVGL  213

Query  720   GQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGT---  550
             GQS C+GIGGDPFNGTNF+DCLE F+ DP TEGIVLIGEIGG AEE+A+ F+KE  +   
Sbjct  214   GQSLCIGIGGDPFNGTNFIDCLEVFLNDPATEGIVLIGEIGGNAEEDASEFLKEHNSGPN  273

Query  549   EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLD  370
              KPVV+FIAG+TAPPGRRMGHAGAI++GGKG A++KI  L+ AGV V  SPA+LG+T+  
Sbjct  274   AKPVVSFIAGVTAPPGRRMGHAGAIIAGGKGGAKEKISALQSAGVVVSMSPAQLGSTIYK  333

Query  369   VFTKRGLL  346
              F KR +L
Sbjct  334   EFEKRKML  341



>ref|WP_042311149.1| succinate--CoA ligase [Burkholderia terrae]
Length=291

 Score =   374 bits (961),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 205/285 (72%), Positives = 242/285 (85%), Gaps = 1/285 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             V +D+NT+VICQG TG  GTFH+EQA+ YGT MVGGVTP KGG  HLGLPVF+TVADA  
Sbjct  3     VLIDRNTKVICQGFTGSQGTFHSEQALAYGTLMVGGVTPGKGGAAHLGLPVFDTVADAVD  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
              T ANASVIYVPPP A  AI+EA++AE+ LVVCITEGIP  DMV+VK AL   + TRLIG
Sbjct  63    ATGANASVIYVPPPMAADAILEAVDAEIPLVVCITEGIPVIDMVRVKRALAG-SATRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PG+CKIGIMPG+IH+PG+IG+VSRSGTLTYEAV QTTA GLGQ+TC+GIGGD
Sbjct  122   PNCPGVITPGQCKIGIMPGHIHRPGKIGVVSRSGTLTYEAVAQTTAAGLGQTTCIGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNF+DCLE F+AD  T+GI++IGEIGG+AEE+AA F+K+SG++KPVV FIAG +AP
Sbjct  182   PVNGTNFIDCLEMFLADDDTQGIIMIGEIGGSAEEDAAQFLKDSGSKKPVVGFIAGTSAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTML  373
             PGRRMGHAGAI+SGGKGTA  KI  ++ AG+ V +SPA LG TML
Sbjct  242   PGRRMGHAGAIISGGKGTAGAKIDAMRSAGIHVAQSPAALGETML  286



>ref|WP_027287415.1| succinate--CoA ligase [Rhodovibrio salinarum]
Length=291

 Score =   374 bits (961),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 204/288 (71%), Positives = 241/288 (84%), Gaps = 1/288 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             V +DK+T+VICQG TG  GTFH+EQAI YGTKMVGGV+P KGG  HL LPVFNTVA+AK 
Sbjct  3     VLIDKDTKVICQGFTGAQGTFHSEQAIAYGTKMVGGVSPGKGGQTHLDLPVFNTVAEAKQ  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T A ASVI+VPPPFAG AI+EA++A ++L VCITEGIP  DMVKVK AL   + TRL+G
Sbjct  63    QTGATASVIFVPPPFAGDAILEAIDAGIELAVCITEGIPVMDMVKVKRALAH-SNTRLVG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I P  CKIGIMPG+IH  G+IGIVSRSGTLTYEAV QTTA GLGQSTC+GIGGD
Sbjct  122   PNCPGVITPDACKIGIMPGHIHTRGKIGIVSRSGTLTYEAVSQTTAAGLGQSTCIGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNFVDC++ F+ D +TEGIV+IGEIGGTAEEEAA F+K+S  +KP V FIAGLTAP
Sbjct  182   PVNGTNFVDCIDMFLKDDETEGIVMIGEIGGTAEEEAAEFLKQSSVKKPTVGFIAGLTAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             PGRRMGHAGAI+SGGKG A+DKI  +++AG+ V +SPA +G+TM+   
Sbjct  242   PGRRMGHAGAIISGGKGGAEDKIAAMRDAGIHVADSPASIGSTMVKAL  289



>emb|CDS02808.1| Putative Succinyl-CoA ligase [Absidia idahoensis var. thermophila]
Length=332

 Score =   376 bits (965),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 213/305 (70%), Positives = 250/305 (82%), Gaps = 4/305 (1%)
 Frame = -2

Query  1248  FGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN  1069
             + S A  + ++K+T+VICQG TGK GTFH+EQAIEYGTKMVGGV+PKK G  HLGLPVF 
Sbjct  28    YESTAKNLMINKDTKVICQGFTGKQGTFHSEQAIEYGTKMVGGVSPKKAGQTHLGLPVFG  87

Query  1068  TVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQ  889
             +V +A  ETK +ASVIYVPPP A AAI+EA+E E+ LVV ITEGIPQHDMV+VK AL  Q
Sbjct  88    SVREAVQETKPDASVIYVPPPGAAAAILEAIENEVPLVVAITEGIPQHDMVRVKQALMTQ  147

Query  888   TKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQST  709
              KTRL+GPNCPGII P +CKIGIMPG+IHK G++GIVSRSGTLTYEAV QTT  GLGQ+ 
Sbjct  148   NKTRLVGPNCPGIIAPEQCKIGIMPGHIHKRGKVGIVSRSGTLTYEAVNQTTEAGLGQTL  207

Query  708   CVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTE----KP  541
             CVGIGGDP NGTNF+DCL+ F+ D +TEGIV+IGEIGGTAEEEAAAF++E        KP
Sbjct  208   CVGIGGDPLNGTNFIDCLKIFLEDDKTEGIVMIGEIGGTAEEEAAAFLQEYNLSRENPKP  267

Query  540   VVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFT  361
             VV+FIAGLTAPPGRRMGHAGAI+SGGKG AQDKI  L++AGV V  SPAKLG+ + +  +
Sbjct  268   VVSFIAGLTAPPGRRMGHAGAIISGGKGGAQDKIAALEKAGVIVTPSPAKLGSKLKEAMS  327

Query  360   KRGLL  346
               GL+
Sbjct  328   AAGLV  332



>ref|WP_041861374.1| succinate--CoA ligase [Candidatus Puniceispirillum marinum]
Length=294

 Score =   374 bits (961),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 205/286 (72%), Positives = 233/286 (81%), Gaps = 1/286 (0%)
 Frame = -2

Query  1230  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  1051
              V V+K+TRVICQG TG  GTFH+EQAI YGTKMVGGVTP KGG  HL LPVFN+V +A 
Sbjct  2     SVLVNKDTRVICQGFTGAQGTFHSEQAIAYGTKMVGGVTPGKGGQTHLDLPVFNSVVEAM  61

Query  1050  AETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  871
              ET+ANASVIYVPPPFA  +IMEA++A + L+VCITEGIP  DMVKVK AL   +K+RLI
Sbjct  62    RETEANASVIYVPPPFAADSIMEAIDAGMPLIVCITEGIPVLDMVKVKRAL-DASKSRLI  120

Query  870   GPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGG  691
             GPNCPGII PGECKIGIMPG+IHKPG++GIVSRSGTLTYEAV QTTA GLGQSTCVGIGG
Sbjct  121   GPNCPGIITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVAQTTAAGLGQSTCVGIGG  180

Query  690   DPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTA  511
             DP NGTNF+DCLE F+AD QTE IV+IGEIGG+AEE+AAA+       KP+  FIAG TA
Sbjct  181   DPVNGTNFIDCLEMFLADDQTEAIVMIGEIGGSAEEDAAAYYMAQPNRKPIAGFIAGQTA  240

Query  510   PPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTML  373
             PPGRRMGHAGAIVSGG G A DKI  ++ AG  +  SPA LG  ++
Sbjct  241   PPGRRMGHAGAIVSGGSGAAVDKIAAMETAGFVMASSPAALGDAVM  286



>ref|XP_002180696.1| ligase succinate-coa ligase [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC48104.1| ligase succinate-coa ligase [Phaeodactylum tricornutum CCAP 1055/1]
Length=309

 Score =   375 bits (962),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 217/294 (74%), Positives = 252/294 (86%), Gaps = 1/294 (0%)
 Frame = -2

Query  1242  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTV  1063
             S   +V+VDKN+RVICQG TGK GTFH+ QAI+YGT MVGGVTPKKGG EHLGLPVFNTV
Sbjct  2     SSTAKVWVDKNSRVICQGFTGKQGTFHSTQAIDYGTNMVGGVTPKKGGQEHLGLPVFNTV  61

Query  1062  ADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTK  883
              +A    + +ASVIYVPPP+A  AI++A+EAE+ LVVCITEGIPQ DM +VK AL+ Q +
Sbjct  62    QEAVDGVQPDASVIYVPPPYAAQAILDAIEAEIGLVVCITEGIPQQDMARVKHALRLQDR  121

Query  882   TRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCV  703
             TRLIGPNCPGIIKPGECKIGIMPGYIH+PG+IG+VSRSGTLTYEAV+QTT  GLGQSTCV
Sbjct  122   TRLIGPNCPGIIKPGECKIGIMPGYIHRPGKIGVVSRSGTLTYEAVWQTTVTGLGQSTCV  181

Query  702   GIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGT-EKPVVAFI  526
             GIGGDPFNGTNF+DCLERF  DP+TEGI++IGEIGG+AEEEAA ++KE G   KPVV FI
Sbjct  182   GIGGDPFNGTNFIDCLERFTNDPETEGIIMIGEIGGSAEEEAAEWLKEYGDPNKPVVGFI  241

Query  525   AGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             AGLTAPPGRRMGHAGAI++GGKG A++K + L+ AGV V  SPA+LG TML+  
Sbjct  242   AGLTAPPGRRMGHAGAIIAGGKGGAEEKFQALESAGVHVSRSPARLGATMLEAM  295



>gb|ADE40076.1| succinyl-CoA synthetase, alpha subunit [Candidatus Puniceispirillum 
marinum IMCC1322]
Length=313

 Score =   375 bits (962),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 205/286 (72%), Positives = 233/286 (81%), Gaps = 1/286 (0%)
 Frame = -2

Query  1230  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  1051
              V V+K+TRVICQG TG  GTFH+EQAI YGTKMVGGVTP KGG  HL LPVFN+V +A 
Sbjct  21    SVLVNKDTRVICQGFTGAQGTFHSEQAIAYGTKMVGGVTPGKGGQTHLDLPVFNSVVEAM  80

Query  1050  AETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  871
              ET+ANASVIYVPPPFA  +IMEA++A + L+VCITEGIP  DMVKVK AL   +K+RLI
Sbjct  81    RETEANASVIYVPPPFAADSIMEAIDAGMPLIVCITEGIPVLDMVKVKRAL-DASKSRLI  139

Query  870   GPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGG  691
             GPNCPGII PGECKIGIMPG+IHKPG++GIVSRSGTLTYEAV QTTA GLGQSTCVGIGG
Sbjct  140   GPNCPGIITPGECKIGIMPGHIHKPGKVGIVSRSGTLTYEAVAQTTAAGLGQSTCVGIGG  199

Query  690   DPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTA  511
             DP NGTNF+DCLE F+AD QTE IV+IGEIGG+AEE+AAA+       KP+  FIAG TA
Sbjct  200   DPVNGTNFIDCLEMFLADDQTEAIVMIGEIGGSAEEDAAAYYMAQPNRKPIAGFIAGQTA  259

Query  510   PPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTML  373
             PPGRRMGHAGAIVSGG G A DKI  ++ AG  +  SPA LG  ++
Sbjct  260   PPGRRMGHAGAIVSGGSGAAVDKIAAMETAGFVMASSPAALGDAVM  305



>ref|WP_010423152.1| succinyl-CoA synthetase subsunit alpha [Rickettsia helvetica]
Length=292

 Score =   374 bits (959),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 203/290 (70%), Positives = 245/290 (84%), Gaps = 1/290 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             + ++K T+VICQG TG  GTFH+EQAI YGT MVGGVTP KGG  HL LPV+NTV +AKA
Sbjct  3     ILINKKTKVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGHTHLDLPVYNTVHEAKA  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T ANASVIYVPP FA  +I+EA++AE+++VVCITEGIP  DMVKVK AL   +KTRLIG
Sbjct  63    KTGANASVIYVPPGFAADSILEAIDAEIEVVVCITEGIPILDMVKVKRAL-VGSKTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IHK G IGI+SRSGTLTYEAV QTTAVGLGQSTCVGIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHKRGTIGIISRSGTLTYEAVAQTTAVGLGQSTCVGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNFVDC+E F+ D +T+ +++IGEIGG AEE+AA FIK+S  +KP+V+FIAG+TAP
Sbjct  182   PVNGTNFVDCIEIFLKDDETKAMIMIGEIGGNAEEDAADFIKQSKIKKPIVSFIAGITAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTK  358
             PG+RMGHAGAI++ GKG+A+DK+  L+ AGVT+  SPA +G TMLD+  K
Sbjct  242   PGKRMGHAGAIITRGKGSAEDKLEALQSAGVTITRSPADIGKTMLDLLNK  291



>ref|WP_028368926.1| succinate--CoA ligase [Burkholderia sp. UYPR1.413]
Length=290

 Score =   374 bits (959),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 208/288 (72%), Positives = 242/288 (84%), Gaps = 1/288 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             V +D+NT+VICQG TG  GTFH+EQA+ YGT+MVGGVTP KGGT HLGLPVF+TVADA  
Sbjct  3     VLIDRNTKVICQGFTGSQGTFHSEQAVAYGTQMVGGVTPGKGGTSHLGLPVFDTVADAVG  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
              T ANASVIYVPPP A  AI+EA++AE+ LVVCITEGIP  DMV+VK AL   + TRLIG
Sbjct  63    ATGANASVIYVPPPMAADAILEAVDAEIPLVVCITEGIPVIDMVRVKRALAG-SATRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PG+CKIGIMPG+IH+PG+IG+VSRSGTLTYEAV QTTA GLGQ+TC+GIGGD
Sbjct  122   PNCPGVITPGQCKIGIMPGHIHRPGKIGVVSRSGTLTYEAVAQTTAAGLGQTTCIGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNF+DCLE F+AD  TEGI++IGEIGG+AEE+AA FIK+S T KPVV FIAG +AP
Sbjct  182   PVNGTNFIDCLEMFLADDDTEGIIMIGEIGGSAEEDAAQFIKDSRTNKPVVGFIAGTSAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             PGRRMGHAGAI+SGGKGT   KI  ++ AG+ V +SPA LG TML  F
Sbjct  242   PGRRMGHAGAIISGGKGTVGAKIDAMRAAGIHVAQSPAALGETMLKAF  289



>ref|WP_038035751.1| hypothetical protein [Thermopetrobacter sp. TC1]
Length=291

 Score =   373 bits (958),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 207/284 (73%), Positives = 239/284 (84%), Gaps = 1/284 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             V +D  TRVICQGITG  GTFHT+QA+EYGT+MVGGVTP KGG EHLGLPVF+TV +AKA
Sbjct  3     VLIDSETRVICQGITGAQGTFHTQQALEYGTRMVGGVTPGKGGIEHLGLPVFDTVREAKA  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
              T A+A+VIYVPP FA  AI+EA++AE+ L+VCITEGIP  DMV+VK AL   +K+RLIG
Sbjct  63    ATGADATVIYVPPAFAADAILEAIDAEIPLIVCITEGIPVLDMVRVKRALSG-SKSRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPGII PG+CKIGIMPG+IHKPG +GIVSRSGTLTYEAV QTT VGLGQSTC+GIGGD
Sbjct  122   PNCPGIITPGQCKIGIMPGHIHKPGTVGIVSRSGTLTYEAVKQTTDVGLGQSTCIGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P  G +F+DCLE F  DPQTE IVLIGEIGGT+EEEAA +I+     KPVVA+IAG+TAP
Sbjct  182   PVKGMDFIDCLELFYDDPQTEQIVLIGEIGGTSEEEAAEYIRSQNGAKPVVAYIAGVTAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTM  376
             PGRRMGHAGAI+SGGKGTA+ KI  L+ AGVTV  +PAK+G  M
Sbjct  242   PGRRMGHAGAIISGGKGTAEAKIAALEAAGVTVVRNPAKIGEAM  285



>gb|KJB31855.1| hypothetical protein B456_005G211200 [Gossypium raimondii]
Length=275

 Score =   372 bits (956),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 202/251 (80%), Positives = 217/251 (86%), Gaps = 12/251 (5%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVRP---------ITQSPLWQQQQHRLFGS---PAPEVFVDKNTRV  1201
             MA Q +RLI ++S ++ P          + S      Q R F +   P P VFVDKNTRV
Sbjct  1     MARQASRLIQSLSSRISPHKPQLSPLTPSSSSSQLLTQSRSFSAAPAPQPAVFVDKNTRV  60

Query  1200  ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVI  1021
             ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN+VA+AKAETKANASVI
Sbjct  61    ICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVI  120

Query  1020  YVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKP  841
             YVPP FA AAIMEAMEAELDLVVCITEGIPQHDMV+VKAAL QQ+KTRLIGPNCPGIIKP
Sbjct  121   YVPPAFAAAAIMEAMEAELDLVVCITEGIPQHDMVRVKAALNQQSKTRLIGPNCPGIIKP  180

Query  840   GECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD  661
             GECKIGIMPGYIHKPGR+GIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD
Sbjct  181   GECKIGIMPGYIHKPGRVGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD  240

Query  660   CLERFVADPQT  628
             C+ +F+ADPQT
Sbjct  241   CVTKFLADPQT  251



>ref|WP_019645135.1| succinyl-CoA synthetase subsunit alpha [Novispirillum itersonii]
Length=291

 Score =   373 bits (957),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 205/288 (71%), Positives = 246/288 (85%), Gaps = 1/288 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             V + K+T+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGGT+HL LPVF+TVA+AK 
Sbjct  3     VLIGKDTKVICQGFTGAQGTFHSEQAIAYGTKMVGGVTPGKGGTKHLDLPVFDTVAEAKE  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
              T ANA+VIYVPPPFA  AI+EA++AEL+L VCITEGIP  DMV+VK AL   +KTRL+G
Sbjct  63    RTGANATVIYVPPPFAADAILEAIDAELELAVCITEGIPVLDMVRVKRAL-VNSKTRLVG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IH  G+IG+VSRSGTLTYEAV QTTA GLGQSTC+GIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHMRGKIGVVSRSGTLTYEAVAQTTAAGLGQSTCIGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNF+DCLE F+AD +T+GI++IGEIGG+AEEEAA FIK+S  +KP+V FIAG+TAP
Sbjct  182   PVNGTNFIDCLEMFLADDETQGIIMIGEIGGSAEEEAAEFIKQSKVKKPMVGFIAGVTAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             PG+RMGHAGAI+SGGKGTA  K+  ++ AG+ V +SP+ LG+TML + 
Sbjct  242   PGKRMGHAGAIISGGKGTADAKMDAMRSAGIVVADSPSALGSTMLQLM  289



>ref|XP_005089238.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial-like isoform X3 [Aplysia californica]
 ref|XP_005089239.1| PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, 
mitochondrial-like isoform X4 [Aplysia californica]
Length=326

 Score =   374 bits (960),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 219/330 (66%), Positives = 264/330 (80%), Gaps = 12/330 (4%)
 Frame = -2

Query  1332  TARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQ  1153
             +++++A +    RP  +S     +Q+         + +D+NT+VICQG TGK GTFH++Q
Sbjct  4     SSKVLARLPGLFRPAVRSVYTASRQN---------LMLDENTKVICQGFTGKQGTFHSQQ  54

Query  1152  AIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeame  973
             A+EYGTK+VGGV+P K GTEHLGLPVF +V +AK  T A ASV++VPPPFA AA+MEAM+
Sbjct  55    ALEYGTKLVGGVSPAKAGTEHLGLPVFASVKEAKDATGATASVVFVPPPFAAAAVMEAMD  114

Query  972   aELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPG  793
             AE+ LVVCITEGIPQ DMV+VK  L +Q+KTRLIGPNCPGIIKPG CKIGIMPG+IH PG
Sbjct  115   AEIPLVVCITEGIPQQDMVRVKHRLVRQSKTRLIGPNCPGIIKPGLCKIGIMPGHIHMPG  174

Query  792   RIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVL  613
             +IGIVSRSGTLTYEAV QTT  GLGQS CVGIGGDPFNGTNF+DCLE F+ DPQTEGIVL
Sbjct  175   KIGIVSRSGTLTYEAVHQTTLAGLGQSLCVGIGGDPFNGTNFIDCLEVFLNDPQTEGIVL  234

Query  612   igeiggtaeeeaaafIKESGT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDK  442
             IGEIGG+AEE AA ++K++ +    KPVV+FIAGLTAPPGRRMGHAGAI++GGKG A +K
Sbjct  235   IGEIGGSAEENAAEYLKQNNSGPNAKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGADEK  294

Query  441   IRTLKEAGVTVCESPAKLGTTMLDVFTKRG  352
             I  LK AGV V  SPA+LGTT+     K+G
Sbjct  295   IAALKSAGVDVTMSPAQLGTTIAAAMAKKG  324



>gb|EWM26381.1| succinyl- ligase subunit mitochondrial precursor [Nannochloropsis 
gaditana]
Length=338

 Score =   374 bits (961),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 214/298 (72%), Positives = 250/298 (84%), Gaps = 2/298 (1%)
 Frame = -2

Query  1242  SPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEY-GTKMVGGVTPKKGGTEHLGLPVFNT  1066
             S   +V+++K+TR+I QG TGK GTFH++QAI+Y GTK+VGGVTPKKGGT HLG PVF+T
Sbjct  40    SSTAKVWINKDTRIIVQGFTGKQGTFHSQQAIDYFGTKVVGGVTPKKGGTTHLGQPVFDT  99

Query  1065  VADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQT  886
             V +A  E K +A+ IYVPPPF  +AI++A++AE+ LVV ITEGIPQ DMVKVK  LKQQT
Sbjct  100   VEEAVRELKPDATAIYVPPPFCASAIIDAIQAEIPLVVAITEGIPQQDMVKVKWYLKQQT  159

Query  885   KTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTC  706
             KTRLIGPNCPGIIKP ECKIGIMPG IHK G IGIVSRSGTLTYEAV QTTAVGLGQSTC
Sbjct  160   KTRLIGPNCPGIIKPEECKIGIMPGAIHKKGSIGIVSRSGTLTYEAVAQTTAVGLGQSTC  219

Query  705   VGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESG-TEKPVVAF  529
             VGIGGDPFNGTNF+DCLERF  DP+T+GI++IGEIGG+AEEEAA +++  G   KPVV+F
Sbjct  220   VGIGGDPFNGTNFIDCLERFTKDPETKGIIMIGEIGGSAEEEAAEWLEAHGDASKPVVSF  279

Query  528   IAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKR  355
             IAG TAPPGRRMGHAGAI+SGGKGTA  K   L++AGV V  SPA+LGTTML   + +
Sbjct  280   IAGSTAPPGRRMGHAGAIISGGKGTAAGKFEALEKAGVHVTRSPAQLGTTMLKAISGK  337



>ref|WP_011190880.1| succinyl-CoA ligase [ADP-forming] subunit alpha [Rickettsia typhi]
 sp|Q9AKE1.1|SUCD_RICTY RecName: Full=Succinyl-CoA ligase [ADP-forming] subunit alpha; 
AltName: Full=Succinyl-CoA synthetase subunit alpha; Short=SCS-alpha 
[Rickettsia typhi str. Wilmington]
 emb|CAC33725.1| Succinyl-CoA synthetase alpha subunit [Rickettsia typhi]
 gb|AAU03896.1| Succinate thiokinase [Rickettsia typhi str. Wilmington]
 gb|AFE54277.1| succinyl-CoA synthetase subunit alpha [Rickettsia typhi str. 
TH1527]
 gb|AFE55117.1| succinyl-CoA synthetase subunit alpha [Rickettsia typhi str. 
B9991CWPP]
Length=292

 Score =   373 bits (957),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 201/290 (69%), Positives = 245/290 (84%), Gaps = 1/290 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             + ++K T+VICQG TG  GTFH+EQAI YGT MVGGVTP KGG  HL LPV+NTV +AKA
Sbjct  3     ILINKKTKVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGHTHLNLPVYNTVHEAKA  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T ANASVIYVPP FA  +I+EA++A++++VVCITEGIP  DMVKVK AL   +KTRLIG
Sbjct  63    KTDANASVIYVPPGFAADSILEAIDAKIEVVVCITEGIPVLDMVKVKRAL-IGSKTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IHK G IGIVSRSGTLTYEAV QTTAVGLGQSTC+GIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHKTGIIGIVSRSGTLTYEAVAQTTAVGLGQSTCIGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGT+FV+C+E F+ D +T+ I++IGEIGG AEE+AA FIK+S  +KP+V+FIAG+TAP
Sbjct  182   PVNGTSFVECIEMFLQDDETKAIIMIGEIGGNAEEDAADFIKQSKIKKPIVSFIAGITAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTK  358
               +RMGHAGAI+SGGKG+A+DK+  L+ AGVT+ +SPA +G TMLD+  K
Sbjct  242   SDKRMGHAGAIISGGKGSAKDKLEALQSAGVTITKSPADIGKTMLDLLNK  291



>ref|WP_045664860.1| succinate--CoA ligase [Rhodospirillaceae bacterium BRH_c57]
 gb|KJS35085.1| succinate--CoA ligase [Rhodospirillaceae bacterium BRH_c57]
Length=291

 Score =   372 bits (956),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 206/285 (72%), Positives = 245/285 (86%), Gaps = 1/285 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             V V K+T+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGGT+HL LPVF+TVA+AK 
Sbjct  3     VLVGKDTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTKHLDLPVFDTVAEAKE  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
              T ANA+VIYVPPPFA  AI+EA++AEL+L VCITEGIP  DMV+V  AL Q +KTRL+G
Sbjct  63    RTGANATVIYVPPPFAADAILEAIDAELELAVCITEGIPVLDMVRVYRAL-QNSKTRLVG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IH+ G+IG+VSRSGTLTYEAV QTTA GLGQSTC+GIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHQRGKIGVVSRSGTLTYEAVAQTTAAGLGQSTCIGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNF+DCLE F+ DP+TEGI++IGEIGG+AEEEAA FIK    +KP+V FIAG+TAP
Sbjct  182   PVNGTNFIDCLEMFLKDPETEGIIMIGEIGGSAEEEAAEFIKAQKVKKPMVGFIAGVTAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTML  373
             PG+RMGHAGAI+SGGKGTA+ K+  ++ AG+ V +SPA LG+TM+
Sbjct  242   PGKRMGHAGAIISGGKGTAEAKMEAMRSAGIAVADSPAALGSTMV  286



>ref|WP_025896902.1| succinate--CoA ligase [Sneathiella glossodoripedis]
Length=291

 Score =   372 bits (956),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 203/288 (70%), Positives = 242/288 (84%), Gaps = 1/288 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             V V+K+T+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGG  HL LP+FNTV +A  
Sbjct  3     VLVNKDTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGETHLDLPIFNTVDEAVH  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
              T ANASVIYVPPPFAG AI+EA++A ++LVVCITEGIP  DMV+VK ALK  + TRLIG
Sbjct  63    ATGANASVIYVPPPFAGDAILEAVDAGVELVVCITEGIPVLDMVRVKRALKD-SGTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I P ECKIGIMPG+IH+ G +GIVSRSGTLTYEAV QTTA GLGQSTC+GIGGD
Sbjct  122   PNCPGVITPDECKIGIMPGHIHRRGNVGIVSRSGTLTYEAVAQTTAAGLGQSTCIGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNF+DCL+ F+ D +TE I++IGEIGG+AEEEAA F+K+S  +KPVV FIAG+TAP
Sbjct  182   PVNGTNFIDCLDMFLHDDETESIIMIGEIGGSAEEEAAEFLKQSKIKKPVVGFIAGVTAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             PGRRMGHAGAI+SGGKG A DK+  ++ AG+TV +SP+ LG+T++ V 
Sbjct  242   PGRRMGHAGAIISGGKGGADDKMEAMRSAGITVSDSPSALGSTLVRVL  289



>ref|WP_014412789.1| succinyl-CoA synthetase subsunit alpha [Rickettsia australis]
 gb|AFC71264.1| succinyl-CoA synthetase subunit alpha [Rickettsia australis str. 
Cutlack]
Length=292

 Score =   372 bits (956),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 201/290 (69%), Positives = 243/290 (84%), Gaps = 1/290 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             + ++K T+VICQG TG  GTFH+EQAI YGT MVGGVTP KGG  HL LPV+NTV +AKA
Sbjct  3     ILINKKTKVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGHTHLDLPVYNTVHEAKA  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T ANASVIYVPP FA  +I+EA++AE+++VVCITEGIP  DMVKVK AL   +KTRLIG
Sbjct  63    KTGANASVIYVPPSFAADSILEAIDAEIEVVVCITEGIPVLDMVKVKRAL-VGSKTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IHK G IGIVSRSGTLTYEAV QTTAVGLGQSTCVGIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVAQTTAVGLGQSTCVGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNFVDC++ F+ D +T+ I++IGEIGG AEE+AA FIK+S  +KP+V+FIAG+TAP
Sbjct  182   PVNGTNFVDCIDMFLKDDETKAIIMIGEIGGNAEEDAAEFIKQSKIKKPIVSFIAGITAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTK  358
             PG+RMGHAGAI++GG+G+A+DK+  L+ A VT+  SPA +G  M D+  K
Sbjct  242   PGKRMGHAGAIIAGGQGSAEDKLEALQSASVTITRSPADIGKAMFDLLNK  291



>ref|NP_001002577.2| succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial 
[Danio rerio]
 gb|AAH81520.1| Succinate-CoA ligase, GDP-forming, alpha subunit [Danio rerio]
 gb|AAI64126.1| Suclg1 protein [Danio rerio]
Length=324

 Score =   374 bits (959),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 206/313 (66%), Positives = 253/313 (81%), Gaps = 3/313 (1%)
 Frame = -2

Query  1275  LWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGT  1096
             L Q      +      ++++KNT+VIC+G TGK GTFH++Q+++YG+++VGGV+P KGG 
Sbjct  12    LQQAGVRHCYSGSRNNLYINKNTKVICRGFTGKQGTFHSQQSLDYGSQLVGGVSPGKGGK  71

Query  1095  EHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMV  916
              HLGLPVFN+V +AK  T A A+VIYVPPPFA AAI+EA++AE+ L VCITEGIPQ DMV
Sbjct  72    THLGLPVFNSVKEAKDGTGAEATVIYVPPPFAAAAIIEAIDAEMPLAVCITEGIPQQDMV  131

Query  915   KVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQT  736
             +VK  L +Q KTRL+GPNCPG+I PGECKIGIMPG+IHK GRIGIVSRSGTLTYEAV QT
Sbjct  132   RVKHRLLRQNKTRLVGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQT  191

Query  735   TAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKES  556
             T VGLGQS C+GIGGDPFNGTNF+DCLE F+ DP+TEGI+LIGEIGG AEE AA ++K+ 
Sbjct  192   TQVGLGQSLCIGIGGDPFNGTNFIDCLEVFLQDPKTEGIILIGEIGGDAEENAAEYLKQH  251

Query  555   GT---EKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLG  385
              +    KPVV+FIAGLTAPPGRRMGHAGA ++GGKG A++KI  L+ AGV V  SPA+LG
Sbjct  252   NSGANAKPVVSFIAGLTAPPGRRMGHAGAFIAGGKGGAKEKIAALQSAGVVVSMSPAQLG  311

Query  384   TTMLDVFTKRGLL  346
             +T+   F KR +L
Sbjct  312   STIFKEFEKRKML  324



>gb|KJE93223.1| succinate-CoA ligase [Capsaspora owczarzaki ATCC 30864]
Length=370

 Score =   375 bits (963),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 213/315 (68%), Positives = 248/315 (79%), Gaps = 0/315 (0%)
 Frame = -2

Query  1329  ARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQA  1150
             A LI N+   +    +  +   +  R + S    + ++K+T+VICQG TGK GTFH+EQA
Sbjct  44    ALLIFNIHTMLSTFARVAVQAPRLARAYNSTRKNLLINKDTKVICQGFTGKQGTFHSEQA  103

Query  1149  IEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeamea  970
             + YGTKMVGGV+P K G +HLGLPVF  V DA   T A+A+VIYVPPPFA  AI EA+EA
Sbjct  104   LLYGTKMVGGVSPAKAGQQHLGLPVFKDVKDAVKATGAHATVIYVPPPFAAGAIFEAIEA  163

Query  969   ELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGR  790
             E+ L VCITEGIPQ DMVKVK AL  Q KTRL+GPNCPGIIKP ECKIGIMPG+IHK G 
Sbjct  164   EIPLAVCITEGIPQQDMVKVKNALLSQNKTRLVGPNCPGIIKPDECKIGIMPGHIHKRGN  223

Query  789   IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLi  610
             IGIVSRSGTLTYEAV QTTAVGLGQS CVGIGGDPFNGTNFVDCL+ F+ DP+T+GI+LI
Sbjct  224   IGIVSRSGTLTYEAVAQTTAVGLGQSLCVGIGGDPFNGTNFVDCLDIFLNDPETKGIILI  283

Query  609   geiggtaeeeaaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTL  430
             GEIGG+AEEEAA ++K    +KPVV+FIAG TAPPGRRMGHAGAI+SGGKG A  KI  L
Sbjct  284   GEIGGSAEEEAAEYLKNHKIKKPVVSFIAGRTAPPGRRMGHAGAIISGGKGGADAKIAAL  343

Query  429   KEAGVTVCESPAKLG  385
               AGVTV +SPA++G
Sbjct  344   HSAGVTVVDSPAQMG  358



>ref|WP_014246680.1| MULTISPECIES: succinyl-CoA synthetase subsunit alpha [Azospirillum]
 emb|CBS85614.1| succinyl-CoA synthetase, alpha subunit, NAD(P)-binding [Azospirillum 
lipoferum 4B]
Length=291

 Score =   372 bits (955),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 211/288 (73%), Positives = 239/288 (83%), Gaps = 1/288 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             V VDKNT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGG +HL LP+F+TV++A  
Sbjct  3     VLVDKNTKVICQGFTGAQGTFHSEQAIAYGTKMVGGVTPGKGGAKHLDLPIFDTVSEAVE  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T ANASVIYVPPPFA  AI+EA++AE+ LVVCITEGIP  DMV+VK AL   +KTRLIG
Sbjct  63    KTGANASVIYVPPPFAADAILEAIDAEIPLVVCITEGIPVLDMVRVKRAL-DGSKTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPGII P ECKIGIMPG+IHK G+IGIVSRSGTLTYEAV QTTA GLGQ+TC+GIGGD
Sbjct  122   PNCPGIITPDECKIGIMPGHIHKRGKIGIVSRSGTLTYEAVAQTTAAGLGQTTCIGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNFVD LE FV DP+TEGI++IGEIGG AE   A FIK SGT+KPVV FIAG TAP
Sbjct  182   PVNGTNFVDSLELFVKDPETEGIIMIGEIGGDAEVRGAEFIKASGTKKPVVGFIAGRTAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             PGRRMGHAGA++SGG  TA  KI  +K  G+ V +SPA LG+TML VF
Sbjct  242   PGRRMGHAGAVISGGNDTADFKIDFMKSVGIAVADSPASLGSTMLKVF  289



>ref|WP_007089205.1| MULTISPECIES: succinyl-CoA synthetase subsunit alpha [Thalassospira]
 gb|KEO55687.1| succinyl-CoA synthetase subsunit alpha [Thalassospira permensis 
NBRC 106175]
 gb|AJD50385.1| succinyl-CoA synthetase subunit alpha [Thalassospira xiamenensis 
M-5 = DSM 17429]
Length=291

 Score =   372 bits (955),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 204/289 (71%), Positives = 241/289 (83%), Gaps = 1/289 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             V VDKNT+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGGT+HL LPVFNTV +A  
Sbjct  3     VLVDKNTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTKHLDLPVFNTVDEAVH  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
              T ANASVIYVPPPFA  AI+EA++A+++L VCITEGIP  DMV+VK AL   +KTRL+G
Sbjct  63    VTGANASVIYVPPPFAADAILEAIDAKVELAVCITEGIPVADMVRVKRAL-SGSKTRLVG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I P ECKIGIMPG+IH+ G+IGIVSRSGTLTYEAV QTTA GLGQSTC+GIGGD
Sbjct  122   PNCPGVITPDECKIGIMPGHIHRRGKIGIVSRSGTLTYEAVAQTTAAGLGQSTCIGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNF+DCLE F+ DP+T+GI++IGEIGG+AEEEA  F++ S  +KPV  FIAG+TAP
Sbjct  182   PVNGTNFIDCLELFLNDPETQGIIMIGEIGGSAEEEACEFLQASKVKKPVAGFIAGVTAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFT  361
             PG+RMGHAGAI+SGGKGTA  K+  ++ AG+ V +SPA LG+TML    
Sbjct  242   PGKRMGHAGAIISGGKGTADAKMEAMRSAGILVADSPASLGSTMLKALN  290



>ref|XP_006394390.1| hypothetical protein EUTSA_v10003962mg [Eutrema salsugineum]
 gb|ESQ31676.1| hypothetical protein EUTSA_v10003962mg [Eutrema salsugineum]
Length=539

 Score =   380 bits (977),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 199/256 (78%), Positives = 214/256 (84%), Gaps = 14/256 (5%)
 Frame = -2

Query  1344  MAWQTARLIANVSKKVR----------PITQSPLWQQQQHRLFGS---PAPEVFVDKNTR  1204
             M+ Q  RL+ ++S K R          P  QS L    Q R F S   P   VFVDKNTR
Sbjct  1     MSRQVTRLLGSLSSKARRCSIGGSEVFPSCQS-LSSLTQSRSFASDPPPPAAVFVDKNTR  59

Query  1203  VICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASV  1024
             V+CQGITGKNGTFHTEQAIEYGTKMV GVTPKKGGTEHLGLPVFN+VA+AKAETKANASV
Sbjct  60    VMCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASV  119

Query  1023  IYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIK  844
             IYVP PFA AAIME ++AELDL+VCITEGIPQHDMV+VK AL  Q+KTRLIGPNCPGIIK
Sbjct  120   IYVPAPFAAAAIMEGIQAELDLIVCITEGIPQHDMVRVKHALNSQSKTRLIGPNCPGIIK  179

Query  843   PGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV  664
             PGECKIGIMPGYIHKPG+IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV
Sbjct  180   PGECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFV  239

Query  663   DCLERFVADPQTEGIV  616
             DCLE+F  DPQTE I+
Sbjct  240   DCLEKFFVDPQTEDIL  255



>ref|WP_038603019.1| succinate--CoA ligase [Rickettsiales bacterium Ac37b]
 gb|AIL65299.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Rickettsiales 
bacterium Ac37b]
Length=290

 Score =   372 bits (954),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 204/288 (71%), Positives = 241/288 (84%), Gaps = 1/288 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             V V+KNT+VICQG TG  GTFH+ QAIEYGTKMVGGVTP KGGT HL LPVFNTV +A  
Sbjct  3     VLVNKNTKVICQGFTGSQGTFHSTQAIEYGTKMVGGVTPGKGGTSHLELPVFNTVKEAVD  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
              T ANASVIYVPPPFA  +I+EA++AEL+LVVCITEGIP  DMVKVK AL   ++TRLIG
Sbjct  63    VTGANASVIYVPPPFAADSILEAIDAELELVVCITEGIPVLDMVKVKRAL-AGSRTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPGII P ECKIGIMPG+IHK G +GIVSRSGTLTYEAV QTTA+GLGQSTC+GIGGD
Sbjct  122   PNCPGIITPNECKIGIMPGHIHKRGSVGIVSRSGTLTYEAVAQTTALGLGQSTCIGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNF+DCLE F+ D +T+ I++IGEIGG+AEEEAA F+KES  +KPVV FIAG TAP
Sbjct  182   PVNGTNFIDCLELFLNDEETKSIIMIGEIGGSAEEEAAVFLKESKIKKPVVGFIAGRTAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             PG+RMGHAGAI+SG +G+A+ K+  +K +G+ V ESPA +G T+ ++ 
Sbjct  242   PGKRMGHAGAIISGTRGSAEHKLEAMKSSGIIVAESPAAIGRTLKELL  289



>gb|EUB56696.1| Succinyl-CoA ligase [GDP-forming] subunit alpha [Echinococcus 
granulosus]
Length=334

 Score =   373 bits (958),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 208/325 (64%), Positives = 252/325 (78%), Gaps = 3/325 (1%)
 Frame = -2

Query  1329  ARLIANVSKKVRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQA  1150
             AR+I+ + K       S +  Q     + S    + +   T+VICQG TGK GTFH++Q 
Sbjct  2     ARIISRMFKAAGRFPFSSVLSQFTRSSYASTRKNLLLSDKTKVICQGFTGKQGTFHSQQT  61

Query  1149  IEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeamea  970
             + YGTK+VGGV+P KGG  HLGLPVFNTV +AK  T A+A+VIYVPP FA  AI EAMEA
Sbjct  62    LAYGTKLVGGVSPGKGGQTHLGLPVFNTVGEAKEATGADATVIYVPPQFAARAIDEAMEA  121

Query  969   ELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGR  790
             E+ L+VCITEGIPQHDM++VK  L +Q+K+RL+GPNCPGIIKPG CKIGIMPG+ H PG 
Sbjct  122   EMPLIVCITEGIPQHDMIRVKHRLVRQSKSRLLGPNCPGIIKPGVCKIGIMPGHSHAPGH  181

Query  789   IGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLi  610
             IGIVSRSGTLTYEAV QTT  GLGQS CVGIGGDPFNGT+F+DCLE F+ DP T GI++I
Sbjct  182   IGIVSRSGTLTYEAVHQTTVTGLGQSLCVGIGGDPFNGTDFIDCLEVFLGDPDTHGIIII  241

Query  609   geiggtaeeeaaafIKESG---TEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKI  439
             GEIGG AEEEAAA++KE     ++KPVV+F+AG+TAPPGRRMGHAGAI+SGGKG A+ KI
Sbjct  242   GEIGGQAEEEAAAYLKEHNSGPSKKPVVSFVAGVTAPPGRRMGHAGAIISGGKGDAKSKI  301

Query  438   RTLKEAGVTVCESPAKLGTTMLDVF  364
               L+EAGV V  SPAK+G+ ++ V 
Sbjct  302   AALEEAGVIVSRSPAKMGSALMQVM  326



>ref|WP_006577242.1| succinyl-CoA synthetase, alpha subunit [Cupriavidus sp. HPC(L)]
 gb|ESJ11338.1| succinyl-CoA synthetase subsunit alpha [Cupriavidus sp. HPC(L)]
Length=291

 Score =   371 bits (953),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 203/284 (71%), Positives = 241/284 (85%), Gaps = 1/284 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             V +D +TRV+CQG+TG  G+FHTEQA+ YGT+MVGGVTP KGG  HLGLPVF+TVA+A  
Sbjct  3     VLIDNHTRVLCQGLTGAQGSFHTEQALAYGTQMVGGVTPGKGGETHLGLPVFDTVAEAAE  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
              T A ASVIYVPPPFA  AI+EA++A L+LVVCITEGIP  DMV+VK AL   ++TRL+G
Sbjct  63    RTGAQASVIYVPPPFAADAILEAVDAGLELVVCITEGIPVLDMVRVKRALSG-SRTRLVG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PG+CKIGIMPG+IH+PGRIG+VSRSGTLTYEAV QT+A GLGQSTC+GIGGD
Sbjct  122   PNCPGVITPGQCKIGIMPGHIHRPGRIGVVSRSGTLTYEAVAQTSAAGLGQSTCIGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNF+DCL+ F+ D  TEGI+LIGEIGG+AEEEAA F++ESG++KPVV FIAG TAP
Sbjct  182   PVNGTNFIDCLKLFLEDDDTEGIILIGEIGGSAEEEAAQFLRESGSDKPVVGFIAGTTAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTM  376
             PGRRMGHAGAI+SGG GTA  KI  ++ AG+ V  SPA+LG TM
Sbjct  242   PGRRMGHAGAIISGGSGTADAKIEAMRAAGIHVSRSPAELGQTM  285



>ref|WP_043950111.1| succinate--CoA ligase [Candidatus Phaeomarinobacter ectocarpi]
 emb|CDO59471.1| Succinyl-CoA ligase [ADP-forming] alpha chain [Candidatus Phaeomarinobacter 
ectocarpi]
Length=291

 Score =   371 bits (953),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 202/288 (70%), Positives = 243/288 (84%), Gaps = 1/288 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             V +D NT+VI QG TG  GTFH+E AIEYGTK+VGGVTP KGGT+HL LPVF+TV +A  
Sbjct  3     VLIDSNTKVITQGFTGAQGTFHSETAIEYGTKLVGGVTPGKGGTKHLDLPVFDTVGEAVE  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T A+A++IYVPPPFA  AI+EA++AE+ L VCITEGIP  DMVKVK AL   +KTRL+G
Sbjct  63    KTGADATMIYVPPPFAADAILEAIDAEIPLAVCITEGIPVLDMVKVKKAL-CGSKTRLVG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IH+PG +GIVSRSGTLTYEAV QTTA GLGQ+TC+GIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHQPGTVGIVSRSGTLTYEAVGQTTAAGLGQTTCIGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNF+DCL+ F+ D +TE I++IGEIGG+AEE+AA F+K+S T+KPVV FIAG+TAP
Sbjct  182   PVNGTNFIDCLDMFLGDDKTESIIMIGEIGGSAEEDAAEFLKQSKTKKPVVGFIAGVTAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             PGRRMGHAGAI+SGGKG A  KI  +K AG+TV  SPA LG+T++DV 
Sbjct  242   PGRRMGHAGAIISGGKGDAASKIEAMKSAGITVSPSPAALGSTLVDVL  289



>ref|WP_029011387.1| succinate--CoA ligase [Azospirillum halopraeferens]
Length=291

 Score =   371 bits (953),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 208/289 (72%), Positives = 236/289 (82%), Gaps = 1/289 (0%)
 Frame = -2

Query  1230  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  1051
              V V+  TRVICQG TG  GTFH+EQAI YGT+MVGGVTP KGG+ HL LPVF+TVADA 
Sbjct  2     SVLVNSETRVICQGFTGAQGTFHSEQAIAYGTRMVGGVTPGKGGSTHLDLPVFDTVADAV  61

Query  1050  AETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  871
               T A ASVIYVPPPFA  AI+EA++AE+ LVVCITEGIP  DM+ V+ AL   + TRLI
Sbjct  62    ERTGATASVIYVPPPFAADAILEAIDAEIPLVVCITEGIPVQDMLAVRRAL-DHSATRLI  120

Query  870   GPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGG  691
             GPNCPGII PG+CKIGIMPG+IHKPGRIGIVSRSGTLTYEAV QTTA GLGQ+TC+GIGG
Sbjct  121   GPNCPGIITPGQCKIGIMPGHIHKPGRIGIVSRSGTLTYEAVAQTTATGLGQTTCIGIGG  180

Query  690   DPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTA  511
             DP NGTNFVD LE F+ADPQTEGI++IGEIGG AE + A FI++SGT KPVV FIAG TA
Sbjct  181   DPVNGTNFVDALEMFLADPQTEGIIMIGEIGGDAEVKGAEFIRQSGTTKPVVGFIAGRTA  240

Query  510   PPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             PPGRRMGHAGA++SGG  TA  KI  +K AG+ V +SPA LG+TML   
Sbjct  241   PPGRRMGHAGAVISGGNDTADFKIEVMKSAGLHVADSPASLGSTMLSAM  289



>ref|WP_023386589.1| succinyl-CoA synthetase subsunit alpha [Anaplasma marginale]
 gb|AGZ78618.1| succinyl-CoA synthetase subsunit alpha [Anaplasma marginale str. 
Gypsy Plains]
 gb|AGZ79469.1| succinyl-CoA synthetase subsunit alpha [Anaplasma marginale str. 
Dawn]
Length=294

 Score =   371 bits (953),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 209/292 (72%), Positives = 241/292 (83%), Gaps = 1/292 (0%)
 Frame = -2

Query  1230  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  1051
              V VDKNTRVICQG TG NGTFH+EQAI YGTKMVGGVTP KGGT HLGLPVF+TV  AK
Sbjct  2     SVLVDKNTRVICQGFTGSNGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFDTVLQAK  61

Query  1050  AETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  871
              ET+ANASVIYVP P+A  AI EA+EAE++L+VCITEGIP  DMV+VK AL   +K+R+I
Sbjct  62    VETQANASVIYVPAPYAADAIFEAIEAEIELIVCITEGIPVLDMVQVKRALA-GSKSRMI  120

Query  870   GPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGG  691
             GPNCPGII P ECKIGIMPGYIHK G IG+VSRSGTLTYEAV QTTAVGLGQSTC+GIGG
Sbjct  121   GPNCPGIITPEECKIGIMPGYIHKKGNIGVVSRSGTLTYEAVAQTTAVGLGQSTCIGIGG  180

Query  690   DPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTA  511
             DP +G +F+DC++ F+ D  T GIV+IGEIGG+ EEEA  F++ SGT+KPVV F+AG TA
Sbjct  181   DPVHGMSFLDCVQLFLEDEDTHGIVIIGEIGGSEEEEAVEFLQSSGTKKPVVGFVAGQTA  240

Query  510   PPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKR  355
             PPG+RMGHAGAI SG  GTA+ KI  +K AGV V E+PA +G T+LDV  KR
Sbjct  241   PPGKRMGHAGAISSGSSGTAKGKIEFMKRAGVAVAETPAVIGKTVLDVMGKR  292



>ref|XP_004347867.1| succinate-CoA ligase [Capsaspora owczarzaki ATCC 30864]
Length=318

 Score =   372 bits (956),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 209/290 (72%), Positives = 239/290 (82%), Gaps = 0/290 (0%)
 Frame = -2

Query  1254  RLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPV  1075
             R + S    + ++K+T+VICQG TGK GTFH+EQA+ YGTKMVGGV+P K G +HLGLPV
Sbjct  17    RAYNSTRKNLLINKDTKVICQGFTGKQGTFHSEQALLYGTKMVGGVSPAKAGQQHLGLPV  76

Query  1074  FNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALK  895
             F  V DA   T A+A+VIYVPPPFA  AI EA+EAE+ L VCITEGIPQ DMVKVK AL 
Sbjct  77    FKDVKDAVKATGAHATVIYVPPPFAAGAIFEAIEAEIPLAVCITEGIPQQDMVKVKNALL  136

Query  894   QQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQ  715
              Q KTRL+GPNCPGIIKP ECKIGIMPG+IHK G IGIVSRSGTLTYEAV QTTAVGLGQ
Sbjct  137   SQNKTRLVGPNCPGIIKPDECKIGIMPGHIHKRGNIGIVSRSGTLTYEAVAQTTAVGLGQ  196

Query  714   STCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVV  535
             S CVGIGGDPFNGTNFVDCL+ F+ DP+T+GI+LIGEIGG+AEEEAA ++K    +KPVV
Sbjct  197   SLCVGIGGDPFNGTNFVDCLDIFLNDPETKGIILIGEIGGSAEEEAAEYLKNHKIKKPVV  256

Query  534   AFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLG  385
             +FIAG TAPPGRRMGHAGAI+SGGKG A  KI  L  AGVTV +SPA++G
Sbjct  257   SFIAGRTAPPGRRMGHAGAIISGGKGGADAKIAALHSAGVTVVDSPAQMG  306



>emb|CCG84081.1| protein of unknown function [Taphrina deformans PYCC 5710]
Length=318

 Score =   372 bits (955),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 207/318 (65%), Positives = 253/318 (80%), Gaps = 0/318 (0%)
 Frame = -2

Query  1299  VRPITQSPLWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGG  1120
             +R + Q     ++    +G     + ++  T+V+ QG TGK GTFH +QA++YGTK+VGG
Sbjct  1     MRSVRQFSTTARRCSDAYGQTLQNLRINGETKVLFQGFTGKQGTFHAQQALDYGTKVVGG  60

Query  1119  VTPKKGGTEHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITE  940
               PKK GTEHL LPVF ++A+A  +TKA+AS I+VPPP A  A++EA+EAE+ LVVCITE
Sbjct  61    TNPKKAGTEHLSLPVFKSIAEAMQQTKADASAIFVPPPVAAGAVLEAIEAEVPLVVCITE  120

Query  939   GIPQHDMVKVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTL  760
             GIPQHDMV+V  ALK Q+KTRL+GPNCPGII PG+CKIGIMP +IHK G+IGIVSRSGTL
Sbjct  121   GIPQHDMVRVTQALKTQSKTRLVGPNCPGIIAPGQCKIGIMPSHIHKRGKIGIVSRSGTL  180

Query  759   TYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeee  580
             TYEAV QTT VGLGQS  +GIGGDPF+GTNF+D L  F+ D +TEGI+LIGEIGG+AEE+
Sbjct  181   TYEAVNQTTNVGLGQSLVIGIGGDPFSGTNFIDALNLFLNDAETEGIILIGEIGGSAEED  240

Query  579   aaafIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCES  400
             AA  IKESGT KPVV+FIAG+TAPPGRRMGHAGAI SGG GTA+ K   L+ AGV V ES
Sbjct  241   AARLIKESGTTKPVVSFIAGMTAPPGRRMGHAGAITSGGTGTAKGKQDALRAAGVIVSES  300

Query  399   PAKLGTTMLDVFTKRGLL  346
             PAKLG+ MLD FT+R ++
Sbjct  301   PAKLGSFMLDEFTRRDMI  318



>emb|CDH52273.1| succinyl-ligase subunit mitochondrialprecursor [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=330

 Score =   372 bits (956),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 209/304 (69%), Positives = 244/304 (80%), Gaps = 4/304 (1%)
 Frame = -2

Query  1248  FGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN  1069
             + S A  + ++K+T+VICQG TGK GTFH+EQAI YGT MVGGV+PKK G  HLGLPVF 
Sbjct  26    YESTAKNLMINKDTKVICQGFTGKQGTFHSEQAIAYGTNMVGGVSPKKAGQTHLGLPVFG  85

Query  1068  TVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQ  889
             +V +A  E K +ASVIYVPPP A AA++EA+E E+ LVV ITEGIPQHDMV+VK AL  Q
Sbjct  86    SVREAVQEAKPDASVIYVPPPGAAAAVLEAIENEIPLVVAITEGIPQHDMVRVKQALMTQ  145

Query  888   TKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQST  709
              KTRL+GPNCPGII P +CKIGIMPG+IHK G++GIVSRSGTLTYEAV QTT VGLGQ+ 
Sbjct  146   NKTRLVGPNCPGIIAPEQCKIGIMPGHIHKRGKVGIVSRSGTLTYEAVNQTTQVGLGQTL  205

Query  708   CVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESG----TEKP  541
             CVGIGGDP NGTNF+DCL+ F+ D  TEGIV+IGEIGGTAEEEAA F+++      T KP
Sbjct  206   CVGIGGDPLNGTNFIDCLKIFLEDDNTEGIVMIGEIGGTAEEEAADFLRQYNLTRETPKP  265

Query  540   VVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFT  361
             VV+FIAGLTAPPGRRMGHAGAI+SGGKG AQDKI  L+ AGV V  SPA+LG  + +  T
Sbjct  266   VVSFIAGLTAPPGRRMGHAGAIISGGKGGAQDKIAALESAGVIVTPSPAQLGNKLKEAMT  325

Query  360   KRGL  349
               GL
Sbjct  326   AAGL  329



>ref|WP_025527854.1| succinate--CoA ligase [Burkholderia sp. JGI 0001009-G23]
Length=290

 Score =   371 bits (952),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 205/285 (72%), Positives = 239/285 (84%), Gaps = 1/285 (0%)
 Frame = -2

Query  1230  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  1051
              V +DKNTRVICQG TG  GTFH+EQAI YGT+MVGGVTP KGGT HL LPVF+TVADA 
Sbjct  2     SVLIDKNTRVICQGFTGAQGTFHSEQAIAYGTRMVGGVTPGKGGTTHLDLPVFDTVADAV  61

Query  1050  AETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  871
             A+T A ASVIYVPPPFA  AI+EA++ E+  +VCITEGIP  DM++VK AL   + +RL+
Sbjct  62    AKTGAEASVIYVPPPFAADAILEAIDVEVPFIVCITEGIPVLDMLRVKRALAG-SASRLV  120

Query  870   GPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGG  691
             GPNCPG+I PGECKIGIMPG+IH+PG+IG+VSRSGTLTYEAV QTTA GLGQ+TC+GIGG
Sbjct  121   GPNCPGVITPGECKIGIMPGHIHRPGKIGVVSRSGTLTYEAVAQTTAAGLGQTTCIGIGG  180

Query  690   DPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTA  511
             DP NGTNF+DCL  F+ D  TEGI++IGEIGG+AEEEAA F+K+SGT+KPVV FIAG TA
Sbjct  181   DPVNGTNFIDCLSLFIDDDATEGIIMIGEIGGSAEEEAAQFLKDSGTKKPVVGFIAGTTA  240

Query  510   PPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTM  376
             PPGRRMGHAGAI+SGG GTA  KI  +K AG+ V +SPA LG TM
Sbjct  241   PPGRRMGHAGAIISGGSGTASAKIDAMKAAGILVADSPAALGETM  285



>ref|WP_046058391.1| succinate--CoA ligase [Rickettsia monacensis]
 emb|CEO17419.1| Succinyl-CoA ligase [ADP-forming] subunit alpha [Rickettsia monacensis]
Length=290

 Score =   371 bits (952),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 202/286 (71%), Positives = 242/286 (85%), Gaps = 1/286 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             + ++K T+VICQG TG  GTFH+EQAI YGT MVGGVTP KGG  HL LPV+NTV +AKA
Sbjct  3     ILINKKTKVICQGFTGSQGTFHSEQAIAYGTNMVGGVTPGKGGHTHLDLPVYNTVHEAKA  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
             +T ANASVIYVPP FA  +I+EA++AE+++VVCITEGIP  DMVKVK AL   +KTRLIG
Sbjct  63    KTGANASVIYVPPDFAADSILEAIDAEIEVVVCITEGIPVLDMVKVKRAL-VGSKTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IHK G IGIVSRSGTLTYEAV QTT VGLGQSTCVGIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHKRGTIGIVSRSGTLTYEAVAQTTTVGLGQSTCVGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P N TNFVDC+E F+ D +T+ I++IGEIGG AEE+AA FIK+S  +KP+V+FIAG+TAP
Sbjct  182   PVNDTNFVDCIEMFLKDDETKAIIMIGEIGGNAEEDAAEFIKQSKIKKPIVSFIAGITAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLD  370
             PG+RMGHAGAI++GGKG+A+DK+  L+ AGVT+  SPA +G TML+
Sbjct  242   PGKRMGHAGAIIAGGKGSAEDKLEALQSAGVTITRSPADIGKTMLE  287



>emb|CDS05386.1| Putative Succinyl-CoA ligase [Absidia idahoensis var. thermophila]
Length=330

 Score =   372 bits (955),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 209/304 (69%), Positives = 244/304 (80%), Gaps = 4/304 (1%)
 Frame = -2

Query  1248  FGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFN  1069
             + S A  + ++K+T+VICQG TGK GTFH+EQAI YGT MVGGV+PKK G  HLGLPVF 
Sbjct  26    YESTAKNLMINKDTKVICQGFTGKQGTFHSEQAIAYGTNMVGGVSPKKAGQTHLGLPVFG  85

Query  1068  TVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQ  889
             +V +A  E K +ASVIYVPPP A AA++EA+E E+ LVV ITEGIPQHDMV+VK AL  Q
Sbjct  86    SVREAVQEAKPDASVIYVPPPGAAAAVLEAIENEIPLVVAITEGIPQHDMVRVKQALMTQ  145

Query  888   TKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQST  709
              KTRL+GPNCPGII P +CKIGIMPG+IHK G++GIVSRSGTLTYEAV QTT VGLGQ+ 
Sbjct  146   NKTRLVGPNCPGIIAPEQCKIGIMPGHIHKRGKVGIVSRSGTLTYEAVNQTTQVGLGQTL  205

Query  708   CVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESG----TEKP  541
             CVGIGGDP NGTNF+DCL+ F+ D  TEGIV+IGEIGGTAEEEAA F+++      T KP
Sbjct  206   CVGIGGDPLNGTNFIDCLKIFLEDDNTEGIVMIGEIGGTAEEEAADFLRQYNLTRETPKP  265

Query  540   VVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFT  361
             VV+FIAGLTAPPGRRMGHAGAI+SGGKG AQDKI  L+ AGV V  SPA+LG  + +  T
Sbjct  266   VVSFIAGLTAPPGRRMGHAGAIISGGKGGAQDKIAALESAGVIVTPSPAQLGNKLKEAMT  325

Query  360   KRGL  349
               GL
Sbjct  326   AAGL  329



>ref|WP_002730338.1| MULTISPECIES: succinyl-CoA synthetase subsunit alpha [Phaeospirillum]
 emb|CCG42597.1| succinyl-CoA synthetase, alpha subunit, NAD(P)-binding [Phaeospirillum 
molischianum DSM 120]
 gb|EPY01792.1| succinyl-CoA synthetase subunit alpha [Phaeospirillum fulvum 
MGU-K5]
Length=291

 Score =   371 bits (952),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 199/288 (69%), Positives = 234/288 (81%), Gaps = 1/288 (0%)
 Frame = -2

Query  1227  VFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAKA  1048
             V V+  T+VICQG TG  GTFH+EQAI YGTKMVGGVTP KGGT HL LPVFNTVA+AKA
Sbjct  3     VLVNSETKVICQGFTGAQGTFHSEQAIAYGTKMVGGVTPGKGGTSHLDLPVFNTVAEAKA  62

Query  1047  ETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLIG  868
              T  NA+VIYVPPPFA  AI+EA++AE++L VCITEGIP  DM+ VK AL   +KTRLIG
Sbjct  63    RTGCNATVIYVPPPFAADAILEAIDAEIELAVCITEGIPVADMLAVKRAL-VGSKTRLIG  121

Query  867   PNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGD  688
             PNCPG+I PGECKIGIMPG+IH+ G++GIVSRSGTLTYEAV QTTA GLGQ+TC+GIGGD
Sbjct  122   PNCPGVITPGECKIGIMPGHIHRRGKVGIVSRSGTLTYEAVAQTTAAGLGQTTCIGIGGD  181

Query  687   PFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTAP  508
             P NGTNFVD LE F+ DP+TE I++IGEIGG AE + A  +++S  +KP V FIAG TAP
Sbjct  182   PINGTNFVDSLEMFLDDPETEAIIMIGEIGGDAEVKGAELLRDSKIKKPTVGFIAGRTAP  241

Query  507   PGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVF  364
             PGRRMGHAGA++SGG  TA  KI  ++ AG+ V ESPA LG+TML + 
Sbjct  242   PGRRMGHAGAVISGGNDTADFKIEAMRSAGIAVAESPAALGSTMLALL  289



>ref|XP_012142093.1| PREDICTED: succinyl-CoA ligase subunit alpha, mitochondrial [Megachile 
rotundata]
Length=333

 Score =   372 bits (956),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 207/313 (66%), Positives = 251/313 (80%), Gaps = 3/313 (1%)
 Frame = -2

Query  1275  LWQQQQHRLFGSPAPEVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGT  1096
             L + Q    +      + +D NT+VICQG TGK GTFH +QAIEYGTK+VGGV+PKK G+
Sbjct  19    LLRSQIRFNYTDTRKNLKIDSNTKVICQGFTGKQGTFHCKQAIEYGTKIVGGVSPKKAGS  78

Query  1095  EHLGLPVFNTVADAKAETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMV  916
             EHLG PVF TV +AK  T A ASVIYVPPP A +AIMEA++AE+ L+VCITEGIPQHDMV
Sbjct  79    EHLGKPVFKTVKEAKEATGATASVIYVPPPAAASAIMEAIDAEMSLIVCITEGIPQHDMV  138

Query  915   KVKAALKQQTKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQT  736
             KVK  L +Q K+RLIGPNCPGII P +CKIGIMPG+IH+ G+IGIVSRSGTLTYEAV QT
Sbjct  139   KVKRRLLEQNKSRLIGPNCPGIIAPEQCKIGIMPGHIHQKGKIGIVSRSGTLTYEAVNQT  198

Query  735   TAVGLGQSTCVGIGGDPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKES  556
             T  GLGQ+ CVGIGGDPFNGT+F+DCL+ F+ DP+ +GI++IGEIGG+AEE AA ++ E+
Sbjct  199   TLTGLGQTLCVGIGGDPFNGTDFIDCLDVFLKDPECDGIIMIGEIGGSAEESAAEYLIEN  258

Query  555   ---GTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLG  385
                G  KPVV+FIAG+TAPPGRRMGHAGAI+SGGKG AQDKI  L++AGV V  SPA++G
Sbjct  259   NTGGKAKPVVSFIAGITAPPGRRMGHAGAIISGGKGGAQDKINALEKAGVIVTRSPAQMG  318

Query  384   TTMLDVFTKRGLL  346
               +L   T+ GL+
Sbjct  319   NELLKEMTRLGLV  331



>ref|WP_010263012.1| succinyl-CoA ligase chain A (sucD), partial [Anaplasma marginale]
Length=294

 Score =   371 bits (952),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 208/292 (71%), Positives = 241/292 (83%), Gaps = 1/292 (0%)
 Frame = -2

Query  1230  EVFVDKNTRVICQGITGKNGTFHTEQAIEYGTKMVGGVTPKKGGTEHLGLPVFNTVADAK  1051
              V VDKNTRVICQG TG NGTFH+EQA+ YGTKMVGGVTP KGGT HLGLPVF+TV  AK
Sbjct  2     SVLVDKNTRVICQGFTGSNGTFHSEQAVAYGTKMVGGVTPGKGGTTHLGLPVFDTVLQAK  61

Query  1050  AETKANASVIYVPPPFagaaimeameaELDLVVCITEGIPQHDMVKVKAALKQQTKTRLI  871
              ET+ANASVIYVP P+A  AI EA+EAE++L+VCITEGIP  DMV+VK AL   +K+R+I
Sbjct  62    VETQANASVIYVPAPYAADAIFEAIEAEIELIVCITEGIPVLDMVQVKRALA-GSKSRMI  120

Query  870   GPNCPGIIKPGECKIGIMPGYIHKPGRIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGG  691
             GPNCPGII P ECKIGIMPGYIHK G IG+VSRSGTLTYEAV QTTAVGLGQSTC+GIGG
Sbjct  121   GPNCPGIITPEECKIGIMPGYIHKKGNIGVVSRSGTLTYEAVAQTTAVGLGQSTCIGIGG  180

Query  690   DPFNGTNFVDCLERFVADPQTEGIVLigeiggtaeeeaaafIKESGTEKPVVAFIAGLTA  511
             DP +G +F+DC++ F+ D  T GIV+IGEIGG+ EEEA  F++ SGT+KPVV F+AG TA
Sbjct  181   DPVHGMSFLDCVQLFLEDEDTHGIVIIGEIGGSEEEEAVEFLQSSGTKKPVVGFVAGQTA  240

Query  510   PPGRRMGHAGAIVSGGKGTAQDKIRTLKEAGVTVCESPAKLGTTMLDVFTKR  355
             PPG+RMGHAGAI SG  GTA+ KI  +K AGV V E+PA +G T+LDV  KR
Sbjct  241   PPGKRMGHAGAISSGSSGTAKGKIEFMKRAGVAVAETPAVIGKTVLDVMGKR  292



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4295394865454