BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13785

Length=1622
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009614133.1|  PREDICTED: serine carboxypeptidase-like 18 i...    485   1e-163   Nicotiana tomentosiformis
gb|AAF64227.1|AF248647_1  glucose acyltransferase                       479   6e-161   Solanum pennellii
ref|XP_006353976.1|  PREDICTED: serine carboxypeptidase-like 18-like    477   3e-160   Solanum tuberosum [potatoes]
ref|XP_009614132.1|  PREDICTED: serine carboxypeptidase-like 18 i...    477   4e-160   Nicotiana tomentosiformis
gb|AAD01263.1|  glucose acyltransferase                                 476   7e-160   Solanum berthaultii
ref|XP_009795830.1|  PREDICTED: serine carboxypeptidase-like 18 i...    476   9e-160   Nicotiana sylvestris
ref|XP_004248779.1|  PREDICTED: serine carboxypeptidase-like 18         473   1e-158   Solanum lycopersicum
ref|XP_006350185.1|  PREDICTED: serine carboxypeptidase-like 18-l...    473   1e-158   Solanum tuberosum [potatoes]
ref|XP_009795831.1|  PREDICTED: serine carboxypeptidase-like 18 i...    463   7e-156   Nicotiana sylvestris
ref|XP_006353974.1|  PREDICTED: serine carboxypeptidase-like 18-like    463   7e-155   Solanum tuberosum [potatoes]
gb|AAD01265.1|  glucose acyltransferase                                 463   7e-155   Solanum berthaultii
gb|AAD01264.1|  glucose acyltransferase                                 462   2e-154   Solanum berthaultii
ref|XP_004248778.1|  PREDICTED: serine carboxypeptidase-like 18         458   6e-153   Solanum lycopersicum
ref|XP_006353975.1|  PREDICTED: serine carboxypeptidase-like 18-like    457   1e-152   Solanum tuberosum [potatoes]
ref|XP_011069855.1|  PREDICTED: serine carboxypeptidase-like 18 i...    427   1e-140   Sesamum indicum [beniseed]
ref|XP_007201135.1|  hypothetical protein PRUPE_ppa016992mg             425   3e-140   
ref|XP_011069858.1|  PREDICTED: serine carboxypeptidase-like 18         425   8e-140   Sesamum indicum [beniseed]
ref|XP_008236294.1|  PREDICTED: serine carboxypeptidase-like 14         422   5e-139   Prunus mume [ume]
ref|XP_007200784.1|  hypothetical protein PRUPE_ppa024053mg             417   4e-137   
ref|XP_011069856.1|  PREDICTED: serine carboxypeptidase-like 18 i...    417   1e-136   Sesamum indicum [beniseed]
ref|XP_002522135.1|  serine carboxypeptidase, putative                  416   2e-136   
ref|XP_008236292.1|  PREDICTED: serine carboxypeptidase-like 13 i...    413   3e-135   Prunus mume [ume]
ref|XP_011070163.1|  PREDICTED: serine carboxypeptidase-like 18         412   7e-135   Sesamum indicum [beniseed]
ref|XP_010647903.1|  PREDICTED: serine carboxypeptidase-like 13         411   2e-134   Vitis vinifera
ref|XP_002266354.2|  PREDICTED: serine carboxypeptidase-like 18         411   2e-134   Vitis vinifera
emb|CBI22421.3|  unnamed protein product                                412   4e-133   Vitis vinifera
ref|XP_007201001.1|  hypothetical protein PRUPE_ppa005249mg             405   3e-132   
ref|XP_010028346.1|  PREDICTED: serine carboxypeptidase-like 18         405   4e-132   Eucalyptus grandis [rose gum]
ref|XP_011457834.1|  PREDICTED: serine carboxypeptidase-like 18         404   1e-131   Fragaria vesca subsp. vesca
ref|XP_010028339.1|  PREDICTED: serine carboxypeptidase-like 18         403   2e-131   Eucalyptus grandis [rose gum]
emb|CBI22420.3|  unnamed protein product                                403   6e-131   Vitis vinifera
ref|XP_009343181.1|  PREDICTED: serine carboxypeptidase-like 1 is...    402   9e-131   
ref|XP_011030307.1|  PREDICTED: serine carboxypeptidase-like 18 i...    401   2e-130   Populus euphratica
ref|XP_009343180.1|  PREDICTED: serine carboxypeptidase-like 1          400   2e-130   Pyrus x bretschneideri [bai li]
ref|XP_006422770.1|  hypothetical protein CICLE_v10028371mg             399   7e-130   Citrus clementina [clementine]
ref|XP_010028341.1|  PREDICTED: serine carboxypeptidase-like 18 i...    397   3e-129   Eucalyptus grandis [rose gum]
ref|XP_006486897.1|  PREDICTED: serine carboxypeptidase-like 17-like    397   5e-129   Citrus sinensis [apfelsine]
gb|KCW55076.1|  hypothetical protein EUGRSUZ_I01041                     392   3e-128   Eucalyptus grandis [rose gum]
ref|XP_007201023.1|  hypothetical protein PRUPE_ppa005420mg             395   3e-128   Prunus persica
ref|XP_008236291.1|  PREDICTED: serine carboxypeptidase-like 13 i...    394   7e-128   
ref|XP_006486895.1|  PREDICTED: serine carboxypeptidase-like 18-like    394   8e-128   Citrus sinensis [apfelsine]
gb|KCW55068.1|  hypothetical protein EUGRSUZ_I010391                    390   8e-128   Eucalyptus grandis [rose gum]
ref|XP_008236286.1|  PREDICTED: serine carboxypeptidase-like 2 is...    394   9e-128   Prunus mume [ume]
ref|XP_008236280.1|  PREDICTED: serine carboxypeptidase-like 17 i...    393   2e-127   Prunus mume [ume]
ref|XP_007199819.1|  hypothetical protein PRUPE_ppa005264mg             393   3e-127   
ref|XP_009375674.1|  PREDICTED: serine carboxypeptidase-like 7          392   4e-127   Pyrus x bretschneideri [bai li]
ref|XP_006486896.1|  PREDICTED: serine carboxypeptidase-like 18-like    392   7e-127   Citrus sinensis [apfelsine]
ref|XP_008236287.1|  PREDICTED: serine carboxypeptidase-like 13         392   7e-127   Prunus mume [ume]
ref|XP_002298786.2|  hypothetical protein POPTR_0001s29870g             391   9e-127   
ref|XP_009343182.1|  PREDICTED: serine carboxypeptidase-like 18 i...    389   1e-126   
ref|XP_010028345.1|  PREDICTED: serine carboxypeptidase-like 18         390   1e-126   Eucalyptus grandis [rose gum]
ref|XP_006422777.1|  hypothetical protein CICLE_v10028360mg             390   2e-126   Citrus clementina [clementine]
ref|XP_009343914.1|  PREDICTED: serine carboxypeptidase-like 7          390   2e-126   Pyrus x bretschneideri [bai li]
ref|XP_011030310.1|  PREDICTED: serine carboxypeptidase-like 18 i...    390   5e-126   Populus euphratica
ref|XP_008236285.1|  PREDICTED: serine carboxypeptidase-like 2 is...    389   8e-126   Prunus mume [ume]
ref|XP_006422773.1|  hypothetical protein CICLE_v10028648mg             385   2e-125   
ref|XP_008236275.1|  PREDICTED: serine carboxypeptidase-like 17 i...    387   2e-125   Prunus mume [ume]
ref|XP_002265842.1|  PREDICTED: serine carboxypeptidase-like 18         385   7e-124   Vitis vinifera
ref|XP_006422780.1|  hypothetical protein CICLE_v10028349mg             384   9e-124   Citrus clementina [clementine]
ref|XP_011100015.1|  PREDICTED: serine carboxypeptidase-like 7 is...    384   9e-124   Sesamum indicum [beniseed]
emb|CBI22424.3|  unnamed protein product                                385   1e-123   Vitis vinifera
ref|XP_008236281.1|  PREDICTED: serine carboxypeptidase-like 17 i...    384   1e-123   Prunus mume [ume]
ref|XP_010065879.1|  PREDICTED: serine carboxypeptidase-like 13         382   3e-123   Eucalyptus grandis [rose gum]
ref|XP_008236346.1|  PREDICTED: serine carboxypeptidase-like 18         380   6e-123   
ref|XP_008236290.1|  PREDICTED: serine carboxypeptidase-like 17 i...    381   8e-123   Prunus mume [ume]
ref|XP_008236288.1|  PREDICTED: serine carboxypeptidase-like 18 i...    381   1e-122   
ref|XP_011088733.1|  PREDICTED: serine carboxypeptidase-like 7          380   4e-122   Sesamum indicum [beniseed]
ref|XP_008236276.1|  PREDICTED: serine carboxypeptidase-like 18 i...    377   4e-122   Prunus mume [ume]
ref|XP_011100017.1|  PREDICTED: serine carboxypeptidase-like 13         379   5e-122   Sesamum indicum [beniseed]
gb|KCW55073.1|  hypothetical protein EUGRSUZ_I01040                     378   2e-121   Eucalyptus grandis [rose gum]
ref|XP_008338878.1|  PREDICTED: serine carboxypeptidase-like 1          377   3e-121   
emb|CAN74923.1|  hypothetical protein VITISV_038590                     378   3e-121   Vitis vinifera
ref|XP_010065873.1|  PREDICTED: serine carboxypeptidase-like 2          377   3e-121   Eucalyptus grandis [rose gum]
ref|XP_010028347.1|  PREDICTED: serine carboxypeptidase-like 18         376   1e-120   Eucalyptus grandis [rose gum]
ref|XP_004289672.1|  PREDICTED: serine carboxypeptidase-like 13         375   1e-120   Fragaria vesca subsp. vesca
ref|XP_011100013.1|  PREDICTED: serine carboxypeptidase-like 13 i...    374   7e-120   
ref|XP_012093157.1|  PREDICTED: serine carboxypeptidase-like 2          374   8e-120   Jatropha curcas
ref|XP_012093156.1|  PREDICTED: serine carboxypeptidase-like 18         372   2e-119   Jatropha curcas
ref|XP_010065869.1|  PREDICTED: serine carboxypeptidase-like 2 is...    372   3e-119   Eucalyptus grandis [rose gum]
ref|XP_011030308.1|  PREDICTED: serine carboxypeptidase-like 18 i...    370   7e-119   Populus euphratica
ref|XP_012075109.1|  PREDICTED: serine carboxypeptidase-like 18         370   2e-118   Jatropha curcas
ref|XP_002522133.1|  serine carboxypeptidase, putative                  370   2e-118   Ricinus communis
ref|XP_012093227.1|  PREDICTED: serine carboxypeptidase-like 18         371   2e-118   
ref|XP_007199854.1|  hypothetical protein PRUPE_ppa005665mg             369   2e-118   
gb|KCW63571.1|  hypothetical protein EUGRSUZ_G01198                     368   1e-117   Eucalyptus grandis [rose gum]
ref|XP_010065871.1|  PREDICTED: serine carboxypeptidase-like 2 is...    367   2e-117   
gb|KCW63569.1|  hypothetical protein EUGRSUZ_G01197                     366   5e-117   Eucalyptus grandis [rose gum]
ref|XP_002269439.1|  PREDICTED: serine carboxypeptidase-like 7          367   5e-117   Vitis vinifera
emb|CBI22419.3|  unnamed protein product                                366   6e-117   Vitis vinifera
ref|XP_010065865.1|  PREDICTED: serine carboxypeptidase-like 2 is...    365   1e-116   Eucalyptus grandis [rose gum]
gb|EYU37560.1|  hypothetical protein MIMGU_mgv1a005845mg                365   1e-116   Erythranthe guttata [common monkey flower]
ref|XP_007201024.1|  hypothetical protein PRUPE_ppa006101mg             362   4e-116   
ref|XP_012093215.1|  PREDICTED: serine carboxypeptidase-like 18         361   6e-116   
gb|EYU37561.1|  hypothetical protein MIMGU_mgv1a005963mg                362   1e-115   Erythranthe guttata [common monkey flower]
gb|KDP44531.1|  hypothetical protein JCGZ_16364                         365   1e-115   Jatropha curcas
ref|XP_010065872.1|  PREDICTED: serine carboxypeptidase-like 2          362   2e-115   
ref|XP_004296446.1|  PREDICTED: serine carboxypeptidase-like 18         360   9e-115   Fragaria vesca subsp. vesca
ref|XP_002300184.2|  hypothetical protein POPTR_0001s31980g             359   2e-114   
ref|XP_012075152.1|  PREDICTED: serine carboxypeptidase-like 13         359   3e-114   
ref|XP_002522137.1|  serine carboxypeptidase, putative                  359   3e-114   
ref|XP_012093225.1|  PREDICTED: serine carboxypeptidase-like 18         358   5e-114   Jatropha curcas
ref|XP_002266615.3|  PREDICTED: serine carboxypeptidase-like 17         357   9e-114   Vitis vinifera
emb|CAN83341.1|  hypothetical protein VITISV_021484                     358   2e-113   Vitis vinifera
ref|XP_006369794.1|  hypothetical protein POPTR_0001s31980g             356   5e-113   Populus trichocarpa [western balsam poplar]
ref|XP_003633198.1|  PREDICTED: serine carboxypeptidase-like 13 i...    354   1e-112   Vitis vinifera
dbj|BAF99696.1|  1-O-acylglucose:anthocyanin-O-acyltransferase- l...    355   1e-112   Gentiana triflora
ref|XP_010656845.1|  PREDICTED: serine carboxypeptidase-like 13         355   2e-112   Vitis vinifera
ref|XP_010682454.1|  PREDICTED: serine carboxypeptidase-like 18 i...    353   3e-112   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP44530.1|  hypothetical protein JCGZ_16363                         354   3e-112   Jatropha curcas
ref|XP_010040884.1|  PREDICTED: serine carboxypeptidase-like 18         353   3e-112   
ref|XP_010028342.1|  PREDICTED: serine carboxypeptidase-like 18 i...    352   4e-112   
ref|XP_002266867.3|  PREDICTED: serine carboxypeptidase-like 17         353   4e-112   Vitis vinifera
emb|CAN78674.1|  hypothetical protein VITISV_009248                     353   5e-112   Vitis vinifera
ref|XP_010046975.1|  PREDICTED: serine carboxypeptidase-like 17         354   7e-112   Eucalyptus grandis [rose gum]
emb|CBI17847.3|  unnamed protein product                                355   8e-112   Vitis vinifera
ref|XP_010936146.1|  PREDICTED: serine carboxypeptidase-like 18 i...    350   8e-112   
ref|XP_002522136.1|  serine carboxypeptidase, putative                  351   9e-112   
ref|XP_010936150.1|  PREDICTED: serine carboxypeptidase-like 18 i...    352   1e-111   
ref|XP_003633199.2|  PREDICTED: serine carboxypeptidase-like 13 i...    352   1e-111   Vitis vinifera
ref|XP_010936155.1|  PREDICTED: serine carboxypeptidase-like 18         352   1e-111   Elaeis guineensis
ref|XP_012079434.1|  PREDICTED: serine carboxypeptidase-like 7          352   2e-111   Jatropha curcas
dbj|BAO04183.1|  putative acyl-glucose-dependent anthocyanin acyl...    351   3e-111   Delphinium grandiflorum
ref|XP_010936145.1|  PREDICTED: serine carboxypeptidase-like 18 i...    348   3e-111   
ref|XP_008236344.1|  PREDICTED: serine carboxypeptidase-like 13         352   3e-111   
ref|XP_012093155.1|  PREDICTED: serine carboxypeptidase-like 18         350   6e-111   Jatropha curcas
ref|XP_011045684.1|  PREDICTED: serine carboxypeptidase-like 18 i...    350   7e-111   Populus euphratica
gb|KCW55058.1|  hypothetical protein EUGRSUZ_I01033                     348   8e-111   Eucalyptus grandis [rose gum]
ref|XP_010936154.1|  PREDICTED: serine carboxypeptidase-like 18         350   1e-110   
ref|XP_010656846.1|  PREDICTED: serine carboxypeptidase-like 13 i...    349   2e-110   Vitis vinifera
ref|XP_011003871.1|  PREDICTED: serine carboxypeptidase-like 18 i...    349   2e-110   Populus euphratica
emb|CBI17848.3|  unnamed protein product                                352   3e-110   Vitis vinifera
gb|KCW55074.1|  hypothetical protein EUGRSUZ_I01040                     347   4e-110   Eucalyptus grandis [rose gum]
ref|XP_010028338.1|  PREDICTED: serine carboxypeptidase-like 13         348   5e-110   Eucalyptus grandis [rose gum]
ref|XP_002283413.1|  PREDICTED: serine carboxypeptidase-like 2          348   6e-110   Vitis vinifera
ref|XP_010046973.1|  PREDICTED: serine carboxypeptidase-like 18         348   7e-110   Eucalyptus grandis [rose gum]
ref|XP_010048652.1|  PREDICTED: serine carboxypeptidase-like 18         348   8e-110   Eucalyptus grandis [rose gum]
ref|XP_010028337.1|  PREDICTED: serine carboxypeptidase-like 18         348   1e-109   Eucalyptus grandis [rose gum]
ref|XP_012093161.1|  PREDICTED: serine carboxypeptidase-like 18         347   1e-109   Jatropha curcas
ref|XP_011100016.1|  PREDICTED: serine carboxypeptidase-like 18 i...    345   1e-109   Sesamum indicum [beniseed]
ref|XP_011045683.1|  PREDICTED: serine carboxypeptidase-like 18 i...    347   1e-109   Populus euphratica
ref|XP_010028344.1|  PREDICTED: serine carboxypeptidase-like 7          347   2e-109   Eucalyptus grandis [rose gum]
emb|CBI19380.3|  unnamed protein product                                348   2e-109   Vitis vinifera
emb|CDP08199.1|  unnamed protein product                                348   2e-109   Coffea canephora [robusta coffee]
ref|XP_010030617.1|  PREDICTED: serine carboxypeptidase-like 18         345   3e-109   
ref|XP_011003870.1|  PREDICTED: serine carboxypeptidase-like 18 i...    346   3e-109   Populus euphratica
ref|XP_011457835.1|  PREDICTED: serine carboxypeptidase-like 7          345   4e-109   Fragaria vesca subsp. vesca
emb|CAN67390.1|  hypothetical protein VITISV_034715                     345   1e-108   Vitis vinifera
ref|XP_010048542.1|  PREDICTED: serine carboxypeptidase-like 13         344   1e-108   Eucalyptus grandis [rose gum]
ref|XP_008236293.1|  PREDICTED: serine carboxypeptidase-like 18 i...    343   2e-108   
ref|XP_008790304.1|  PREDICTED: uncharacterized protein LOC103707550    357   4e-108   
ref|XP_007200900.1|  hypothetical protein PRUPE_ppb017681mg             341   5e-108   
ref|XP_010040883.1|  PREDICTED: serine carboxypeptidase-like 18         341   7e-108   
ref|XP_006350186.1|  PREDICTED: serine carboxypeptidase-like 18-l...    339   1e-107   
emb|CDP08179.1|  unnamed protein product                                343   1e-107   Coffea canephora [robusta coffee]
ref|XP_010277006.1|  PREDICTED: serine carboxypeptidase-like 1 is...    342   1e-107   Nelumbo nucifera [Indian lotus]
dbj|BAF56655.1|  serine carboxypeptitase-like protein 1                 341   1e-107   Diospyros kaki [Japanese persimmon]
ref|XP_007047573.1|  Serine carboxypeptidase-like 2, putative iso...    342   2e-107   
ref|XP_002272116.1|  PREDICTED: serine carboxypeptidase-like 16         341   2e-107   Vitis vinifera
ref|XP_006472320.1|  PREDICTED: serine carboxypeptidase-like 18-l...    341   2e-107   
ref|XP_002510077.1|  serine carboxypeptidase, putative                  340   5e-107   Ricinus communis
gb|KJB48748.1|  hypothetical protein B456_008G084200                    339   9e-107   Gossypium raimondii
gb|KDO81468.1|  hypothetical protein CISIN_1g012276mg                   339   1e-106   Citrus sinensis [apfelsine]
ref|XP_010936156.1|  PREDICTED: serine carboxypeptidase-like 18         337   2e-106   
ref|XP_010061646.1|  PREDICTED: serine carboxypeptidase-like 2          339   2e-106   Eucalyptus grandis [rose gum]
ref|XP_007201000.1|  hypothetical protein PRUPE_ppa005249mg             337   2e-106   
ref|XP_009601001.1|  PREDICTED: serine carboxypeptidase-like 7 is...    338   2e-106   Nicotiana tomentosiformis
ref|XP_006433655.1|  hypothetical protein CICLE_v10001060mg             338   2e-106   Citrus clementina [clementine]
ref|XP_011100014.1|  PREDICTED: serine carboxypeptidase-like 18 i...    337   3e-106   
ref|XP_004299780.2|  PREDICTED: serine carboxypeptidase-like 13         339   4e-106   Fragaria vesca subsp. vesca
ref|XP_012068198.1|  PREDICTED: serine carboxypeptidase-like 17         338   4e-106   Jatropha curcas
gb|AIW39897.1|  serine carboxypeptidase-like protein                    338   6e-106   Camellia sinensis [black tea]
ref|XP_004289772.1|  PREDICTED: serine carboxypeptidase-like 18         338   6e-106   Fragaria vesca subsp. vesca
gb|KJB58677.1|  hypothetical protein B456_009G221000                    337   8e-106   Gossypium raimondii
ref|XP_012069145.1|  PREDICTED: serine carboxypeptidase-like 11         337   8e-106   Jatropha curcas
ref|XP_002525293.1|  serine carboxypeptidase, putative                  341   9e-106   
ref|XP_008790306.1|  PREDICTED: uncharacterized protein LOC103707552    350   1e-105   
ref|XP_009382032.1|  PREDICTED: serine carboxypeptidase-like 7          337   1e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007199857.1|  hypothetical protein PRUPE_ppa006297mg             335   1e-105   
ref|XP_010094886.1|  Serine carboxypeptidase-like 18                    335   2e-105   
dbj|BAO04182.1|  hypothetical protein                                   336   3e-105   Delphinium grandiflorum
ref|XP_010065870.1|  PREDICTED: serine carboxypeptidase-like 13 i...    335   3e-105   
gb|KHG24307.1|  Serine carboxypeptidase-like 18                         335   3e-105   Gossypium arboreum [tree cotton]
gb|KJB48749.1|  hypothetical protein B456_008G084200                    335   3e-105   Gossypium raimondii
ref|XP_010694001.1|  PREDICTED: serine carboxypeptidase-like 10 i...    335   5e-105   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB73512.1|  hypothetical protein B456_011G236800                    335   5e-105   Gossypium raimondii
ref|XP_010694004.1|  PREDICTED: serine carboxypeptidase-like 7 is...    334   6e-105   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003571685.1|  PREDICTED: serine carboxypeptidase-like 17         335   8e-105   Brachypodium distachyon [annual false brome]
gb|KCW55070.1|  hypothetical protein EUGRSUZ_I010391                    329   1e-104   Eucalyptus grandis [rose gum]
ref|XP_010028343.1|  PREDICTED: serine carboxypeptidase-like 18 i...    333   1e-104   Eucalyptus grandis [rose gum]
ref|XP_009600999.1|  PREDICTED: serine carboxypeptidase-like 7 is...    334   1e-104   Nicotiana tomentosiformis
ref|XP_004288266.1|  PREDICTED: serine carboxypeptidase-like 2 is...    335   1e-104   Fragaria vesca subsp. vesca
ref|XP_012093158.1|  PREDICTED: serine carboxypeptidase-like 18         334   1e-104   Jatropha curcas
ref|XP_011621823.1|  PREDICTED: serine carboxypeptidase-like 17         334   2e-104   Amborella trichopoda
ref|XP_004292764.2|  PREDICTED: serine carboxypeptidase-like 7 is...    334   2e-104   Fragaria vesca subsp. vesca
ref|XP_012093160.1|  PREDICTED: serine carboxypeptidase-like 7          333   3e-104   Jatropha curcas
ref|XP_010694000.1|  PREDICTED: serine carboxypeptidase-like 7          332   3e-104   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010656847.1|  PREDICTED: serine carboxypeptidase-like 18 i...    329   1e-103   
ref|XP_011457832.1|  PREDICTED: serine carboxypeptidase-like 17         332   1e-103   Fragaria vesca subsp. vesca
gb|KCW55062.1|  hypothetical protein EUGRSUZ_I01038                     327   1e-103   Eucalyptus grandis [rose gum]
ref|XP_002268517.1|  PREDICTED: serine carboxypeptidase-like 17         332   1e-103   Vitis vinifera
ref|XP_002300280.2|  hypothetical protein POPTR_0001s29810g             330   1e-103   
ref|XP_007018461.1|  Serine carboxypeptidase-like 7, putative           331   2e-103   
ref|XP_011627623.1|  PREDICTED: serine carboxypeptidase-like 7          331   3e-103   Amborella trichopoda
ref|XP_009384628.1|  PREDICTED: serine carboxypeptidase-like 18         331   3e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_012068194.1|  PREDICTED: serine carboxypeptidase-like 17         329   1e-102   Jatropha curcas
gb|EPS73196.1|  hypothetical protein M569_01551                         328   1e-102   Genlisea aurea
gb|KJB73511.1|  hypothetical protein B456_011G236800                    329   2e-102   Gossypium raimondii
ref|XP_011030309.1|  PREDICTED: serine carboxypeptidase-like 18 i...    328   2e-102   Populus euphratica
gb|KDP41601.1|  hypothetical protein JCGZ_16008                         328   2e-102   Jatropha curcas
ref|XP_006369725.1|  hypothetical protein POPTR_0001s29900g             327   3e-102   
dbj|BAH89272.1|  putative serine carboxypeptidase-like acyltransf...    329   3e-102   Diospyros kaki [Japanese persimmon]
gb|KJB73510.1|  hypothetical protein B456_011G236800                    328   3e-102   Gossypium raimondii
ref|XP_006433654.1|  hypothetical protein CICLE_v10001055mg             328   4e-102   Citrus clementina [clementine]
ref|XP_009393004.1|  PREDICTED: serine carboxypeptidase-like 2          328   4e-102   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_012068195.1|  PREDICTED: serine carboxypeptidase-like 17 i...    328   4e-102   Jatropha curcas
ref|XP_009626153.1|  PREDICTED: serine carboxypeptidase-like 13         327   5e-102   Nicotiana tomentosiformis
ref|XP_010694009.1|  PREDICTED: serine carboxypeptidase-like 7          327   6e-102   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010682455.1|  PREDICTED: serine carboxypeptidase-like 18 i...    323   6e-102   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO81471.1|  hypothetical protein CISIN_1g012205mg                   327   7e-102   Citrus sinensis [apfelsine]
gb|ERN17425.1|  hypothetical protein AMTR_s00037p00227730               328   7e-102   Amborella trichopoda
ref|XP_002446557.1|  hypothetical protein SORBIDRAFT_06g018070          327   8e-102   Sorghum bicolor [broomcorn]
ref|XP_006653168.1|  PREDICTED: serine carboxypeptidase-like 18-like    326   1e-101   
ref|XP_006343160.1|  PREDICTED: serine carboxypeptidase-like 18-l...    327   1e-101   Solanum tuberosum [potatoes]
ref|XP_006422775.1|  hypothetical protein CICLE_v10028360mg             322   1e-101   
gb|KDO81474.1|  hypothetical protein CISIN_1g012236mg                   326   1e-101   Citrus sinensis [apfelsine]
ref|XP_009764359.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    326   2e-101   Nicotiana sylvestris
ref|XP_010106919.1|  Serine carboxypeptidase-like 18                    325   4e-101   
ref|XP_006472322.1|  PREDICTED: serine carboxypeptidase-like 18-like    325   4e-101   Citrus sinensis [apfelsine]
gb|KCW63573.1|  hypothetical protein EUGRSUZ_G01198                     324   4e-101   Eucalyptus grandis [rose gum]
ref|XP_010030620.1|  PREDICTED: serine carboxypeptidase-like 1          328   5e-101   
ref|XP_010936147.1|  PREDICTED: serine carboxypeptidase-like 18 i...    322   5e-101   
ref|XP_006433653.1|  hypothetical protein CICLE_v10001059mg             324   8e-101   Citrus clementina [clementine]
gb|KCW63574.1|  hypothetical protein EUGRSUZ_G01198                     323   1e-100   Eucalyptus grandis [rose gum]
ref|XP_010936152.1|  PREDICTED: serine carboxypeptidase-like 18 i...    323   1e-100   
sp|Q9C7Z9.2|SCP18_ARATH  RecName: Full=Serine carboxypeptidase-li...    323   1e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002510076.1|  serine carboxypeptidase, putative                  323   2e-100   
gb|ACN30985.1|  unknown                                                 322   5e-100   Zea mays [maize]
ref|XP_010320198.1|  PREDICTED: serine carboxypeptidase-like 17         322   6e-100   
ref|XP_008661499.1|  PREDICTED: uncharacterized protein LOC100216...    321   7e-100   
ref|XP_011006024.1|  PREDICTED: serine carboxypeptidase-like 3 is...    322   7e-100   Populus euphratica
ref|XP_007199818.1|  hypothetical protein PRUPE_ppa005264mg             321   8e-100   
ref|XP_006472316.1|  PREDICTED: serine carboxypeptidase-like 18-l...    322   8e-100   Citrus sinensis [apfelsine]
ref|XP_004299781.1|  PREDICTED: serine carboxypeptidase-like 13         321   1e-99    Fragaria vesca subsp. vesca
ref|XP_008661498.1|  PREDICTED: uncharacterized protein LOC100216...    321   1e-99    
ref|XP_002265154.3|  PREDICTED: serine carboxypeptidase-like 13         321   1e-99    Vitis vinifera
ref|XP_010065814.1|  PREDICTED: serine carboxypeptidase-like 18         322   2e-99    Eucalyptus grandis [rose gum]
ref|XP_010694003.1|  PREDICTED: serine carboxypeptidase-like 7 is...    320   3e-99    
ref|XP_004299782.1|  PREDICTED: serine carboxypeptidase-like 13         320   3e-99    Fragaria vesca subsp. vesca
gb|EMT21721.1|  Serine carboxypeptidase-like 17                         320   5e-99    
ref|XP_006356866.1|  PREDICTED: uncharacterized protein LOC102592829    333   5e-99    
gb|KCW63570.1|  hypothetical protein EUGRSUZ_G01197                     318   6e-99    Eucalyptus grandis [rose gum]
ref|XP_004513964.1|  PREDICTED: serine carboxypeptidase-like 18-l...    320   9e-99    Cicer arietinum [garbanzo]
ref|XP_010939013.1|  PREDICTED: serine carboxypeptidase-like 18 i...    318   1e-98    Elaeis guineensis
gb|KCW63605.1|  hypothetical protein EUGRSUZ_G01232                     317   1e-98    Eucalyptus grandis [rose gum]
ref|XP_010691546.1|  PREDICTED: serine carboxypeptidase-like 18         318   2e-98    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009771128.1|  PREDICTED: serine carboxypeptidase-like 13 i...    318   2e-98    Nicotiana sylvestris
ref|XP_008790305.1|  PREDICTED: serine carboxypeptidase-like 18         329   2e-98    
ref|XP_004252000.2|  PREDICTED: serine carboxypeptidase-like 7          319   2e-98    Solanum lycopersicum
ref|XP_009395245.1|  PREDICTED: serine carboxypeptidase-like 12         317   3e-98    Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAF99698.1|  1-O-acylglucose:anthocyanin-O-acyltransferase- l...    318   3e-98    Gentiana triflora
ref|XP_010936148.1|  PREDICTED: serine carboxypeptidase-like 18 i...    313   4e-98    
gb|KCW63576.1|  hypothetical protein EUGRSUZ_G01200                     316   4e-98    Eucalyptus grandis [rose gum]
ref|XP_010065863.1|  PREDICTED: serine carboxypeptidase-like 18         317   6e-98    Eucalyptus grandis [rose gum]
ref|XP_006415267.1|  hypothetical protein EUTSA_v10007571mg             317   6e-98    Eutrema salsugineum [saltwater cress]
ref|NP_001052165.1|  Os04g0176400                                       317   8e-98    
ref|XP_010065898.1|  PREDICTED: serine carboxypeptidase-like 18         317   9e-98    
ref|XP_003593232.1|  Serine carboxypeptidase-like protein               315   1e-97    
ref|XP_010555479.1|  PREDICTED: serine carboxypeptidase-like 7          315   1e-97    Tarenaya hassleriana [spider flower]
ref|XP_010065864.1|  PREDICTED: serine carboxypeptidase-like 2 is...    316   2e-97    Eucalyptus grandis [rose gum]
ref|XP_011030311.1|  PREDICTED: serine carboxypeptidase-like 18 i...    315   2e-97    Populus euphratica
ref|XP_008337031.1|  PREDICTED: serine carboxypeptidase-like 18         314   3e-97    
gb|KCW63567.1|  hypothetical protein EUGRSUZ_G01195                     314   3e-97    Eucalyptus grandis [rose gum]
gb|EAY93240.1|  hypothetical protein OsI_15047                          315   4e-97    Oryza sativa Indica Group [Indian rice]
ref|XP_004975754.1|  PREDICTED: serine carboxypeptidase-like 7-like     315   4e-97    Setaria italica
ref|XP_010939016.1|  PREDICTED: serine carboxypeptidase-like 18 i...    315   6e-97    Elaeis guineensis
ref|XP_010556472.1|  PREDICTED: serine carboxypeptidase-like 18 i...    314   6e-97    Tarenaya hassleriana [spider flower]
ref|XP_007146212.1|  hypothetical protein PHAVU_006G021700g             313   7e-97    Phaseolus vulgaris [French bean]
ref|XP_010065819.1|  PREDICTED: serine carboxypeptidase-like 18         314   1e-96    Eucalyptus grandis [rose gum]
ref|XP_010235061.1|  PREDICTED: serine carboxypeptidase-like 10         313   2e-96    Brachypodium distachyon [annual false brome]
emb|CBI24085.3|  unnamed protein product                                312   2e-96    
ref|XP_003573745.1|  PREDICTED: serine carboxypeptidase-like 17 i...    313   3e-96    
gb|KEH33547.1|  serine carboxypeptidase-like protein                    311   4e-96    
emb|CDP20368.1|  unnamed protein product                                311   5e-96    
ref|XP_003593861.1|  Serine carboxypeptidase family protein             311   7e-96    
dbj|BAF99699.1|  1-O-acylglucose:anthocyanin-O-acyltransferase- l...    311   8e-96    
ref|XP_003593858.1|  Serine carboxypeptidase-like protein               311   9e-96    
gb|KFK44962.1|  hypothetical protein AALP_AA1G326200                    310   1e-95    
ref|XP_004289770.1|  PREDICTED: serine carboxypeptidase-like 18         310   2e-95    
ref|XP_010692123.1|  PREDICTED: serine carboxypeptidase-like 13         310   2e-95    
ref|XP_006415268.1|  hypothetical protein EUTSA_v10007570mg             310   2e-95    
ref|XP_009768014.1|  PREDICTED: serine carboxypeptidase-like 17         310   3e-95    
ref|XP_010277008.1|  PREDICTED: serine carboxypeptidase-like 18 i...    309   3e-95    
ref|XP_010314600.1|  PREDICTED: serine carboxypeptidase-like 11         309   5e-95    
ref|XP_009784017.1|  PREDICTED: serine carboxypeptidase-like 7 is...    308   6e-95    
ref|XP_004238067.1|  PREDICTED: uncharacterized protein LOC101252078    320   6e-95    
dbj|BAF99697.1|  1-O-acylglucose:anthocyanin-O-acyltransferase- l...    310   8e-95    
ref|XP_010065817.1|  PREDICTED: serine carboxypeptidase-like 18         309   9e-95    
ref|XP_009388678.1|  PREDICTED: serine carboxypeptidase-like 18         309   9e-95    
ref|XP_010686322.1|  PREDICTED: serine carboxypeptidase-like 7 is...    308   1e-94    
ref|XP_010320337.1|  PREDICTED: serine carboxypeptidase-like 13 i...    308   1e-94    
ref|XP_006415266.1|  hypothetical protein EUTSA_v10007559mg             308   1e-94    
gb|KCW80986.1|  hypothetical protein EUGRSUZ_C02352                     309   1e-94    
ref|XP_009784016.1|  PREDICTED: serine carboxypeptidase-like 11 i...    308   1e-94    
ref|XP_006356867.1|  PREDICTED: serine carboxypeptidase-like 19-like    318   2e-94    
gb|KEH36682.1|  1-O-acylglucose:anthocyanin acyltransferase             304   2e-94    
gb|KCW55069.1|  hypothetical protein EUGRSUZ_I010391                    303   2e-94    
gb|KCW63578.1|  hypothetical protein EUGRSUZ_G01202                     306   2e-94    
ref|NP_001151152.1|  serine carboxypeptidase 1 precursor                308   2e-94    
ref|XP_010461188.1|  PREDICTED: serine carboxypeptidase-like 18         307   2e-94    
ref|XP_010321497.1|  PREDICTED: serine carboxypeptidase-like 12         307   2e-94    
tpg|DAA39921.1|  TPA: Serine carboxypeptidase 1                         309   3e-94    
ref|XP_012093217.1|  PREDICTED: serine carboxypeptidase-like 18         303   3e-94    
gb|KDO81472.1|  hypothetical protein CISIN_1g012205mg                   305   5e-94    
ref|XP_012068196.1|  PREDICTED: serine carboxypeptidase-like 2 is...    305   7e-94    
ref|XP_010314652.1|  PREDICTED: serine carboxypeptidase-like 11         312   7e-94    
emb|CDY59210.1|  BnaA09g54030D                                          306   8e-94    
ref|XP_006399445.1|  hypothetical protein EUTSA_v10015495mg             306   8e-94    
ref|XP_009343188.1|  PREDICTED: serine carboxypeptidase-like 18         305   9e-94    
ref|XP_010556473.1|  PREDICTED: serine carboxypeptidase-like 18 i...    305   1e-93    
gb|KHN45135.1|  Serine carboxypeptidase-like 19                         306   1e-93    
gb|KEH29044.1|  1-O-acylglucose:anthocyanin acyltransferase             306   1e-93    
ref|XP_009131550.1|  PREDICTED: serine carboxypeptidase-like 7 is...    305   1e-93    
ref|XP_006581276.1|  PREDICTED: serine carboxypeptidase-like 19-l...    306   1e-93    
gb|AES73172.2|  1-O-acylglucose:anthocyanin acyltransferase             306   2e-93    
ref|XP_003593859.1|  Serine carboxypeptidase-like protein               305   2e-93    
ref|XP_003572138.1|  PREDICTED: serine carboxypeptidase-like 10         305   3e-93    
ref|XP_004289771.1|  PREDICTED: serine carboxypeptidase-like 17         305   3e-93    
ref|XP_011621830.1|  PREDICTED: serine carboxypeptidase-like 17         304   3e-93    
ref|XP_010426467.1|  PREDICTED: serine carboxypeptidase-like 7          303   3e-93    
ref|NP_001242803.1|  uncharacterized protein LOC100794342               305   4e-93    
ref|XP_003604931.1|  Serine carboxypeptidase                            304   5e-93    
ref|XP_004238557.1|  PREDICTED: uncharacterized protein LOC101252581    315   5e-93    
gb|KHN06942.1|  Serine carboxypeptidase-like 19                         304   6e-93    
ref|XP_003573757.1|  PREDICTED: serine carboxypeptidase-like 13         304   6e-93    
ref|XP_010320338.1|  PREDICTED: serine carboxypeptidase-like 17 i...    303   6e-93    
ref|XP_006354895.1|  PREDICTED: serine carboxypeptidase-like 18-like    304   6e-93    
ref|XP_009612197.1|  PREDICTED: serine carboxypeptidase-like 11 i...    304   6e-93    
emb|CAN82419.1|  hypothetical protein VITISV_044004                     301   9e-93    
emb|CAN82418.1|  hypothetical protein VITISV_044003                     303   9e-93    
emb|CDY22581.1|  BnaC05g24190D                                          302   2e-92    
ref|XP_010515304.1|  PREDICTED: serine carboxypeptidase-like 7          301   2e-92    
ref|XP_004983497.1|  PREDICTED: serine carboxypeptidase-like 18-like    303   2e-92    
ref|XP_009140440.1|  PREDICTED: serine carboxypeptidase-like 13 i...    301   2e-92    
ref|XP_010321496.1|  PREDICTED: serine carboxypeptidase-like 13 i...    302   2e-92    
ref|XP_009114926.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    302   3e-92    
ref|XP_009126130.1|  PREDICTED: serine carboxypeptidase-like 12 i...    301   6e-92    
ref|XP_009131551.1|  PREDICTED: serine carboxypeptidase-like 7 is...    300   8e-92    
ref|NP_187828.1|  serine carboxypeptidase-like 17                       300   8e-92    
ref|XP_006404766.1|  hypothetical protein EUTSA_v10000651mg             300   9e-92    
ref|XP_009612206.1|  PREDICTED: serine carboxypeptidase-like 18 i...    298   1e-91    
ref|XP_007159376.1|  hypothetical protein PHAVU_002G233100g             301   1e-91    
gb|KHG16860.1|  Serine carboxypeptidase-like 19                         296   1e-91    
ref|XP_007136774.1|  hypothetical protein PHAVU_009G072900g             300   1e-91    
emb|CDY38096.1|  BnaC02g06770D                                          301   1e-91    
ref|XP_010030506.1|  PREDICTED: serine carboxypeptidase-like 7          301   1e-91    
ref|NP_001064014.1|  Os10g0101100                                       300   1e-91    
ref|XP_003604928.1|  Serine carboxypeptidase                            300   2e-91    
gb|AFK49380.1|  unknown                                                 300   2e-91    
ref|XP_010556480.1|  PREDICTED: serine carboxypeptidase-like 1          299   2e-91    
emb|CDP21038.1|  unnamed protein product                                300   2e-91    
gb|AES63483.2|  serine carboxypeptidase-like protein                    299   2e-91    
ref|NP_001067860.1|  Os11g0460800                                       300   2e-91    
ref|XP_010503611.1|  PREDICTED: serine carboxypeptidase-like 7          299   2e-91    
ref|XP_010068327.1|  PREDICTED: serine carboxypeptidase-like 18         300   4e-91    
emb|CDX85493.1|  BnaA02g03200D                                          298   4e-91    
ref|XP_002460078.1|  hypothetical protein SORBIDRAFT_02g022430          299   4e-91    
ref|XP_006342727.1|  PREDICTED: uncharacterized protein LOC102585123    310   5e-91    
ref|XP_008669340.1|  PREDICTED: serine carboxypeptidase-like 7          299   7e-91    
gb|KCW63486.1|  hypothetical protein EUGRSUZ_G01118                     296   8e-91    
dbj|BAF99694.1|  1-O-acylglucose:anthocyanin-O-acyltransferase          299   8e-91    
ref|XP_003520964.1|  PREDICTED: serine carboxypeptidase-like 11-like    298   8e-91    
ref|XP_010320340.1|  PREDICTED: serine carboxypeptidase-like 13 i...    298   9e-91    
ref|XP_009122528.1|  PREDICTED: serine carboxypeptidase-like 19         298   9e-91    
ref|XP_012093174.1|  PREDICTED: serine carboxypeptidase-like 2          298   1e-90    
gb|KCW63602.1|  hypothetical protein EUGRSUZ_G01229                     296   1e-90    
gb|EMS55666.1|  Serine carboxypeptidase-like 19                         300   1e-90    
ref|XP_006297701.1|  hypothetical protein CARUB_v10013730mg             297   1e-90    
gb|KCW68631.1|  hypothetical protein EUGRSUZ_F02236                     298   1e-90    
ref|NP_174619.1|  serine carboxypeptidase-like 18                       297   1e-90    
ref|XP_006376417.1|  serine carboxypeptidase S10 family protein         296   1e-90    
ref|XP_006297708.1|  hypothetical protein CARUB_v10013737mg             296   2e-90    
ref|XP_003566614.1|  PREDICTED: serine carboxypeptidase-like 13 i...    298   2e-90    
ref|NP_179881.3|  serine carboxypeptidase-like 13                       296   2e-90    
ref|XP_002878651.1|  hypothetical protein ARALYDRAFT_900758             296   3e-90    
emb|CAM91988.1|  sinapoylglucose:choline sinapoyltransferase            296   3e-90    
gb|KCW54736.1|  hypothetical protein EUGRSUZ_I00690                     297   4e-90    
ref|XP_007047575.1|  Serine carboxypeptidase-like 18, putative is...    293   4e-90    
ref|XP_010321495.1|  PREDICTED: serine carboxypeptidase-like 13 i...    296   5e-90    
gb|KFK25883.1|  hypothetical protein AALP_AA8G174700                    296   5e-90    
ref|XP_006356850.1|  PREDICTED: serine carboxypeptidase-like 18-like    296   5e-90    
ref|XP_006399443.1|  hypothetical protein EUTSA_v10015958mg             296   7e-90    
ref|XP_010499905.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    295   9e-90    
ref|XP_010320344.1|  PREDICTED: serine carboxypeptidase-like 10 i...    293   9e-90    
emb|CDP01267.1|  unnamed protein product                                296   9e-90    
gb|AAQ91191.1|  1-O-sinapoylglucose:choline sinapoyltransferase         295   1e-89    
dbj|BAJ99095.1|  predicted protein                                      295   1e-89    
ref|XP_010320343.1|  PREDICTED: serine carboxypeptidase-like 10 i...    293   1e-89    
ref|XP_010320342.1|  PREDICTED: serine carboxypeptidase-like 10 i...    295   1e-89    
ref|XP_009125363.1|  PREDICTED: serine carboxypeptidase-like 19         295   1e-89    
ref|XP_009771129.1|  PREDICTED: serine carboxypeptidase-like 13 i...    294   1e-89    
ref|XP_007134008.1|  hypothetical protein PHAVU_010G011400g             295   1e-89    
gb|AES87127.2|  1-O-acylglucose:anthocyanin acyltransferase             295   2e-89    
ref|XP_009761854.1|  PREDICTED: serine carboxypeptidase-like 18         293   2e-89    
emb|CAM91989.1|  sinapoylglucose:choline sinapoyltransferase            295   2e-89    
ref|XP_008452664.1|  PREDICTED: serine carboxypeptidase-like 2          295   2e-89    
ref|XP_006407566.1|  hypothetical protein EUTSA_v10020743mg             293   2e-89    
dbj|BAB03129.1|  serine carboxypeptidase                                292   3e-89    
gb|ABR16352.1|  unknown                                                 295   3e-89    
ref|XP_008452662.1|  PREDICTED: serine carboxypeptidase-like 13         294   4e-89    
ref|XP_009126131.1|  PREDICTED: serine carboxypeptidase-like 3 is...    290   4e-89    
ref|XP_009126133.1|  PREDICTED: serine carboxypeptidase-like 3 is...    290   4e-89    
ref|XP_010484310.1|  PREDICTED: serine carboxypeptidase-like 7          293   4e-89    
ref|XP_006295774.1|  hypothetical protein CARUB_v10024896mg             293   5e-89    
ref|XP_010939017.1|  PREDICTED: serine carboxypeptidase-like 12 i...    294   5e-89    
ref|XP_009125362.1|  PREDICTED: serine carboxypeptidase-like 19         293   6e-89    
ref|XP_006342726.1|  PREDICTED: serine carboxypeptidase-like 11-like    293   6e-89    
ref|NP_001077946.1|  serine carboxypeptidase-like 13                    292   6e-89    
gb|AES87130.2|  1-O-acylglucose:anthocyanin acyltransferase             293   7e-89    
ref|XP_009365383.1|  PREDICTED: serine carboxypeptidase-like 13         293   9e-89    
ref|XP_011466202.1|  PREDICTED: serine carboxypeptidase-like 2 is...    295   1e-88    
ref|XP_010429230.1|  PREDICTED: serine carboxypeptidase-like 11 i...    291   1e-88    
ref|XP_010472296.1|  PREDICTED: serine carboxypeptidase-like 11 i...    291   2e-88    
ref|XP_010556479.1|  PREDICTED: serine carboxypeptidase-like 19         291   2e-88    
ref|XP_010486655.1|  PREDICTED: serine carboxypeptidase-like 7 is...    291   3e-88    
emb|CDX70702.1|  BnaC03g07860D                                          290   3e-88    
ref|XP_010527656.1|  PREDICTED: serine carboxypeptidase-like 2          290   4e-88    
ref|XP_003604929.1|  Serine carboxypeptidase                            303   4e-88    
ref|XP_002878650.1|  hypothetical protein ARALYDRAFT_481168             290   5e-88    
ref|XP_004141409.2|  PREDICTED: serine carboxypeptidase-like 1 is...    290   5e-88    
gb|KCW63483.1|  hypothetical protein EUGRSUZ_G01115                     288   6e-88    
ref|XP_006369720.1|  hypothetical protein POPTR_0001s29840g             289   6e-88    
gb|ACG36102.1|  serine carboxypeptidase 1 precursor                     290   7e-88    
ref|XP_004960851.1|  PREDICTED: serine carboxypeptidase-like 19-like    290   7e-88    
ref|XP_007138067.1|  hypothetical protein PHAVU_009G177800g             291   1e-87    
ref|XP_010065818.1|  PREDICTED: serine carboxypeptidase-like 18         290   1e-87    
ref|XP_010065816.1|  PREDICTED: serine carboxypeptidase-like 18 i...    290   1e-87    
ref|XP_004151544.2|  PREDICTED: serine carboxypeptidase-like 1 is...    290   1e-87    
ref|XP_010065815.1|  PREDICTED: serine carboxypeptidase-like 18 i...    288   1e-87    
emb|CDY49438.1|  BnaA09g42290D                                          289   1e-87    
ref|XP_008452668.1|  PREDICTED: serine carboxypeptidase-like 7          289   1e-87    
gb|KDP44547.1|  hypothetical protein JCGZ_16380                         290   1e-87    
ref|XP_008644916.1|  PREDICTED: serine carboxypeptidase-like 18 i...    290   2e-87    
gb|EEE50445.1|  hypothetical protein OsJ_30452                          289   2e-87    
gb|ABG22467.1|  Serine carboxypeptidase family protein, expressed       290   2e-87    
ref|XP_010939015.1|  PREDICTED: serine carboxypeptidase-like 18 i...    288   2e-87    
dbj|BAF99695.1|  1-O-acylglucose:anthocyanin-O-acyltransferase          290   2e-87    
ref|XP_010464720.1|  PREDICTED: serine carboxypeptidase-like 7          288   2e-87    
gb|AAK52316.1|  sinapoylglucose:choline sinapoyltransferase             289   2e-87    
ref|NP_001064015.1|  Os10g0101200                                       289   2e-87    
gb|EMT03311.1|  Serine carboxypeptidase-like 19                         288   2e-87    
ref|XP_009133994.1|  PREDICTED: serine carboxypeptidase-like 10 i...    288   2e-87    
ref|XP_011006023.1|  PREDICTED: serine carboxypeptidase-like 3 is...    290   2e-87    
gb|KCW55071.1|  hypothetical protein EUGRSUZ_I010391                    283   2e-87    
ref|XP_010422959.1|  PREDICTED: serine carboxypeptidase-like 19         289   2e-87    
emb|CDY11114.1|  BnaC06g23660D                                          288   3e-87    
ref|XP_008452666.1|  PREDICTED: serine carboxypeptidase-like 7 is...    288   3e-87    
gb|ERN01883.1|  hypothetical protein AMTR_s00089p00130140               285   3e-87    
ref|XP_006663395.1|  PREDICTED: serine carboxypeptidase-like 18-like    289   3e-87    
ref|XP_006594522.1|  PREDICTED: serine carboxypeptidase-like 12-like    289   3e-87    
ref|XP_010556471.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    288   3e-87    
ref|NP_568215.2|  serine carboxypeptidase-like 19                       288   4e-87    
ref|NP_179883.1|  sinapoylglucose:anthocyanin sinapoyltransferase       288   4e-87    
ref|XP_003604933.1|  Serine carboxypeptidase                            288   4e-87    
ref|XP_004486284.1|  PREDICTED: serine carboxypeptidase-like 12-like    288   4e-87    
ref|NP_850034.1|  sinapoylglucose:malate sinapoyltransferase            287   4e-87    
ref|XP_010509542.1|  PREDICTED: serine carboxypeptidase-like 9 is...    288   5e-87    
gb|EEC68084.1|  hypothetical protein OsI_35952                          288   5e-87    
ref|XP_010491604.1|  PREDICTED: serine carboxypeptidase-like 19         288   6e-87    
ref|XP_006296372.1|  hypothetical protein CARUB_v10025545mg             287   6e-87    
ref|XP_003573759.1|  PREDICTED: serine carboxypeptidase-like 18         288   6e-87    
emb|CDX76889.1|  BnaC08g34750D                                          287   7e-87    
ref|XP_003560245.1|  PREDICTED: serine carboxypeptidase-like 18         288   7e-87    
ref|XP_006294243.1|  hypothetical protein CARUB_v10023242mg             287   8e-87    
ref|XP_010429234.1|  PREDICTED: serine carboxypeptidase-like 12 i...    286   9e-87    
dbj|BAJ85413.1|  predicted protein                                      288   1e-86    
ref|XP_007047576.1|  Serine carboxypeptidase-like 18, putative is...    283   1e-86    
ref|NP_177471.1|  serine carboxypeptidase-like 3                        286   1e-86    
ref|XP_010472300.1|  PREDICTED: serine carboxypeptidase-like 9 is...    288   1e-86    
ref|NP_001030669.1|  serine carboxypeptidase-like 7                     285   1e-86    
gb|KJB73514.1|  hypothetical protein B456_011G236800                    286   1e-86    
ref|XP_012067090.1|  PREDICTED: serine carboxypeptidase-like 17         287   1e-86    
ref|XP_008452663.1|  PREDICTED: serine carboxypeptidase-like 13         287   1e-86    
ref|XP_010509543.1|  PREDICTED: serine carboxypeptidase-like 9 is...    286   1e-86    
ref|NP_177473.1|  serine carboxypeptidase-like 2                        286   2e-86    
ref|XP_009139971.1|  PREDICTED: serine carboxypeptidase-like 13 i...    286   2e-86    
emb|CDP08178.1|  unnamed protein product                                288   2e-86    
ref|XP_009117321.1|  PREDICTED: serine carboxypeptidase-like 10 i...    286   2e-86    
ref|XP_010428244.1|  PREDICTED: serine carboxypeptidase-like 2 is...    286   2e-86    
ref|XP_010464719.1|  PREDICTED: serine carboxypeptidase-like 7 is...    284   2e-86    
ref|XP_006415270.1|  hypothetical protein EUTSA_v10009366mg             285   3e-86    
ref|NP_198467.2|  serine carboxypeptidase-like 1                        285   3e-86    
ref|XP_002522132.1|  serine carboxypeptidase, putative                  287   3e-86    
ref|XP_006390568.1|  hypothetical protein EUTSA_v10018572mg             285   3e-86    
ref|NP_187656.1|  serine carboxypeptidase-like 7                        285   3e-86    
gb|AAC17816.2|  putative serine carboxypeptidase I                      285   3e-86    
ref|XP_009103431.1|  PREDICTED: serine carboxypeptidase-like 10         285   3e-86    
gb|EMS46782.1|  Serine carboxypeptidase-like 18                         283   4e-86    
ref|XP_003579296.2|  PREDICTED: serine carboxypeptidase-like 2          287   4e-86    
ref|XP_007047577.1|  Serine carboxypeptidase-like 18, putative is...    282   4e-86    
ref|XP_006403281.1|  hypothetical protein EUTSA_v10003211mg             285   4e-86    



>ref|XP_009614133.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Nicotiana 
tomentosiformis]
Length=451

 Score =   485 bits (1249),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 245/444 (55%), Positives = 311/444 (70%), Gaps = 24/444 (5%)
 Frame = -3

Query  1518  LKLCLVSQQNFHSNSIL--VT*VWENLKIQLFYYFIESEKSPEtd------------pll  1381
             LKL   S +NF SNS L     V E  K+QL+YYF+ESE+ PE D              L
Sbjct  9     LKLYQASMENFLSNSKLGNYVGVGEEEKVQLYYYFVESERDPENDPLMLWLTGGPGCSGL  68

Query  1380  lwltggpgplTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTN  1201
                    GPLT +YANS GD P LEL   +WTKVANIIF+DQP G+GYSY++TS+AYN N
Sbjct  69    SSFVYEIGPLTFDYANSIGDFPKLELKSNSWTKVANIIFIDQPAGSGYSYAKTSEAYNFN  128

Query  1200  DTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNM  1021
             DTL+   TY FL +WL+DHP FL NPLYV+GDSYSGI V L+ R IYDG+E G +PR+N+
Sbjct  129   DTLAVALTYEFLRKWLMDHPEFLKNPLYVSGDSYSGIFVALLTRRIYDGIEVGEKPRVNI  188

Query  1020  KGCIEGNPLTHRFSDTNNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQ  841
             KG I+GN LT  + D N RV+Y +RMG +SD +Y+STK +CNGNY +  P+N +C  DLQ
Sbjct  189   KGYIQGNALTDHYIDFNGRVIYAHRMGLISDKIYQSTKANCNGNYAEVDPNNVSCLNDLQ  248

Query  840   RVTKCTEKINMPQILEPACNPEILLSLDGEN---------LPQQWCRDDNYLFAYSWANN  688
             RV +C + I    ILEP C+   L+S+  E          +   WCR+ NY+++Y WAN+
Sbjct  249   RVDRCLKNIRRAHILEPWCDLPFLMSILKETPANARSLFPIEGPWCREKNYIYSYVWAND  308

Query  687   KIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIY  508
             K V+KAL VREGT  EW+RCN ++    + ER+E+YV++VK+ +D HR   +KSCR LIY
Sbjct  309   KAVKKALNVREGTTLEWVRCNDSMHYRGK-ERTESYVYDVKSVIDDHRHLISKSCRALIY  367

Query  507   SGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAG  328
             SGDHDM+VPH STE+WI+SLK+ + DDW PWFV+ QVAGY +KYSQ +YE+TYATVKG G
Sbjct  368   SGDHDMVVPHSSTEEWIDSLKLPITDDWEPWFVDGQVAGYKVKYSQNDYEMTYATVKGGG  427

Query  327   HTAPEYKPRECLPMIQRWLSIYPL  256
             HTAPEYKP +CL M+ RW S YPL
Sbjct  428   HTAPEYKPEQCLAMVDRWFSGYPL  451



>gb|AAF64227.1|AF248647_1 glucose acyltransferase [Solanum pennellii]
Length=464

 Score =   479 bits (1232),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 238/422 (56%), Positives = 299/422 (71%), Gaps = 22/422 (5%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E  K+QLFY+F++SE+ P  D              L       GPLT +YANS+G+ P
Sbjct  44    VGEEEKVQLFYFFVQSERDPRNDPLMIWLTGGPGCSGLSSFVYEIGPLTFDYANSSGNFP  103

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              LELN Y+WTKVANIIF+DQP GTGYSY+ TS+AYN NDTLS   TY FL +WL+DHP +
Sbjct  104   KLELNSYSWTKVANIIFIDQPAGTGYSYANTSEAYNCNDTLSVTLTYDFLRKWLMDHPEY  163

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             LNNPLYV GDSYSGI V L+ R IYDG+E G  PR+N+KG I+GN LT R  D N RV Y
Sbjct  164   LNNPLYVGGDSYSGIFVALLTRKIYDGIEVGDRPRVNIKGYIQGNALTDRSIDFNGRVKY  223

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
                MG +SD +Y+S K +CNGNYID  P+N  C  DLQ+VT+C + I   QILEP C+  
Sbjct  224   ANHMGLISDKIYQSAKANCNGNYIDVDPNNILCLNDLQKVTRCLKNIRRAQILEPYCDLP  283

Query  774   ILLSLDGEN---------LPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNH  622
              L+ +  E          +   WCR+ NY+++Y WAN+K VQKAL VREGT  EW+RCN 
Sbjct  284   YLMGILQETPTNGQSVFPIAGPWCREKNYIYSYVWANDKAVQKALNVREGTTLEWVRCNE  343

Query  621   TLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKV  442
             ++    + ER+E+YV++V + +D H+  T+KSCR LIYSGDHDM+VPH+STE+WIE+LK+
Sbjct  344   SMHYRGK-ERTESYVYDVPSVIDDHQHLTSKSCRALIYSGDHDMVVPHLSTEEWIETLKL  402

Query  441   GVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIY  262
              + DDW PWFV+DQVAGY +KY Q +YE+TYATVKGAGHTAPEYKP +CLPM+ RW S  
Sbjct  403   PIADDWEPWFVDDQVAGYKVKYLQNDYEMTYATVKGAGHTAPEYKPEQCLPMVDRWFSGD  462

Query  261   PL  256
             PL
Sbjct  463   PL  464



>ref|XP_006353976.1| PREDICTED: serine carboxypeptidase-like 18-like [Solanum tuberosum]
Length=464

 Score =   477 bits (1227),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 237/422 (56%), Positives = 300/422 (71%), Gaps = 22/422 (5%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSP------------EtdplllwltggpgplTINYANSTGDIP  1315
             V E  K+QLFY+F+ SE+ P                 L       GPLT +YANS G+ P
Sbjct  44    VGEEEKVQLFYFFVPSERDPLNDPLMIWLTGGPGCSGLSSFVYEIGPLTFDYANSNGNFP  103

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              LELN Y+WTKVANIIF+DQP GTGYSY+ TS+AYN NDTLS   TY FL +WL+DHP +
Sbjct  104   KLELNSYSWTKVANIIFIDQPAGTGYSYANTSEAYNCNDTLSVTLTYDFLRKWLMDHPEY  163

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             LNNPLYV GDSYSGI V  + R IYDG+E G +PRLN+KG I+GN LT R+ D+N R+ Y
Sbjct  164   LNNPLYVGGDSYSGIFVAPLTRKIYDGIEVGDKPRLNIKGYIQGNALTDRYIDSNGRIKY  223

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
               RMG +SD +Y+S K +CNG+Y D  PHN  C  DLQ+VTKC + I   QILEP C+  
Sbjct  224   ANRMGLISDKIYQSAKTNCNGSYFDVDPHNILCLNDLQKVTKCLKNIRRAQILEPYCDLP  283

Query  774   ILLS------LDGEN---LPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNH  622
              L+        +G++   +   WCR+ NY+++Y WAN+K+VQKAL VREGT  EW+RCN 
Sbjct  284   YLMGNLQETPTNGQSVFPIAGPWCREKNYIYSYVWANDKVVQKALNVREGTTLEWVRCNE  343

Query  621   TLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKV  442
             ++    + ER+E+YV++V + +D HR  T+KSCR LIYSGDHDM+VPH+STE+WI++LK+
Sbjct  344   SMHYRGK-ERTESYVYDVPSAIDDHRHLTSKSCRALIYSGDHDMVVPHLSTEEWIDTLKL  402

Query  441   GVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIY  262
              + DDW PWFV+ QVAGY +KY Q +YELTYATVKGAGHTAPEYKP +CLPM+ RW S  
Sbjct  403   PIADDWEPWFVDAQVAGYKVKYLQNDYELTYATVKGAGHTAPEYKPEQCLPMVDRWFSGD  462

Query  261   PL  256
             PL
Sbjct  463   PL  464



>ref|XP_009614132.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Nicotiana 
tomentosiformis]
Length=468

 Score =   477 bits (1227),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 235/422 (56%), Positives = 300/422 (71%), Gaps = 22/422 (5%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E  K+QL+YYF+ESE+ PE D              L       GPLT +YANS GD P
Sbjct  48    VGEEEKVQLYYYFVESERDPENDPLMLWLTGGPGCSGLSSFVYEIGPLTFDYANSIGDFP  107

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              LEL   +WTKVANIIF+DQP G+GYSY++TS+AYN NDTL+   TY FL +WL+DHP F
Sbjct  108   KLELKSNSWTKVANIIFIDQPAGSGYSYAKTSEAYNFNDTLAVALTYEFLRKWLMDHPEF  167

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L NPLYV+GDSYSGI V L+ R IYDG+E G +PR+N+KG I+GN LT  + D N RV+Y
Sbjct  168   LKNPLYVSGDSYSGIFVALLTRRIYDGIEVGEKPRVNIKGYIQGNALTDHYIDFNGRVIY  227

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
              +RMG +SD +Y+STK +CNGNY +  P+N +C  DLQRV +C + I    ILEP C+  
Sbjct  228   AHRMGLISDKIYQSTKANCNGNYAEVDPNNVSCLNDLQRVDRCLKNIRRAHILEPWCDLP  287

Query  774   ILLSLDGEN---------LPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNH  622
              L+S+  E          +   WCR+ NY+++Y WAN+K V+KAL VREGT  EW+RCN 
Sbjct  288   FLMSILKETPANARSLFPIEGPWCREKNYIYSYVWANDKAVKKALNVREGTTLEWVRCND  347

Query  621   TLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKV  442
             ++    + ER+E+YV++VK+ +D HR   +KSCR LIYSGDHDM+VPH STE+WI+SLK+
Sbjct  348   SMHYRGK-ERTESYVYDVKSVIDDHRHLISKSCRALIYSGDHDMVVPHSSTEEWIDSLKL  406

Query  441   GVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIY  262
              + DDW PWFV+ QVAGY +KYSQ +YE+TYATVKG GHTAPEYKP +CL M+ RW S Y
Sbjct  407   PITDDWEPWFVDGQVAGYKVKYSQNDYEMTYATVKGGGHTAPEYKPEQCLAMVDRWFSGY  466

Query  261   PL  256
             PL
Sbjct  467   PL  468



>gb|AAD01263.1| glucose acyltransferase [Solanum berthaultii]
Length=464

 Score =   476 bits (1225),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 237/422 (56%), Positives = 297/422 (70%), Gaps = 22/422 (5%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSP------------EtdplllwltggpgplTINYANSTGDIP  1315
             V E  K+QLFY+F+ SE+ P                 L       GPLT +YANS G+ P
Sbjct  44    VGEEEKVQLFYFFVPSERDPLNDPLMIWLTGGPGCSGLSSFVYEIGPLTFDYANSNGNFP  103

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              LELN  +WTKVANIIF+DQP GTGYSY+ TS+AYN NDTLS   TY FL +WL+DHP +
Sbjct  104   KLELNSNSWTKVANIIFIDQPAGTGYSYANTSEAYNCNDTLSVTLTYDFLRKWLMDHPEY  163

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             LNNPLYV GDSYSGI V L+ R IYDG+E G +PRLN+KG I+GN LT R+ D+N R+ Y
Sbjct  164   LNNPLYVGGDSYSGIFVALLTRKIYDGIEVGDKPRLNIKGYIQGNALTDRYIDSNGRIKY  223

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
               RMG +SD +Y+S K +CNG+Y D  PHN  C  DLQ+VTKC + I   QILEP C+  
Sbjct  224   ANRMGLISDKIYQSAKTNCNGSYFDVDPHNILCLNDLQKVTKCLKNIRRAQILEPYCDLP  283

Query  774   ILLSLDGEN---------LPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNH  622
              L+ +  E          +   WCR+ NY+++Y WAN+K+VQKAL VREGT  EW+RCN 
Sbjct  284   YLMDILQETPTNGQSVFPIAGPWCREKNYIYSYVWANDKVVQKALNVREGTTLEWVRCNE  343

Query  621   TLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKV  442
             ++    + ER+E+YV++V + V  HR  T+KSCR LIYSGDHDM+VPH+STE+WI++LK+
Sbjct  344   SMHYRGK-ERTESYVYDVPSAVGDHRHLTSKSCRALIYSGDHDMVVPHLSTEEWIDTLKL  402

Query  441   GVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIY  262
              + DDW PWFV+ QVAGY +KY Q +YELTYATVKGAGHTAPEYKP +CLPM+ RW S  
Sbjct  403   PIADDWEPWFVDAQVAGYKVKYLQNDYELTYATVKGAGHTAPEYKPEQCLPMVDRWFSGD  462

Query  261   PL  256
             PL
Sbjct  463   PL  464



>ref|XP_009795830.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Nicotiana 
sylvestris]
Length=467

 Score =   476 bits (1224),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 234/422 (55%), Positives = 299/422 (71%), Gaps = 22/422 (5%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E  K+QL+YYF+ESE+ PE D              L       GPL  +YANS+GD P
Sbjct  47    VGEEEKVQLYYYFVESERDPENDPLMLWLTGGPGCSGLSSFVYEIGPLMFDYANSSGDFP  106

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              LELN  +WTKVANIIF+DQP G+GYSY++TS+AYN NDTL+   TY FL +WL+DHP +
Sbjct  107   KLELNSNSWTKVANIIFIDQPAGSGYSYAKTSEAYNCNDTLAVTLTYEFLRKWLMDHPKY  166

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L NP YV GDSYSGI V L+ R IYDG+E G +PR+N+KG I+GN LT  + D N RV+Y
Sbjct  167   LKNPQYVGGDSYSGIFVALLTRRIYDGIEVGEKPRVNIKGYIQGNALTDHYIDANGRVIY  226

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
              +RMG +SD LY+STK +CNGNY++  P+N +C  DLQRV KC + I    ILEP C+  
Sbjct  227   AHRMGLISDKLYQSTKANCNGNYVNVDPNNESCLNDLQRVDKCLKNIRRAHILEPWCDLP  286

Query  774   ILLSLDGEN---------LPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNH  622
              L+S+             +   WCR+ NY+++Y WAN+K V+KAL VREGT  EW+RCN 
Sbjct  287   FLMSILQVTPTNVRSLFPIEGPWCREKNYIYSYIWANDKAVRKALNVREGTALEWVRCND  346

Query  621   TLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKV  442
             ++    + ER+E+YV++V++ +D HR   +KSCR LIYSGDHDM+VPH STE+WI+SLK+
Sbjct  347   SMHYRGK-ERTESYVYDVQSVIDDHRHLISKSCRALIYSGDHDMVVPHSSTEEWIDSLKL  405

Query  441   GVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIY  262
              + DDW PWFV+ QVAGY +KYSQ +YELTYATVKG GHTAPEYKP +CL M+ RW S Y
Sbjct  406   PIADDWEPWFVDGQVAGYKVKYSQNDYELTYATVKGGGHTAPEYKPEQCLAMVDRWFSGY  465

Query  261   PL  256
             PL
Sbjct  466   PL  467



>ref|XP_004248779.1| PREDICTED: serine carboxypeptidase-like 18 [Solanum lycopersicum]
Length=464

 Score =   473 bits (1217),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 235/422 (56%), Positives = 297/422 (70%), Gaps = 22/422 (5%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E  K+QLFY+F++SE+ P  D              L       GPLT +YANS+G+ P
Sbjct  44    VGEEEKVQLFYFFVQSERDPRNDPLMIWLTGGPGCSGLSSFVYEIGPLTFDYANSSGNFP  103

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              LELN Y+WTKVANIIF+DQP GTGYSY+ TS+AYN NDTLS   TY FL +WL+DHP +
Sbjct  104   KLELNSYSWTKVANIIFIDQPAGTGYSYANTSEAYNCNDTLSVTLTYDFLRKWLMDHPEY  163

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             LNNPLYV GDSYSGI V L+ R IYDG+E G  PR+N+KG I+GN LT R  D N RV Y
Sbjct  164   LNNPLYVGGDSYSGIFVALLTRKIYDGIEVGDRPRVNIKGYIQGNALTDRSIDFNGRVKY  223

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
                MG +SD +Y+S K +CNGNYID  P+N  C  DLQ+ T+C + I   QILEP C+  
Sbjct  224   ANHMGLISDKIYQSAKANCNGNYIDVDPNNILCLNDLQKATRCLKNIRRAQILEPYCDLP  283

Query  774   ILLSLDGEN---------LPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNH  622
              L+ +  E          +   WCR+ NY+++Y WAN+K VQKAL VREGT  EW+RCN 
Sbjct  284   YLMGILQETPTNGQSVFPIAGPWCREKNYIYSYVWANDKAVQKALNVREGTTLEWVRCNE  343

Query  621   TLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKV  442
             ++    + ER+E+YV++V + +D H+  T+KSCR LIYSGDHDM+VPH+ST++WIE+LK+
Sbjct  344   SMHYRGK-ERTESYVYDVPSVIDDHQHLTSKSCRALIYSGDHDMVVPHLSTKEWIETLKL  402

Query  441   GVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIY  262
              + DDW PWFV+ QVAGY +KY Q +YE+TYATVKGAGHTAPEYKP +CLPM+ RW S  
Sbjct  403   PIADDWEPWFVDGQVAGYKVKYLQNDYEMTYATVKGAGHTAPEYKPEQCLPMVDRWFSGD  462

Query  261   PL  256
             PL
Sbjct  463   PL  464



>ref|XP_006350185.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X1 [Solanum 
tuberosum]
Length=461

 Score =   473 bits (1216),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 231/417 (55%), Positives = 304/417 (73%), Gaps = 16/417 (4%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E  K+QLFYYF+ESE+ P+ D              L       GPLT +YANS+G+ P
Sbjct  45    VGEEEKLQLFYYFVESERDPQNDPLIIWLIGGPGCSGLSAFLYEIGPLTFDYANSSGNFP  104

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              LELN ++W+KVANIIF+DQPVG GYSY++TS+AYN+NDTLSA   Y FL +WL+DHP +
Sbjct  105   KLELNLHSWSKVANIIFIDQPVGAGYSYAKTSEAYNSNDTLSATLIYDFLRKWLMDHPEY  164

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L NPLYVAGDSY+GI + LV R IYDG+E G EP++N+KG I+GN LT R++  N+RV Y
Sbjct  165   LKNPLYVAGDSYAGIYIALVTRKIYDGVEVGDEPQMNIKGYIQGNALTDRYTTMNSRVKY  224

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
              Y MG +SD +Y+S K +CNGNY+D  P+N  C  DLQ+V KC   I    ILE  C   
Sbjct  225   AYHMGLISDKIYQSAKANCNGNYVDIDPNNILCLNDLQKVKKCLNSIRRDHILENWCELS  284

Query  774   ILLSLDGE--NLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLS-GPP  604
             +L+S       +P  WCR++NY+++  WAN+K VQKAL +REGT+ EW++CN ++  G  
Sbjct  285   VLMSNVHSLFPIPGPWCRENNYIYSKIWANDKAVQKALNIREGTILEWVKCNQSMRYGLH  344

Query  603   EA-ERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDD  427
             E  +RSE+YV++++ ++D HR  ++KSCR L+YSGDHDM +PH++TE+WI++LK+ + DD
Sbjct  345   EGMKRSESYVYDIQTSIDDHRHLSSKSCRALVYSGDHDMTIPHLNTEEWIDTLKLPILDD  404

Query  426   WRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             W PWFVEDQVAGY +KY Q +YELTYATVKGAGHTAPEYKPR+CL M+ RW S  PL
Sbjct  405   WEPWFVEDQVAGYKVKYLQNDYELTYATVKGAGHTAPEYKPRQCLSMVDRWFSDDPL  461



>ref|XP_009795831.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Nicotiana 
sylvestris]
Length=396

 Score =   463 bits (1191),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 216/373 (58%), Positives = 277/373 (74%), Gaps = 10/373 (3%)
 Frame = -3

Query  1347  INYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSF  1168
              +YANS+GD P LELN  +WTKVANIIF+DQP G+GYSY++TS+AYN NDTL+   TY F
Sbjct  25    FDYANSSGDFPKLELNSNSWTKVANIIFIDQPAGSGYSYAKTSEAYNCNDTLAVTLTYEF  84

Query  1167  LVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTH  988
             L +WL+DHP +L NP YV GDSYSGI V L+ R IYDG+E G +PR+N+KG I+GN LT 
Sbjct  85    LRKWLMDHPKYLKNPQYVGGDSYSGIFVALLTRRIYDGIEVGEKPRVNIKGYIQGNALTD  144

Query  987   RFSDTNNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINM  808
              + D N RV+Y +RMG +SD LY+STK +CNGNY++  P+N +C  DLQRV KC + I  
Sbjct  145   HYIDANGRVIYAHRMGLISDKLYQSTKANCNGNYVNVDPNNESCLNDLQRVDKCLKNIRR  204

Query  807   PQILEPACNPEILLSLDGEN---------LPQQWCRDDNYLFAYSWANNKIVQKALGVRE  655
               ILEP C+   L+S+             +   WCR+ NY+++Y WAN+K V+KAL VRE
Sbjct  205   AHILEPWCDLPFLMSILQVTPTNVRSLFPIEGPWCREKNYIYSYIWANDKAVRKALNVRE  264

Query  654   GTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHV  475
             GT  EW+RCN ++    + ER+E+YV++V++ +D HR   +KSCR LIYSGDHDM+VPH 
Sbjct  265   GTALEWVRCNDSMHYRGK-ERTESYVYDVQSVIDDHRHLISKSCRALIYSGDHDMVVPHS  323

Query  474   STEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPREC  295
             STE+WI+SLK+ + DDW PWFV+ QVAGY +KYSQ +YELTYATVKG GHTAPEYKP +C
Sbjct  324   STEEWIDSLKLPIADDWEPWFVDGQVAGYKVKYSQNDYELTYATVKGGGHTAPEYKPEQC  383

Query  294   LPMIQRWLSIYPL  256
             L M+ RW S YPL
Sbjct  384   LAMVDRWFSGYPL  396



>ref|XP_006353974.1| PREDICTED: serine carboxypeptidase-like 18-like [Solanum tuberosum]
Length=464

 Score =   463 bits (1192),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 235/422 (56%), Positives = 295/422 (70%), Gaps = 22/422 (5%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E  K+QLFY+F++SE+ PE D              L       GPLT +YANS+G+ P
Sbjct  44    VGEEGKVQLFYFFVKSERDPENDPLMIWLTGGPGCSALSTFFYEMGPLTFDYANSSGNFP  103

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              LELN Y+WTKVANIIF+DQP GTGYSYS TS+AYN +DTLS   TY FL +WL+DHP +
Sbjct  104   KLELNSYSWTKVANIIFIDQPAGTGYSYSNTSEAYNCSDTLSVTLTYDFLRKWLMDHPEY  163

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L NPLYV G SYSG  V  + R IYDG+E G +PR+N+KG I+GN  T R+ D N RV Y
Sbjct  164   LKNPLYVTGGSYSGFFVGPLTRKIYDGIELGDKPRVNIKGYIQGNAQTDRYIDFNGRVKY  223

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
               RMG +SD +Y+STK +CNGNYID  P+N  C  DLQ+V +C + I    ILEP C+ E
Sbjct  224   ANRMGLISDKIYQSTKANCNGNYIDVDPNNILCLSDLQKVERCLKNIQGTHILEPWCDLE  283

Query  774   ILLSLDGEN---------LPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNH  622
               +S+  E          +P  WCR+ NY+++Y WAN+K VQKAL VREGT+ EW+RCN 
Sbjct  284   SFMSILQETPTNGQSVFPIPGPWCREKNYIYSYVWANDKAVQKALNVREGTILEWVRCNE  343

Query  621   TLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKV  442
             ++    + ER+E+YV++V + VD H   T+KSCR LIYSGDHDMIVPH++TE+WIE+LK+
Sbjct  344   SMHYRGK-ERTESYVYDVPSAVDDHCHLTSKSCRALIYSGDHDMIVPHLTTEEWIETLKL  402

Query  441   GVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIY  262
              + DDW PW V+ QVAGY MKY Q +YELTYATVKGAGHTA EYKP +CL M+ RW S  
Sbjct  403   PIVDDWEPWIVDAQVAGYKMKYLQNDYELTYATVKGAGHTAAEYKPEQCLSMVDRWFSGD  462

Query  261   PL  256
             PL
Sbjct  463   PL  464



>gb|AAD01265.1| glucose acyltransferase [Solanum berthaultii]
Length=461

 Score =   463 bits (1191),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 234/422 (55%), Positives = 294/422 (70%), Gaps = 25/422 (6%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSP------------EtdplllwltggpgplTINYANSTGDIP  1315
             V E  K+QLFY+F+ SE+ P                 L       GPLT +YANS G+ P
Sbjct  44    VGEEEKVQLFYFFVPSERDPLNDPLMIWLTGGPGCSGLSSFVYEIGPLTFDYANSNGNFP  103

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              LELN  +WTKVANIIF+DQP GTGYSY+ TS+AYN NDTLS   TY FL +WL+DHP +
Sbjct  104   KLELNSNSWTKVANIIFIDQPAGTGYSYANTSEAYNCNDTLSVTLTYDFLRKWLMDHPEY  163

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             LNNPLYV GDSYSGI V  + R IYDG+E G +PRLN+KG I+GN LT R+ D+N R+ Y
Sbjct  164   LNNPLYVGGDSYSGIFVAPLTRKIYDGIEVGDKPRLNIKGYIQGNALTDRYIDSNGRIKY  223

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
               RMG +SD +Y+S K +CNG+Y D  PHN  C  DLQ+VTK    I   QILEP C+  
Sbjct  224   ANRMGLISDKIYQSAKTNCNGSYFDVDPHNILCLNDLQKVTK---NIRRAQILEPYCDLP  280

Query  774   ILLSLDGEN---------LPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNH  622
              L+ +  E          +   WCR+ NY+++Y WAN+K+VQKAL VREGT  EW+RCN 
Sbjct  281   YLMDILQETPTNGQSVFPIAGPWCREKNYIYSYVWANDKVVQKALNVREGTTLEWVRCNE  340

Query  621   TLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKV  442
             ++    + ER+E+YV++V + V  HR  T+KSCR LIYSGDHDM+VPH+STE+WI++LK+
Sbjct  341   SMHYRGK-ERTESYVYDVPSAVGDHRHLTSKSCRALIYSGDHDMVVPHLSTEEWIDTLKL  399

Query  441   GVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIY  262
              + DDW PWFV+ QVAGY +KY Q +YELTYATVKGAGHTAP+YKP +CLPM+ RW S  
Sbjct  400   PIADDWEPWFVDAQVAGYKVKYLQNDYELTYATVKGAGHTAPQYKPEQCLPMVDRWFSGD  459

Query  261   PL  256
             PL
Sbjct  460   PL  461



>gb|AAD01264.1| glucose acyltransferase [Solanum berthaultii]
Length=456

 Score =   462 bits (1188),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 231/415 (56%), Positives = 300/415 (72%), Gaps = 17/415 (4%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E  K+QLFY+F+ESE+ P+ D              L       GPLT +YANS+G+ P
Sbjct  45    VGEEEKLQLFYFFVESERDPQNDPLMIWLTGGPGCSGLSTFLYEFGPLTFDYANSSGNFP  104

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              LELN ++WTKVANIIF+DQPVGTGYSY++TS+AYN+NDTLSA  TY FL +WL+DHP +
Sbjct  105   KLELNLHSWTKVANIIFIDQPVGTGYSYAKTSEAYNSNDTLSATLTYDFLRKWLMDHPEY  164

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L NPLYV  +SY+GI   LV R IYDG+E G EP++N+KG I+GN LT  +   N+RV Y
Sbjct  165   LKNPLYVGSESYAGIYSALVTRKIYDGVEVGDEPQMNIKGYIQGNALTDAYITVNSRVKY  224

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
              Y MG +SD +Y+S K +CNGNY+D  P+N  C  DLQ+V KC   I    ILE  C+  
Sbjct  225   VYHMGLISDKIYQSAKANCNGNYVDIDPNNILCLNDLQKVKKCLNNIQSHHILENWCDLS  284

Query  774   ILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTL--SGPPE  601
             +L S +  + P  WCR++NY+++  WAN+K VQKAL VREGT+ EW+RCN+++  S    
Sbjct  285   LLRS-NVHSGP--WCRENNYIYSKIWANDKAVQKALNVREGTILEWVRCNNSMKYSARES  341

Query  600   AERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWR  421
              +RS +YV+ +++++D HR  T+KSCR LIYSGDHDMI+ HVSTE+WI++LK+ + DDW 
Sbjct  342   MKRSGSYVYEIQSSIDDHRHLTSKSCRALIYSGDHDMIISHVSTEEWIDTLKLPIVDDWE  401

Query  420   PWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             PWFVEDQVAGY +KY Q +YELTYATVKGAGHTAPEYKPR+C+ M+  W S  PL
Sbjct  402   PWFVEDQVAGYKVKYLQNDYELTYATVKGAGHTAPEYKPRQCMSMVDXWFSGDPL  456



>ref|XP_004248778.1| PREDICTED: serine carboxypeptidase-like 18 [Solanum lycopersicum]
Length=465

 Score =   458 bits (1179),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 232/422 (55%), Positives = 298/422 (71%), Gaps = 22/422 (5%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E+ ++QLFY+FI+SE+ PE D              L       GPLT +YANS+G+ P
Sbjct  45    VGEDEQVQLFYFFIQSERDPENDPLMIWLTGGPGCSALSTFFYEMGPLTFDYANSSGNFP  104

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              LELN Y+WTKVANIIF+DQP GTGYSY+ TS+AYN +DTLS   TY FL +WL++HP +
Sbjct  105   KLELNSYSWTKVANIIFIDQPAGTGYSYANTSEAYNCSDTLSVTLTYDFLRKWLMEHPEY  164

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L NPLYV G SYSG  VP +   IYDG+E G +P+LN+KG I GN  T RF D N RV Y
Sbjct  165   LKNPLYVTGGSYSGFFVPPLTHKIYDGIEVGDKPQLNIKGYILGNAQTDRFIDFNGRVRY  224

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
               RMG +SD +Y+STK +CNGNYID  P+N+ C  DLQ+V +C + I    ILEP C+ E
Sbjct  225   ANRMGLISDKIYQSTKANCNGNYIDVDPNNTLCLNDLQKVDRCLKNIQWTHILEPWCDVE  284

Query  774   ILLSL------DGEN---LPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNH  622
               +S+      +G++   +   WCR+ NY+++Y WANNK VQKAL VREGT+ EW+RCN 
Sbjct  285   SFMSILQEIPTNGQSVFPIAGPWCREKNYIYSYVWANNKAVQKALNVREGTILEWVRCNE  344

Query  621   TLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKV  442
             ++    + ER+E+YV++V + VD HR  T+KSC+ LIYSGDHDMIVPH++TE+WI++LK+
Sbjct  345   SMHYRGK-ERTESYVYDVPSAVDDHRHLTSKSCQALIYSGDHDMIVPHLTTEEWIDTLKL  403

Query  441   GVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIY  262
              + DDW PW V+ QVAGY MKY Q +YELTYATVK AGHTA EYKP +CL M+ RW S  
Sbjct  404   PIVDDWEPWLVDVQVAGYKMKYLQNDYELTYATVKDAGHTAAEYKPEQCLSMVDRWFSGD  463

Query  261   PL  256
             PL
Sbjct  464   PL  465



>ref|XP_006353975.1| PREDICTED: serine carboxypeptidase-like 18-like [Solanum tuberosum]
Length=460

 Score =   457 bits (1176),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 229/413 (55%), Positives = 289/413 (70%), Gaps = 18/413 (4%)
 Frame = -3

Query  1443  KIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELN  1300
             K+QLFY+FIESE+ P+ D              L  L    GPLT +YANS+G+ P LELN
Sbjct  49    KVQLFYFFIESERDPQNDPLMLWLTGGPGCSGLSTLLYEMGPLTFDYANSSGNFPKLELN  108

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
              Y+WTKVANIIF+DQP GTGYSY+ TS+AYN +DTLS   TY FL +WL+DHP +L NPL
Sbjct  109   SYSWTKVANIIFIDQPAGTGYSYANTSEAYNCSDTLSVTLTYEFLRKWLMDHPKYLKNPL  168

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMG  940
             YV+G SY+G  VP + R IYDG+E G +P+LN+KG I GN  T R+ D N +V Y   M 
Sbjct  169   YVSGSSYAGFFVPPLTRKIYDGIEVGDKPQLNIKGYILGNAQTDRYIDVNGKVKYANHMA  228

Query  939   FLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPEILLSL  760
              +S+ +Y+S KE+CN NYID  PHN+ C  DLQ+VT+C + I    ILEP C+   L   
Sbjct  229   LISEKIYQSAKENCNENYIDIDPHNTLCLNDLQKVTRCLKNIKEAHILEPWCDLPFLQEA  288

Query  759   DGE-----NLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAE  595
                      +   WCR+ NY+++Y WAN+K VQKAL VREGT  EW+RCN ++    + E
Sbjct  289   PTNVHSVFPIAGPWCREKNYIYSYVWANDKAVQKALNVREGTTLEWVRCNESMRYRGK-E  347

Query  594   RSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPW  415
             R+E+Y ++V + +DYHR  TNKSCR LIYSGDHDMIVPH++TE+WIE+LK+ + DDW PW
Sbjct  348   RTESYAYDVPSAIDYHRHLTNKSCRALIYSGDHDMIVPHLTTEEWIETLKLPIVDDWEPW  407

Query  414   FVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
              V+ QVAGY MKY Q +YELTYATVKGAGHTA EYKP +CL M+ RW S  PL
Sbjct  408   IVDAQVAGYKMKYLQNDYELTYATVKGAGHTAAEYKPEQCLSMVDRWFSGDPL  460



>ref|XP_011069855.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Sesamum 
indicum]
Length=481

 Score =   427 bits (1098),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 212/428 (50%), Positives = 282/428 (66%), Gaps = 32/428 (7%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V EN + QLFY+F+ESE +PE D              L  +    G   ++YAN  GD  
Sbjct  49    VGENEEAQLFYFFLESESNPEKDPFVFWLTGGPGCAGLSTILLEMGTFMLDYANCKGDSV  108

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L+LN YAWTK ANI+F+DQPVGTG+SY++T  +   NDTLSA+  Y FL +WL+DHP +
Sbjct  109   ALKLNEYAWTKAANILFIDQPVGTGFSYAKTLASSLANDTLSARLCYDFLKKWLIDHPKY  168

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L NPLY+ G+SY+GI +PLVV  +Y+G+++G +P LNMKG   GNP+T  F+D N R+ Y
Sbjct  169   LENPLYIFGESYAGIVLPLVVNEVYNGIKTGDKPVLNMKGYGIGNPMTDLFADLNERIPY  228

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
              +RMG LSD LY+  K +C+GNY++    N  C  DL+R+ +C ++I  PQIL+P C   
Sbjct  229   AHRMGLLSDKLYQLAKANCHGNYLNVDSDNDLCLNDLERINQCLDRIAKPQILDPWCEDS  288

Query  783   ----------------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREG  652
                             NP   L        ++WCR+DN   AY WAN+K  QKAL VR+G
Sbjct  289   SAKKQDVLSWYMSFEENPINFLQPVVAARKKEWCREDNARLAYIWANDKSAQKALNVRKG  348

Query  651   TMTEWLRCNHTL-SGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHV  475
             T+ +W+RCN ++ +  P       Y+ NVK TV YH+ FT+KS RVLI+SGDHDM  PH+
Sbjct  349   TIKQWVRCNQSIVNSTPGPSGIIPYINNVKRTVGYHQKFTHKSARVLIFSGDHDMQAPHI  408

Query  474   STEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPREC  295
             STEKWIESLKV ++ DWRPWFVE+Q+ GYTM+Y+Q +YELTYAT+KG GHT PEY+P+E 
Sbjct  409   STEKWIESLKVPIKSDWRPWFVENQIGGYTMQYAQGDYELTYATIKGGGHTNPEYRPKES  468

Query  294   LPMIQRWL  271
               M  RW+
Sbjct  469   FVMFNRWI  476



>ref|XP_007201135.1| hypothetical protein PRUPE_ppa016992mg, partial [Prunus persica]
 gb|EMJ02334.1| hypothetical protein PRUPE_ppa016992mg, partial [Prunus persica]
Length=450

 Score =   425 bits (1093),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 216/420 (51%), Positives = 278/420 (66%), Gaps = 35/420 (8%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             +QLFYYFIESE+SP+ D                 L    GP+  NYANS+G+ P L LNP
Sbjct  37    VQLFYYFIESERSPKEDPLVLWLTGGPGCSGFSGLAYQIGPIMFNYANSSGNEPTLMLNP  96

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTKVANIIF+DQPVG+G+SY+++   Y T D  SA HTY FL +WL DHP FL NPLY
Sbjct  97    YSWTKVANIIFLDQPVGSGFSYAKSWQGYETGDISSASHTYEFLRKWLKDHPEFLKNPLY  156

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             +AGDSYSGITVP+VV+ + +G E G EP LN+KG + GNP T    D N+R+ + +RM  
Sbjct  157   IAGDSYSGITVPIVVQEVSNGNEVGHEPPLNLKGYVLGNPFTEPTYDVNSRIKFAHRMAL  216

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-----NPEI  772
             +SD LY+STK +C G Y+   P N+ C  +LQ VT+CT+KI   QILEP C     NP+I
Sbjct  217   ISDTLYESTKTNCKGEYVQVDPSNAPCVENLQEVTECTQKIYYNQILEPKCSTMSPNPKI  276

Query  771   L---LSLDGENL-------PQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNH  622
                  + D EN         + WCR  NYLF++ WAN+K VQ AL VREGT+  W +CN 
Sbjct  277   FKWDQNFDDENFLDMLHHSTKPWCRPYNYLFSFIWANDKTVQNALHVREGTIKGWEKCNQ  336

Query  621   TLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKV  442
             +L        S  Y  +V+ ++DYHR+ T K+ R L+YSGDHDM++P+V T++WI+SL +
Sbjct  337   SL--------SSNYAHDVRTSIDYHRNLTKKNLRALVYSGDHDMLIPYVGTQEWIKSLNL  388

Query  441   GVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIY  262
              V+  WRPWFV  QVAGYT  Y++K Y LT+ TVKG GHTAPE+KP EC  MI RW + Y
Sbjct  389   SVDYQWRPWFVNGQVAGYTNAYTRKTYSLTFVTVKGGGHTAPEFKPMECHAMIDRWFAYY  448



>ref|XP_011069858.1| PREDICTED: serine carboxypeptidase-like 18 [Sesamum indicum]
Length=481

 Score =   425 bits (1093),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 206/425 (48%), Positives = 283/425 (67%), Gaps = 32/425 (8%)
 Frame = -3

Query  1449  NLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLE  1306
             N ++QLFY+F ESE +PE D              L  +    G   ++YANS G    L+
Sbjct  52    NEEVQLFYFFFESESNPEKDPLLLWMTGGPGCTGLSTILLEMGTFMLDYANSKGGSVALK  111

Query  1305  LNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNN  1126
             LN YAWTK ANI+F+DQP GTG+SY++T + +  NDTLSA+  Y FL +WL+DHP +L N
Sbjct  112   LNEYAWTKAANILFIDQPAGTGFSYAKTLEGFLANDTLSARLCYDFLKKWLIDHPKYLEN  171

Query  1125  PLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYR  946
             PLY+ G+SYSGI +PLVV  +Y+G+E+G +P LNMKG   GNP+T  F+D N R+ Y ++
Sbjct  172   PLYIFGESYSGIVLPLVVNEVYNGIETGDKPVLNMKGYGIGNPITDVFADLNERIPYAHQ  231

Query  945   MGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPEIL-  769
             MG LSD LY+S K +C+GNY++    N  C  DL R+ +C ++I   QIL+P C   +  
Sbjct  232   MGLLSDKLYQSAKVNCHGNYLNVDSDNDLCLNDLDRINQCLDRIAKAQILDPWCEDSLAK  291

Query  768   --------LSLDGENL----------PQQWCRDDNYLFAYSWANNKIVQKALGVREGTMT  643
                     +S +  ++           ++WCR+DN   A++WAN+K  QKAL +REGT+ 
Sbjct  292   KQDVLSWYMSFEENSINFLQSVVVAGKKEWCREDNVRLAHTWANDKYAQKALNIREGTIK  351

Query  642   EWLRCNHTLS-GPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTE  466
             +W+RCN +++   P       Y+ NVK TV YH+ FT+KS RVLI+SGDHDM+ PH+STE
Sbjct  352   QWVRCNQSIANSTPGPSGIIPYINNVKRTVGYHQKFTHKSARVLIFSGDHDMMAPHISTE  411

Query  465   KWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPM  286
             KWIESLKV ++ DWRPWFV +Q+ GYTM+Y+Q +YELTYAT+KG GHT PEY+P+E   M
Sbjct  412   KWIESLKVPIKSDWRPWFVGNQIGGYTMQYAQGDYELTYATIKGGGHTNPEYRPKESFVM  471

Query  285   IQRWL  271
               RW+
Sbjct  472   FDRWI  476



>ref|XP_008236294.1| PREDICTED: serine carboxypeptidase-like 14 [Prunus mume]
Length=463

 Score =   422 bits (1086),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 213/420 (51%), Positives = 279/420 (66%), Gaps = 35/420 (8%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             +QLFYYFIESE+SP+ D                 L    GP+  NYANS+G+ P L LNP
Sbjct  50    VQLFYYFIESERSPKEDPLVLWLTGGPGCSGFSGLAYQIGPIMFNYANSSGNEPTLVLNP  109

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTKVANIIF+DQPVG+G+SY+++ + Y T D  SA HTY FL +WL DHP FL NPLY
Sbjct  110   YSWTKVANIIFLDQPVGSGFSYAKSWEGYETGDISSAAHTYEFLRKWLKDHPEFLKNPLY  169

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             +AGDSYSGITVP+VV+ + +G E   EP LN+KG + GNP T    D N+R+ + +RM  
Sbjct  170   IAGDSYSGITVPIVVQEVSNGNEVRHEPPLNLKGYVLGNPFTEPTYDVNSRIKFAHRMAL  229

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-----NPEI  772
             +SD LY+STK +C G Y+   P N+ C  +LQ VT+CT+KI    ILEP C     NP+I
Sbjct  230   ISDTLYESTKTNCKGEYVQVDPSNAPCVLNLQEVTECTQKIYYNHILEPKCSTMSPNPKI  289

Query  771   L---LSLDGENL-------PQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNH  622
                  + DGE+         + WCR  NYLF++ WAN+K VQ AL VREGT+  W +CN 
Sbjct  290   FKWDQNFDGEDFLDMLHHSTEPWCRTYNYLFSFIWANDKTVQNALHVREGTIKGWEKCNQ  349

Query  621   TLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKV  442
             ++        S  Y  +V+ ++DYHR+ T K+ R L+YSGDHDM++P+V T++WI+SL +
Sbjct  350   SI--------SSNYAHDVRTSIDYHRNLTKKNLRALVYSGDHDMLIPYVGTQEWIKSLNL  401

Query  441   GVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIY  262
              V+  WRPWFV+ QVAGYT  Y++K Y LT+ TVKG GHTAPE+KP EC  MI RW + Y
Sbjct  402   SVDYQWRPWFVDGQVAGYTNAYTRKTYSLTFVTVKGGGHTAPEFKPMECHAMIDRWFAYY  461



>ref|XP_007200784.1| hypothetical protein PRUPE_ppa024053mg [Prunus persica]
 gb|EMJ01983.1| hypothetical protein PRUPE_ppa024053mg [Prunus persica]
Length=456

 Score =   417 bits (1073),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 207/412 (50%), Positives = 273/412 (66%), Gaps = 27/412 (7%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEt-------------dplllwltggpgplTINYANSTGDIPDLELN  1300
             IQLFY+FIESE+SP+                    +    GPL  NYANS+G+ P   LN
Sbjct  51    IQLFYFFIESERSPKEDPLLLWLSGGPGCSSFTAMVYDSIGPLIFNYANSSGNEPTFLLN  110

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             PYAWTK+AN+IF+DQPVGTGYSY+++ + Y T DTLS   TY FL +WL DHP FL NPL
Sbjct  111   PYAWTKIANVIFLDQPVGTGYSYAKSWEEYRTGDTLSCTQTYEFLRKWLKDHPQFLKNPL  170

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMG  940
             Y+AGDSYSGITVP+V + + +G E+G EP +N+KG + GNP T    D N+R+ Y +RM 
Sbjct  171   YIAGDSYSGITVPIVAQQVSNGNEAGHEPPMNLKGYVLGNPWTEPTYDVNSRIQYAHRMA  230

Query  939   FLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---NPEIL  769
              +S+ LY+STK +C G Y+   P N+ C  +LQ V +C +KIN+ QILEP C   +P+  
Sbjct  231   LISNELYESTKTNCKGEYVQVDPSNAPCVKNLQEVNECIQKINLAQILEPKCSTLSPKPK  290

Query  768   LSLDGENLPQQ---WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEA  598
                  +N  ++   W +  NY+F + WAN+K VQ AL VREGT+  W RCN +L      
Sbjct  291   RFKWDQNFAEEDFTWLQSYNYIFCFIWANDKTVQNALNVREGTIKGWERCNQSL------  344

Query  597   ERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRP  418
                  YV++V+ ++DYHR+ T K+ R L+YSGDHDMI+P+V T +WI+SL + V+  WRP
Sbjct  345   --FSNYVYDVRTSIDYHRNLTKKNLRALVYSGDHDMIIPYVGTREWIKSLNLSVDYQWRP  402

Query  417   WFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIY  262
             WFV  QVAGYT  Y+ K Y LT+ TVKG GH+APEYKP ECL M+ RW + Y
Sbjct  403   WFVNGQVAGYTNAYTLKAYSLTFVTVKGGGHSAPEYKPMECLAMVDRWFAYY  454



>ref|XP_011069856.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Sesamum 
indicum]
Length=477

 Score =   417 bits (1072),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 210/428 (49%), Positives = 279/428 (65%), Gaps = 36/428 (8%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V EN + QLFY+F+ESE +PE D              L  +    G   ++YAN  GD  
Sbjct  49    VGENEEAQLFYFFLESESNPEKDPFVFWLTGGPGCAGLSTILLEMGTFMLDYANCKGDSV  108

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L+LN YAWTK ANI+F+DQPVGTG+SY++T  +   NDTLSA+  Y FL +WL+DHP +
Sbjct  109   ALKLNEYAWTKAANILFIDQPVGTGFSYAKTLASSLANDTLSARLCYDFLKKWLIDHPKY  168

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L NPLY+ G+SY+GI +PLVV  +Y+G+++G +P LNMKG   GNP+T  F+D N R+ Y
Sbjct  169   LENPLYIFGESYAGIVLPLVVNEVYNGIKTGDKPVLNMKGYGIGNPMTDLFADLNERIPY  228

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
              +RMG LSD LY+  K +C+GNY++    N  C  DL+R+ +C ++I  PQIL+P C   
Sbjct  229   AHRMGLLSDKLYQLAKANCHGNYLNVDSDNDLCLNDLERINQCLDRIAKPQILDPWCEDS  288

Query  783   ----------------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREG  652
                             NP   L        ++WCR+DN   AY WAN+K  QKAL VR+ 
Sbjct  289   SAKKQDVLSWYMSFEENPINFLQPVVAARKKEWCREDNARLAYIWANDKSAQKALNVRK-  347

Query  651   TMTEWLRCNHTL-SGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHV  475
                +W+RCN ++ +  P       Y+ NVK TV YH+ FT+KS RVLI+SGDHDM  PH+
Sbjct  348   ---QWVRCNQSIVNSTPGPSGIIPYINNVKRTVGYHQKFTHKSARVLIFSGDHDMQAPHI  404

Query  474   STEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPREC  295
             STEKWIESLKV ++ DWRPWFVE+Q+ GYTM+Y+Q +YELTYAT+KG GHT PEY+P+E 
Sbjct  405   STEKWIESLKVPIKSDWRPWFVENQIGGYTMQYAQGDYELTYATIKGGGHTNPEYRPKES  464

Query  294   LPMIQRWL  271
               M  RW+
Sbjct  465   FVMFNRWI  472



>ref|XP_002522135.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF40335.1| serine carboxypeptidase, putative [Ricinus communis]
Length=478

 Score =   416 bits (1070),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 209/433 (48%), Positives = 288/433 (67%), Gaps = 49/433 (11%)
 Frame = -3

Query  1443  KIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELN  1300
             ++QLFYYF+ESE+SPE D                 L    GPL  NY +S  + P  ELN
Sbjct  58    EVQLFYYFVESERSPENDPLMLWLTGGPGCSAFSGLVYEVGPLKFNYVDSKHNKPVFELN  117

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             PY+WTKVANIIF+D PVGTG+SY++T +AY+ NDT++A   Y FL +WL+ +P FL NPL
Sbjct  118   PYSWTKVANIIFLDSPVGTGFSYAKTGEAYHVNDTIAAAEIYDFLRKWLVSNPQFLANPL  177

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMG  940
             Y+ GDSYSGI VP+VV+ I +G E G++P ++++G + GNPLT+   D N+++ + YR+ 
Sbjct  178   YIGGDSYSGIIVPIVVQEILNGNEMGLQPPMDLRGYLLGNPLTNYRIDLNSKISFAYRLS  237

Query  939   FLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC------NP  778
              LS  +Y+S K +C G Y    P+N+ C  D+Q + +C +K++  QILEP C      NP
Sbjct  238   LLSKKIYESFKINCKGEYAYPDPNNALCMQDIQTINECIKKLDPAQILEPECSRTFSPNP  297

Query  777   -----------------EILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGT  649
                              +ILLS     +P++WCR+ NYL++Y+WAN+K VQ+AL +REGT
Sbjct  298   MASRWDPTAISDYSIDDDILLS--PSQIPERWCREYNYLYSYTWANDKNVQEALRIREGT  355

Query  648   MTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVST  469
             + EW RCN++LS          Y + V +T+DYH++FT    + LIYSGDHDM +PHV T
Sbjct  356   IKEWARCNYSLS----------YSYGVISTIDYHKNFTKTGLQALIYSGDHDMAIPHVGT  405

Query  468   EKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKE--YELTYATVKGAGHTAPEYKPREC  295
             E+WIESL + +  DW+PW V+ QVAGYT++YS  E  Y LT+ATVKG GHTAPEYKP++C
Sbjct  406   EEWIESLNLTIASDWQPWLVDGQVAGYTVEYSYDEYAYRLTFATVKGGGHTAPEYKPKQC  465

Query  294   LPMIQRWLSIYPL  256
             L M+ RW +IYPL
Sbjct  466   LAMVDRWFAIYPL  478



>ref|XP_008236292.1| PREDICTED: serine carboxypeptidase-like 13 isoform X2 [Prunus 
mume]
Length=480

 Score =   413 bits (1062),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 212/429 (49%), Positives = 277/429 (65%), Gaps = 42/429 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEt-------------dplllwltggpgplTINYANSTGDIPDLELN  1300
             +QLFYYF ESE SPE                    +    GPL+ +YA+S G+ P LELN
Sbjct  60    VQLFYYFFESEGSPEYDPLVLWLTGGPGCSAFSAIVYENLGPLSFDYAHSIGNKPKLELN  119

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAY-NTNDTLSAQHTYSFLVQWLLDHPTFLNNP  1123
             PY+WTKVANIIF+D PVGTG+SY++T + Y N NDTLSA  TY FL +WL+DHP F N+P
Sbjct  120   PYSWTKVANIIFLDAPVGTGFSYAKTWEGYSNLNDTLSAAQTYEFLRKWLMDHPKFYNSP  179

Query  1122  LYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRM  943
             LY+AGDSYSGITVP++V+ I DG +    P +N+KG + GNP T    D N +V++ Y  
Sbjct  180   LYIAGDSYSGITVPMLVQEISDGNQDEHVPPMNLKGYVLGNPGTDEKKDNNYQVLFAYLK  239

Query  942   GFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-------  784
               +SD LY+S K++C G YI+   +N+ C  DLQ   +C E I   QILEP+C       
Sbjct  240   ALISDELYQSMKKNCKGEYINVDLNNTLCLEDLQLYNECIEDIQSVQILEPSCTLVASPK  299

Query  783   -------------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMT  643
                             + L L    LP+ WCR  NYLF+Y WAN+K VQ AL ++EG++ 
Sbjct  300   SAGSKRNINYFSDKDSVNLLLSFPQLPRPWCRSYNYLFSYIWANDKTVQDALHIQEGSIK  359

Query  642   EWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEK  463
             EWLRCNHTL         ++Y+ +V +++ YH +   +  RVLIYSGDHDM+VP+V+T  
Sbjct  360   EWLRCNHTL--------QDSYISDVSSSLVYHENLIKQGYRVLIYSGDHDMLVPYVATMA  411

Query  462   WIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMI  283
             WIESL + V+  W+PWFV+ QVAGY ++YS K+Y+LTY T+KGAGHTAPEYKP EC  MI
Sbjct  412   WIESLNLTVDSRWKPWFVDGQVAGYRVQYSDKKYQLTYTTIKGAGHTAPEYKPEECHAMI  471

Query  282   QRWLSIYPL  256
              RW + YPL
Sbjct  472   SRWFAYYPL  480



>ref|XP_011070163.1| PREDICTED: serine carboxypeptidase-like 18 [Sesamum indicum]
Length=485

 Score =   412 bits (1060),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 207/431 (48%), Positives = 279/431 (65%), Gaps = 37/431 (9%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E+ ++QLFY+F ESE  PE D              L  +    G   I++ N TG   
Sbjct  52    VGEDEEVQLFYFFFESEGDPEKDPFIFWITGGPGCSGLSVILMEIGTFVIDFPNCTGGPT  111

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L+LN YAWTK A+I+F+DQP GTGYSYS T   Y TNDTLS + +Y FL +WL+ HP +
Sbjct  112   ALKLNEYAWTKSASILFIDQPAGTGYSYSNTLKGYITNDTLSTRLSYDFLRKWLIKHPQY  171

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L NPLY+ G+SYSGIT+PL+V  +Y GLE+G +P LN+KG   GNP+T  + D N RV Y
Sbjct  172   LKNPLYIVGESYSGITLPLIVDEVYKGLEAGDKPTLNIKGYALGNPITDLYQDINERVPY  231

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
              + MG LS+ LY+S K  C+GNY +A P N+ C  DL+++ +C  KI  P ILEP C+  
Sbjct  232   AHGMGLLSEKLYQSAKVHCHGNYKNADPTNTICVNDLEKINQCLAKIYQPHILEPWCDEA  291

Query  774   I-------LLSLDGENL---------------PQQWCRDDNYLFAYSWANNKIVQKALGV  661
             +       ++SL   ++                ++WCR+DN   ++SWAN+K VQKAL V
Sbjct  292   LWAPKRRDVMSLYPSSVDEIALDFIQPVVTRKKKEWCREDNAFLSHSWANDKAVQKALNV  351

Query  660   REGTMTEWLRCNHTLS-GPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIV  484
             REG  T+W+RCN TL    P       Y+ +V +T+ YH+ FT  + RVLI+SGDHD++ 
Sbjct  352   REG--TQWVRCNQTLRHSKPGPSGKIPYIKDVPSTIGYHKKFTQTNARVLIFSGDHDLVA  409

Query  483   PHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKP  304
             PH STEKWIESLKV ++ DWRPWFV+DQ+ GYTM+Y+Q  YELTYAT+KG+GHT PE++P
Sbjct  410   PHTSTEKWIESLKVPIKSDWRPWFVDDQIGGYTMQYAQGNYELTYATIKGSGHTNPEFRP  469

Query  303   RECLPMIQRWL  271
             +E   +  RW+
Sbjct  470   KESFALFDRWI  480



>ref|XP_010647903.1| PREDICTED: serine carboxypeptidase-like 13 [Vitis vinifera]
Length=464

 Score =   411 bits (1056),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 210/428 (49%), Positives = 277/428 (65%), Gaps = 44/428 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             IQLFYYFIESE++P  D                 L    GPL  +YAN +GDIP L  NP
Sbjct  48    IQLFYYFIESERNPSLDPLMLWLTGGPGCSAFSGLVYEIGPLIFDYANRSGDIPALLSNP  107

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTKVA+IIF+D PVG+G+SY+++S+ Y T+D+L+A H Y FL +WL+DHP FL N LY
Sbjct  108   YSWTKVASIIFLDSPVGSGFSYAQSSEGYRTSDSLAAAHGYDFLKKWLIDHPEFLRNRLY  167

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             +AGDSYSG+ VP++ + I DG E+G EP +N+ G + GN L     D N+RV + +RM F
Sbjct  168   IAGDSYSGLFVPIIAQKISDGNEAGQEPHMNLNGYLLGNALVDENIDFNSRVPFAHRMTF  227

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN--------  781
             LSD LYK T+ SCNG Y+ A P N  C  +L+ V KC EKIN+P +LEP C         
Sbjct  228   LSDKLYKKTEASCNGKYLKADPSNGQCTENLKVVNKCMEKINLPHVLEPKCGRPLSWKPN  287

Query  780   -------------PEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTE  640
                           + LLS     LP+  CR   +LF+Y WAN++ VQKALG+REGT+ E
Sbjct  288   ALKWESIPLEENFSDFLLS-PIRQLPEPTCRLYKFLFSYIWANDRRVQKALGIREGTIPE  346

Query  639   WLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKW  460
             W+RCN++L+          Y  +V +TV Y +    K    LIYSGDHDM+VPH+ T++W
Sbjct  347   WVRCNNSLA----------YTHDVFSTVAYIQKLHEKGYGGLIYSGDHDMLVPHMGTQEW  396

Query  459   IESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQ  280
             I SL + +  DW PWFV+ QVAG++++YS  +  +T+ATVKG GHTAPEYKP+ECL MI 
Sbjct  397   INSLNLSISKDWEPWFVDGQVAGFSIEYSNSKRGMTFATVKGGGHTAPEYKPKECLAMIY  456

Query  279   RWLSIYPL  256
             RWL+ YPL
Sbjct  457   RWLAYYPL  464



>ref|XP_002266354.2| PREDICTED: serine carboxypeptidase-like 18 [Vitis vinifera]
Length=468

 Score =   411 bits (1057),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 207/426 (49%), Positives = 281/426 (66%), Gaps = 41/426 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             +QLFYYF++SE++P  D                 L    GPL+ +YA S  ++P  +LNP
Sbjct  53    VQLFYYFVKSERNPRDDPLLLWLTGGPGCSAFSGLVYEVGPLSFDYAKSNENLPTFKLNP  112

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTK+A++IF+D PVGTG+SYS T++ YN NDTLSA   Y+FL +WL++HP F  NPLY
Sbjct  113   YSWTKLASMIFLDAPVGTGFSYSRTAEGYNMNDTLSASQIYAFLRKWLINHPKFQKNPLY  172

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             V+GDSYSGI +P+VV+ I +G + G EP++N++G   GNP+T  FSD N+R+ Y +R+G 
Sbjct  173   VSGDSYSGIIIPMVVQEISNGNDEGKEPKMNIQGYTIGNPVTDHFSDFNSRIEYTHRVGI  232

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-----NP--  778
             LSD LY+  KESCNG Y+   P N  C  +L+  T+C  KI    ILEP+C     NP  
Sbjct  233   LSDELYEELKESCNGKYVYVDPSNVECTNNLKVYTQCINKIYSAHILEPSCAMLSPNPNA  292

Query  777   ------------EILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWL  634
                          I L L     P+ WCR  NY+F+Y WAN+K VQKAL VREGT+ +W+
Sbjct  293   SKLDRSSLQEINSIGLLLSQPQKPEPWCRSYNYVFSYLWANDKTVQKALHVREGTVKDWV  352

Query  633   RCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIE  454
             RCN +LS          Y  NV ++VDYHR+ T K+ R LIYSGDHDM++P+V T+ WI 
Sbjct  353   RCNESLS----------YTSNVFSSVDYHRNLTKKAYRALIYSGDHDMLIPYVGTQAWIA  402

Query  453   SLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRW  274
             SL + + +DW+PWFV+ QVAG+ ++Y   +Y +T+ATVKGAGHTAPEY+P+E   M+ RW
Sbjct  403   SLNLNISEDWQPWFVDGQVAGFRVEYLHNKYLMTFATVKGAGHTAPEYRPKEGFAMVYRW  462

Query  273   LSIYPL  256
             L+ Y L
Sbjct  463   LAHYFL  468



>emb|CBI22421.3| unnamed protein product [Vitis vinifera]
Length=589

 Score =   412 bits (1058),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 210/428 (49%), Positives = 277/428 (65%), Gaps = 44/428 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             IQLFYYFIESE++P  D                 L    GPL  +YAN +GDIP L  NP
Sbjct  173   IQLFYYFIESERNPSLDPLMLWLTGGPGCSAFSGLVYEIGPLIFDYANRSGDIPALLSNP  232

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTKVA+IIF+D PVG+G+SY+++S+ Y T+D+L+A H Y FL +WL+DHP FL N LY
Sbjct  233   YSWTKVASIIFLDSPVGSGFSYAQSSEGYRTSDSLAAAHGYDFLKKWLIDHPEFLRNRLY  292

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             +AGDSYSG+ VP++ + I DG E+G EP +N+ G + GN L     D N+RV + +RM F
Sbjct  293   IAGDSYSGLFVPIIAQKISDGNEAGQEPHMNLNGYLLGNALVDENIDFNSRVPFAHRMTF  352

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN--------  781
             LSD LYK T+ SCNG Y+ A P N  C  +L+ V KC EKIN+P +LEP C         
Sbjct  353   LSDKLYKKTEASCNGKYLKADPSNGQCTENLKVVNKCMEKINLPHVLEPKCGRPLSWKPN  412

Query  780   -------------PEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTE  640
                           + LLS     LP+  CR   +LF+Y WAN++ VQKALG+REGT+ E
Sbjct  413   ALKWESIPLEENFSDFLLS-PIRQLPEPTCRLYKFLFSYIWANDRRVQKALGIREGTIPE  471

Query  639   WLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKW  460
             W+RCN++L+          Y  +V +TV Y +    K    LIYSGDHDM+VPH+ T++W
Sbjct  472   WVRCNNSLA----------YTHDVFSTVAYIQKLHEKGYGGLIYSGDHDMLVPHMGTQEW  521

Query  459   IESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQ  280
             I SL + +  DW PWFV+ QVAG++++YS  +  +T+ATVKG GHTAPEYKP+ECL MI 
Sbjct  522   INSLNLSISKDWEPWFVDGQVAGFSIEYSNSKRGMTFATVKGGGHTAPEYKPKECLAMIY  581

Query  279   RWLSIYPL  256
             RWL+ YPL
Sbjct  582   RWLAYYPL  589



>ref|XP_007201001.1| hypothetical protein PRUPE_ppa005249mg [Prunus persica]
 gb|EMJ02200.1| hypothetical protein PRUPE_ppa005249mg [Prunus persica]
Length=470

 Score =   405 bits (1042),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 206/429 (48%), Positives = 273/429 (64%), Gaps = 42/429 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEt-------------dplllwltggpgplTINYANSTGDIPDLELN  1300
             +QLFYYF ESE SPE                    +    GPL+ +YA+S G+ P L+LN
Sbjct  50    VQLFYYFFESEGSPEYDPLVLWLNGGPGCSAFSGLVYENLGPLSFDYAHSIGNKPKLKLN  109

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNT-NDTLSAQHTYSFLVQWLLDHPTFLNNP  1123
             PY+WTKVANIIF+D PVGTG+SY++  + YN  NDTLSA  TY FL +WL+DHP F NNP
Sbjct  110   PYSWTKVANIIFLDAPVGTGFSYAKNWEGYNNLNDTLSAAQTYEFLRKWLMDHPKFYNNP  169

Query  1122  LYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRM  943
             LY+ GDSYSGI VP+VV+ I DG +    P +N+KG + GNP+T    D N +V++ Y  
Sbjct  170   LYITGDSYSGIIVPMVVQEISDGNQDEHVPPMNLKGYVLGNPVTDEKKDNNYKVLFAYLK  229

Query  942   GFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNP-----  778
               +SD LY+S +++C G YI+   +N+ C  DL+   +C E I   QILEP C       
Sbjct  230   ALISDELYQSMRKNCKGEYINVDLNNTLCVGDLELYNECIEDIQSAQILEPTCTSVASPK  289

Query  777   ---------------EILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMT  643
                             + L L    L + WCR  NYLF+Y WAN+K VQ AL ++EG++ 
Sbjct  290   SAGSKWNINYFSDKDSVNLLLSFPELTRPWCRSYNYLFSYIWANDKTVQDALHIQEGSIK  349

Query  642   EWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEK  463
             EWLRCNHTL         ++Y+F+V +++ YH +   +  RVLIYSGDHDM++P+V+T  
Sbjct  350   EWLRCNHTLK--------DSYIFDVSSSLVYHENLIKQGYRVLIYSGDHDMVIPYVATMA  401

Query  462   WIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMI  283
             WIESL + V+  W+PWFV+ QVAGY ++YS K+Y+LTY T+KGAGHTA EYKP EC  MI
Sbjct  402   WIESLNLTVDSRWKPWFVDGQVAGYRVQYSDKKYQLTYTTIKGAGHTATEYKPEECHAMI  461

Query  282   QRWLSIYPL  256
              RW + YPL
Sbjct  462   SRWFAYYPL  470



>ref|XP_010028346.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW55075.1| hypothetical protein EUGRSUZ_I01041 [Eucalyptus grandis]
Length=464

 Score =   405 bits (1040),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 205/431 (48%), Positives = 282/431 (65%), Gaps = 40/431 (9%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E  ++QLFYYFIESE+SP+ D              L  L    GP+  ++++S+G  P
Sbjct  44    VGELEEVQLFYYFIESERSPKRDPLLVWLTGGPGCSSLSSLIYEIGPMQFDFSSSSGTKP  103

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L+ NPY+WTKVAN+IF+D PVGTG+SY+ T  AYN +DT SA  TY FL +WL+ HP+F
Sbjct  104   ILKYNPYSWTKVANVIFLDAPVGTGFSYATTDTAYNVSDTSSAAQTYEFLRKWLVSHPSF  163

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L NPLY+ GDSYSG+ +P++V+NI DG+E+G +P++N+ G   GNP+T    D + R+ Y
Sbjct  164   LANPLYITGDSYSGVVIPIIVKNIQDGIEAGHQPQMNLVGYTLGNPVTCDEKDMSFRIPY  223

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN--  781
               +M  +SD LY++TK  CNG++ +  P N AC  DL+ V+ C EKI + Q+LEP+CN  
Sbjct  224   ANKMALVSDELYETTKTDCNGDFQNVDPTNGACLTDLEMVSLCLEKIFLAQVLEPSCNLI  283

Query  780   ---------PEILLSLDGEN---LPQQ---WCRDDNYLFAYSWANNKIVQKALGVREGTM  646
                         +L  D  N   +P Q   WCR  NY+++Y WAN++ VQ+ALG+R GT 
Sbjct  284   SPNHTRLKWSRSILEEDTVNIVSMPHQSRPWCRPANYIYSYIWANDEKVQEALGIRTGTK  343

Query  645   TEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTE  466
              EW RCNHTLS          Y  +V N V YH   + K+ R L+YSGDHD+ +P+V+T 
Sbjct  344   QEWNRCNHTLS----------YTKDVLNAVVYHEYLSEKTLRALVYSGDHDLAIPYVATL  393

Query  465   KWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQ-KEYELTYATVKGAGHTAPEYKPRECLP  289
              WI SL + +E  W PWFVE Q+AGY++ YS+  +Y+LT+ T+KG GHTAPEYKP++CL 
Sbjct  394   DWIRSLNLTLEGSWSPWFVEGQIAGYSILYSKNSKYDLTFTTIKGGGHTAPEYKPKQCLA  453

Query  288   MIQRWLSIYPL  256
             M+ RW S YPL
Sbjct  454   MVDRWFSYYPL  464



>ref|XP_011457834.1| PREDICTED: serine carboxypeptidase-like 18 [Fragaria vesca subsp. 
vesca]
Length=465

 Score =   404 bits (1037),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 210/426 (49%), Positives = 276/426 (65%), Gaps = 39/426 (9%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEt-------------dplllwltggpgplTINYANSTGDIPDLELN  1300
             +QLFYYFIESE SPE                    +    GPL+ + ANSTG+ P L+LN
Sbjct  48    VQLFYYFIESEGSPEYDPLVLWLTGGPGCSGFSALVYESIGPLSFDAANSTGNKPQLKLN  107

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAY-NTNDTLSAQHTYSFLVQWLLDHPTFLNNP  1123
             PY+WTKVANIIF+D PVGTGYSY++T + Y N +DTLSA   Y F  +WL+DHP FL NP
Sbjct  108   PYSWTKVANIIFLDAPVGTGYSYAKTWEGYSNMSDTLSAAEIYEFFRKWLMDHPKFLENP  167

Query  1122  LYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRM  943
             LYVAGDSYSGI VP+VV+ I DG E+G  P +N++G + GNP T    D N RV + +R 
Sbjct  168   LYVAGDSYSGIIVPIVVQEISDGNEAGRHPPMNIQGYVLGNPATDLDVDENYRVPFAFRK  227

Query  942   GFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---NPEI  772
               +SD LY+S K +C G Y++  P+N+ C  DL +  +C  +IN PQILEP C   +P  
Sbjct  228   ALISDELYQSMKTNCKGEYVNVDPNNALCVDDLDQYNECIAEINTPQILEPYCTVSSPNP  287

Query  771   L--------LSLDGEN---LPQ---QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWL  634
             L        L  D  N   LPQ    WCR   Y F+Y WAN+K VQ AL VREG++ +W 
Sbjct  288   LGSDWESSDLRKDSVNLLSLPQLSRPWCRSYIYRFSYIWANDKTVQDALHVREGSIKDWQ  347

Query  633   RCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIE  454
             RCN TLS         +Y+ +V +++ YH++   K  RVLIYSGDHDM++P++ T  WIE
Sbjct  348   RCNKTLSA--------SYISDVSSSLVYHQNLIKKGYRVLIYSGDHDMVIPYLGTVAWIE  399

Query  453   SLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRW  274
             SL + V+  W+PWFV  Q+AGY ++Y+ ++Y+LT+ T+KG GHTAPEY+P ECL M+ RW
Sbjct  400   SLNLTVDSGWKPWFVNGQIAGYRVQYTYEKYQLTFTTIKGGGHTAPEYRPEECLAMLSRW  459

Query  273   LSIYPL  256
              + YPL
Sbjct  460   FAFYPL  465



>ref|XP_010028339.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
Length=464

 Score =   403 bits (1035),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 210/431 (49%), Positives = 282/431 (65%), Gaps = 40/431 (9%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E  ++QLFYYFIESE+SP+ D              L  L    GPL  +Y+NS+G+ P
Sbjct  44    VGELEEVQLFYYFIESERSPKDDPLLLWLTGGPGCSALSGLLYEIGPLQFDYSNSSGNRP  103

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L+LNPY+WTK+ANIIF+D PVGTG+SY+ T  AY+ +DT SA  TY FL +WL+ HP F
Sbjct  104   VLKLNPYSWTKIANIIFLDAPVGTGFSYATTWTAYDNSDTSSAAQTYEFLRKWLMAHPKF  163

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L NPLY+ GDSYSG+ VP++V+ +YDG E+G EP +N+KG + GNP+T    D + R+ Y
Sbjct  164   LTNPLYITGDSYSGVIVPIIVKEVYDGNEAGREPPMNLKGYVLGNPVTCEVKDISQRIPY  223

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
             G++   +SD LY++TK  CNG+Y++  P N AC  DL+ V+ C EKI + QILEP C   
Sbjct  224   GHKTALISDELYEATKTDCNGDYVNVDPTNGACLTDLEMVSICLEKIYLAQILEPMCSFL  283

Query  783   ---------NPEILLS--LDGENLPQQ---WCRDDNYLFAYSWANNKIVQKALGVREGTM  646
                      +  IL    ++  ++P Q   WCR+ NYL++Y WAN++ VQ+AL +REGT 
Sbjct  284   SPNHTKLKWSRSILQENIINVVSMPLQSRPWCRNYNYLYSYIWANDRNVQEALHIREGTK  343

Query  645   TEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTE  466
              EW RCN +LS          Y  +V N+V YHR  +  S R LIYSGDHD+ +P++ T 
Sbjct  344   PEWDRCNESLS----------YTKDVLNSVVYHRYLSKTSLRALIYSGDHDLAIPYIGTL  393

Query  465   KWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQ-KEYELTYATVKGAGHTAPEYKPRECLP  289
              WI SL + +   W PWFV  QVAGY++ YS+  +Y+LTY T+KG GHTAPEYKP+EC  
Sbjct  394   DWIRSLNLTLLGPWAPWFVNGQVAGYSILYSKNNKYDLTYTTIKGGGHTAPEYKPKECFS  453

Query  288   MIQRWLSIYPL  256
             M+ RW S YPL
Sbjct  454   MVDRWFSYYPL  464



>emb|CBI22420.3| unnamed protein product [Vitis vinifera]
Length=503

 Score =   403 bits (1036),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 205/426 (48%), Positives = 279/426 (65%), Gaps = 42/426 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             +QLFYYF++SE++P  D                 L    GPL+ +YA S  ++P  +LNP
Sbjct  89    VQLFYYFVKSERNPRDDPLLLWLTGGPGCSAFSGLVYEVGPLSFDYAKSNENLPTFKLNP  148

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTK+A++IF+D PVGTG+SYS T++ YN NDTLSA   Y+FL +WL++HP F  NPLY
Sbjct  149   YSWTKLASMIFLDAPVGTGFSYSRTAEGYNMNDTLSASQIYAFLRKWLINHPKFQKNPLY  208

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             V+GDSYSGI +P+VV+ I +G + G EP++N++G   GNP+T  FSD N+R+ Y +R+G 
Sbjct  209   VSGDSYSGIIIPMVVQEISNGNDEGKEPKMNIQGYTIGNPVTDHFSDFNSRIEYTHRVGI  268

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-----NP--  778
             LSD LY+  KESCNG Y+   P N  C  +L+  T+C  KI    ILEP+C     NP  
Sbjct  269   LSDELYEELKESCNGKYVYVDPSNVECTNNLKVYTQCINKIYSAHILEPSCAMLSPNPNA  328

Query  777   ------------EILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWL  634
                          I L L     P+ WCR  NY+F+Y WAN+K VQKAL VRE  + +W+
Sbjct  329   SKLDRSSLQEINSIGLLLSQPQKPEPWCRSYNYVFSYLWANDKTVQKALHVREA-IKDWV  387

Query  633   RCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIE  454
             RCN +LS          Y  NV ++VDYHR+ T K+ R LIYSGDHDM++P+V T+ WI 
Sbjct  388   RCNESLS----------YTSNVFSSVDYHRNLTKKAYRALIYSGDHDMLIPYVGTQAWIA  437

Query  453   SLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRW  274
             SL + + +DW+PWFV+ QVAG+ ++Y   +Y +T+ATVKGAGHTAPEY+P+E   M+ RW
Sbjct  438   SLNLNISEDWQPWFVDGQVAGFRVEYLHNKYLMTFATVKGAGHTAPEYRPKEGFAMVYRW  497

Query  273   LSIYPL  256
             L+ Y L
Sbjct  498   LAHYFL  503



>ref|XP_009343181.1| PREDICTED: serine carboxypeptidase-like 1 isoform X1 [Pyrus x 
bretschneideri]
Length=470

 Score =   402 bits (1032),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 207/429 (48%), Positives = 275/429 (64%), Gaps = 42/429 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             +QLFYYFIESE SPE D                 L    GPL+ +YA+S G+ P L+LNP
Sbjct  50    VQLFYYFIESEGSPEYDPLVLWLTGGPGCSAFSALVYEIGPLSFDYADSIGNKPKLKLNP  109

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAY-NTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             Y+WTKVANIIFVD PVGTG+SY++T   Y N +DTLSA  TY FL +WL+DHP F NNPL
Sbjct  110   YSWTKVANIIFVDAPVGTGFSYAKTWRGYANMSDTLSAAQTYEFLRKWLMDHPKFFNNPL  169

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMG  940
             Y+ GDSYSGI +PL+V+ I DG      P +N+KG + GNPLT    D N+R+++ Y   
Sbjct  170   YIGGDSYSGIVIPLIVQEISDGNHDDNMPPMNIKGYVLGNPLTDSKKDENSRILFAYLKA  229

Query  939   FLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPEILLS-  763
              +SD LY+S + +CNG+YI+  P+N+ C  DL+   +CTE I + QILEP C    LL  
Sbjct  230   LISDELYQSLQINCNGDYINVDPYNALCLVDLEIYNECTEDIYLGQILEPTCTTVTLLKS  289

Query  762   -------------------LDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTE  640
                                L    L + WCRD NY+F+  WAN++ VQ AL V+EG++ +
Sbjct  290   RGSIWNPNHLSDKDSLNILLTSSKLLRPWCRDYNYIFSEIWANDRTVQDALHVQEGSIED  349

Query  639   WLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKW  460
             W+RCN +L         ++ + +V +++ YH +   +  RVL+YSGDHDM+VP+V T  W
Sbjct  350   WVRCNKSL--------EDSNINDVSSSLVYHENLIKRGYRVLVYSGDHDMVVPYVGTLAW  401

Query  459   IESLKVGVEDDWRPWFVEDQVAGYTMKYSQ-KEYELTYATVKGAGHTAPEYKPRECLPMI  283
             IESL + V+  WRPWFV  Q+AGY+++YS    Y+LT+ T+KGAGHTAPEYKP ECL MI
Sbjct  402   IESLNLTVDSRWRPWFVSGQIAGYSVQYSHITNYKLTFTTIKGAGHTAPEYKPEECLAMI  461

Query  282   QRWLSIYPL  256
              RW + YPL
Sbjct  462   SRWFAYYPL  470



>ref|XP_011030307.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Populus 
euphratica]
Length=484

 Score =   401 bits (1031),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 214/461 (46%), Positives = 284/461 (62%), Gaps = 51/461 (11%)
 Frame = -3

Query  1515  KLCLVSQQNFHSNSILV-----T*VWENLKIQLFYYFIESEKSPEtd------------p  1387
             K  + S   FH N   V       V E   +QLFYYF+ESE+SP+ D             
Sbjct  34    KSIIKSLPGFHGNLPFVLETGYIGVGELEAVQLFYYFVESERSPKDDPLVLWLTGGPGCS  93

Query  1386  lllwltggpgplTINYANSTGD-IPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  1210
              L       GPL+ +YA S+G   P L LNPY+WTK+ANIIFVD PVGTG+SYS T + Y
Sbjct  94    ALSGFIYEIGPLSFDYAKSSGGGKPVLALNPYSWTKIANIIFVDAPVGTGFSYSTTWEGY  153

Query  1209  NTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPR  1030
             + +DTLSA  TY FL +WL+DHP FL NPLYVAGDSYSGI  P++V+ I DG E G +P 
Sbjct  154   DVSDTLSAAETYEFLRKWLVDHPKFLTNPLYVAGDSYSGIVAPIIVQEISDGNEVGRQPT  213

Query  1029  LNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQY  850
             +N+KG + GNP+T    DTN+RV + Y    +SD LY+S  ++C G Y++    N++C  
Sbjct  214   MNLKGYVLGNPVTDDEIDTNSRVPFAYLKALISDKLYESFMKNCKGEYLNPDQSNASCME  273

Query  849   DLQRVTKCTEKINMPQILEPAC------------NPEILLSLDGENL------PQQWCRD  724
             D+  + +C   +   QILEPAC            +P  L++ D + L      P QWCR 
Sbjct  274   DILAIKECIGTVFTGQILEPACKSVSPKPVALKWDPRFLIADDADILLPRPRVPGQWCRS  333

Query  723   DNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHR  544
              N+++ Y WAN++ V+ AL +R+GT+ +W RCN TL+          Y +NVK+TVDYHR
Sbjct  334   YNHVYIYGWANDETVRDALHIRKGTIKDWRRCNKTLA----------YSYNVKSTVDYHR  383

Query  543   SFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKE  364
             + T K  R LIYSGDHDM +P++ T +WIESL + ++ DW PWFV+ QVAGY M Y+   
Sbjct  384   NLTKKPYRALIYSGDHDMTIPYIGTHEWIESLNLTIKYDWEPWFVDGQVAGYAMLYADNA  443

Query  363   -----YELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                  Y+LT+ATVKG GHTAPEY+P +C  M+ RW   YPL
Sbjct  444   QEYITYDLTFATVKGGGHTAPEYRPEQCFAMMDRWFDYYPL  484



>ref|XP_009343180.1| PREDICTED: serine carboxypeptidase-like 1 [Pyrus x bretschneideri]
Length=470

 Score =   400 bits (1029),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 206/429 (48%), Positives = 275/429 (64%), Gaps = 42/429 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             +QLFYYFIESE SPE D                 L    GPL+ +YA+S G+ P L+LNP
Sbjct  50    VQLFYYFIESEGSPEYDPLVLWLTGGPGCSAFSALVYEIGPLSFDYADSIGNKPKLKLNP  109

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAY-NTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             Y+WTKVANIIFVD PVGTG+SY++T   Y N +DTLSA  TY FL +WL+DHP F NNPL
Sbjct  110   YSWTKVANIIFVDAPVGTGFSYAKTWRGYANMSDTLSAAQTYEFLRKWLMDHPKFFNNPL  169

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMG  940
             Y+ GDSYSGI +PL+V+ I DG      P +N+KG + GNPLT    D N+R+++ Y   
Sbjct  170   YIGGDSYSGIVIPLIVQEISDGNHDDNMPPMNIKGYVLGNPLTDSKKDENSRILFAYLKA  229

Query  939   FLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPEILLS-  763
              +SD LY+S + +CNG+YI+  P+N+ C  DL+   +CTE I + QILEP C    LL  
Sbjct  230   LISDELYQSLQINCNGDYINVDPYNALCLVDLEIYNECTEDIYLGQILEPTCTTVTLLKS  289

Query  762   -------------------LDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTE  640
                                L    L + WCRD NY+F+  WAN++ VQ AL V+EG++ +
Sbjct  290   RGSIWNPNHLSDKDSLNILLTSSKLLRPWCRDYNYIFSEIWANDRTVQDALHVQEGSIED  349

Query  639   WLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKW  460
             W+RCN +L         ++ + +V +++ YH +   +  RVL+YSGDHDM+VP+V T  W
Sbjct  350   WVRCNKSL--------EDSNINDVSSSLVYHENLIKRGYRVLVYSGDHDMVVPYVGTLAW  401

Query  459   IESLKVGVEDDWRPWFVEDQVAGYTMKYSQ-KEYELTYATVKGAGHTAPEYKPRECLPMI  283
             IE+L + V+  WRPWFV  Q+AGY+++YS    Y+LT+ T+KGAGHTAPEYKP ECL MI
Sbjct  402   IEALNLTVDSRWRPWFVSGQIAGYSVQYSHITNYKLTFTTIKGAGHTAPEYKPEECLAMI  461

Query  282   QRWLSIYPL  256
              RW + YPL
Sbjct  462   SRWFAYYPL  470



>ref|XP_006422770.1| hypothetical protein CICLE_v10028371mg [Citrus clementina]
 gb|ESR36010.1| hypothetical protein CICLE_v10028371mg [Citrus clementina]
Length=468

 Score =   399 bits (1026),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 212/434 (49%), Positives = 276/434 (64%), Gaps = 43/434 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtdplll------------wltggpgplTINYANSTGDIP  1315
             V EN  +QLFYYFIESE+SPE DPL+L             L    GPL+ +Y NS  + P
Sbjct  45    VGENDNVQLFYYFIESERSPEDDPLVLWLSGGPGCSGFWALAYQLGPLSFDYENSRENSP  104

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L LNPY+WTKVA+IIF+D P GTG+SY +    +  NDTLSA  TY FL +WL+ HP+F
Sbjct  105   KLLLNPYSWTKVASIIFIDAPAGTGFSYVKNWQGFVMNDTLSAVQTYFFLRKWLIAHPSF  164

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L NPLY+ G+SYSG  +P+VV+ I DG++ G EPR+N+KG + GNP+T   SD N R  +
Sbjct  165   LANPLYIFGESYSGKVLPIVVQKISDGIDLGDEPRMNLKGYVLGNPVTDEASDMNFRPQF  224

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
              Y  G ++  +Y+S K +C G Y +A P N  C+ DLQ +T C  K+++  I EP C+ +
Sbjct  225   AYMKGLITHEIYESAKRNCRGEYTNADPSNGLCKADLQNITACIGKLSIQNIYEPQCSLD  284

Query  774   ILL---------------SLDG-----ENLPQQWCRDDNYLFAYSWANNKIVQKALGVRE  655
             IL                S D      ++ P  WCR DNY ++Y+WANNK VQKAL VRE
Sbjct  285   ILRRPVQFIWDRAIIEEDSFDFLYSPVQSAPSHWCRKDNYFYSYNWANNKAVQKALRVRE  344

Query  654   GTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHV  475
             GT+  W RCN +LS          Y  +V + VDYHR  T K  +VL+YSGD DM+VP++
Sbjct  345   GTVEYWTRCNKSLS----------YTSDVSSGVDYHRKLTKKGYQVLVYSGDVDMVVPYM  394

Query  474   STEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQK-EYELTYATVKGAGHTAPEYKPRE  298
             +TE WI+SL + +E  W+PW VE QVAGY  +Y  K  Y LT+ATVKGAGH  PEY+P+E
Sbjct  395   ATEAWIKSLNLTIETGWQPWLVESQVAGYWYRYKGKNNYHLTFATVKGAGHNGPEYRPKE  454

Query  297   CLPMIQRWLSIYPL  256
             CL MI RW + YPL
Sbjct  455   CLAMIDRWFASYPL  468



>ref|XP_010028341.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Eucalyptus 
grandis]
Length=464

 Score =   397 bits (1021),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 210/431 (49%), Positives = 279/431 (65%), Gaps = 40/431 (9%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E  ++QLFYYFIESE+SP+ D              L  L    GPL  +Y++S+ + P
Sbjct  44    VGELQEVQLFYYFIESERSPKDDPLLLWLTGGPGCSALSGLLFEIGPLQFDYSDSSENRP  103

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L+LNPY+WTK+ANIIF+D PVGTG+SY+    AYN++DT SA  TY FL +WL+ HP F
Sbjct  104   VLKLNPYSWTKIANIIFLDAPVGTGFSYATAWRAYNSSDTSSATQTYEFLRKWLMSHPRF  163

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L NPLY+ GDSYSG+ VP++V+ +YDG E+G EP +N+KG + GNP+T    D + R+ +
Sbjct  164   LTNPLYITGDSYSGVVVPIIVKEVYDGNEAGREPPMNLKGYVLGNPVTCEVKDISQRIPF  223

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN--  781
             G++   +SD LY+STK+ CNG+Y++  P N AC  DL+ V+K  EKI + QILEP CN  
Sbjct  224   GHKTALISDELYESTKKDCNGDYVNVDPTNGACLTDLEMVSKRLEKIYLAQILEPICNFM  283

Query  780   ----------PEILLS--LDGENLPQQ---WCRDDNYLFAYSWANNKIVQKALGVREGTM  646
                         IL    ++  ++P Q   WCR+ NYL++Y WAN++ VQ+AL +REGT 
Sbjct  284   SPNHTRLKWSRSILEENIINVVSMPLQSRPWCRNYNYLYSYIWANDRNVQEALHIREGTK  343

Query  645   TEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTE  466
              EW RCN +LS          Y  +V N+V YHR  +  S R LIYSGDHDM +P+V T 
Sbjct  344   PEWDRCNESLS----------YTKDVLNSVVYHRYLSKTSLRALIYSGDHDMAIPYVGTL  393

Query  465   KWIESLKVGVEDDWRPWFVEDQVAGYTMKY-SQKEYELTYATVKGAGHTAPEYKPRECLP  289
              WI SL + +   W PWFV  QVAGY+  Y    +Y+LTY T+KG GHTAPEYKP+EC  
Sbjct  394   DWIRSLNLTLLGMWSPWFVGGQVAGYSTLYVVGMKYDLTYTTIKGGGHTAPEYKPKECFA  453

Query  288   MIQRWLSIYPL  256
             M+ RW S YPL
Sbjct  454   MVDRWFSYYPL  464



>ref|XP_006486897.1| PREDICTED: serine carboxypeptidase-like 17-like [Citrus sinensis]
Length=468

 Score =   397 bits (1020),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 208/434 (48%), Positives = 270/434 (62%), Gaps = 43/434 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V EN  +QLFYYFIESE+SPE D                 L    GPL  +Y NS  + P
Sbjct  45    VGENDDVQLFYYFIESERSPEDDPLVLWLSGGPGCSGFSALAYQLGPLAFDYENSRENSP  104

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L LNPY+WTKVA+IIF+D P GTG+SY +    +  NDTLSA  TY FL +WL+ HP+F
Sbjct  105   KLLLNPYSWTKVASIIFIDAPAGTGFSYVKNWQGFVMNDTLSAVQTYFFLRKWLIAHPSF  164

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L NPLY+ GDSYSG  +P+VV+ I DG++ G EPR+N+KG + GNP+T   SD N R  +
Sbjct  165   LANPLYIFGDSYSGKVLPIVVQKISDGIDLGDEPRMNLKGYLLGNPVTDEASDINFRPQF  224

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
              Y  G ++  +Y+S K +C G Y +  P N  C+ DLQ +T C  K+ +  I E  C+ +
Sbjct  225   AYMKGLITHEIYESAKRNCRGEYTNVDPSNGLCKADLQNITACIGKLCIQNIYESQCSLD  284

Query  774   IL--------------------LSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVRE  655
             IL                    L    ++ P++WCR DNY ++Y+WANNK VQKAL VRE
Sbjct  285   ILRRRVQFIWDRAIIQEDSFDFLYSAVQSAPRRWCRKDNYFYSYNWANNKAVQKALRVRE  344

Query  654   GTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHV  475
             GT+  W RCN +LS          Y ++V + VDYHR  T K  +VL+YSGD DM+VP++
Sbjct  345   GTVEYWTRCNKSLS----------YTYDVSSGVDYHRKLTKKGYQVLVYSGDVDMVVPYM  394

Query  474   STEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQK-EYELTYATVKGAGHTAPEYKPRE  298
             +TE WI+SL + +E  W+PW VE QVAGY  +Y  K  Y LT+ATVKGAGHT  EYKP+E
Sbjct  395   ATEAWIKSLNLTIETGWQPWLVESQVAGYWYRYKGKNNYHLTFATVKGAGHTGLEYKPKE  454

Query  297   CLPMIQRWLSIYPL  256
             CL MI RW + YPL
Sbjct  455   CLAMIYRWFASYPL  468



>gb|KCW55076.1| hypothetical protein EUGRSUZ_I01041 [Eucalyptus grandis]
Length=374

 Score =   392 bits (1006),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 186/382 (49%), Positives = 258/382 (68%), Gaps = 28/382 (7%)
 Frame = -3

Query  1347  INYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSF  1168
              ++++S+G  P L+ NPY+WTKVAN+IF+D PVGTG+SY+ T  AYN +DT SA  TY F
Sbjct  3     FDFSSSSGTKPILKYNPYSWTKVANVIFLDAPVGTGFSYATTDTAYNVSDTSSAAQTYEF  62

Query  1167  LVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTH  988
             L +WL+ HP+FL NPLY+ GDSYSG+ +P++V+NI DG+E+G +P++N+ G   GNP+T 
Sbjct  63    LRKWLVSHPSFLANPLYITGDSYSGVVIPIIVKNIQDGIEAGHQPQMNLVGYTLGNPVTC  122

Query  987   RFSDTNNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINM  808
                D + R+ Y  +M  +SD LY++TK  CNG++ +  P N AC  DL+ V+ C EKI +
Sbjct  123   DEKDMSFRIPYANKMALVSDELYETTKTDCNGDFQNVDPTNGACLTDLEMVSLCLEKIFL  182

Query  807   PQILEPACN-----------PEILLSLDGEN---LPQQ---WCRDDNYLFAYSWANNKIV  679
              Q+LEP+CN              +L  D  N   +P Q   WCR  NY+++Y WAN++ V
Sbjct  183   AQVLEPSCNLISPNHTRLKWSRSILEEDTVNIVSMPHQSRPWCRPANYIYSYIWANDEKV  242

Query  678   QKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGD  499
             Q+ALG+R GT  EW RCNHTLS          Y  +V N V YH   + K+ R L+YSGD
Sbjct  243   QEALGIRTGTKQEWNRCNHTLS----------YTKDVLNAVVYHEYLSEKTLRALVYSGD  292

Query  498   HDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQ-KEYELTYATVKGAGHT  322
             HD+ +P+V+T  WI SL + +E  W PWFVE Q+AGY++ YS+  +Y+LT+ T+KG GHT
Sbjct  293   HDLAIPYVATLDWIRSLNLTLEGSWSPWFVEGQIAGYSILYSKNSKYDLTFTTIKGGGHT  352

Query  321   APEYKPRECLPMIQRWLSIYPL  256
             APEYKP++CL M+ RW S YPL
Sbjct  353   APEYKPKQCLAMVDRWFSYYPL  374



>ref|XP_007201023.1| hypothetical protein PRUPE_ppa005420mg [Prunus persica]
 gb|EMJ02222.1| hypothetical protein PRUPE_ppa005420mg [Prunus persica]
Length=462

 Score =   395 bits (1014),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 195/413 (47%), Positives = 270/413 (65%), Gaps = 31/413 (8%)
 Frame = -3

Query  1443  KIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELN  1300
             ++QLFYYFIESE+SPE D                 L    GP++ ++ + T    +L LN
Sbjct  64    ELQLFYYFIESERSPENDPLLLWITGGPRCSSFSGLVYENGPISFSFTSITKHPVELVLN  123

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             PY+WTK+ANIIF+D P GTG+SYS T+D YNT+DT+ A+    FL +WLL HP FL NPL
Sbjct  124   PYSWTKLANIIFLDAPAGTGFSYSTTTDGYNTSDTIHAKRASEFLQRWLLTHPKFLANPL  183

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMG  940
             Y++GDSYSG  VP++V+ I +G+E+GI P LN++G I GNP+T+R ++ N+++ Y +RM 
Sbjct  184   YISGDSYSGKIVPIIVQEITNGIEAGIGPSLNLEGYIIGNPVTNRKAELNSQIEYAHRMA  243

Query  939   FLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPEILLSL  760
              +S  +++STK +C G+Y+D  P+N  C  +LQ   +C  ++ +  IL PAC P I    
Sbjct  244   LISTRMFESTKRNCKGDYVDVDPNNELCLINLQAFEECISRLEVSHILAPACAPGI----  299

Query  759   DGEN-----LPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAE  595
             D +N      P+Q CR +   ++  WAN+  V KAL +REGT  EW RCN ++       
Sbjct  300   DDDNFLSFPFPEQLCRVERQRYSEVWANDINVPKALNIREGTKAEWARCNSSIP------  353

Query  594   RSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPW  415
                 Y+ +V+++VDYHR+   KS R  +YSGDHD+ VPH+STE WIESL + + DDW+PW
Sbjct  354   ----YIKDVRSSVDYHRNLMQKSLRAFVYSGDHDLKVPHISTEAWIESLSLPIVDDWKPW  409

Query  414   FVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             F  +QVAGY + YS  EY LTYAT+KG GHT PE+ PRE   MI+RWL   PL
Sbjct  410   FSNNQVAGYRVGYSNGEYHLTYATIKGGGHTGPEFNPRESFDMIERWLEHSPL  462



>ref|XP_008236291.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Prunus 
mume]
Length=480

 Score =   394 bits (1013),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 205/429 (48%), Positives = 272/429 (63%), Gaps = 42/429 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEt-------------dplllwltggpgplTINYANSTGDIPDLELN  1300
             +QLFYYF ESE SPE                    +    GPL+ +YA+S G+ P LELN
Sbjct  60    VQLFYYFFESEGSPEYDPLVLWLTGGPGCSAFSAIVYENLGPLSFDYAHSIGNKPKLELN  119

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAY-NTNDTLSAQHTYSFLVQWLLDHPTFLNNP  1123
             PY+WTKVANIIF+D PVGTG+SY++T + Y N NDTLSA  TY FL +WL+DHP F N+P
Sbjct  120   PYSWTKVANIIFLDAPVGTGFSYAKTWEGYSNLNDTLSAAQTYEFLRKWLMDHPKFYNSP  179

Query  1122  LYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRM  943
             LY+AGDSYSGITVP++V+ I DG +    P +N+KG + GNP T    D N +V++ Y  
Sbjct  180   LYIAGDSYSGITVPMLVQEISDGNQDEHVPPMNLKGYVLGNPGTDEKKDNNYQVLFAYLK  239

Query  942   GFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-------  784
               +SD LY+S K++C G YI+   +N+ C  DL+   +C E I+   ILEP+C       
Sbjct  240   ALISDELYQSIKKNCKGEYINVDLNNTLCVEDLELYNECIEGIHSAHILEPSCTIIESPK  299

Query  783   -------------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMT  643
                             + L L    L + WCR  NYL++  W N+K VQ AL ++EG++T
Sbjct  300   SARSKWNGNYFSNKDSVNLLLSFLQLRRPWCRSYNYLYSSIWENDKTVQDALHIQEGSIT  359

Query  642   EWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEK  463
             EW RCN TL         E Y+ +V +++ YH +   +  RVL+YSGDHDM +P+V+T  
Sbjct  360   EWERCNKTLQ--------ELYITDVSSSLVYHENIIKQGYRVLVYSGDHDMDIPYVATMA  411

Query  462   WIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMI  283
             WIESL + V+  W+PWFV+ QVAGY M+Y+ K+Y+LTYAT+KGAGHTAPEYKP EC  MI
Sbjct  412   WIESLNLTVDSPWKPWFVDGQVAGYRMQYTYKKYQLTYATIKGAGHTAPEYKPEECHAMI  471

Query  282   QRWLSIYPL  256
              RW + YPL
Sbjct  472   SRWFAYYPL  480



>ref|XP_006486895.1| PREDICTED: serine carboxypeptidase-like 18-like [Citrus sinensis]
Length=476

 Score =   394 bits (1013),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 205/436 (47%), Positives = 277/436 (64%), Gaps = 45/436 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V EN  +QLFYYFIESE+SPE D                 L    GPL  +Y NS   +P
Sbjct  51    VGENDDVQLFYYFIESERSPEDDPLVLWLTGGPGCSGFSGLVFEIGPLVFDYENSKASLP  110

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
                LN Y+WTKVANIIF+D PVGTG+SY+ + + Y  NDTLSA   Y FL +WL+ H  F
Sbjct  111   RFSLNQYSWTKVANIIFLDAPVGTGFSYANSWEGYIMNDTLSATQIYHFLRKWLIVHSDF  170

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L NPLY+AGDSYSG  VP+VV+ I DG+++G +PR+N+KG + GNP+T    D N+++ +
Sbjct  171   LANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMNLKGYMLGNPVTDDKIDQNSKIQF  230

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
              Y    ++  +YKS K++C G+Y++  P N  C+ DLQ ++ CT  +N   I EP C   
Sbjct  231   AYLNALITYEIYKSAKKNCKGDYVNVDPGNYLCKADLQNISACTGNVNGGNIYEPKCSFV  290

Query  783   NPEI-------------------LLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGV  661
             +P+                    LL L  +  P+ WCR  NYL+A +WAN+K VQ+ALG+
Sbjct  291   SPKPTRLSPRDGSVVEDEEDYLDLLFLPAQPAPKLWCRHQNYLYAPTWANDKTVQRALGI  350

Query  660   REGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVP  481
             +EG + EW RCN +LS          Y  NV +++DYHR+   K  +VLIYSGD DM +P
Sbjct  351   QEGMVKEWRRCNKSLS----------YTTNVLSSLDYHRNLIKKGYQVLIYSGDVDMEIP  400

Query  480   HVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKE-YELTYATVKGAGHTAPEYKP  304
             +V TE WI+SL + ++  W+PW V+ QVAG+ M+Y++K  Y LT+ATVKGAGHTAPEYKP
Sbjct  401   YVGTETWIKSLNLTIDSGWQPWLVDGQVAGFWMRYAEKNLYRLTFATVKGAGHTAPEYKP  460

Query  303   RECLPMIQRWLSIYPL  256
             +ECL MI RW ++YPL
Sbjct  461   KECLEMINRWFAMYPL  476



>gb|KCW55068.1| hypothetical protein EUGRSUZ_I010391, partial [Eucalyptus grandis]
Length=375

 Score =   390 bits (1003),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 190/382 (50%), Positives = 258/382 (68%), Gaps = 28/382 (7%)
 Frame = -3

Query  1347  INYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSF  1168
              +Y+NS+G+ P L+LNPY+WTK+ANIIF+D PVGTG+SY+ T  AY+ +DT SA  TY F
Sbjct  4     FDYSNSSGNRPVLKLNPYSWTKIANIIFLDAPVGTGFSYATTWTAYDNSDTSSAAQTYEF  63

Query  1167  LVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTH  988
             L +WL+ HP FL NPLY+ GDSYSG+ VP++V+ +YDG E+G EP +N+KG + GNP+T 
Sbjct  64    LRKWLMAHPKFLTNPLYITGDSYSGVIVPIIVKEVYDGNEAGREPPMNLKGYVLGNPVTC  123

Query  987   RFSDTNNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINM  808
                D + R+ YG++   +SD LY++TK  CNG+Y++  P N AC  DL+ V+ C EKI +
Sbjct  124   EVKDISQRIPYGHKTALISDELYEATKTDCNGDYVNVDPTNGACLTDLEMVSICLEKIYL  183

Query  807   PQILEPAC------------NPEILLS--LDGENLPQQ---WCRDDNYLFAYSWANNKIV  679
              QILEP C            +  IL    ++  ++P Q   WCR+ NYL++Y WAN++ V
Sbjct  184   AQILEPMCSFLSPNHTKLKWSRSILQENIINVVSMPLQSRPWCRNYNYLYSYIWANDRNV  243

Query  678   QKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGD  499
             Q+AL +REGT  EW RCN +LS          Y  +V N+V YHR  +  S R LIYSGD
Sbjct  244   QEALHIREGTKPEWDRCNESLS----------YTKDVLNSVVYHRYLSKTSLRALIYSGD  293

Query  498   HDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQ-KEYELTYATVKGAGHT  322
             HD+ +P++ T  WI SL + +   W PWFV  QVAGY++ YS+  +Y+LTY T+KG GHT
Sbjct  294   HDLAIPYIGTLDWIRSLNLTLLGPWAPWFVNGQVAGYSILYSKNNKYDLTYTTIKGGGHT  353

Query  321   APEYKPRECLPMIQRWLSIYPL  256
             APEYKP+EC  M+ RW S YPL
Sbjct  354   APEYKPKECFSMVDRWFSYYPL  375



>ref|XP_008236286.1| PREDICTED: serine carboxypeptidase-like 2 isoform X2 [Prunus 
mume]
Length=470

 Score =   394 bits (1012),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 205/428 (48%), Positives = 271/428 (63%), Gaps = 41/428 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEt-------------dplllwltggpgplTINYANSTGDIPDLELN  1300
             +QLFYYF ESE SPE                    +    GPL+ + A+S G+ P L+LN
Sbjct  51    VQLFYYFFESEGSPEYDPLVLWLTGGPGCSAFSAIVYENLGPLSFDSAHSIGNKPKLKLN  110

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAY-NTNDTLSAQHTYSFLVQWLLDHPTFLNNP  1123
             PY+WTKVANIIF+D PVGTG+SY++  + Y N NDT+SA  TY FL +WL+DHP F NNP
Sbjct  111   PYSWTKVANIIFLDAPVGTGFSYAKNWEGYTNLNDTISAAQTYQFLRKWLMDHPKFYNNP  170

Query  1122  LYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRM  943
             LY+AGDSYSGI VP++V+ I DG +    P +N+KG + GNPLT    D N+RV++ Y  
Sbjct  171   LYIAGDSYSGIIVPMLVQEISDGNQDEHAPPMNLKGYVLGNPLTDSEKDDNSRVLFAYLK  230

Query  942   GFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-------  784
               +S+ LY+S K +C G+YI+   +N+ C  DL+   +C E IN  QILEP C       
Sbjct  231   ALISEELYQSMKINCKGDYINVDLNNTLCVDDLELYNECIEDINDVQILEPVCTVHSPKP  290

Query  783   ------------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTE  640
                            + L L    L + WCR   YL +Y WAN+K VQ+AL ++EG++ E
Sbjct  291   AQSKGYADDRTNKDSVNLLLSFPQLRRPWCRSYAYLLSYIWANDKTVQEALHIQEGSIKE  350

Query  639   WLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKW  460
             W RCN TL         E Y+ +V +++ YH +   +  RVL+YSGDHDM VP+V T  W
Sbjct  351   WERCNKTL--------QEFYISDVSSSLVYHENLIKQGYRVLVYSGDHDMNVPYVGTMGW  402

Query  459   IESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQ  280
             IESL + V+  W+PWFV+ QVAGY ++Y+ K+Y+LTYAT+KGAGHTAPEYKP EC  MI 
Sbjct  403   IESLNLTVDSHWKPWFVDGQVAGYRVQYTYKKYQLTYATIKGAGHTAPEYKPEECFAMIS  462

Query  279   RWLSIYPL  256
             RWL+ YPL
Sbjct  463   RWLAYYPL  470



>ref|XP_008236280.1| PREDICTED: serine carboxypeptidase-like 17 isoform X1 [Prunus 
mume]
Length=476

 Score =   393 bits (1010),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 197/423 (47%), Positives = 272/423 (64%), Gaps = 37/423 (9%)
 Frame = -3

Query  1443  KIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELN  1300
             ++QLFYYF ESE+SPE D                 L    GP+  ++   T D  +L LN
Sbjct  64    ELQLFYYFTESERSPENDPLLLWITGGPRCSAFSGLVYEIGPIAFSFTRITKDPVELVLN  123

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             PY+WTK+ANIIF+D P GTG+SYS T+D YNT+DT+ A+    FL +WL  H  FL NPL
Sbjct  124   PYSWTKLANIIFLDAPAGTGFSYSTTTDGYNTSDTIHAKRASEFLRKWLSTHRKFLANPL  183

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMG  940
             Y++GDSYSG  VP++V+ I +G+E+G EP LN+KG + G+P+T+   D N+R+ + +RM 
Sbjct  184   YISGDSYSGKIVPIIVQEIVNGIEAGTEPPLNLKGYVIGDPVTNEKEDLNSRIEFAHRMA  243

Query  939   FLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPEI----  772
              +S+ +Y+STK++C G Y+D  P+N  C  +LQ   +CT +++   IL PAC P I    
Sbjct  244   LISNRMYESTKKNCKGEYVDVDPNNQLCLNNLQSFKECTSRLDDSHILAPACVPRINHNE  303

Query  771   -------LLSLDGENL----PQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCN  625
                      S+D   L    P+  CR D   ++  WAN+  V+KAL +REGT  EW+RCN
Sbjct  304   QTTFGWDWDSVDDNFLSFPFPESLCRADRLRYSVVWANDMEVRKALNIREGTKGEWVRCN  363

Query  624   HTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLK  445
                       R+  Y+ +V+  V+YHR+ + KS R  +YSGDHD+ VP+VSTE WIESL 
Sbjct  364   ----------RTTPYIKDVQRAVEYHRNLSQKSLRAFVYSGDHDLSVPYVSTEAWIESLS  413

Query  444   VGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSI  265
             + ++DDW+PWF  +QVAGYT++YS  +Y LTYAT+KG GHTAPE+ PREC  MI+RWL  
Sbjct  414   LPIDDDWKPWFSNNQVAGYTVRYSNGDYHLTYATIKGGGHTAPEFNPRECFDMIKRWLEH  473

Query  264   YPL  256
              PL
Sbjct  474   SPL  476



>ref|XP_007199819.1| hypothetical protein PRUPE_ppa005264mg [Prunus persica]
 gb|EMJ01018.1| hypothetical protein PRUPE_ppa005264mg [Prunus persica]
Length=470

 Score =   393 bits (1009),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 203/429 (47%), Positives = 272/429 (63%), Gaps = 42/429 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEt-------------dplllwltggpgplTINYANSTGDIPDLELN  1300
             +QLFYYF ESE SPE                    +    GPL+ +YA+S G+ P L+LN
Sbjct  50    VQLFYYFFESEGSPEYDPLVLWLNGGPGCSAFSGLVYENLGPLSFDYAHSIGNKPKLKLN  109

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAY-NTNDTLSAQHTYSFLVQWLLDHPTFLNNP  1123
             PY+WTKVANIIF+D PVGTG+SY++  + Y N NDTLSA  TY FL +WL+DHP F NNP
Sbjct  110   PYSWTKVANIIFLDAPVGTGFSYAKNWEGYSNLNDTLSAAQTYEFLRKWLMDHPKFYNNP  169

Query  1122  LYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRM  943
             LY+AGDSYSGI VP+VV+ I DG +    P +N+KG + GNP+T +  D N +V++ Y  
Sbjct  170   LYIAGDSYSGIIVPMVVQEISDGNQDEHVPPMNLKGYVLGNPVTDKKKDYNYKVLFAYLK  229

Query  942   GFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNP-----  778
               +SD LY+S K++C G YI+   +N+ C  DL+   +C E I+   ILEP+C       
Sbjct  230   ALISDELYQSMKKNCKGEYINVDLNNTLCVEDLELYNECVEGIHSAHILEPSCTTIESPK  289

Query  777   ---------------EILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMT  643
                             + L L    L + WCR  NYL++  W N+K VQ AL ++EG++T
Sbjct  290   SAQSKWNGNYFSNKDSVNLLLSFLQLRRPWCRSYNYLYSSIWENDKTVQDALHIQEGSIT  349

Query  642   EWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEK  463
             EW RCN TL         E Y+ +V +++ YH +   +  RVL+YSGDHDM +P+V+T  
Sbjct  350   EWERCNKTL--------QELYISDVSSSLVYHENLIKQGYRVLVYSGDHDMDIPYVATMA  401

Query  462   WIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMI  283
             WIESL + V+  W+PWFV+ QVAGY ++Y+ K+Y+LTYAT+KGAGHTAPEYKP EC  MI
Sbjct  402   WIESLNLTVDSPWKPWFVDGQVAGYRVQYTYKKYQLTYATIKGAGHTAPEYKPEECHAMI  461

Query  282   QRWLSIYPL  256
              RW + YPL
Sbjct  462   SRWFAYYPL  470



>ref|XP_009375674.1| PREDICTED: serine carboxypeptidase-like 7 [Pyrus x bretschneideri]
Length=462

 Score =   392 bits (1007),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 198/420 (47%), Positives = 263/420 (63%), Gaps = 33/420 (8%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEt-------------dplllwltggpgplTINYANSTGDIPDLELN  1300
             +QLFYYFIESE+SPE                    +    GPL+ +YA+S G+ P L+LN
Sbjct  51    VQLFYYFIESERSPENDPLVLWLTGGPACSGFHTLVYVNIGPLSFDYAHSIGNKPKLKLN  110

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             PY+WTKVANIIF+D PVGTG+SY+ T   YN +DT  A  TY FL +WL+DHP FLNNPL
Sbjct  111   PYSWTKVANIIFIDAPVGTGFSYATTWKGYNISDTSHAAQTYQFLRKWLVDHPKFLNNPL  170

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVV-YGYRM  943
             Y+ G SYSGI VP+VV+ I DG E G+ P +N+KG + GNP  H      N VV + +  
Sbjct  171   YIGGASYSGIVVPVVVQEIADGNEKGVAPAMNLKGYVLGNPAIHSAHRYRNYVVPFSHLK  230

Query  942   GFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-------  784
               +SD LY+STK +C G YID  P N +C  DL  V +C + IN   ILEP C       
Sbjct  231   ALISDELYQSTKTNCKGEYIDVDPDNDSCLEDLDLVKECVKDINDVNILEPKCIDSSPTP  290

Query  783   ----NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTL  616
                 N  + L L    LP+QWCR DNY+F+  WAN+K V+ AL +REG++ EW RCN +L
Sbjct  291   NHLSNDSVKLLLPFSQLPRQWCRKDNYIFSDIWANDKAVRNALHIREGSIEEWARCNTSL  350

Query  615   SGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGV  436
                       +++ ++ +++ Y  +   +  RVL+YSGD DM VP+++T  WIESL + V
Sbjct  351   --------QTSFIHDIASSLIYLENLIKQGYRVLVYSGDQDMNVPYMATIAWIESLNLTV  402

Query  435   EDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                W+PW V  QVAGY ++Y+ + Y+LT+ T+KG GH APEYKP ECL M+ RW + YPL
Sbjct  403   ASHWKPWLVNGQVAGYRVQYTHESYQLTHTTIKGGGHAAPEYKPEECLAMVSRWFAYYPL  462



>ref|XP_006486896.1| PREDICTED: serine carboxypeptidase-like 18-like [Citrus sinensis]
Length=470

 Score =   392 bits (1006),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 204/436 (47%), Positives = 272/436 (62%), Gaps = 45/436 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPE------------tdplllwltggpgplTINYANSTGDIP  1315
             V +N  +QLFYYFIESE+SPE                   L    GPL+ +Y  S  ++P
Sbjct  45    VGQNDDVQLFYYFIESERSPEDDPLVLWLTGGPGCSGFSGLVFEIGPLSFDYEKSKVNLP  104

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
                LNPY+WTKVAN+IF+D PVGTG+SY+ T   Y  NDTLSA   Y FL +WL+ HP+F
Sbjct  105   KFLLNPYSWTKVANVIFLDAPVGTGFSYANTWQGYIMNDTLSAAQNYYFLRKWLIAHPSF  164

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L NPLY+ GDSYSGI VP++V+++ DG++ G  PR+N+KG + GNPLT    + N+   +
Sbjct  165   LANPLYIGGDSYSGIIVPMIVQHVSDGIDVGHRPRMNLKGYLLGNPLTDSTENQNSVPHF  224

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
              Y    +S  +Y+S K +C G Y+   P N  C  DL+ +T+C  ++N  QI EP+C   
Sbjct  225   AYLNALISHEIYESAKRNCKGEYVKVDPSNGLCIADLENITECISRVNHAQIYEPSCRGP  284

Query  774   ILL----------------SLDGENLPQQ------WCRDDNYLFAYSWANNKIVQKALGV  661
             I+                 SLD  + P Q      WCR  NY+++Y WAN+K VQ A+GV
Sbjct  285   IISPRRKLFNWNSSVLEEDSLDFLSSPTQPAASGTWCRFHNYVYSYIWANDKTVQSAIGV  344

Query  660   REGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVP  481
             REGT+  W+RCN +LS          Y  +V +++ YHR+   K  +VLIYSGD DM VP
Sbjct  345   REGTVKYWVRCNQSLS----------YTKDVSSSLAYHRNLIKKGYQVLIYSGDVDMKVP  394

Query  480   HVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQK-EYELTYATVKGAGHTAPEYKP  304
             +V+TE WI+SL + +E  W+PWFVE QVAGY  +Y +K  Y LT+ATVKGAGHTAPEYKP
Sbjct  395   YVATEAWIKSLSLTIETGWQPWFVEGQVAGYWYRYKEKNNYHLTFATVKGAGHTAPEYKP  454

Query  303   RECLPMIQRWLSIYPL  256
             +ECL MI RW + +PL
Sbjct  455   KECLAMIDRWFACHPL  470



>ref|XP_008236287.1| PREDICTED: serine carboxypeptidase-like 13 [Prunus mume]
Length=480

 Score =   392 bits (1007),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 203/429 (47%), Positives = 271/429 (63%), Gaps = 42/429 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEt-------------dplllwltggpgplTINYANSTGDIPDLELN  1300
             +QLFYYF ESE SPE                    +    GPL+ +YA+S G+ P L+LN
Sbjct  60    VQLFYYFFESEGSPEYDPLVLWLTGGPGCSAFSALVYENLGPLSFDYAHSIGNKPKLKLN  119

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAY-NTNDTLSAQHTYSFLVQWLLDHPTFLNNP  1123
             PY+WTKVANIIF+D PVGTG+SY++  + Y N NDTLSA  TY FL +WL+DHP F NNP
Sbjct  120   PYSWTKVANIIFLDAPVGTGFSYAKNWEGYSNLNDTLSAAQTYEFLRKWLMDHPKFYNNP  179

Query  1122  LYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRM  943
             LY+AGDSYSGI VP+VV+ I DG +    P +N+KG + GNP+T +  D N +V++ Y  
Sbjct  180   LYIAGDSYSGIIVPMVVQEISDGNQDEHVPPMNLKGYVLGNPVTDKKKDYNYKVLFAYLK  239

Query  942   GFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-------  784
               +SD LY+S K++C G YI+   +N+ C  DL+   +C E I+   ILEP+C       
Sbjct  240   ALISDELYQSIKKNCKGEYINVDLNNTLCVEDLELYNECIEGIHSAHILEPSCTIIESPK  299

Query  783   -------------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMT  643
                             + L L    L + WCR  NYL++  W N+K VQ AL ++EG++T
Sbjct  300   SARSKWNGNYFSNKDSVNLLLSFLQLRRPWCRSYNYLYSSIWENDKTVQDALHIQEGSIT  359

Query  642   EWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEK  463
             EW RCN TL         E Y  +V +++ YH +   +  RVL+YSGDHDM +P+V+T  
Sbjct  360   EWERCNKTL--------QELYTSDVSSSLVYHENIIKQGYRVLVYSGDHDMDIPYVATMA  411

Query  462   WIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMI  283
             WIESL + V+  W+PWFV+ QVAGY ++Y+ K+Y+LTYAT+KGAGHTAPEYKP EC  MI
Sbjct  412   WIESLNLTVDSPWKPWFVDGQVAGYRVQYTYKKYQLTYATIKGAGHTAPEYKPEECHAMI  471

Query  282   QRWLSIYPL  256
              RW + YPL
Sbjct  472   SRWFAYYPL  480



>ref|XP_002298786.2| hypothetical protein POPTR_0001s29870g [Populus trichocarpa]
 gb|EEE83591.2| hypothetical protein POPTR_0001s29870g [Populus trichocarpa]
Length=469

 Score =   391 bits (1005),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 204/437 (47%), Positives = 275/437 (63%), Gaps = 46/437 (11%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGD-I  1318
             V E   +QLFYYFIESE+SP+ D              L  L    GPL+ +YA S+G   
Sbjct  43    VGELEAVQLFYYFIESERSPKDDPLVLWLTGGPGCSALSGLIYEIGPLSFDYAKSSGGGK  102

Query  1317  PDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPT  1138
             P   LNPY+WTK+ANIIFVD PVGTG+SYS T + Y+ +DT+SA  TY FL +WL+DHP 
Sbjct  103   PVFALNPYSWTKIANIIFVDAPVGTGFSYSTTGEGYHVSDTISAAETYEFLRKWLVDHPK  162

Query  1137  FLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVV  958
             FL NPLYVAGDS+SGI  P++V+ I DG E G +P +N+KG + GNP+T    DTN+ V 
Sbjct  163   FLTNPLYVAGDSFSGIVAPIIVQEISDGNEVGRQPTINLKGYVLGNPVTDHEIDTNSIVP  222

Query  957   YGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC--  784
             + +    +SD LY+S  ++C G Y++    N++C  D+  + +C   +   QILEPAC  
Sbjct  223   FAHLKALISDKLYESFMKNCKGEYLNPDQSNASCMEDILAIKECIGNVFTGQILEPACKE  282

Query  783   ----------NPEILLSLDGENL------PQQWCRDDNYLFAYSWANNKIVQKALGVREG  652
                       +P  L++ D + L      P  WCR  NY++ Y WAN++ V+ AL +R+G
Sbjct  283   ISPKPVALKWDPRFLIADDADILLSRPRVPGPWCRSYNYVYIYMWANDETVRDALHIRKG  342

Query  651   TMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVS  472
             T+ +W RCN TL+          Y +NV++TVDYHR+ T K  R LIYSGDHDM +P++ 
Sbjct  343   TIKDWRRCNKTLA----------YSYNVESTVDYHRNLTKKPYRALIYSGDHDMTIPYIG  392

Query  471   TEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQK-----EYELTYATVKGAGHTAPEYK  307
             T +WIESL + ++ DW PWFV+ QVAGY M Y+        Y+LT+ATVKG GHTAPEY+
Sbjct  393   THEWIESLNLTIKYDWEPWFVDGQVAGYAMLYADNVQDYITYDLTFATVKGGGHTAPEYR  452

Query  306   PRECLPMIQRWLSIYPL  256
             P +C  M+ RW   YPL
Sbjct  453   PEQCFAMMDRWFDYYPL  469



>ref|XP_009343182.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Pyrus 
x bretschneideri]
Length=407

 Score =   389 bits (999),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 189/386 (49%), Positives = 255/386 (66%), Gaps = 30/386 (8%)
 Frame = -3

Query  1347  INYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY-NTNDTLSAQHTYS  1171
              +YA+S G+ P L+LNPY+WTKVANIIFVD PVGTG+SY++T   Y N +DTLSA  TY 
Sbjct  30    FDYADSIGNKPKLKLNPYSWTKVANIIFVDAPVGTGFSYAKTWRGYANMSDTLSAAQTYE  89

Query  1170  FLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLT  991
             FL +WL+DHP F NNPLY+ GDSYSGI +PL+V+ I DG      P +N+KG + GNPLT
Sbjct  90    FLRKWLMDHPKFFNNPLYIGGDSYSGIVIPLIVQEISDGNHDDNMPPMNIKGYVLGNPLT  149

Query  990   HRFSDTNNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKIN  811
                 D N+R+++ Y    +SD LY+S + +CNG+YI+  P+N+ C  DL+   +CTE I 
Sbjct  150   DSKKDENSRILFAYLKALISDELYQSLQINCNGDYINVDPYNALCLVDLEIYNECTEDIY  209

Query  810   MPQILEPACNPEILLS--------------------LDGENLPQQWCRDDNYLFAYSWAN  691
             + QILEP C    LL                     L    L + WCRD NY+F+  WAN
Sbjct  210   LGQILEPTCTTVTLLKSRGSIWNPNHLSDKDSLNILLTSSKLLRPWCRDYNYIFSEIWAN  269

Query  690   NKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLI  511
             ++ VQ AL V+EG++ +W+RCN +L         ++ + +V +++ YH +   +  RVL+
Sbjct  270   DRTVQDALHVQEGSIEDWVRCNKSL--------EDSNINDVSSSLVYHENLIKRGYRVLV  321

Query  510   YSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQ-KEYELTYATVKG  334
             YSGDHDM+VP+V T  WIESL + V+  WRPWFV  Q+AGY+++YS    Y+LT+ T+KG
Sbjct  322   YSGDHDMVVPYVGTLAWIESLNLTVDSRWRPWFVSGQIAGYSVQYSHITNYKLTFTTIKG  381

Query  333   AGHTAPEYKPRECLPMIQRWLSIYPL  256
             AGHTAPEYKP ECL MI RW + YPL
Sbjct  382   AGHTAPEYKPEECLAMISRWFAYYPL  407



>ref|XP_010028345.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW55077.1| hypothetical protein EUGRSUZ_I01042 [Eucalyptus grandis]
Length=464

 Score =   390 bits (1003),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 200/431 (46%), Positives = 279/431 (65%), Gaps = 40/431 (9%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E  ++QLFYYFIESE+SP+ D              L  L    GP+  ++++S+G  P
Sbjct  44    VGELEEVQLFYYFIESERSPKDDPLLLWLTGGPGCSSLSGLIYEIGPMQFDFSSSSGTKP  103

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L+ NPY+WTK+ANIIF+D PVGTG+SY+ T  AYN +DT SA  TY FL +WL+ +P+F
Sbjct  104   ILKYNPYSWTKIANIIFLDAPVGTGFSYATTPTAYNISDTSSAAQTYEFLRKWLVSYPSF  163

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L NPLYV+GDSYSG+ +P+VV+NI DG+E+G +P++N+ G   GNP+T    D + R+  
Sbjct  164   LANPLYVSGDSYSGVVIPIVVKNIQDGIEAGRQPQMNLVGYTLGNPVTCEKKDKSFRIPQ  223

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN--  781
               +M  +SD LY++TK  CNG++ +  P N AC  DL+ V+ C EKI   QILEP+C+  
Sbjct  224   ANKMALVSDELYETTKTDCNGDFQNVDPTNGACLTDLEMVSLCLEKIFFLQILEPSCSLI  283

Query  780   ---------PEILLSLDGENL------PQQWCRDDNYLFAYSWANNKIVQKALGVREGTM  646
                         +L  D  N+       + WCR  NY+++Y WAN++ V++ALGVREGT 
Sbjct  284   SPNHTRLKWSRSILEEDTVNVVSMLQQSKPWCRSYNYIYSYIWANDEKVREALGVREGTT  343

Query  645   TEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTE  466
              EW RC+ TLS          Y  +V + V YH   + K+ R L+YSGDHD+ +P+++T 
Sbjct  344   QEWTRCSSTLS----------YTKDVLDAVVYHEYLSEKTLRALVYSGDHDLAIPYMATL  393

Query  465   KWIESLKVGVEDDWRPWFVEDQVAGYTMKY-SQKEYELTYATVKGAGHTAPEYKPRECLP  289
              WI SL + +E  W PWFVE Q+AGY++ Y    +Y+LT+ T+KGAGHTAPEYKP++CL 
Sbjct  394   NWIRSLNLTLEGSWSPWFVEGQIAGYSILYLKNSKYDLTFTTIKGAGHTAPEYKPKQCLA  453

Query  288   MIQRWLSIYPL  256
             M+ RW S YPL
Sbjct  454   MVDRWFSYYPL  464



>ref|XP_006422777.1| hypothetical protein CICLE_v10028360mg [Citrus clementina]
 gb|ESR36017.1| hypothetical protein CICLE_v10028360mg [Citrus clementina]
Length=470

 Score =   390 bits (1003),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 205/436 (47%), Positives = 274/436 (63%), Gaps = 45/436 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V +N  +QLFYYFIESE+SPE D                 L    GPL+ +Y  S  ++P
Sbjct  45    VGQNDDVQLFYYFIESERSPEDDPLVLWLSGGPGCSGFSGLVFEIGPLSFDYEKSKVNLP  104

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
                LNPY+WTKVANIIF+D PVGTG+SY+ T   Y  NDTLSA   Y FL +WL+ HP+F
Sbjct  105   KFLLNPYSWTKVANIIFLDAPVGTGFSYANTWQGYIMNDTLSAAQNYYFLRKWLIAHPSF  164

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L NPLY+ GDSYSGI VP++V++I DG++ G  PR+N+KG + GNPLT    + N+   +
Sbjct  165   LANPLYIGGDSYSGIIVPMIVQHISDGIDVGHRPRMNLKGYLLGNPLTDSTENQNSVPHF  224

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
              Y    +S  +Y+S K +C G Y++  P N  C  DL+ +T+C  ++N  QI EP+C   
Sbjct  225   AYLNALISHEIYESAKRNCQGEYVNVDPSNGLCIADLENITECISRVNHAQIYEPSCRGP  284

Query  774   ILL----------------SLDGENLPQQ------WCRDDNYLFAYSWANNKIVQKALGV  661
              +                 SLD  + P Q      WCR  NY+++Y WAN+K VQ+A+GV
Sbjct  285   FISPRRKLFNWNRSIIEEDSLDFLSSPTQPAASGTWCRFHNYVYSYIWANDKTVQRAIGV  344

Query  660   REGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVP  481
             +EGT+  W+RCN +LS          Y  +V +++ YHR+   K  +VLIYSGD DM VP
Sbjct  345   QEGTVKYWVRCNQSLS----------YTKDVSSSLAYHRNLIKKGYQVLIYSGDVDMKVP  394

Query  480   HVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQK-EYELTYATVKGAGHTAPEYKP  304
             +V+TE WI+SL + +E  W+PWFVE QVAGY  +Y +K  Y LT+ATVKGAGHTAPEYKP
Sbjct  395   YVATEAWIKSLNLTIETGWQPWFVEGQVAGYWYRYKEKNNYHLTFATVKGAGHTAPEYKP  454

Query  303   RECLPMIQRWLSIYPL  256
             +ECL MI RW + +PL
Sbjct  455   KECLGMIDRWFACHPL  470



>ref|XP_009343914.1| PREDICTED: serine carboxypeptidase-like 7 [Pyrus x bretschneideri]
Length=462

 Score =   390 bits (1002),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 197/420 (47%), Positives = 262/420 (62%), Gaps = 33/420 (8%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEt-------------dplllwltggpgplTINYANSTGDIPDLELN  1300
             +QLFYYFIESE+SPE                    +    GPL+ +YA+S G+ P L+LN
Sbjct  51    VQLFYYFIESERSPENDPLVLWLTGGPACSGFHTLVYVNIGPLSFDYAHSIGNKPKLKLN  110

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             PY+WTKVANIIF+D PVGTG+SY+ T   YN +DT  A  TY FL +WL+DHP FLNNPL
Sbjct  111   PYSWTKVANIIFIDAPVGTGFSYATTWKGYNISDTSHAAQTYQFLRKWLVDHPKFLNNPL  170

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVV-YGYRM  943
             Y+ G SYSGI VP+VV+ I DG E G+ P +N+KG + GNP  H      N VV + +  
Sbjct  171   YIGGASYSGIVVPVVVQEIADGNEKGVAPAMNLKGYVLGNPAIHSAHRYRNYVVPFSHLK  230

Query  942   GFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-------  784
               +SD LY+STK +C G YID  P N +C  DL  V +C + IN   ILEP C       
Sbjct  231   ALISDELYQSTKTNCKGEYIDVDPDNDSCLEDLDLVKECVKDINDVNILEPKCIDSSPTP  290

Query  783   ----NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTL  616
                 N  + L L    LP+QWCR DNY+F+  WAN+K V+ AL +REG++ EW RCN ++
Sbjct  291   NHLSNDSVKLLLPFSQLPRQWCRKDNYIFSDIWANDKAVRNALHIREGSIEEWARCNTSV  350

Query  615   SGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGV  436
                       +++ ++ +++ Y  +   +  RVL+YSGD DM VP+++T  WIESL + V
Sbjct  351   --------QTSFIHDIASSLIYLENLIKQGYRVLVYSGDQDMNVPYMATIAWIESLNLTV  402

Query  435   EDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                W PW V  QVAGY ++Y+ + Y+LT+ T+KG GH APEYKP ECL M+ RW + YPL
Sbjct  403   ASHWNPWLVNGQVAGYRVQYTHESYQLTHTTIKGGGHAAPEYKPEECLAMVSRWFAYYPL  462



>ref|XP_011030310.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Populus 
euphratica]
Length=484

 Score =   390 bits (1001),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 209/461 (45%), Positives = 282/461 (61%), Gaps = 51/461 (11%)
 Frame = -3

Query  1515  KLCLVSQQNFHSNSILV-----T*VWENLKIQLFYYFIESEKSPEtd------------p  1387
             K  + S   FH N   V       V E   +QLFYYF+ESE+SP+ D             
Sbjct  34    KSIIKSLPGFHGNLPFVLETGYIGVGELEAVQLFYYFVESERSPKDDPLVLWLTGGPGCS  93

Query  1386  lllwltggpgplTINYANSTGD-IPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  1210
              L       GPL+ +YA S+G   P L LNPY+WTK+ANIIFVD PVGTG+SYS T + Y
Sbjct  94    ALSGFIYEIGPLSFDYAKSSGGGKPVLALNPYSWTKIANIIFVDAPVGTGFSYSTTWEGY  153

Query  1209  NTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPR  1030
             + +DTLSA  TY FL +WL+DHP FL NPLYVAGDSYSGI  P++V+ I DG E G +P 
Sbjct  154   DVSDTLSAAETYEFLRKWLVDHPKFLTNPLYVAGDSYSGIVAPIIVQEISDGNEVGRQPT  213

Query  1029  LNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQY  850
             +N+KG + GNPLT    DTN+ V + Y    +SD LY+S  ++C G Y++    N++C  
Sbjct  214   MNLKGYVLGNPLTDHEIDTNSIVPFAYLKALISDKLYESFMKNCKGEYLNPDQSNASCME  273

Query  849   DLQRVTKCTEKINMPQILEPAC------------NPEILLSLDGENL---PQ---QWCRD  724
             D+  + +C   +   QILEP C            +P  L++ D + L   P+    WCR 
Sbjct  274   DILAIKECIGDLYTAQILEPTCKLISPKPVALKWDPRFLIADDADILLSSPRVHGHWCRS  333

Query  723   DNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHR  544
              N+++ Y WAN++ V+ AL +R+GT+ +W RCN TL+          Y +NV++ VDYHR
Sbjct  334   YNHVYIYGWANDETVRDALHIRKGTIKDWRRCNKTLA----------YSYNVESAVDYHR  383

Query  543   SFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKE  364
             + T K  R LIYSGDHD+I+P++ T +WIESL + ++ DW PWFV+ QVAGY M Y+   
Sbjct  384   NLTKKPYRALIYSGDHDIIIPYIGTHEWIESLNLTIKHDWEPWFVDGQVAGYAMLYADNA  443

Query  363   -----YELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                  Y+L++ATVKG GHTAPEY+P +C  M+ RW   YPL
Sbjct  444   QEYITYDLSFATVKGGGHTAPEYRPEQCFAMMDRWFDYYPL  484



>ref|XP_008236285.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Prunus 
mume]
Length=472

 Score =   389 bits (999),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 205/430 (48%), Positives = 271/430 (63%), Gaps = 43/430 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEt-------------dplllwltggpgplTINYANSTGDIPDLELN  1300
             +QLFYYF ESE SPE                    +    GPL+ + A+S G+ P L+LN
Sbjct  51    VQLFYYFFESEGSPEYDPLVLWLTGGPGCSAFSAIVYENLGPLSFDSAHSIGNKPKLKLN  110

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAY-NTNDTLSAQHTYSFLVQWLLDHPTFLNNP  1123
             PY+WTKVANIIF+D PVGTG+SY++  + Y N NDT+SA  TY FL +WL+DHP F NNP
Sbjct  111   PYSWTKVANIIFLDAPVGTGFSYAKNWEGYTNLNDTISAAQTYQFLRKWLMDHPKFYNNP  170

Query  1122  LYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRM  943
             LY+AGDSYSGI VP++V+ I DG +    P +N+KG + GNPLT    D N+RV++ Y  
Sbjct  171   LYIAGDSYSGIIVPMLVQEISDGNQDEHAPPMNLKGYVLGNPLTDSEKDDNSRVLFAYLK  230

Query  942   GFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-------  784
               +S+ LY+S K +C G+YI+   +N+ C  DL+   +C E IN  QILEP C       
Sbjct  231   ALISEELYQSMKINCKGDYINVDLNNTLCVDDLELYNECIEDINDVQILEPVCTVHSPKP  290

Query  783   ------------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVRE--GTM  646
                            + L L    L + WCR   YL +Y WAN+K VQ+AL ++E  G++
Sbjct  291   AQSKGYADDRTNKDSVNLLLSFPQLRRPWCRSYAYLLSYIWANDKTVQEALHIQENQGSI  350

Query  645   TEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTE  466
              EW RCN TL         E Y+ +V +++ YH +   +  RVL+YSGDHDM VP+V T 
Sbjct  351   KEWERCNKTL--------QEFYISDVSSSLVYHENLIKQGYRVLVYSGDHDMNVPYVGTM  402

Query  465   KWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPM  286
              WIESL + V+  W+PWFV+ QVAGY ++Y+ K+Y+LTYAT+KGAGHTAPEYKP EC  M
Sbjct  403   GWIESLNLTVDSHWKPWFVDGQVAGYRVQYTYKKYQLTYATIKGAGHTAPEYKPEECFAM  462

Query  285   IQRWLSIYPL  256
             I RWL+ YPL
Sbjct  463   ISRWLAYYPL  472



>ref|XP_006422773.1| hypothetical protein CICLE_v10028648mg [Citrus clementina]
 gb|ESR36013.1| hypothetical protein CICLE_v10028648mg [Citrus clementina]
Length=383

 Score =   385 bits (988),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 190/385 (49%), Positives = 249/385 (65%), Gaps = 31/385 (8%)
 Frame = -3

Query  1347  INYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSF  1168
              +Y NS  +   L LNPY+WTKVA+IIF+D P GTG+SY +    +  NDTLSA  TY F
Sbjct  9     FDYENSRENSSKLLLNPYSWTKVASIIFIDAPAGTGFSYVKNWQGFVMNDTLSAVQTYFF  68

Query  1167  LVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTH  988
             L +WL+ HP+FL NPLY+ GDSYSG  +P+VV+ I DG++ G EPR+N+KG + GNP+T 
Sbjct  69    LRKWLIAHPSFLANPLYIFGDSYSGKVLPIVVQKISDGIDLGDEPRMNLKGYLLGNPVTD  128

Query  987   RFSDTNNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINM  808
                DTN R  + Y  G ++  +Y+S K +C G Y +A P N  C+ DLQ +T C  K+ +
Sbjct  129   EALDTNFRPQFAYMKGLITHEIYESAKRNCRGEYTNADPSNGLCKADLQNITACIGKLCI  188

Query  807   PQILEPACNPEILL---------------SLDG-----ENLPQQWCRDDNYLFAYSWANN  688
               I EP C+ +IL                S D      ++ P+ WCR DNY ++Y+WANN
Sbjct  189   QNIYEPQCSLDILRRPVQFMWDRAIIEEDSFDFLYSPVQSAPRHWCRKDNYFYSYNWANN  248

Query  687   KIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIY  508
             K VQKAL VREGT+  W RCN +LS          Y ++V + VDYHR  T K  +VL+Y
Sbjct  249   KAVQKALRVREGTVEYWTRCNKSLS----------YTYDVSSGVDYHRKLTKKGYQVLVY  298

Query  507   SGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQK-EYELTYATVKGA  331
             SGD DM+VP+++TE WI+SL + +E  W+PW VE QVAGY  +Y  K  Y LT+ATVKGA
Sbjct  299   SGDVDMVVPYMATEAWIKSLNLTIETGWQPWLVESQVAGYWYRYKGKNNYHLTFATVKGA  358

Query  330   GHTAPEYKPRECLPMIQRWLSIYPL  256
             GHT PEYKP+ECL MI RW + YPL
Sbjct  359   GHTGPEYKPKECLAMIDRWFASYPL  383



>ref|XP_008236275.1| PREDICTED: serine carboxypeptidase-like 17 isoform X1 [Prunus 
mume]
Length=461

 Score =   387 bits (995),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 192/408 (47%), Positives = 266/408 (65%), Gaps = 31/408 (8%)
 Frame = -3

Query  1443  KIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELN  1300
             ++QLFYYFIESE+SPE D                 L    GP++ ++ + T    +L LN
Sbjct  64    ELQLFYYFIESERSPENDPLLLWITGGPRCSGFSGLVYENGPISFSFTSITKHPVELVLN  123

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             PY+WTK+ANIIF+D P GTG+SYS T+D YNT+DT+ A+    F+ +WLL HP FL NPL
Sbjct  124   PYSWTKLANIIFLDAPAGTGFSYSTTTDGYNTSDTIHAKRASEFVQRWLLTHPKFLANPL  183

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMG  940
             Y++GDSYSG  VP++V++I +G+E+GI P LN+KG + GNP+T+R  + N+++ Y +RM 
Sbjct  184   YISGDSYSGKIVPIIVQDITNGIEAGISPFLNLKGYVIGNPVTNRKEELNSQIEYAHRMA  243

Query  939   FLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPEILLSL  760
              +S  +++STK +C G+YID  P+N  C  +LQ   +C  +I    IL PAC P +    
Sbjct  244   LISTRMFESTKRNCKGDYIDVDPNNELCLNNLQAFEECISRIEESHILAPACAPGV----  299

Query  759   DGEN-----LPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAE  595
             D +N      P+Q CR +   ++  WAN+  V+KAL +REGT  EW RCN ++       
Sbjct  300   DDDNFLSFPFPEQLCRVERQRYSEVWANDMNVRKALNIREGTKAEWARCNSSIP------  353

Query  594   RSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPW  415
                 Y+ +V ++V YHR+   KS R  +YSGDHD+ VPH+STE WIESL + + DDW+PW
Sbjct  354   ----YIKDVHSSVYYHRNLMQKSLRAFVYSGDHDLKVPHISTEAWIESLSLPIVDDWKPW  409

Query  414   FVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
             F  +QVAGY + YS  EY LTYAT+KG GHT PE+ PRE   MI+RWL
Sbjct  410   FSNNQVAGYRVGYSNGEYHLTYATIKGGGHTGPEFNPRESFDMIERWL  457



>ref|XP_002265842.1| PREDICTED: serine carboxypeptidase-like 18 [Vitis vinifera]
Length=491

 Score =   385 bits (988),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 196/430 (46%), Positives = 268/430 (62%), Gaps = 45/430 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             ++LFYYFIESE+ P  D                 L    GPL  NY    G +P LELNP
Sbjct  72    VELFYYFIESERDPARDPLILWLTGGPGCSGFSGLVYEIGPLRFNYTAFNGSLPSLELNP  131

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTKVA+IIF+D PVGTG+SY+   D Y  +DT+SA+  Y F+ +WL+DHP FL NPLY
Sbjct  132   YSWTKVASIIFLDAPVGTGFSYATNPDDYYASDTISARDNYIFIRKWLIDHPRFLYNPLY  191

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             + GDSYSGI VP++   I +G++ G++P + + G I GNP+TH  +D N+R+ + +R+  
Sbjct  192   IGGDSYSGIIVPILTLEIANGIQMGLKPLMTLMGYILGNPVTHLHNDENSRIPFAHRIAL  251

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPEI-----  772
             +SD LY+S K +C G +ID    N  C   L  +TKCTEK+N   ILEP C  +      
Sbjct  252   ISDELYESAKNACKGEFIDPDESNGECMEVLAVITKCTEKLNSAHILEPVCALDSPKPKE  311

Query  771   ----------------LLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTE  640
                             ++SL      + WCR+ NYL +Y W N++ VQ+AL VR GT+  
Sbjct  312   SKLKWSLNHIEDVSSDMISLPVPQRSELWCRNYNYLLSYIWENDEAVQEALHVRNGTIPF  371

Query  639   WLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKW  460
             W RCN TL           Y  NV +TV YHR+ ++   R LIYSGDHDM++P+V TE+W
Sbjct  372   WKRCNKTLD----------YDSNVVSTVPYHRNLSDLGYRALIYSGDHDMLIPYVGTERW  421

Query  459   IESLKVGVEDDWRPWFVEDQVAGYTMKY--SQKEYELTYATVKGAGHTAPEYKPRECLPM  286
             ++SL + V + W PWFV+ QVAGY++ Y  ++ E ++TYATVKG GHTAPE++P++CL M
Sbjct  422   VKSLNISVLNGWEPWFVDGQVAGYSVVYQANKTESDITYATVKGGGHTAPEFRPKQCLAM  481

Query  285   IQRWLSIYPL  256
             I RWL+ YPL
Sbjct  482   IDRWLAFYPL  491



>ref|XP_006422780.1| hypothetical protein CICLE_v10028349mg [Citrus clementina]
 gb|ESR36020.1| hypothetical protein CICLE_v10028349mg [Citrus clementina]
Length=476

 Score =   384 bits (986),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 200/436 (46%), Positives = 275/436 (63%), Gaps = 45/436 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V ++  +QLFYYFIESE+SPE D                 L    GPL  +Y +S   +P
Sbjct  51    VGDDDDVQLFYYFIESERSPEDDPLVLWLTGGPGCSGFSGLVFEIGPLVFDYESSRPSLP  110

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
                LN Y+WTKVAN+IF+D PVGTG+SY+ +   Y  NDTLSA   Y FL +WL+ H  F
Sbjct  111   RFSLNQYSWTKVANVIFLDAPVGTGFSYANSWQGYIMNDTLSATQIYHFLRKWLVVHSDF  170

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L NPLY+AGDSYSG  VP+VV+ I DG+++G +PR+N+KG + GNP+T    D N+++ +
Sbjct  171   LANPLYIAGDSYSGKIVPIVVQEISDGIDAGHKPRMNLKGYMLGNPVTDDKIDQNSKIQF  230

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
              Y    ++  +Y+S K++C G+Y++  P N  C+ DLQ ++ CT  +N   I EP C   
Sbjct  231   AYLKALITYEIYESAKKNCKGDYVNVDPGNYLCKADLQNISVCTGNVNGVNIYEPRCSFV  290

Query  783   NPEI-------------------LLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGV  661
             +P+                    LL L  +  P+ WCR+ NY +A +WAN+K VQ+ALG+
Sbjct  291   SPKSTRLSPGDASVMEDEEDSLDLLFLPAQPAPKLWCRNQNYFYAPTWANDKTVQRALGI  350

Query  660   REGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVP  481
             +EG + EW RCN +LS          Y  NV ++VDYHR+F  K  +VLIYSGD DM   
Sbjct  351   QEGMVKEWRRCNKSLS----------YTTNVLSSVDYHRNFIKKGYQVLIYSGDVDMGTS  400

Query  480   HVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKE-YELTYATVKGAGHTAPEYKP  304
             +V TE WI+SL + ++  W+PW V+ QVAG+ M+Y++K  Y LT+ATVKGAGHTAPEYKP
Sbjct  401   YVGTETWIKSLNLTIDSGWQPWLVDGQVAGFWMRYAEKNLYRLTFATVKGAGHTAPEYKP  460

Query  303   RECLPMIQRWLSIYPL  256
             +ECL MI RW ++YPL
Sbjct  461   KECLEMINRWFAMYPL  476



>ref|XP_011100015.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Sesamum 
indicum]
Length=467

 Score =   384 bits (985),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 203/432 (47%), Positives = 267/432 (62%), Gaps = 43/432 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E  ++QLFYYFIESE  P+TD                 L    GPL  +     G  P
Sbjct  48    VGEEDEVQLFYYFIESENDPQTDPLILWLTGGPGCSGFSGLVYEIGPLAFDVEAFDGSFP  107

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
                 NPY+WTKVANIIF+D PVGTG+SY+ TS AYNT+DT S +H Y FL +WL +HP F
Sbjct  108   SFITNPYSWTKVANIIFIDSPVGTGFSYATTSQAYNTSDTKSVEHNYLFLRKWLSNHPEF  167

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             + N LY+AGDSY G  VP+V   I  G E+ IEPR+ ++G I GN  T    D N ++ Y
Sbjct  168   VKNHLYIAGDSYGGKIVPMVALEIAKGNEARIEPRILIQGYIVGNSRTDPNKDENEKLPY  227

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
              +RM  +SD  ++  K +CNG Y+   P N  C Y LQ V +CT +++   ILEP C   
Sbjct  228   AHRMALVSDEYFELAKRNCNGEYVSPDPDNIGCLYALQLVNECTSRVDEAHILEPKCKFM  287

Query  783   ----------------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREG  652
                             +P  LLSL  +  P  WCR+ NY+ +Y WANN+ VQ+AL +R+G
Sbjct  288   SPRPSVSRSPQLFLEDDPVDLLSLSKQEKP--WCRNYNYVSSYVWANNETVQEALQIRQG  345

Query  651   TMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVS  472
             T+++W RCN +LS          Y  +V +   +H+  ++K  + L YSGDHDMIVP++S
Sbjct  346   TISDWKRCNRSLS----------YEQDVLSVSKHHQLLSDKGFQALAYSGDHDMIVPYMS  395

Query  471   TEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECL  292
             T KWI  L + +++DWRPW V+ QVAGYTMKY   + ELT+ATVKGAGHTAPEYKP++CL
Sbjct  396   TLKWIRDLNLTLDEDWRPWTVDGQVAGYTMKYKNNQAELTFATVKGAGHTAPEYKPKQCL  455

Query  291   PMIQRWLSIYPL  256
              MI+RWLS+YPL
Sbjct  456   AMIKRWLSLYPL  467



>emb|CBI22424.3| unnamed protein product [Vitis vinifera]
Length=507

 Score =   385 bits (988),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 196/430 (46%), Positives = 268/430 (62%), Gaps = 45/430 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             ++LFYYFIESE+ P  D                 L    GPL  NY    G +P LELNP
Sbjct  88    VELFYYFIESERDPARDPLILWLTGGPGCSGFSGLVYEIGPLRFNYTAFNGSLPSLELNP  147

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTKVA+IIF+D PVGTG+SY+   D Y  +DT+SA+  Y F+ +WL+DHP FL NPLY
Sbjct  148   YSWTKVASIIFLDAPVGTGFSYATNPDDYYASDTISARDNYIFIRKWLIDHPRFLYNPLY  207

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             + GDSYSGI VP++   I +G++ G++P + + G I GNP+TH  +D N+R+ + +R+  
Sbjct  208   IGGDSYSGIIVPILTLEIANGIQMGLKPLMTLMGYILGNPVTHLHNDENSRIPFAHRIAL  267

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPEI-----  772
             +SD LY+S K +C G +ID    N  C   L  +TKCTEK+N   ILEP C  +      
Sbjct  268   ISDELYESAKNACKGEFIDPDESNGECMEVLAVITKCTEKLNSAHILEPVCALDSPKPKE  327

Query  771   ----------------LLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTE  640
                             ++SL      + WCR+ NYL +Y W N++ VQ+AL VR GT+  
Sbjct  328   SKLKWSLNHIEDVSSDMISLPVPQRSELWCRNYNYLLSYIWENDEAVQEALHVRNGTIPF  387

Query  639   WLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKW  460
             W RCN TL           Y  NV +TV YHR+ ++   R LIYSGDHDM++P+V TE+W
Sbjct  388   WKRCNKTLD----------YDSNVVSTVPYHRNLSDLGYRALIYSGDHDMLIPYVGTERW  437

Query  459   IESLKVGVEDDWRPWFVEDQVAGYTMKY--SQKEYELTYATVKGAGHTAPEYKPRECLPM  286
             ++SL + V + W PWFV+ QVAGY++ Y  ++ E ++TYATVKG GHTAPE++P++CL M
Sbjct  438   VKSLNISVLNGWEPWFVDGQVAGYSVVYQANKTESDITYATVKGGGHTAPEFRPKQCLAM  497

Query  285   IQRWLSIYPL  256
             I RWL+ YPL
Sbjct  498   IDRWLAFYPL  507



>ref|XP_008236281.1| PREDICTED: serine carboxypeptidase-like 17 isoform X2 [Prunus 
mume]
Length=472

 Score =   384 bits (985),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 195/423 (46%), Positives = 268/423 (63%), Gaps = 41/423 (10%)
 Frame = -3

Query  1443  KIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELN  1300
             ++QLFYYF ESE+SPE D                 L    GP+  ++   T D  +L LN
Sbjct  64    ELQLFYYFTESERSPENDPLLLWITGGPRCSAFSGLVYEIGPIAFSFTRITKDPVELVLN  123

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             PY+WTK+ANIIF+D P GTG+SYS T+D YNT+DT+ A+    FL +WL  H  FL NPL
Sbjct  124   PYSWTKLANIIFLDAPAGTGFSYSTTTDGYNTSDTIHAKRASEFLRKWLSTHRKFLANPL  183

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMG  940
             Y++GDSYSG  VP++V+ I +G+E+G EP LN+KG + G+P+T+   D N+R+ + +RM 
Sbjct  184   YISGDSYSGKIVPIIVQEIVNGIEAGTEPPLNLKGYVIGDPVTNEKEDLNSRIEFAHRMA  243

Query  939   FLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPEI----  772
              +S+ +Y    E+C G Y+D  P+N  C  +LQ   +CT +++   IL PAC P I    
Sbjct  244   LISNRMY----ENCKGEYVDVDPNNQLCLNNLQSFKECTSRLDDSHILAPACVPRINHNE  299

Query  771   -------LLSLDGENL----PQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCN  625
                      S+D   L    P+  CR D   ++  WAN+  V+KAL +REGT  EW+RCN
Sbjct  300   QTTFGWDWDSVDDNFLSFPFPESLCRADRLRYSVVWANDMEVRKALNIREGTKGEWVRCN  359

Query  624   HTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLK  445
                       R+  Y+ +V+  V+YHR+ + KS R  +YSGDHD+ VP+VSTE WIESL 
Sbjct  360   ----------RTTPYIKDVQRAVEYHRNLSQKSLRAFVYSGDHDLSVPYVSTEAWIESLS  409

Query  444   VGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSI  265
             + ++DDW+PWF  +QVAGYT++YS  +Y LTYAT+KG GHTAPE+ PREC  MI+RWL  
Sbjct  410   LPIDDDWKPWFSNNQVAGYTVRYSNGDYHLTYATIKGGGHTAPEFNPRECFDMIKRWLEH  469

Query  264   YPL  256
              PL
Sbjct  470   SPL  472



>ref|XP_010065879.1| PREDICTED: serine carboxypeptidase-like 13 [Eucalyptus grandis]
 gb|KCW63577.1| hypothetical protein EUGRSUZ_G01201 [Eucalyptus grandis]
Length=465

 Score =   382 bits (981),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 195/424 (46%), Positives = 268/424 (63%), Gaps = 39/424 (9%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             +Q+FYYF++SE+SP+ D              L  +    GP T NY N T   P L+++ 
Sbjct  52    VQMFYYFVKSERSPKDDPLVLWITGGPGCSTLSAILYEIGPFTFNYENLTPSRPTLKVHE  111

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTKVANIIFVD+PVG G+SY+   ++YN ND +SA  TY FL +WL  HP FL+NPLY
Sbjct  112   YSWTKVANIIFVDEPVGAGFSYANNWESYNVNDNISATDTYEFLRKWLTLHPEFLSNPLY  171

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             + GDSY G   P+V   + +G+E+G+EP +N+KG + GNP+T+  SD N+RV + Y    
Sbjct  172   IGGDSYGGFINPIVTLKVAEGIEAGLEPIMNLKGYLLGNPVTNLQSDENSRVRFAYLKAL  231

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---------  784
             +S+ LYKS  ++CNG++I+    N+AC  DL+ VT C EK+++  ILEP C         
Sbjct  232   ISEELYKSADKNCNGDFINVNESNAACVDDLKIVTMCLEKLDIANILEPNCLYSTPKSTV  291

Query  783   ----NPEIL----LSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRC  628
                 +P +L      L    LP  WCR  NY+ +Y+WAN++ VQ+AL VR GT+ +W RC
Sbjct  292   DGTWDPSLLNRDPTFLALPQLPGVWCRVYNYMLSYTWANDRAVQEALHVRPGTIRKWARC  351

Query  627   NHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESL  448
             N ++S          Y ++++  +DYH+    +  R LIYSGDHDM +P+V T  WIE+L
Sbjct  352   NESIS----------YEYSIREVIDYHKELLKRGYRALIYSGDHDMAIPYVGTLAWIETL  401

Query  447   KVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLS  268
              + V +DW+ WFV+ QVAGYT  YS  E  LTYATVKG GHTAPEYKP+EC  MI RW +
Sbjct  402   NLTVSEDWQAWFVDGQVAGYTTVYSYGEAYLTYATVKGGGHTAPEYKPKECFAMIDRWFA  461

Query  267   IYPL  256
              Y L
Sbjct  462   YYYL  465



>ref|XP_008236346.1| PREDICTED: serine carboxypeptidase-like 18 [Prunus mume]
Length=444

 Score =   380 bits (977),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 192/397 (48%), Positives = 255/397 (64%), Gaps = 36/397 (9%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEt-------------dplllwltggpgplTINYANSTGDIPDLELN  1300
             IQLFY+FIESE+SP+                    +    GPL  NYANS+G+ P   LN
Sbjct  50    IQLFYFFIESERSPKEDPLLLWLSGGPGCSSFTAMVYDSIGPLIFNYANSSGNEPTFLLN  109

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             PYAWTK+AN+IF+DQPVGTGYSY+++ + Y T DTLS+  TY FL +WL DHP FL NPL
Sbjct  110   PYAWTKIANVIFLDQPVGTGYSYAKSWEEYRTGDTLSSSQTYEFLRKWLKDHPRFLKNPL  169

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMG  940
             Y+AGDSYSGITVP+V + + +G E+G EP +N+KG + GNP T    D N+R+ Y +RM 
Sbjct  170   YIAGDSYSGITVPIVAQQVSNGNEAGHEPPMNLKGYVLGNPWTEPTYDVNSRIKYAHRMA  229

Query  939   FLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---NPEIL  769
              +S+ LY+STK +C G Y+   P N+ C  +LQ V +C +KIN+ QILEP C   +P+  
Sbjct  230   LISNELYESTKTNCKGEYVQVDPSNAPCVENLQEVNECIQKINLAQILEPKCSTLSPKPK  289

Query  768   LSLDGENLPQQ------------WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCN  625
                  +N  ++            WCR  NY+F + WAN+K VQ AL VREGT+  W RCN
Sbjct  290   RFKWDQNFAEEDLLDVLHYSTKSWCRSYNYIFCFIWANDKTVQNALHVREGTIKGWERCN  349

Query  624   HTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLK  445
              +L           Y ++V+ ++DYHR+ T K+ R L+YSGDHDMI+P+V T +WI+SL 
Sbjct  350   QSL--------DSNYAYDVRTSIDYHRNLTKKNLRALVYSGDHDMIIPYVGTREWIKSLN  401

Query  444   VGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKG  334
             + V+  WRPWFV  QVAGYT  Y+ K Y LT+ TVK 
Sbjct  402   LSVDYQWRPWFVNGQVAGYTNAYTLKAYSLTFVTVKA  438



>ref|XP_008236290.1| PREDICTED: serine carboxypeptidase-like 17 isoform X2 [Prunus 
mume]
Length=473

 Score =   381 bits (979),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 194/423 (46%), Positives = 265/423 (63%), Gaps = 37/423 (9%)
 Frame = -3

Query  1443  KIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELN  1300
             ++Q+FYYF ESE SPE D                 L    GP++  + + + D   L LN
Sbjct  61    ELQMFYYFTESESSPENDPLLLWMTGGPRCSSFYGLIYEIGPISFQFNDLSKDPLKLVLN  120

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             PY+WTKVANIIF+D P  TGYSYS T +   ++DTL A   Y FL +WL+ HP FL+NPL
Sbjct  121   PYSWTKVANIIFLDAPAATGYSYSTTLEGLISSDTLHATRAYQFLQKWLVAHPQFLSNPL  180

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMG  940
             Y++GDS++G  VP++V++I  G+E+G+EP LN+KG I GNP T+   D N+R+ Y +R+ 
Sbjct  181   YISGDSFTGKIVPIIVQHITQGIEAGMEPALNLKGYIIGNPSTNAKEDFNSRIEYAHRLA  240

Query  939   FLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE-----  775
              +SD +Y+S+K +C G Y+D  P N  C   LQ   +CT +++   IL P C  +     
Sbjct  241   LISDRVYESSKRNCKGEYVDVDPKNQLCLNSLQAFKECTRRLDTEHILAPFCGKDYYNEW  300

Query  774   -ILLSLDGENL---------PQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCN  625
              IL + D E++         P Q CR+D   +A  W N+  V+KAL +REGT  EW +CN
Sbjct  301   TILKTNDRESMDDVFLDFPSPLQLCREDRIRYAVLWQNDINVRKALNIREGTKGEWAKCN  360

Query  624   HTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLK  445
              T            Y F+V ++VDYHR+ + K  R ++YSGDHD+ +P++ST  WIESL 
Sbjct  361   KT----------TPYTFDVPSSVDYHRNLSQKHLRAIVYSGDHDITIPYISTLAWIESLN  410

Query  444   VGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSI  265
             + +EDDW+PWF + QVAGYTM YS  EY LTYAT+KG GHTAPEY P+EC  MI RWL+ 
Sbjct  411   LTLEDDWKPWFSDHQVAGYTMYYSNNEYNLTYATIKGGGHTAPEYNPKECFDMINRWLAH  470

Query  264   YPL  256
              PL
Sbjct  471   SPL  473



>ref|XP_008236288.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Prunus 
mume]
Length=491

 Score =   381 bits (979),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 193/423 (46%), Positives = 264/423 (62%), Gaps = 37/423 (9%)
 Frame = -3

Query  1443  KIQLFYYFIESEKSPE------------tdplllwltggpgplTINYANSTGDIPDLELN  1300
             ++Q+FYYF ESE SPE                   L    GP++  + + + D   L LN
Sbjct  79    ELQMFYYFTESESSPENDPLLLWMTGGPRCSSFYGLIYEIGPISFQFNDLSKDPLKLVLN  138

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             PY+WTKVANIIF+D P  TGYSYS T +   ++DTL A   Y FL +WL+ HP FL+NPL
Sbjct  139   PYSWTKVANIIFLDAPAATGYSYSTTLEGLISSDTLHATRAYQFLQKWLVAHPQFLSNPL  198

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMG  940
             Y++GDS++G  VP++V++I  G+E+G+EP LN+KG I GNP T+   D N+R+ Y +R+ 
Sbjct  199   YISGDSFTGKIVPIIVQHITQGIEAGMEPALNLKGYIIGNPSTNAKEDFNSRIEYAHRLA  258

Query  939   FLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE-----  775
              +SD +Y+S+K +C G Y+D  P N  C   LQ   +CT +++   IL P C  +     
Sbjct  259   LISDRVYESSKRNCKGEYVDVDPKNQLCLNSLQAFKECTRRLDTEHILAPFCGKDYYNEW  318

Query  774   -ILLSLDGENL---------PQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCN  625
              IL + D E++         P Q CR+D   +A  W N+  V+KAL +REGT  EW +CN
Sbjct  319   TILKTNDRESMDDVFLDFPSPLQLCREDRIRYAVLWQNDINVRKALNIREGTKGEWAKCN  378

Query  624   HTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLK  445
              T            Y F+V ++VDYHR+ + K  R ++YSGDHD+ +P++ST  WIESL 
Sbjct  379   KT----------TPYTFDVPSSVDYHRNLSQKHLRAIVYSGDHDITIPYISTLAWIESLN  428

Query  444   VGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSI  265
             + +EDDW+PWF + QVAGYTM YS  EY LTYAT+KG GHTAPEY P+EC  MI RWL+ 
Sbjct  429   LTLEDDWKPWFSDHQVAGYTMYYSNNEYNLTYATIKGGGHTAPEYNPKECFDMINRWLAH  488

Query  264   YPL  256
              PL
Sbjct  489   SPL  491



>ref|XP_011088733.1| PREDICTED: serine carboxypeptidase-like 7 [Sesamum indicum]
Length=493

 Score =   380 bits (976),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 203/445 (46%), Positives = 273/445 (61%), Gaps = 34/445 (8%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V EN ++QLFYYFI+SE  PE D                 L    GPL  +     G  P
Sbjct  50    VGENDEVQLFYYFIQSENDPERDPLILWLTGGPGCSGFSGLVYEIGPLAFDLEAFDGSFP  109

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
                LNPY+WTK+ANIIF+D PVGTG+SY+ T  AYN+NDT SA+H YSFL +WLL+HP F
Sbjct  110   SFTLNPYSWTKIANIIFIDSPVGTGFSYATTPQAYNSNDTKSAEHNYSFLRKWLLNHPEF  169

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             + N LYVAGDSY G   P+V   I  G ++G EPR+ ++G I GN +T+   D N RV Y
Sbjct  170   VKNRLYVAGDSYGGKITPMVALEIVKGNDAGFEPRMLLQGYIVGNSITNFSKDQNERVPY  229

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
              ++M  + D  ++    SC+G Y++  P N  C   LQ + +C  +I    ILEP C   
Sbjct  230   AHKMALIPDEYFEVASSSCHGEYVNPDPQNMQCLSALQLIKECLSRIYDAHILEPKCISR  289

Query  783   NPEILLSLDGENL------PQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNH  622
             + +++L  D  +L       Q  CR+ NY+ +Y WAN++ VQ+AL +R+GT+TEW RCN 
Sbjct  290   SGQLILEDDPVDLLSSSKQEQPLCRNYNYVTSYVWANDETVQEALHIRKGTITEWKRCNR  349

Query  621   TLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKV  442
             +LS          Y  +V++   +HR    K  + L+YSGDHDM +P++ST KWI  L +
Sbjct  350   SLS----------YEHDVESVFQHHRLLNEKGFQALVYSGDHDMAIPYLSTLKWICDLNL  399

Query  441   GVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIY  262
              ++ DWRPW V+ QVAGYTMKY   E +LT+ATVKGAGHTAPEYKP++CL M+ RWLS Y
Sbjct  400   TLDKDWRPWNVDGQVAGYTMKYKNNEAQLTFATVKGAGHTAPEYKPKQCLAMVNRWLSSY  459

Query  261   PL*LLCKIILNAYYIPY*NGKCLAI  187
             P  L   I ++   IP    +CLA+
Sbjct  460   P--LYIDISMSELIIPT-TFECLAM  481



>ref|XP_008236276.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Prunus 
mume]
Length=395

 Score =   377 bits (967),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 174/353 (49%), Positives = 240/353 (68%), Gaps = 19/353 (5%)
 Frame = -3

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
             +L LNPY+WTK+ANIIF+D P GTG+SYS T+D YNT+DT+ A+    F+ +WLL HP F
Sbjct  53    ELVLNPYSWTKLANIIFLDAPAGTGFSYSTTTDGYNTSDTIHAKRASEFVQRWLLTHPKF  112

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L NPLY++GDSYSG  VP++V++I +G+E+GI P LN+KG + GNP+T+R  + N+++ Y
Sbjct  113   LANPLYISGDSYSGKIVPIIVQDITNGIEAGISPFLNLKGYVIGNPVTNRKEELNSQIEY  172

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
              +RM  +S  +++STK +C G+YID  P+N  C  +LQ   +C  +I    IL PAC P 
Sbjct  173   AHRMALISTRMFESTKRNCKGDYIDVDPNNELCLNNLQAFEECISRIEESHILAPACAPG  232

Query  774   ILLSLDGEN-----LPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSG  610
             +    D +N      P+Q CR +   ++  WAN+  V+KAL +REGT  EW RCN ++  
Sbjct  233   V----DDDNFLSFPFPEQLCRVERQRYSEVWANDMNVRKALNIREGTKAEWARCNSSIP-  287

Query  609   PPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVED  430
                      Y+ +V ++V YHR+   KS R  +YSGDHD+ VPH+STE WIESL + + D
Sbjct  288   ---------YIKDVHSSVYYHRNLMQKSLRAFVYSGDHDLKVPHISTEAWIESLSLPIVD  338

Query  429   DWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
             DW+PWF  +QVAGY + YS  EY LTYAT+KG GHT PE+ PRE   MI+RWL
Sbjct  339   DWKPWFSNNQVAGYRVGYSNGEYHLTYATIKGGGHTGPEFNPRESFDMIERWL  391



>ref|XP_011100017.1| PREDICTED: serine carboxypeptidase-like 13 [Sesamum indicum]
Length=467

 Score =   379 bits (973),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 199/432 (46%), Positives = 266/432 (62%), Gaps = 43/432 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E  ++QLFYYFIESE  P+TD                 L    GPL  +     G  P
Sbjct  48    VGEEDEVQLFYYFIESENDPQTDPLILWLTGGPGCTGFSALVYEIGPLAFDLEAFDGSFP  107

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
                 NPY+WTKVANIIF+D PVGTG+SY+ T++AYNT+DT S +H YSF+ +WL +HP F
Sbjct  108   SFITNPYSWTKVANIIFIDSPVGTGFSYATTTEAYNTSDTKSVEHNYSFMRKWLSNHPEF  167

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             + N LYVAGDSY G  VP+V   I  G E+  EPR+ ++G I GN  T    D N ++ Y
Sbjct  168   VKNHLYVAGDSYGGKIVPMVALEIAKGNEARFEPRILLQGYIVGNSRTDANKDDNEKLPY  227

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
              +RM  +SD  ++  K +CNG Y+   P N  C Y L+ V +CT ++N   ILEP C   
Sbjct  228   AHRMALVSDEYFELAKSNCNGEYVSPDPDNIGCLYALRLVNECTSRVNGGHILEPKCKLM  287

Query  783   ----------------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREG  652
                             +P  LLSL  +  P  WCR+ NY  +Y WANN+ VQ+AL +R+G
Sbjct  288   SPRPSVSRSPQLFLEDDPVDLLSLSKQEKP--WCRNYNYASSYVWANNETVQEALQIRQG  345

Query  651   TMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVS  472
             T+++W RC+ +LS          Y  +V +   +H+  ++K  + L YSGDHDMI+P++S
Sbjct  346   TISDWKRCSRSLS----------YEQDVLSVFKHHQLLSDKGFQALAYSGDHDMIIPYMS  395

Query  471   TEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECL  292
             T KWI  L + +++DWRPW V+ QVAGYTMKY   + ELT+ATVKGAGHTAPEYKP++CL
Sbjct  396   TLKWIRDLNLTLDEDWRPWTVDGQVAGYTMKYKNNQAELTFATVKGAGHTAPEYKPKQCL  455

Query  291   PMIQRWLSIYPL  256
              MI+ WLS+YPL
Sbjct  456   AMIKSWLSLYPL  467



>gb|KCW55073.1| hypothetical protein EUGRSUZ_I01040 [Eucalyptus grandis]
Length=484

 Score =   378 bits (971),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 201/411 (49%), Positives = 265/411 (64%), Gaps = 40/411 (10%)
 Frame = -3

Query  1443  KIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELN  1300
             ++QLFYYFIESE+SP  D              L  L    GPL  +Y+NS+G  P  ELN
Sbjct  49    EVQLFYYFIESERSPNDDPLLLWLTGGPGCSALSGLLFEIGPLQFDYSNSSGIRPLFELN  108

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             PY+WTK+ANIIF+D PVGTG+SY+ T  AYN NDT SA  TY FL +WLL HP FL N L
Sbjct  109   PYSWTKIANIIFLDAPVGTGFSYAMTWAAYNINDTSSAAQTYEFLRKWLLAHPKFLTNQL  168

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMG  940
             Y++GDSYSG+ VP++V+ IYDG E+G EP +N+KG + GNP+T    D + R+ YGY+  
Sbjct  169   YISGDSYSGVVVPIIVKEIYDGNEAGREPPMNLKGYVLGNPVTCEVKDISQRIPYGYKTA  228

Query  939   FLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNP------  778
              +SD LY+STK  CNG+Y++  P N A   DL+ V+ C EKIN+PQILEP C+       
Sbjct  229   LISDELYESTKTDCNGDYMNVDPTNGAYLRDLEMVSICLEKINLPQILEPKCSALSPNHT  288

Query  777   ------EILLS--LDGENLPQQ---WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLR  631
                    IL    +D  ++PQQ   WCR  NYL++Y WAN++ VQ+AL +REG   EW R
Sbjct  289   RLKWSRSILKENIIDVISMPQQSKPWCRSYNYLYSYIWANDRNVQEALHIREGMKPEWNR  348

Query  630   CNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIES  451
             CN ++S          Y  ++ N+V YHR  +  S R LIYSGDHDM +P+V T  WI S
Sbjct  349   CNESIS----------YTKDILNSVVYHRYLSKTSLRALIYSGDHDMGIPYVGTLDWIRS  398

Query  450   LKVGVEDDWRPWFVEDQVAGYTMKYSQ-KEYELTYATVKGAGHTAPEYKPR  301
             L + +   W PW+V+ QVAGY++ Y +  +Y+LT+ T+KG GHTAP+  PR
Sbjct  399   LNLTLLGPWGPWYVDGQVAGYSILYLENNKYDLTFTTIKGGGHTAPDINPR  449



>ref|XP_008338878.1| PREDICTED: serine carboxypeptidase-like 1 [Malus domestica]
Length=475

 Score =   377 bits (969),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 208/434 (48%), Positives = 275/434 (63%), Gaps = 47/434 (11%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEt-------------dplllwltggpgplTINYANSTGDIPDLELN  1300
             +QLFYYFIESE SPE                    +    GPL+ +YANS G+ P  +LN
Sbjct  50    VQLFYYFIESEGSPEYDPLVLWLTGGPGCSAFSGLIYENLGPLSFDYANSIGNKPXFKLN  109

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAY-NTNDTLSAQHTYSFLVQWLLDHPTFLNNP  1123
             PY+WTKVANIIF+D PVG G+SY++T   Y N +DTLSA  TY FL +WL+DHP F NN 
Sbjct  110   PYSWTKVANIIFLDAPVGXGFSYAKTWXGYXNMSDTLSAAQTYEFLRKWLMDHPKFFNNQ  169

Query  1122  LYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRM  943
             L VAGDSYSGI VP++V+ I DG      P +N+KG + GNP T    D ++R+++ Y  
Sbjct  170   LXVAGDSYSGIVVPIIVQXISDGNHDDNVPPINIKGYVLGNPXTDLDKDXDSRILFAYLK  229

Query  942   GFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTK-----CTEKINMPQILEPAC--  784
               +SD LY+S + +CNG YI+  P+N+ C  DL+   +     CTE I   QILEP+C  
Sbjct  230   ALISDELYQSLETNCNGEYINVDPNNALCXDDLEIYNEVSGNICTEDIRAAQILEPSCTV  289

Query  783   ----------NPEILLSLDGEN-------LPQQWCRDDNYLFAYSWANNKIVQKALGVRE  655
                       NP+ L   D +N       LP+ WCR+ NY+ +  WAN+K VQ AL VRE
Sbjct  290   TSPKSTGSIWNPDHLSDRDSKNTLLTSSGLPRLWCREYNYILSEIWANDKTVQDALHVRE  349

Query  654   GTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHV  475
             G++ EW+RCN++L          +Y+ +V +++ YH +   K  RVLIYSGDHDM+VP+V
Sbjct  350   GSIEEWVRCNYSL--------QXSYIKDVSSSLVYHENLIKKGYRVLIYSGDHDMVVPYV  401

Query  474   STEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQ-KEYELTYATVKGAGHTAPEYKPRE  298
              T  WIESL + V++ WRPWFV  Q+AGY+++YS    Y+LT+ T+KGAGHTAPEYKP E
Sbjct  402   GTLAWIESLNLTVDNRWRPWFVSGQIAGYSVQYSXITNYKLTFTTIKGAGHTAPEYKPEE  461

Query  297   CLPMIQRWLSIYPL  256
             CL MI RW + YPL
Sbjct  462   CLAMISRWFAYYPL  475



>emb|CAN74923.1| hypothetical protein VITISV_038590 [Vitis vinifera]
Length=499

 Score =   378 bits (971),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 196/438 (45%), Positives = 269/438 (61%), Gaps = 53/438 (12%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             ++LFYYFIESE+ P  D                 L    GPL  NY    G +P LELNP
Sbjct  72    VELFYYFIESERDPARDPLILWLTGGPGCSGFSGLVYEIGPLRFNYTAFNGSLPSLELNP  131

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTKVA+IIF+D PVGTG+SY+   D Y  +DT+SA+  Y F+ +WL+DHP FL NPLY
Sbjct  132   YSWTKVASIIFLDAPVGTGFSYATNPDDYYASDTISARDNYIFIRKWLIDHPRFLYNPLY  191

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNM--------KGCIEGNPLTHRFSDTNNRV  961
             + GDSYSGI VP++   I +G++ G++P + +        +G I GNP+TH  +D N+R+
Sbjct  192   IGGDSYSGIIVPILTLEIANGIQMGLKPLMTLMFYNWNGIQGYILGNPVTHLHNDENSRI  251

Query  960   VYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN  781
              + +R+  +SD LY+S K +C G +ID    N  C   L  +TKCTEK+N   ILEP C 
Sbjct  252   PFAHRIALISDELYESAKNACKGEFIDPDESNGECMEVLAVITKCTEKLNSAHILEPVCA  311

Query  780   PEI---------------------LLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALG  664
              +                      ++SL      + WCR+ NYL +Y W N++ VQ+AL 
Sbjct  312   LDSPKPKESKLKWSLNHIEDVSSDMISLPVPQRSELWCRNYNYLLSYIWENDEAVQEALH  371

Query  663   VREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIV  484
             VR GT+  W RCN TL           Y  NV +TV YHR+ ++   R LIYSGDHDM++
Sbjct  372   VRNGTIPFWKRCNKTLD----------YDSNVVSTVPYHRNLSDLGYRALIYSGDHDMLI  421

Query  483   PHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKY--SQKEYELTYATVKGAGHTAPEY  310
             P+V TE+W++SL + V + W PWFV+ QVAGY++ Y  ++ E ++TYATVKG GHTAPE+
Sbjct  422   PYVGTERWVKSLNISVLNGWEPWFVDGQVAGYSVVYQANKTESDITYATVKGGGHTAPEF  481

Query  309   KPRECLPMIQRWLSIYPL  256
             +P++CL MI RWL+ YPL
Sbjct  482   RPKQCLAMIDRWLAFYPL  499



>ref|XP_010065873.1| PREDICTED: serine carboxypeptidase-like 2 [Eucalyptus grandis]
 gb|KCW63566.1| hypothetical protein EUGRSUZ_G01194 [Eucalyptus grandis]
Length=470

 Score =   377 bits (968),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 197/424 (46%), Positives = 262/424 (62%), Gaps = 41/424 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             +QLFYYF+ESE+SP  D              L  L    GP T NY  ST   P L+LN 
Sbjct  55    VQLFYYFVESERSPRDDPLVLWLTGGPGCSALSGLIYEIGPFTFNYEKSTRFRPALKLND  114

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTKVANIIF+DQPVGTG+SY+ + ++YN ND +S   +Y FL +WL  HP FL+NPLY
Sbjct  115   YSWTKVANIIFLDQPVGTGFSYANSWESYNMNDNISVAESYEFLRKWLKLHPQFLSNPLY  174

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             +AGDSYSG+TVP+V   +  G E+G+EP++N+KG + GNPLT+  SD N+RV + +  G 
Sbjct  175   IAGDSYSGVTVPMVALEVDKGNEAGLEPKINLKGYVLGNPLTNYNSDLNSRVPFAHLKGL  234

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---------  784
             +S+ LY+S K  CNG Y++    N+ C  D++ V  C E IN   ILEP C         
Sbjct  235   ISNELYESAKTDCNGKYLNVNESNADCVDDIKAVNLCLENINTGSILEPKCVTQAPKSTV  294

Query  783   ----NPEIL------LSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWL  634
                 +P ++      L L  +  P+ WCR+ NYL++Y WA++K VQ AL +REGT+  W+
Sbjct  295   SDRWDPTLINRDRSPLLLPTQRAPRVWCRNYNYLYSYIWASDKAVQDALHIREGTIEAWV  354

Query  633   RCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIE  454
             RCN TLS          Y  NV   +D H+    +  R LIYSGDHDM++P+V T+  I+
Sbjct  355   RCNKTLS----------YTSNVLVVIDIHKELIKRGFRALIYSGDHDMVIPYVGTQASID  404

Query  453   SLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRW  274
             +L + +  DW  WFV+ QVAGY   YS     LT+ATVKGAGHTAPEYKP EC  +I RW
Sbjct  405   TLNMTISTDWHAWFVDGQVAGYATLYSSFPSLLTFATVKGAGHTAPEYKPEECFALISRW  464

Query  273   LSIY  262
                +
Sbjct  465   FDYF  468



>ref|XP_010028347.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW55081.1| hypothetical protein EUGRSUZ_I01044 [Eucalyptus grandis]
Length=487

 Score =   376 bits (966),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 203/431 (47%), Positives = 265/431 (61%), Gaps = 45/431 (10%)
 Frame = -3

Query  1443  KIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELN  1300
             +I+LFYYFIESE++P  D                 L    GPLT +YA+  G  P L  N
Sbjct  67    EIELFYYFIESERNPVKDPLLLWLTGGPGCSGFSGLVFEIGPLTFDYASFNGSSPTLLSN  126

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             P +WT++ANIIF+D PVGTG++YS T + Y T+D  SA+  Y FL +W+  HP F  NPL
Sbjct  127   PESWTQIANIIFLDAPVGTGFAYSTTQEGYYTSDIKSAKDIYKFLRKWIQGHPKFSKNPL  186

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMG  940
             Y+AGDSYSG  VP V      G+ +G +P L ++G + GNP+T   SD N+RV Y YR+ 
Sbjct  187   YIAGDSYSGKIVPQVTLLASKGITAGEKPTLYLQGYMLGNPVTDLDSDQNSRVEYQYRVS  246

Query  939   FLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN-------  781
             FLS  LY+S  E+CNGNYID  P NSAC  D++++ KCT KI    ILEP C+       
Sbjct  247   FLSTELYESAIENCNGNYIDPDPENSACVEDVRQIAKCTLKICDAAILEPKCSYAKPRSK  306

Query  780   ---------------PEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTM  646
                            P  LL    +  P+ WCR++NY+ +Y WAN++ VQ AL +R GT+
Sbjct  307   EMGLNWGSKFFDDDVPLDLLRSPSKKRPENWCRNENYVLSYVWANDQSVQDALHIRNGTI  366

Query  645   TEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTE  466
              +W RCN +L+          Y  ++ +TV YH        R L+YSGDHDM++P+V+TE
Sbjct  367   PDWTRCNKSLA----------YEDDLNSTVPYHYELIEAGYRALVYSGDHDMLIPYVATE  416

Query  465   KWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYE-LTYATVKGAGHTAPEYKPRECLP  289
             KWI SL + V DDWRPWFV+ Q+AGYT K +    + + YATVKGAGHTAPEYKPR+CL 
Sbjct  417   KWIHSLNMTVVDDWRPWFVDGQIAGYTFKSTINLGDGMAYATVKGAGHTAPEYKPRQCLE  476

Query  288   MIQRWLSIYPL  256
             M  RWLS YPL
Sbjct  477   MADRWLSHYPL  487



>ref|XP_004289672.1| PREDICTED: serine carboxypeptidase-like 13 [Fragaria vesca subsp. 
vesca]
Length=474

 Score =   375 bits (964),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 192/430 (45%), Positives = 260/430 (60%), Gaps = 39/430 (9%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V ++ ++QLFYY +ESE+SPE D                 L    GP++    N + D  
Sbjct  55    VGDSEEVQLFYYLVESERSPENDPLLIWLTGGPRCSSFYGLIYEIGPMSFELTNLSTDPL  114

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L LNP +W KVANIIFVD P GTGYSYS TS    ++DTL +   Y FL++W+  HP F
Sbjct  115   TLVLNPNSWNKVANIIFVDAPAGTGYSYSTTSHGLISSDTLHSTRIYEFLLKWITAHPKF  174

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L N  YVAGDSYSG  VP++   I DG+E+GI+P LN+KG I GNP+++   D N+R+VY
Sbjct  175   LANSFYVAGDSYSGKIVPIIALQITDGIEAGIKPNLNLKGYIVGNPVSNGQQDVNSRIVY  234

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
              +++G +SD +Y+S  ++C G ++D  P+N  C   LQ + +C  +I+   IL P C P+
Sbjct  235   AHQLGLISDRIYQSANKNCKGEFVDLDPNNKLCLNSLQAIDECIGRIDNEHILAPFCLPD  294

Query  774   ILLSLDGENLPQQW-----------------CRDDNYLFAYSWANNKIVQKALGVREGTM  646
             I  +     L   W                 CR+D   ++  W N+  V+ AL +REGT 
Sbjct  295   INENPQNSILEMNWESNDDSFLDFSFPMVHMCREDKIRYSVLWQNDMNVRNALNIREGTK  354

Query  645   TEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTE  466
              +W +CN T            Y F++ + ++YHR+ + KS R LIYSGDHDM VP++ST 
Sbjct  355   GQWTKCNKT----------TPYTFDIASNIEYHRNLSQKSLRALIYSGDHDMSVPYISTL  404

Query  465   KWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPM  286
              WIES+   +E+DWRPWF  DQVAGYT+ YS KEY LTYAT+KG GHTAPEY P+EC  M
Sbjct  405   AWIESMNFTIEEDWRPWFSNDQVAGYTLYYSNKEYNLTYATIKGGGHTAPEYNPKECFDM  464

Query  285   IQRWLSIYPL  256
             I RWL+  PL
Sbjct  465   ISRWLAHAPL  474



>ref|XP_011100013.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Sesamum 
indicum]
Length=467

 Score =   374 bits (959),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 197/430 (46%), Positives = 266/430 (62%), Gaps = 39/430 (9%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E  ++QLFYYFIESE  P+TD                 L    GPL  +     G  P
Sbjct  48    VGEEDEVQLFYYFIESENDPQTDPLILWLTGGPGCSGFSGLVYEIGPLAFDLEAFDGSFP  107

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
                 NPY+WTKVANIIF+D PVGTG+SY+ TS+AYNT+DT S +  YSFL +WL +HP F
Sbjct  108   SFITNPYSWTKVANIIFIDSPVGTGFSYATTSEAYNTSDTKSVEQNYSFLRKWLSNHPEF  167

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             + N LY+AG+SY G  VP+V   I  G E+G EPR++++G I GN  T    D N ++ Y
Sbjct  168   VKNHLYIAGNSYGGKIVPMVALEIAKGNEAGFEPRISLQGYITGNSWTDPNKDENEKLPY  227

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
              +RM  +SD  ++  K +CNG Y++  P N  C Y L+ V +CT  +N   ILEP C   
Sbjct  228   AHRMALVSDEYFELAKSNCNGEYVNPDPDNIGCLYALRLVNECTSHVNDEHILEPKCKVM  287

Query  783   --------NPEILLSLDGENL------PQQWCRDDNYLFAYSWANNKIVQKALGVREGTM  646
                     +P++ L  D  +L       + WCR+ NY  +Y WANN+ VQ+AL +R+GT+
Sbjct  288   SPRPSVSRSPQLFLEDDPVDLLALSKQEKPWCRNYNYAASYVWANNETVQEALQIRQGTI  347

Query  645   TEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTE  466
             ++W RCN +LS          Y  +V +   +H+  ++K  + L YSGDHDM VP++ST 
Sbjct  348   SDWKRCNKSLS----------YEQDVVSVFKHHQLLSDKGFQALAYSGDHDMEVPYMSTL  397

Query  465   KWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPM  286
             KWI +L + +++DWR W V+ QVAGYTMKY   + ELT+ATVKGAGHTA  YKP+ECL M
Sbjct  398   KWIRNLNLTLDEDWRSWTVDGQVAGYTMKYKNNQAELTFATVKGAGHTASAYKPKECLAM  457

Query  285   IQRWLSIYPL  256
             I+RWLS+YPL
Sbjct  458   IKRWLSLYPL  467



>ref|XP_012093157.1| PREDICTED: serine carboxypeptidase-like 2 [Jatropha curcas]
 gb|KDP44532.1| hypothetical protein JCGZ_16365 [Jatropha curcas]
Length=472

 Score =   374 bits (959),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 184/430 (43%), Positives = 269/430 (63%), Gaps = 38/430 (9%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSP---EtdplllwltggpgplTINYANS---------TGDIP  1315
             V E   ++LFYYF ESE+ P        L    G  G   I + N          +G +P
Sbjct  52    VGEMQDVELFYYFFESERDPIYDPLVLWLTGGPGCSGFSAIAFENGPLAIARDTYSGGLP  111

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L+LNPY+WTKVA+IIF+D PVG G+SY+ T++  NT+DTLSA  TY+FL +WL+ HP F
Sbjct  112   SLKLNPYSWTKVASIIFIDAPVGAGFSYATTAEGRNTSDTLSAFQTYNFLRRWLVSHPKF  171

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L + +Y+ GDSYSGI VPLVV+NI +G+ESG++P ++++G + GNP+T  + D N+R+ +
Sbjct  172   LGSQVYIGGDSYSGIVVPLVVQNILEGIESGLKPSIDLQGYLLGNPVTDYYIDDNSRIPF  231

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
              +R+  +SD  Y++ K  CNG+Y++   +N+ C   LQ + +C  +I + QILEP C   
Sbjct  232   IHRVSLISDEYYENAKLYCNGDYLNVDSNNTLCVTALQNIKQCILQIKLTQILEPQCAFS  291

Query  783   --------------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTM  646
                              ++ SL    LP+  CR+  Y  +Y + NN+ VQ ALGVREGT+
Sbjct  292   SKKTTELDWDIKSQEARVIDSLQANKLPELRCREFGYALSYKYMNNETVQTALGVREGTV  351

Query  645   TEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTE  466
               W RC  +           TY  NV+++V  H++ +    R L+YSGDHD+ +P+V T 
Sbjct  352   ETWSRCFKSFP---------TYTENVQSSVYIHKNLSKTGLRALVYSGDHDISIPYVGTL  402

Query  465   KWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPM  286
             +WI+SL++ V D+WRPW+V+ Q+AGY  K+  + + LTYAT+KG GHTAPEYKP ECL +
Sbjct  403   EWIKSLEIPVFDEWRPWYVDGQIAGYQTKFMNEHFRLTYATIKGGGHTAPEYKPTECLAL  462

Query  285   IQRWLSIYPL  256
             + RW + YP+
Sbjct  463   VDRWFARYPV  472



>ref|XP_012093156.1| PREDICTED: serine carboxypeptidase-like 18 [Jatropha curcas]
Length=457

 Score =   372 bits (955),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 197/422 (47%), Positives = 263/422 (62%), Gaps = 37/422 (9%)
 Frame = -3

Query  1443  KIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELN  1300
             ++QLFYYF+ESE +P+ D                 L    GPL+ NYA S    P LELN
Sbjct  47    EVQLFYYFVESEGNPQEDPLLLWLTGGPGCSGFSALVYEIGPLSFNYAKSRVK-PTLELN  105

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             PY+WTKVA+IIF+D PVGTG+SY+ TS AY ++DT      Y FL +WLLDHP F +N L
Sbjct  106   PYSWTKVASIIFLDAPVGTGFSYATTSQAYQSSDTNQGAANYEFLRKWLLDHPEFQSNRL  165

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMG  940
             Y+AGDSYSG  VPLVV+ I +G ++G  P++N+ G + GNP+T    DTN+R  Y Y  G
Sbjct  166   YIAGDSYSGKIVPLVVQEIVNGNDAGRNPKMNLVGYVLGNPVTDEAKDTNSRFKYAYFTG  225

Query  939   FLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-----NPE  775
              +S+ +Y++ K +C GNY  + P+N+AC   LQ   +C  KI +PQILEP C      P 
Sbjct  226   LISEEVYENGKRNCKGNYTYSEPNNTACAVVLQVYEECIAKIYLPQILEPFCEYWSAKPS  285

Query  774   ILLS---------LDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNH  622
              L           +D       WCR+ NY+ ++ W N+K+VQKAL +REGT+  WLRCN 
Sbjct  286   KLERAESALMEDPIDIHASRSPWCRNYNYIPSFVWLNDKMVQKALHIREGTIENWLRCNT  345

Query  621   TLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKV  442
             +L           Y  ++ ++   HR+   K  +VLIYSGD D+ VP +ST  WIE+L +
Sbjct  346   SL----------LYTKDLTSSFGIHRNLIEKGLKVLIYSGDQDISVPFLSTMAWIEALNL  395

Query  441   GVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIY  262
              +E +W PWF++ QVAGY M+Y +  Y LTYAT+KG GHTAPEYKP+EC  MI RWL  +
Sbjct  396   TIEHEWNPWFLDGQVAGYWMEYYRNMYMLTYATIKGGGHTAPEYKPKECFAMIDRWLGYF  455

Query  261   PL  256
             PL
Sbjct  456   PL  457



>ref|XP_010065869.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Eucalyptus 
grandis]
 gb|KCW63572.1| hypothetical protein EUGRSUZ_G01198 [Eucalyptus grandis]
Length=470

 Score =   372 bits (955),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 194/421 (46%), Positives = 258/421 (61%), Gaps = 41/421 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             +QLFYYF+ESE+SP  D              L  L    GP T NY  ST   P L+LN 
Sbjct  55    VQLFYYFVESERSPRDDPLVLWLTGGPGCSALSGLIYEIGPFTFNYEKSTRFRPSLKLND  114

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTKVANIIF+DQPVGTG+SY+   ++YN ND +S   +Y FL +WL  HP FL+NPLY
Sbjct  115   YSWTKVANIIFLDQPVGTGFSYANNWESYNINDNISVAESYEFLRKWLKLHPQFLSNPLY  174

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             +AGDSYSG+TVP V   +  G E+G+EP++N++G + GNPLT+  SD N+RV + +  G 
Sbjct  175   IAGDSYSGVTVPRVALEVDKGNEAGLEPKMNLEGYVLGNPLTNYDSDLNSRVPFAHLKGL  234

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---------  784
             + + LY+S K  CNG YI+    N+ C  DL+ V  C E I+   ILEP C         
Sbjct  235   IPNELYESAKTDCNGKYINVNESNADCVDDLKAVNLCVENIDTANILEPNCVTQSPKSTV  294

Query  783   ----NPEIL------LSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWL  634
                 +P ++      L L  E   + WCR+ NYL+ Y WA+ K+V+ AL +REGT+ +W+
Sbjct  295   SDRWDPTLINRDPSPLLLPTERASRVWCRNYNYLYIYIWASAKVVRDALHIREGTVEKWV  354

Query  633   RCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIE  454
             RCN TLS          Y  N    +D H+    +  RVLIYSGDHDM++P+V T+ WI+
Sbjct  355   RCNKTLS----------YTSNFLVVIDIHKELIKRGFRVLIYSGDHDMVIPYVGTQAWID  404

Query  453   SLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRW  274
             +L + + +DW  WFV+ QVAGY   YS      T+ TVKGAGHTAPEYKP+EC  +I RW
Sbjct  405   TLNLTISEDWHAWFVDGQVAGYATLYSSFPSLFTFVTVKGAGHTAPEYKPKECFALISRW  464

Query  273   L  271
              
Sbjct  465   F  465



>ref|XP_011030308.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Populus 
euphratica]
Length=455

 Score =   370 bits (951),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 207/461 (45%), Positives = 268/461 (58%), Gaps = 80/461 (17%)
 Frame = -3

Query  1515  KLCLVSQQNFHSNSILV-----T*VWENLKIQLFYYFIESEKSPEtd------------p  1387
             K  + S   FH N   V       V E   +QLFYYF+ESE+SP+ D             
Sbjct  34    KSIIKSLPGFHGNLPFVLETGYIGVGELEAVQLFYYFVESERSPKDDPLVLWLTGGPGCS  93

Query  1386  lllwltggpgplTINYANSTGD-IPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  1210
              L       GPL+ +YA S+G   P L LNPY+WTK+ANIIFVD PVGTG+SYS T + Y
Sbjct  94    ALSGFIYEIGPLSFDYAKSSGGGKPVLALNPYSWTKIANIIFVDAPVGTGFSYSTTWEGY  153

Query  1209  NTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPR  1030
             + +DTLSA  TY FL +WL+DHP FL NPLYVAGDSYSGI  P++V+ I DG E G +P 
Sbjct  154   DVSDTLSAAETYEFLRKWLVDHPKFLTNPLYVAGDSYSGIVAPIIVQEISDGNEVGRQPT  213

Query  1029  LNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQY  850
             +N+KG + GNP+T    DTN+RV + Y    +SD LY                       
Sbjct  214   MNLKGYVLGNPVTDDEIDTNSRVPFAYLKALISDKLY-----------------------  250

Query  849   DLQRVTKCTEKINMPQILEPAC------------NPEILLSLDGENL------PQQWCRD  724
                   +C   +   QILEPAC            +P  L++ D + L      P QWCR 
Sbjct  251   ------ECIGTVFTGQILEPACKSVSPKPVALKWDPRFLIADDADILLPRPRVPGQWCRS  304

Query  723   DNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHR  544
              N+++ Y WAN++ V+ AL +R+GT+ +W RCN TL+          Y +NVK+TVDYHR
Sbjct  305   YNHVYIYGWANDETVRDALHIRKGTIKDWRRCNKTLA----------YSYNVKSTVDYHR  354

Query  543   SFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKE  364
             + T K  R LIYSGDHDM +P++ T +WIESL + ++ DW PWFV+ QVAGY M Y+   
Sbjct  355   NLTKKPYRALIYSGDHDMTIPYIGTHEWIESLNLTIKYDWEPWFVDGQVAGYAMLYADNA  414

Query  363   -----YELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                  Y+LT+ATVKG GHTAPEY+P +C  M+ RW   YPL
Sbjct  415   QEYITYDLTFATVKGGGHTAPEYRPEQCFAMMDRWFDYYPL  455



>ref|XP_012075109.1| PREDICTED: serine carboxypeptidase-like 18 [Jatropha curcas]
 gb|KDP35358.1| hypothetical protein JCGZ_10342 [Jatropha curcas]
Length=485

 Score =   370 bits (951),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 191/426 (45%), Positives = 260/426 (61%), Gaps = 42/426 (10%)
 Frame = -3

Query  1437  QLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNPY  1294
             QLFYYF+ES++SP  D             +L       GP+  +Y+N  G +P L LNP+
Sbjct  70    QLFYYFVESQRSPTLDPLMLWLTGGPGCSVLSAFFYESGPVAFDYSNYNGSLPSLHLNPF  129

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
             AWT+  NII+VD P+GTG+SYS T + Y  +D  SA  TY FL +WLLDHP +L N L++
Sbjct  130   AWTQGINIIYVDAPIGTGFSYSTTQENYYVDDIKSAAQTYEFLKKWLLDHPQYLTNQLFI  189

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFL  934
              GDSYSGI +P++V++I DG E G  P +N+KG + GNP T  F D N+RV + +R+  +
Sbjct  190   GGDSYSGIPLPMIVQHILDGNEDGTSPTMNLKGYVLGNPKTDSFIDDNSRVPFVHRLTLI  249

Query  933   SDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN------PEI  772
             SD LY++TKE C G+Y++    N+AC  D+  + +   +IN+ Q+LEP C        + 
Sbjct  250   SDELYETTKEDCAGDYVNINASNTACVSDINAIDELILQINLMQVLEPICQTASPKPTQG  309

Query  771   LLSLDGENLPQQ--------------WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWL  634
             L  ++G     Q              WCR+ NY+ +  WAN+K V+ AL VRE T   W 
Sbjct  310   LRQIEGRRSLYQDHENTSIPSLNSAYWCREYNYVLSGVWANDKAVRDALQVRENTTNVWK  369

Query  633   RCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIE  454
             RCN TL+          Y  +V +TVDYHR+ + +S R LIYSGDHDM V H+ T+ WI 
Sbjct  370   RCNATLA----------YTKDVLSTVDYHRNLSKQSLRALIYSGDHDMSVTHIGTQNWIH  419

Query  453   SLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRW  274
              L +   + WRPWFV+ QVAGYT KY   +Y L +ATVKG GH APEYKP+EC  MI R+
Sbjct  420   LLNLTTNEYWRPWFVDGQVAGYTEKYLNGDYTLIFATVKGGGHVAPEYKPKECYSMIDRF  479

Query  273   LSIYPL  256
             L+ +PL
Sbjct  480   LAYFPL  485



>ref|XP_002522133.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF40333.1| serine carboxypeptidase, putative [Ricinus communis]
Length=480

 Score =   370 bits (951),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 183/430 (43%), Positives = 265/430 (62%), Gaps = 38/430 (9%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E   +QLFYYF ESE+ P  D                 +    GPL I Y   TG +P
Sbjct  60    VGEMEDVQLFYYFFESERDPTFDPLVLWLTGGPGCSGFSAIAFENGPLAIAYDTYTGGLP  119

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L+LNP++WTKVA+II++D PVG+G+SY+ T++  NT+DTLSA  +Y FL +WL++HP F
Sbjct  120   SLKLNPFSWTKVASIIYIDAPVGSGFSYATTNEGANTSDTLSAHQSYIFLRKWLMNHPKF  179

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L + +Y+ GDSYSGI VPL+V+NI +G+ESG++P ++++G + GNP+T  + D N+R+ +
Sbjct  180   LGSQIYIGGDSYSGIIVPLLVQNILEGIESGLKPSIDLQGYLLGNPVTDYYVDQNSRIPF  239

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
              +R+  +SD  Y   K  C G+Y++  P+N+ C   +Q + +C  +I + QILEP C   
Sbjct  240   VHRVSLISDAYYDDAKLYCEGDYMNIEPNNTLCVTAMQNIKQCLLQIKLTQILEPQCAFS  299

Query  783   --------------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTM  646
                              ++ SL+   LP+  CR+  Y  +Y + NN  VQ ALGVR GT+
Sbjct  300   SKKQTDLEWDIISQEANVINSLEANKLPELHCREFGYALSYKYMNNDTVQSALGVRNGTV  359

Query  645   TEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTE  466
               W RC  T           TY  NV++T+  H++ +    R LIYSGDHD+ VP+V T 
Sbjct  360   ETWSRCLKTFP---------TYTENVESTLYIHKNLSKTGLRALIYSGDHDISVPYVGTL  410

Query  465   KWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPM  286
              WI SL++ V D+WRPW+++ QVAGY +K+  + + LTY T+KG GHTAPEYKP EC  M
Sbjct  411   NWIRSLEIPVFDEWRPWYLDGQVAGYQVKFMNEHFRLTYVTIKGGGHTAPEYKPEECQAM  470

Query  285   IQRWLSIYPL  256
             + RW + YP+
Sbjct  471   VDRWFARYPI  480



>ref|XP_012093227.1| PREDICTED: serine carboxypeptidase-like 18 [Jatropha curcas]
Length=500

 Score =   371 bits (952),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 197/420 (47%), Positives = 261/420 (62%), Gaps = 37/420 (9%)
 Frame = -3

Query  1443  KIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELN  1300
             ++QLFYYF+ESE +P+ D                 L    GPL+ NYA S    P LELN
Sbjct  76    EVQLFYYFVESEGNPQEDPLLLWLTGGPGCSGFSALVYEIGPLSFNYAKSRVK-PTLELN  134

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             PY+WTKVA+IIF+D PVGTG+SY+ TS AY ++DT      Y FL +WLLDHP F +N L
Sbjct  135   PYSWTKVASIIFLDAPVGTGFSYATTSQAYQSSDTNQGAANYEFLRKWLLDHPEFQSNRL  194

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMG  940
             Y+AGDSYSG  VPLVV+   +G ++G  P++N+ G + GNP+T    DTN+R  Y    G
Sbjct  195   YIAGDSYSGKIVPLVVKETVNGNDAGRNPKMNLVGYVLGNPVTDEAKDTNSRFKYASFTG  254

Query  939   FLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN-----PE  775
              +S+ +Y++ K +C GNY  A P+N+AC   LQ   +C EKIN+ QILEP C      P 
Sbjct  255   LISEEVYETGKRNCKGNYTYAEPNNTACAVVLQVYEQCIEKINLMQILEPFCGYLSPKPS  314

Query  774   ILLS---------LDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNH  622
              L           +D       WCR  NY+ +Y+W N+K+VQKAL +REGT+  W+RCN 
Sbjct  315   KLERAESALMEDPIDIHTSRSPWCRTYNYIPSYAWLNDKMVQKALHIREGTIENWVRCNT  374

Query  621   TLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKV  442
             +L           Y  ++ ++   HR+ T K  +VLIYSGD D+ VP +ST  WIE+L +
Sbjct  375   SL----------LYTKDLTSSFGLHRNLTEKGLKVLIYSGDQDISVPFLSTMAWIEALNL  424

Query  441   GVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIY  262
              +E DW PWF++ QVAGY M+Y +  Y LTYAT+KG GHTAPEYKP+EC  MI RWL  +
Sbjct  425   TIEYDWNPWFLDGQVAGYWMEYYRNMYMLTYATIKGGGHTAPEYKPKECFAMIDRWLGFF  484



>ref|XP_007199854.1| hypothetical protein PRUPE_ppa005665mg [Prunus persica]
 gb|EMJ01053.1| hypothetical protein PRUPE_ppa005665mg [Prunus persica]
Length=449

 Score =   369 bits (947),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 196/429 (46%), Positives = 260/429 (61%), Gaps = 63/429 (15%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEt-------------dplllwltggpgplTINYANSTGDIPDLELN  1300
             +QLFYYF ESE SPE                    +    GPL+ +YA+S G+ P L+LN
Sbjct  50    VQLFYYFFESEGSPEYDPLVLWLTGGPGCSAFSAIVYENLGPLSFDYAHSIGNKPKLKLN  109

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAY-NTNDTLSAQHTYSFLVQWLLDHPTFLNNP  1123
             PY+WTKVANIIF+D PVGTG+SY++  + Y N NDTLSA  TY FL +WL+DHP F NNP
Sbjct  110   PYSWTKVANIIFLDAPVGTGFSYAKNWEGYSNLNDTLSAAQTYEFLRKWLMDHPKFYNNP  169

Query  1122  LYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRM  943
             LY+AGDSYSGITVP++V+ I DG +    P +N+KG + GNP T+  ++ N +V++ Y  
Sbjct  170   LYIAGDSYSGITVPMLVQEISDGNQDEHVPPMNLKGYVLGNPGTNGKNNNNYKVLFAYLK  229

Query  942   GFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-------  784
               +SD LY+S K++C G Y +   +N+ C  DL+   +C E I   QILEP+C       
Sbjct  230   ALISDELYQSMKKNCKGEYTNVDLNNTLCVEDLELYNECIEDIQSVQILEPSCTLVASPK  289

Query  783   -------------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMT  643
                             + L L    LP+ WCR  NYLF+Y WAN+K VQ AL ++EG++ 
Sbjct  290   SAGSKWNINYFSDKDSVNLLLSFPQLPRPWCRSYNYLFSYIWANDKTVQDALHIQEGSIK  349

Query  642   EWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEK  463
             EWLRCNHTL         ++Y+F+V +++ YH +   +  RVLIYSGDHDM+VP+V+T  
Sbjct  350   EWLRCNHTL--------KDSYIFDVSSSLVYHENLIKQGYRVLIYSGDHDMLVPYVATMA  401

Query  462   WIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMI  283
             WIESL + V+  W+PWFV+ Q                     GAGHTAPEYKP EC  MI
Sbjct  402   WIESLNLTVDSRWKPWFVDGQ---------------------GAGHTAPEYKPEECHAMI  440

Query  282   QRWLSIYPL  256
              RW + YPL
Sbjct  441   SRWFAYYPL  449



>gb|KCW63571.1| hypothetical protein EUGRSUZ_G01198 [Eucalyptus grandis]
Length=471

 Score =   368 bits (944),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 192/420 (46%), Positives = 259/420 (62%), Gaps = 41/420 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             +QLFYYF+ESE+SP  D              L  L    GP T NY  ST   P L+LN 
Sbjct  55    VQLFYYFVESERSPRDDPLVLWLTGGPGCSALSGLIYEIGPFTFNYEKSTRFRPSLKLND  114

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTKVANIIF+DQPVGTG+SY+   ++YN ND +S   +Y FL +WL  HP FL+NPLY
Sbjct  115   YSWTKVANIIFLDQPVGTGFSYANNWESYNINDNISVAESYEFLRKWLKLHPQFLSNPLY  174

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             +AGDSYSG+TVP V   +  G E+G+EP++N++G + GNPLT+  SD N+RV + +  G 
Sbjct  175   IAGDSYSGVTVPRVALEVDKGNEAGLEPKMNLEGYVLGNPLTNYDSDLNSRVPFAHLKGL  234

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---------  784
             + + LY+S K  CNG YI+    N+ C  DL+ V  C E I+   ILEP C         
Sbjct  235   IPNELYESAKTDCNGKYINVNESNADCVDDLKAVNLCVENIDTANILEPNCVTQSPKSTV  294

Query  783   ----NPEIL------LSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWL  634
                 +P ++      L L  E   + WCR+ NYL+ Y WA+ K+V+ AL +REGT+ +W+
Sbjct  295   SDRWDPTLINRDPSPLLLPTERASRVWCRNYNYLYIYIWASAKVVRDALHIREGTVEKWV  354

Query  633   RCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIE  454
             RCN TLS          Y  N    +D H+    +  RVLIYSGDHDM++P+V T+ WI+
Sbjct  355   RCNKTLS----------YTSNFLVVIDIHKELIKRGFRVLIYSGDHDMVIPYVGTQAWID  404

Query  453   SLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRW  274
             +L + + +DW  WFV+ QVAGY   YS      T+ TVKGAGHTAPEYKP+EC  +I+++
Sbjct  405   TLNLTISEDWHAWFVDGQVAGYATLYSSFPSLFTFVTVKGAGHTAPEYKPKECFALIRKF  464



>ref|XP_010065871.1| PREDICTED: serine carboxypeptidase-like 2 isoform X3 [Eucalyptus 
grandis]
Length=470

 Score =   367 bits (943),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 192/421 (46%), Positives = 256/421 (61%), Gaps = 41/421 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             +QLFYYF+ESE+SP  D              L  L    GP T NY  S+   P L+LN 
Sbjct  55    VQLFYYFVESERSPRDDPLVLWLTGGPGCSALSGLIYEIGPFTFNYEKSSRFRPALKLND  114

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTKVANIIF+DQPVGTG+SY+   ++YN +D +S   +Y FL +WL  HP FL+NPLY
Sbjct  115   YSWTKVANIIFLDQPVGTGFSYANNWESYNVDDNISVAESYEFLRKWLKLHPQFLSNPLY  174

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             +AGDSYSG+TVP V   +  G E+G+EP++N++G + GNPLT   SD N+RV + +  G 
Sbjct  175   IAGDSYSGVTVPRVALEVDKGNEAGLEPKMNLEGYVLGNPLTSYDSDLNSRVPFAHLKGL  234

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---------  784
             +S+ LY+S K  CN  YI+    N+ C  DL+ V  C E I    ILEP C         
Sbjct  235   ISNELYESAKTDCNNEYINVNESNADCVDDLKAVNLCVENIRTANILEPNCVTQSPKSTV  294

Query  783   ----NPEIL------LSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWL  634
                 +P ++      L L  E   + WCR+ NYL++Y WA+++ VQ AL +REGT+ +W+
Sbjct  295   SDRWDPTLINRDPSPLLLPTERASRVWCREYNYLYSYIWASDRAVQDALHIREGTVEKWV  354

Query  633   RCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIE  454
             RCN TLS          Y  NV   +D H+    +  R LIYSGDHDM+ P+V T+ WI+
Sbjct  355   RCNKTLS----------YTSNVLVVIDIHKELIKRGFRALIYSGDHDMVFPYVGTQAWID  404

Query  453   SLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRW  274
             +L + + +DW  WFV+ QVAGY   YS      T+ TVKGAGHTAPEYKP+EC  +I RW
Sbjct  405   TLNLTISEDWHAWFVDGQVAGYATLYSSFPSLFTFVTVKGAGHTAPEYKPKECFALISRW  464

Query  273   L  271
              
Sbjct  465   F  465



>gb|KCW63569.1| hypothetical protein EUGRSUZ_G01197 [Eucalyptus grandis]
Length=470

 Score =   366 bits (940),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 192/422 (45%), Positives = 257/422 (61%), Gaps = 41/422 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             +QLFYYF+ESE+SP  D              L  L    GP T NY  S+   P L+LN 
Sbjct  55    VQLFYYFVESERSPRDDPLVLWLTGGPGCSALSGLIYEIGPFTFNYEKSSRFRPALKLND  114

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTKVANIIF+DQPVGTG+SY+   ++YN +D +S   +Y FL +WL  HP FL+NPLY
Sbjct  115   YSWTKVANIIFLDQPVGTGFSYANNWESYNVDDNISVAESYEFLRKWLKLHPQFLSNPLY  174

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             +AGDSYSG+TVP V   +  G E+G+EP++N++G + GNPLT   SD N+RV + +  G 
Sbjct  175   IAGDSYSGVTVPRVALEVDKGNEAGLEPKMNLEGYVLGNPLTSYDSDLNSRVPFAHLKGL  234

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---------  784
             +S+ LY+S K  CN  YI+    N+ C  DL+ V  C E I    ILEP C         
Sbjct  235   ISNELYESAKTDCNNEYINVNESNADCVDDLKAVNLCVENIRTANILEPNCVTQSPKSTV  294

Query  783   ----NPEIL------LSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWL  634
                 +P ++      L L  E   + WCR+ NYL++Y WA+++ VQ AL +REGT+ +W+
Sbjct  295   SDRWDPTLINRDPSPLLLPTERASRVWCREYNYLYSYIWASDRAVQDALHIREGTVEKWV  354

Query  633   RCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIE  454
             RCN TLS          Y  NV   +D H+    +  R LIYSGDHDM+ P+V T+ WI+
Sbjct  355   RCNKTLS----------YTSNVLVVIDIHKELIKRGFRALIYSGDHDMVFPYVGTQAWID  404

Query  453   SLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRW  274
             +L + + +DW  WFV+ QVAGY   YS      T+ TVKGAGHTAPEYKP+EC  +I RW
Sbjct  405   TLNLTISEDWHAWFVDGQVAGYATLYSSFPSLFTFVTVKGAGHTAPEYKPKECFALICRW  464

Query  273   LS  268
              +
Sbjct  465   FN  466



>ref|XP_002269439.1| PREDICTED: serine carboxypeptidase-like 7 [Vitis vinifera]
Length=488

 Score =   367 bits (941),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 191/427 (45%), Positives = 261/427 (61%), Gaps = 43/427 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             +QLFYYFIESE++P  D                 L    GPL  +     G +P L+LNP
Sbjct  73    VQLFYYFIESERNPRLDPLVLWLTGGPGCSGFSALVYEIGPLAFDVEGYDGILPTLKLNP  132

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTKVA+IIF+D PVGTG+SY+ETS  YN +DT SA  TY FL +WL  HP F  NPLY
Sbjct  133   YSWTKVASIIFIDAPVGTGFSYAETSYGYNVSDTSSAAQTYQFLRKWLTFHPNFAGNPLY  192

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             + GDSYSGI  P+++++I  GLE G++P++ ++G + GNPLT    D N+R+ Y +R+  
Sbjct  193   IGGDSYSGIVAPILIKDILHGLEVGLQPKIELQGYLLGNPLTDYLIDDNSRIPYAHRVSL  252

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---NPEI--  772
             +SD LYK+ KE+CNG+Y +   +N+ C   LQ +  C  +IN+  ILEP C   +P+   
Sbjct  253   ISDGLYKAAKETCNGDYGNVDINNTLCVEALQTIKMCLLQINIAMILEPQCAFASPQTTE  312

Query  771   ---------------LLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEW  637
                            LLSL    +P+  CR  +Y+ +Y W N+  VQ AL V+ GT+  W
Sbjct  313   LQWDLRVQENTTMNYLLSL--SRIPELRCRSFSYVLSYKWLNDINVQNALHVQPGTVKTW  370

Query  636   LRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWI  457
              RC  +           +Y  NV +TV YH++FT    R LIYSGDHD+  P++ T +WI
Sbjct  371   RRCPKSF---------PSYTENVDSTVAYHKNFTRTGLRALIYSGDHDLSTPYIGTLEWI  421

Query  456   ESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQR  277
             +SL V V D WRPW+V+ Q+AGYT K+    Y LTYAT+KGAG TAPEYK +E L ++ R
Sbjct  422   KSLDVPVFDKWRPWYVDGQIAGYTTKFMNDHYRLTYATLKGAGLTAPEYKHKESLALVDR  481

Query  276   WLSIYPL  256
             W + YP+
Sbjct  482   WFAYYPI  488



>emb|CBI22419.3| unnamed protein product [Vitis vinifera]
Length=463

 Score =   366 bits (939),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 191/427 (45%), Positives = 261/427 (61%), Gaps = 43/427 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             +QLFYYFIESE++P  D                 L    GPL  +     G +P L+LNP
Sbjct  48    VQLFYYFIESERNPRLDPLVLWLTGGPGCSGFSALVYEIGPLAFDVEGYDGILPTLKLNP  107

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTKVA+IIF+D PVGTG+SY+ETS  YN +DT SA  TY FL +WL  HP F  NPLY
Sbjct  108   YSWTKVASIIFIDAPVGTGFSYAETSYGYNVSDTSSAAQTYQFLRKWLTFHPNFAGNPLY  167

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             + GDSYSGI  P+++++I  GLE G++P++ ++G + GNPLT    D N+R+ Y +R+  
Sbjct  168   IGGDSYSGIVAPILIKDILHGLEVGLQPKIELQGYLLGNPLTDYLIDDNSRIPYAHRVSL  227

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---NPEI--  772
             +SD LYK+ KE+CNG+Y +   +N+ C   LQ +  C  +IN+  ILEP C   +P+   
Sbjct  228   ISDGLYKAAKETCNGDYGNVDINNTLCVEALQTIKMCLLQINIAMILEPQCAFASPQTTE  287

Query  771   ---------------LLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEW  637
                            LLSL    +P+  CR  +Y+ +Y W N+  VQ AL V+ GT+  W
Sbjct  288   LQWDLRVQENTTMNYLLSL--SRIPELRCRSFSYVLSYKWLNDINVQNALHVQPGTVKTW  345

Query  636   LRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWI  457
              RC  +           +Y  NV +TV YH++FT    R LIYSGDHD+  P++ T +WI
Sbjct  346   RRCPKSF---------PSYTENVDSTVAYHKNFTRTGLRALIYSGDHDLSTPYIGTLEWI  396

Query  456   ESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQR  277
             +SL V V D WRPW+V+ Q+AGYT K+    Y LTYAT+KGAG TAPEYK +E L ++ R
Sbjct  397   KSLDVPVFDKWRPWYVDGQIAGYTTKFMNDHYRLTYATLKGAGLTAPEYKHKESLALVDR  456

Query  276   WLSIYPL  256
             W + YP+
Sbjct  457   WFAYYPI  463



>ref|XP_010065865.1| PREDICTED: serine carboxypeptidase-like 2 isoform X2 [Eucalyptus 
grandis]
 gb|KCW63575.1| hypothetical protein EUGRSUZ_G01200 [Eucalyptus grandis]
Length=470

 Score =   365 bits (937),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 189/421 (45%), Positives = 257/421 (61%), Gaps = 41/421 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             +QLFYYF+ESE+SP  D              L  L    GP T NY  S+   P L+LN 
Sbjct  55    VQLFYYFVESERSPRDDPLVLWLTGGPGCSALSGLIYEIGPFTFNYEKSSRFRPALKLND  114

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTKVANIIF+DQP+GTG+SY+   ++YN +D +S   +Y FL +WL  HP FL+NPLY
Sbjct  115   YSWTKVANIIFLDQPIGTGFSYANNWESYNIDDNISIAESYEFLRKWLKLHPQFLSNPLY  174

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             +AGDSYSG+TVP V   +  G E+G+EP++N++G + GNPLT+  SD N+RV + +  G 
Sbjct  175   IAGDSYSGVTVPNVALEVDKGNEAGLEPKMNLEGYVIGNPLTNHDSDLNSRVPFAHLKGL  234

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---------  784
             + + LY+S K  CN  YI+    N+ C  DL+ V  C E I+   ILEP C         
Sbjct  235   IPNELYESAKTDCNNEYINVNESNADCVDDLKAVNLCVENIDTANILEPKCVTQSPKSTV  294

Query  783   ----NPEIL------LSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWL  634
                 +P ++      L L  E   + WCR+ NYL+ Y WA+ K+V+ AL +REGT+ +W+
Sbjct  295   SDRWDPTLINRDPSPLLLPTERASRVWCRNYNYLYIYIWASAKVVRDALHIREGTVEKWV  354

Query  633   RCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIE  454
             RCN TLS          Y  NV   +D H+    +  R L+YSGDHDM++P+V T+ WI+
Sbjct  355   RCNKTLS----------YTSNVLVVIDIHKELIKRGFRALVYSGDHDMVIPYVGTQAWID  404

Query  453   SLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRW  274
             +L + + +DW  WFV+ QVAGY   YS      T+ TVKGAGHTAPEYKP+EC  +I RW
Sbjct  405   TLNLTISEDWHAWFVDGQVAGYATLYSSFPSLFTFVTVKGAGHTAPEYKPKECFALISRW  464

Query  273   L  271
              
Sbjct  465   F  465



>gb|EYU37560.1| hypothetical protein MIMGU_mgv1a005845mg [Erythranthe guttata]
Length=468

 Score =   365 bits (937),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 190/435 (44%), Positives = 264/435 (61%), Gaps = 48/435 (11%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V ++ ++QLFYYF+ESE+ P  D                 L    GPL  +  +  G  P
Sbjct  48    VGDDDEVQLFYYFVESERDPRKDPLIFWLTGGPGCSGFSGLVYEIGPLAFDVVDFDGSFP  107

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
                LNPY+WTK+A+IIF+D PVGTG+SY+ TS++Y T+DT S +  Y FL +WL  HP F
Sbjct  108   SFTLNPYSWTKIASIIFIDSPVGTGFSYTNTSESYATSDTKSTEDNYVFLRKWLSLHPRF  167

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             + N LY+AGDSY G   P+V R I +G E+G++PR+ ++G I GN  T    D N ++ Y
Sbjct  168   VKNRLYIAGDSYGGKITPMVARAISEGNEAGLQPRMLLQGYIVGNSRTDANKDDNEKIPY  227

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
              +RMG +SD  ++  K SC G Y++  P N  C+Y L+ V +CT+ +N P ILEP C   
Sbjct  228   AHRMGLVSDEYFELAKSSCLGEYVNPDPDNIECKYALRLVNECTKLVNNPHILEPKCKFL  287

Query  783   --NPE-----------------ILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGV  661
               NP                  + +S   ++L    CR+ NY  +Y WANN+ VQ+AL +
Sbjct  288   SPNPNYSQRGPLFVEDDPVDDVLFMSTQDDSL----CRNYNYASSYVWANNETVQEALHI  343

Query  660   REGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVP  481
             R+GT+ +W RCN +LS          Y ++V++ ++ HR  + K  + L YSGDHDM +P
Sbjct  344   RKGTIPDWKRCNKSLS----------YEYDVESVLEDHRLLSEKGFQALAYSGDHDMSIP  393

Query  480   HVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPR  301
             ++ST KWI  L + V+DDWRPW    QVAGYT KY   +  +T+ATVKGAGHTAPEYKP+
Sbjct  394   YMSTLKWIRELNLTVDDDWRPWTANGQVAGYTQKYKNNQAYITFATVKGAGHTAPEYKPK  453

Query  300   ECLPMIQRWLSIYPL  256
             EC  M +RWLS+YPL
Sbjct  454   ECFAMFERWLSLYPL  468



>ref|XP_007201024.1| hypothetical protein PRUPE_ppa006101mg [Prunus persica]
 gb|EMJ02223.1| hypothetical protein PRUPE_ppa006101mg [Prunus persica]
Length=427

 Score =   362 bits (930),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 183/408 (45%), Positives = 253/408 (62%), Gaps = 56/408 (14%)
 Frame = -3

Query  1443  KIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELN  1300
             ++QLFYYFIESE+SPE D                 L    GP++ ++ + T D  +L LN
Sbjct  64    ELQLFYYFIESERSPENDPLLLWITGGPRCSAFSGLVYEIGPISFSFTSITKDPAELVLN  123

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             PY+WTK+ANIIF+D P GTG+SYS T+D YNT+D++ A+    FL +WL  H  FL NPL
Sbjct  124   PYSWTKLANIIFLDAPAGTGFSYSTTTDGYNTSDSIHAKRASDFLQKWLSTHRKFLANPL  183

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMG  940
             Y++GDSYSG  VP++V+ I +G+E+G EP LN+KG I G+P+T+   D N+R+ + +RM 
Sbjct  184   YISGDSYSGKIVPIIVQEIVNGIEAGTEPPLNLKGYIIGDPVTNEKEDLNSRIEFAHRMA  243

Query  939   FLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPEILLSL  760
              +S+ +Y+STK +C G Y+D  P+N  C  +LQ   +                       
Sbjct  244   LISNRMYESTKRNCKGEYVDVDPNNQLCLNNLQAFKEV----------------------  281

Query  759   DGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETY  580
                         D   ++  WAN+  V+K+L +REGT  EW RCN          RS  Y
Sbjct  282   ------------DRLRYSVVWANDMKVRKSLNIREGTKGEWARCN----------RSTPY  319

Query  579   VFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQ  400
             + +V+  V+YHR+ + KS R  +YSGDHD+ VP+VSTE WIESL + ++DDW+PWF  +Q
Sbjct  320   IKDVQRAVEYHRNLSQKSLRAFVYSGDHDLSVPYVSTEAWIESLSLPIDDDWKPWFSNNQ  379

Query  399   VAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             VAGYT++YS  EY LTYAT+KG GHTAPE+ P+EC  MI+RWL   PL
Sbjct  380   VAGYTVRYSNGEYHLTYATIKGGGHTAPEFNPKECFDMIKRWLEHSPL  427



>ref|XP_012093215.1| PREDICTED: serine carboxypeptidase-like 18 [Jatropha curcas]
Length=393

 Score =   361 bits (926),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 176/383 (46%), Positives = 245/383 (64%), Gaps = 29/383 (8%)
 Frame = -3

Query  1347  INYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSF  1168
              +Y    G +P L  N Y+WTK+ANIIF+D PVGTG+SYS++ + Y T+DTLS++  Y F
Sbjct  21    FDYEAFNGSLPSLIENQYSWTKIANIIFLDAPVGTGFSYSKSQEGYYTSDTLSSKAIYQF  80

Query  1167  LVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTH  988
             L +W++DHP FL NPLY+AGDSYSG+ VP V   + +G  +  +P LN++G + GNP+T 
Sbjct  81    LRKWIIDHPKFLYNPLYIAGDSYSGMIVPTVTIEVVEGNRAKHKPYLNLQGYMLGNPVTD  140

Query  987   RFSDTNNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINM  808
               +D N+RV Y YR+G +S+ LY +    C G YI     N+ C   +Q + +CT KI  
Sbjct  141   LHNDENSRVEYFYRVGLISNELYTAATTYCVGEYISPNISNADCMDTIQHIAECTLKICD  200

Query  807   PQILEPAC------------------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKI  682
              QILEP C                  +  I ++L  E +P  WCR+ NY+ +Y WAN++ 
Sbjct  201   AQILEPKCTLASPKPKGLKWGRKFFDDTPIDIALSSEEVPDNWCRNSNYVLSYIWANDEG  260

Query  681   VQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSG  502
             VQ+AL +R GT+T+W RCN TL+          Y +++ +TV YH+       R L+YSG
Sbjct  261   VQEALHIRNGTITDWKRCNKTLA----------YEYDLLSTVFYHKELLTAGYRALVYSG  310

Query  501   DHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYE-LTYATVKGAGH  325
             DHDM++P+  T  WI SL + + D WRPWFVE Q+AG+T+KYS+   + LT+ATVKG GH
Sbjct  311   DHDMLIPYTGTVTWINSLNLTMSDGWRPWFVEGQIAGFTVKYSRDVGDGLTFATVKGGGH  370

Query  324   TAPEYKPRECLPMIQRWLSIYPL  256
             TAPEYKP+ECL M+ RWLS Y +
Sbjct  371   TAPEYKPKECLAMVDRWLSYYGM  393



>gb|EYU37561.1| hypothetical protein MIMGU_mgv1a005963mg [Erythranthe guttata]
Length=463

 Score =   362 bits (930),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 191/435 (44%), Positives = 264/435 (61%), Gaps = 48/435 (11%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V ++ ++QLFYYF+ESE+ P  D                 L    GPL  +  +  G  P
Sbjct  43    VGDDDEVQLFYYFVESERDPRKDPLIFWLTGGPGCSGFSGLVYEIGPLAFDVVDFDGSFP  102

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
                LNPY+WTK+A+IIF+D PVGTG+SY+ TS++Y T+DT S +  Y FL +WL  HP F
Sbjct  103   SFTLNPYSWTKIASIIFIDSPVGTGFSYTNTSESYATSDTKSTEDNYVFLRKWLSLHPRF  162

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L N LY+AGDSY G   P+V R I +G E+G++PR+ ++G I GN  T    D N ++ Y
Sbjct  163   LKNRLYIAGDSYGGKITPMVARAISEGNEAGLQPRMLLQGYIVGNSRTDANKDDNEKIPY  222

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
              +RMG +SD  ++  K SC G Y++  P N  C+Y L+ V +CT+ IN   ILEP C   
Sbjct  223   AHRMGLVSDEYFELAKSSCLGEYVNPDPDNIECKYALRLVNECTKLINNAHILEPMCKFL  282

Query  783   --NPE-----------------ILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGV  661
               NP                  + +S   ++L    CR+ NY  +Y WANN+ VQ+AL +
Sbjct  283   SPNPNNSQRDPLFVEDDPVEDFLFMSTQDDSL----CRNYNYASSYVWANNESVQEALHI  338

Query  660   REGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVP  481
             R+GT+ +W RCN +L          TY ++V++ ++ HR  + K  + L YSGDHDMI+P
Sbjct  339   RKGTIPDWKRCNTSL----------TYEYDVESVLEDHRLLSEKGFQALAYSGDHDMIIP  388

Query  480   HVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPR  301
             ++ST KWI  L + V+D+WRPW    QVAGYT KY   +  +T+ATVKGAGHTAPEYKP+
Sbjct  389   YMSTLKWIRELNLTVDDEWRPWTANGQVAGYTEKYKNNQAYITFATVKGAGHTAPEYKPK  448

Query  300   ECLPMIQRWLSIYPL  256
             EC  M +RWLS+YPL
Sbjct  449   ECFVMFERWLSLYPL  463



>gb|KDP44531.1| hypothetical protein JCGZ_16364 [Jatropha curcas]
Length=549

 Score =   365 bits (937),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 195/415 (47%), Positives = 258/415 (62%), Gaps = 37/415 (9%)
 Frame = -3

Query  1443  KIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELN  1300
             ++QLFYYF+ESE +P+ D                 L    GPL+ NYA S    P LELN
Sbjct  50    EVQLFYYFVESEGNPQEDPLLLWLTGGPGCSGFSALVYEIGPLSFNYAKSRVK-PTLELN  108

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             PY+WTKVA+IIF+D PVGTG+SY+ TS AY ++DT      Y FL +WLLDHP F +N L
Sbjct  109   PYSWTKVASIIFLDAPVGTGFSYATTSQAYQSSDTNQGAANYEFLRKWLLDHPEFQSNRL  168

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMG  940
             Y+AGDSYSG  VPLVV+   +G ++G  P++N+ G + GNP+T    DTN+R  Y    G
Sbjct  169   YIAGDSYSGKIVPLVVKETVNGNDAGRNPKMNLVGYVLGNPVTDEAKDTNSRFKYASFTG  228

Query  939   FLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN-----PE  775
              +S+ +Y++ K +C GNY  A P+N+AC   LQ   +C EKIN+ QILEP C      P 
Sbjct  229   LISEEVYETGKRNCKGNYTYAEPNNTACAVVLQVYEQCIEKINLMQILEPFCGYLSPKPS  288

Query  774   ILLS---------LDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNH  622
              L           +D       WCR  NY+ +Y+W N+K+VQKAL +REGT+  W+RCN 
Sbjct  289   KLERAESALMEDPIDIHTSRSPWCRTYNYIPSYAWLNDKMVQKALHIREGTIENWVRCNT  348

Query  621   TLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKV  442
             +L           Y  ++ ++   HR+ T K  +VLIYSGD D+ VP +ST  WIE+L +
Sbjct  349   SL----------LYTKDLTSSFGLHRNLTEKGLKVLIYSGDQDISVPFLSTMAWIEALNL  398

Query  441   GVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQR  277
              +E DW PWF++ QVAGY M+Y +  Y LTYAT+KG GHTAPEYKP+EC  MI R
Sbjct  399   TIEYDWNPWFLDGQVAGYWMEYYRNMYMLTYATIKGGGHTAPEYKPKECFAMIDR  453



>ref|XP_010065872.1| PREDICTED: serine carboxypeptidase-like 2 [Eucalyptus grandis]
Length=470

 Score =   362 bits (929),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 191/422 (45%), Positives = 252/422 (60%), Gaps = 41/422 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             +QLFYYF+ESE+SP  D              L  L    GP T NY NS+   P L+ N 
Sbjct  55    VQLFYYFVESERSPRDDHLVLWLTGGPGCSALSGLIYEIGPFTFNYENSSRFRPTLKFND  114

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTKVANIIF+DQPV TG+SY+   ++YN ND +S   +Y FL +WL  HP FL+NPLY
Sbjct  115   YSWTKVANIIFLDQPVRTGFSYANNWESYNINDNISVAESYEFLRKWLKLHPQFLSNPLY  174

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             +AGDSYSG+TVP V   +  G E+G+EP++N++G + GNPLT+  SD N+RV + +    
Sbjct  175   IAGDSYSGVTVPRVALEVDKGNEAGLEPKMNLEGYVLGNPLTNYDSDLNSRVPFAHLKSL  234

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE------  775
             + + LY+S K  CNG YI+    N+ C  DL+ V  C E IN   ILEP C P+      
Sbjct  235   IPNELYESAKTDCNGEYINVNESNADCVDDLKAVNLCVENINTANILEPTCVPQSPKSTV  294

Query  774   -------------ILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWL  634
                            L L  E   + WCR+ NYL+ Y WA+ K V  AL +REGT+ +W+
Sbjct  295   SDRWDPTLINRDPSPLLLSTERASRVWCRNYNYLYIYIWASAKAVPDALHIREGTVEKWV  354

Query  633   RCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIE  454
             RCN TLS          Y  +V   +D H+    +  R LIYSGDHDM++P+V T+ WI 
Sbjct  355   RCNKTLS----------YTSHVLVVIDIHKELIKRGFRALIYSGDHDMLIPYVGTQAWIH  404

Query  453   SLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRW  274
             +L + + +DW  WFV+ QVAGY   YS      T+ TVKGAGHTAPEYKP+EC  +I RW
Sbjct  405   TLNLTISEDWHAWFVDGQVAGYATLYSSFPSLFTFVTVKGAGHTAPEYKPKECFALICRW  464

Query  273   LS  268
              +
Sbjct  465   FN  466



>ref|XP_004296446.1| PREDICTED: serine carboxypeptidase-like 18 [Fragaria vesca subsp. 
vesca]
Length=475

 Score =   360 bits (925),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 187/424 (44%), Positives = 259/424 (61%), Gaps = 43/424 (10%)
 Frame = -3

Query  1437  QLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNPY  1294
             QLFYYF+ES++SP  D             +L       GPL+  Y +  G +P L LNPY
Sbjct  65    QLFYYFVESQRSPAEDPLMLWFTGGPGCSVLSAFFYESGPLSFTYVDYNGSLPSLHLNPY  124

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
             AWT+  NII+VD PVGTG+SYS T + Y  +D  +   +  FL +WL+ HP FLNN LY+
Sbjct  125   AWTQGLNIIYVDSPVGTGFSYSTTQEGYYIDDEDAVDQSVQFLRKWLMAHPQFLNNILYI  184

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFL  934
              GDSYSGI +P++V+ +YDG  +G+EP LN++G I GNP T  F D N+   + +R+  +
Sbjct  185   GGDSYSGIPLPIIVQQLYDGNNAGVEPYLNLRGYILGNPKTDDFIDVNSVNPFAHRLTLI  244

Query  933   SDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN---------  781
             SD LY+STKESC G+Y++   +N+ C  DL  + +   +IN+  +LEP C          
Sbjct  245   SDELYESTKESCGGDYVNVDDNNTVCVTDLAAIDQLLLQINIMHVLEPNCQVALPNNREE  304

Query  780   ---------PEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRC  628
                      PE LL+   E+ P  WCR  NY+    WAN+  V+KAL V E ++  W RC
Sbjct  305   PGRRSIRELPENLLT---ESTPALWCRYYNYVILGVWANDHAVRKALNVSENSIGVWKRC  361

Query  627   NHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESL  448
             N +++          Y   V ++V+YH++ ++ + R LIYSGDHDM VPH+ T++WI  L
Sbjct  362   NMSIA----------YTKTVTSSVEYHKNLSDTNLRALIYSGDHDMSVPHIGTQEWIRYL  411

Query  447   KVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLS  268
              +   + WRPW+V+ QVAGY+ K+S  +Y L YATVKGAGH APEYK +EC  MI RWL+
Sbjct  412   NLTNSEIWRPWYVDGQVAGYSEKFSNNDYSLQYATVKGAGHVAPEYKAKECYAMIDRWLA  471

Query  267   IYPL  256
              YPL
Sbjct  472   YYPL  475



>ref|XP_002300184.2| hypothetical protein POPTR_0001s31980g [Populus trichocarpa]
 gb|EEE84989.2| hypothetical protein POPTR_0001s31980g [Populus trichocarpa]
Length=452

 Score =   359 bits (921),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 181/407 (44%), Positives = 254/407 (62%), Gaps = 23/407 (6%)
 Frame = -3

Query  1437  QLFYYFIESEKSP------------EtdplllwltggpgplTINYANSTGDIPDLELNPY  1294
             +LFY F+ES+  P                 L       GPL  N  +  G +P+L  NPY
Sbjct  56    ELFYLFVESQGKPLEDPLLVYLVGGPGCSALTGFFFQVGPLIFNTTDYLGGLPELLYNPY  115

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
             +WTK A+IIF+D PVGTGYSY+  S+ Y+  DT SA+  + FL  WL+DHP F   P +V
Sbjct  116   SWTKTASIIFIDYPVGTGYSYATRSEGYHMTDTGSAKLVHQFLRTWLIDHPEFTKIPFFV  175

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFL  934
             A D+Y+GI  P+V + I+DG E+G++P +N+KG + G+P T    + N+RV   YR+  +
Sbjct  176   ASDTYAGIITPIVAKEIFDGNEAGLQPHINLKGFVSGSPHTDTALEHNSRVPLAYRLALI  235

Query  933   SDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPEILLSLDG  754
             S +LY+S+K+SC GNY+D  P N+ C  DL+++ +C  +IN   IL P C     LS + 
Sbjct  236   SRSLYESSKKSCKGNYVDVDPSNAPCLEDLEKINQCITQINKENILYPKC---ARLSPNS  292

Query  753   ENLPQQ-WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYV  577
              N  +  WC++  Y+    WAN++ V+ AL VR GT+T W  CN  L       +   Y 
Sbjct  293   NNEERNYWCQNFEYVLVDVWANDERVRDALHVRRGTVTTWYTCNSFL-------QDVLYT  345

Query  576   FNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQV  397
             +NV   VDY+++ T K  ++LIYSGDHDM+VP++STEKWI SL + V+ DWRPWFVE QV
Sbjct  346   YNVFTAVDYYQNLTRKGLQILIYSGDHDMVVPYISTEKWINSLNITVDRDWRPWFVEGQV  405

Query  396   AGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             AGYT+KY+   + LT+AT+KGAGH+  +Y PR C  M +RW+  YPL
Sbjct  406   AGYTVKYTDYGFRLTFATLKGAGHSPTQYTPRWCYNMFERWIHYYPL  452



>ref|XP_012075152.1| PREDICTED: serine carboxypeptidase-like 13 [Jatropha curcas]
Length=481

 Score =   359 bits (922),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 192/421 (46%), Positives = 257/421 (61%), Gaps = 36/421 (9%)
 Frame = -3

Query  1437  QLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNPY  1294
             QLFYYF+ES+ SP  D             +L  L    GPL  +Y N  G +P L LNP+
Sbjct  70    QLFYYFVESQGSPTLDPLMLWLTGGPGCSVLYALFYENGPLAFDYLNYNGSLPSLLLNPF  129

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
             AWT+  NII+VD PVGTG+SYS T + Y  +D  SA  TY FL +WL +HP +L N L++
Sbjct  130   AWTQRINIIYVDAPVGTGFSYSTTQENYYVDDIKSAAQTYEFLRKWLFEHPQYLTNQLFI  189

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFL  934
              GDSYSGI +P++V++I DG E+GI P +N+KG + GNP T  F D N++V + +R+  +
Sbjct  190   GGDSYSGIPLPIIVQHILDGNEAGISPIMNLKGYVLGNPKTDSFIDDNSKVPFAHRLTLI  249

Query  933   SDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC------NP--  778
             SD LYK+TKE C GNY++    N+AC  D+  + +   +IN  QILEP C      NP  
Sbjct  250   SDELYKATKEDCRGNYVNINMSNTACISDMNTINELILQINAVQILEPFCEVRSETNPTQ  309

Query  777   -EILLSLDGENL------PQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHT  619
                 L    EN+         WCR+ N + A  WANNK V+ AL VRE T+  W   N +
Sbjct  310   GRRSLHEYKENISIAPLNSAYWCREYNLVLADIWANNKSVRDALQVRENTIGVWKMGNGS  369

Query  618   LSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVG  439
                         Y  NV +TVDYHR+ + ++ R LIYSGDHD+++PH+ T+KWI  L + 
Sbjct  370   ---------GFAYTENVLSTVDYHRNLSKQNLRALIYSGDHDLLIPHIGTQKWIHLLNLT  420

Query  438   VEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYP  259
             +   WRPWF++ QVAGYT +Y   +Y L Y+TVKGAGH AP YKP+EC  MI R+L  +P
Sbjct  421   ITAYWRPWFLDGQVAGYTKQYVNGDYTLIYSTVKGAGHVAPAYKPKECYAMIDRFLGYFP  480

Query  258   L  256
             L
Sbjct  481   L  481



>ref|XP_002522137.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF40337.1| serine carboxypeptidase, putative [Ricinus communis]
Length=479

 Score =   359 bits (922),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 191/430 (44%), Positives = 256/430 (60%), Gaps = 41/430 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSP------------EtdplllwltggpgplTINYANSTGDIP  1315
             V E  ++QLFYYFIESE+ P                    L    GPL  +Y    G +P
Sbjct  58    VGELEELQLFYYFIESERDPVRDPLLLWLTGGPGCSAFSGLVYEIGPLNYDYDAFNGSLP  117

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L  N ++WTK+ANIIF+D PVGTG+SYS++ + Y T+DT S+Q  Y FL +WL+DHP F
Sbjct  118   SLVANEFSWTKIANIIFLDAPVGTGFSYSKSQEGYYTSDTESSQAIYQFLRKWLVDHPKF  177

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
              NNPLYVAGDSYSG+ VP V   I  G ++   P +N++G + GNP+T   +D N+RV Y
Sbjct  178   KNNPLYVAGDSYSGMIVPTVTVEIAKGNKAKHRPYMNLQGYMLGNPVTDLHNDENSRVEY  237

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
              YR+G +S  LY+  +E C G YI     N  C   +Q++ +CT K+   QILEP C   
Sbjct  238   FYRVGLISSELYQQAREDCRGEYIAPNISNVDCMDVIQQIAECTLKVCDAQILEPKCSFA  297

Query  783   ---------------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGT  649
                            +P I +    E  P  WCR+ NY+ +Y WAN++ VQ AL VR  T
Sbjct  298   SPKPQGLKWGPKFFHDPPIDIVSSSEESPNNWCRNANYVLSYIWANDEDVQNALHVRNDT  357

Query  648   MTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVST  469
             + +W RCN +L+          Y +N+ +TV YH+       R L+YSGDHDM++P+  T
Sbjct  358   IMDWKRCNKSLA----------YSYNMLSTVFYHKELIMNGYRALVYSGDHDMLIPYTGT  407

Query  468   EKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYE-LTYATVKGAGHTAPEYKPRECL  292
               WI +L +   D+WRPWFVE QVAG+T+KY+    + L +ATVKGAGHTAPEYKP+EC 
Sbjct  408   VHWIHTLNLTTVDEWRPWFVEGQVAGFTVKYAHNIGDGLVFATVKGAGHTAPEYKPKECF  467

Query  291   PMIQRWLSIY  262
              M+ RWLS Y
Sbjct  468   AMVDRWLSYY  477



>ref|XP_012093225.1| PREDICTED: serine carboxypeptidase-like 18 [Jatropha curcas]
Length=457

 Score =   358 bits (919),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 193/422 (46%), Positives = 257/422 (61%), Gaps = 37/422 (9%)
 Frame = -3

Query  1443  KIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELN  1300
             ++QLFYYF ESE +P+ D                 L    GPL+ NYA S    P LELN
Sbjct  47    EVQLFYYFFESEGNPQKDPLLLWLTGGPGCSGFSALVYEIGPLSFNYAKSRVK-PTLELN  105

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             PY+WTKVA+IIF+D PVGTG+SY+ TS AY ++DT      Y FL +   DHP F +N L
Sbjct  106   PYSWTKVASIIFLDAPVGTGFSYATTSQAYQSSDTNQGAANYEFLRKHFKDHPEFQSNRL  165

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMG  940
             Y+AGDSYSG  VPLVV+ I +G ++G  P +N+ G + GNP+T    DTN+R  Y Y  G
Sbjct  166   YIAGDSYSGKIVPLVVQEIVNGNDAGRNPNMNLVGYVLGNPVTDEAKDTNSRFKYAYFTG  225

Query  939   FLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN-----PE  775
              +S+ +Y++ K +C  NY  + P+N+AC   LQ   +C  KI +PQILEP C      P 
Sbjct  226   LISEEVYENGKRNCKRNYTYSEPNNTACAVVLQVYEECIAKIYIPQILEPYCGYWSTKPS  285

Query  774   ILLS---------LDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNH  622
              L           +D       WCR+ NY+ ++ W N+K+VQKAL +REGT+  WLRCN 
Sbjct  286   KLERAESALMEDPIDIHASRSPWCRNYNYIPSFVWLNDKMVQKALHIREGTIENWLRCNT  345

Query  621   TLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKV  442
             +L           Y  ++ ++   HR+   K  +VLIYSGD D+ VP +ST  WIE+L +
Sbjct  346   SL----------LYTKDLTSSFGIHRNLIEKGLKVLIYSGDQDISVPFLSTMAWIEALNL  395

Query  441   GVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIY  262
              +E +W PWF++ QVAGY M+Y +  Y LTYAT+KG GHTAPEYKP+EC  MI RWL  +
Sbjct  396   TIEHEWNPWFLDGQVAGYWMEYYRNMYMLTYATIKGGGHTAPEYKPKECFAMIDRWLGFF  455

Query  261   PL  256
             PL
Sbjct  456   PL  457



>ref|XP_002266615.3| PREDICTED: serine carboxypeptidase-like 17 [Vitis vinifera]
 emb|CBI25147.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   357 bits (917),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 191/425 (45%), Positives = 251/425 (59%), Gaps = 41/425 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             I+ FYYF+ES+ +P  D              L       GP+  N  + TG IP L   P
Sbjct  48    IEFFYYFVESQGNPGADPLILYMNGGPGCSGLNGFFYQVGPVVFNTTDYTGGIPTLLPYP  107

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
              +WTK ANIIFVD PVGTG+SY+ TS AY T+DTLS   T  FL  WL DHP F  NPL+
Sbjct  108   RSWTKTANIIFVDAPVGTGFSYATTSQAYTTSDTLSVIQTLGFLRNWLNDHPDFKLNPLF  167

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             +  DSYSG+  P++ + I DG   G EP +N+KG + G+P T    + N+R+VY +RM  
Sbjct  168   IGADSYSGLIAPIIAQEIMDGNGVGEEPHINLKGYLIGSPHTDTTIELNSRIVYAHRMAL  227

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-------NP  778
             +SD LY++ K  CNG Y+D  P N+ C   L+ ++ C E++++  ILEP C       N 
Sbjct  228   ISDALYEAAKTGCNGRYVDIDPSNAKCVEALESISLCIEQVSLQDILEPKCSFISPKQNK  287

Query  777   EILLSLDGEN-----LPQQ------WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLR  631
             EI  SL  EN     LP Q      WCR+  +  +  WAN K VQ AL +R GT+ E+ R
Sbjct  288   EIRRSLR-ENSRSFLLPSQYRTGNDWCRNFEHSLSDIWANYKSVQDALYIRPGTVEEFFR  346

Query  630   CNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIES  451
             CN +LS          Y  NV N   YH++ TN   RVL++SGDHDM++PHV  E+WI+S
Sbjct  347   CNSSLS----------YTENVNNVFGYHKNLTNSGLRVLVFSGDHDMVIPHVGIEQWIKS  396

Query  450   LKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
             L + +  DWRPWFV+ Q+ GYT KY  K Y LTY+T+KGAGH+  EY+ RE   M  RW+
Sbjct  397   LNISLGSDWRPWFVDGQIGGYTRKYVNKAYSLTYSTLKGAGHSPTEYRRRESYEMFYRWI  456

Query  270   SIYPL  256
               YPL
Sbjct  457   HHYPL  461



>emb|CAN83341.1| hypothetical protein VITISV_021484 [Vitis vinifera]
Length=488

 Score =   358 bits (918),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 180/394 (46%), Positives = 242/394 (61%), Gaps = 62/394 (16%)
 Frame = -3

Query  1284  KVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGD  1105
             KVA+IIF+D PVG+G+SY+++S+ Y T+D+L+A H Y FL +WL+DHP FL N LY+AGD
Sbjct  106   KVASIIFLDSPVGSGFSYAQSSEGYRTSDSLAAAHGYDFLKKWLIDHPEFLRNRLYIAGD  165

Query  1104  SYSGITVPLVVRNIYDGL------------------------------ESGIEPRLNMKG  1015
             SYSG+ VP++ + I DG                               E+G EP +N+ G
Sbjct  166   SYSGLFVPIIAQKISDGTYIHGHHSTCFMIYLPVVWLLNLGYFNIVGNEAGQEPHMNLNG  225

Query  1014  CIEGNPLTHRFSDTNNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRV  835
              + GN L     D N+RV + +RM FLSD LYK T+ SCNG Y+ A P N  C  +L+ V
Sbjct  226   YLLGNALVDENIDFNSRVPFAHRMTFLSDKLYKKTEASCNGKYLKADPSNGQCTENLKVV  285

Query  834   TKCTEKINMPQILEPACN---------------------PEILLSLDGENLPQQWCRDDN  718
              KC EKIN+P +LEP C                       + LLS     LP+  CR   
Sbjct  286   NKCMEKINLPHVLEPKCGRPLSWKPNALKWESIPLEENFSDFLLS-PIRQLPEPTCRLYK  344

Query  717   YLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSF  538
             +LF+Y WAN++ VQKALG+REGT+ EW+RCN++L+          Y  +V +TV Y +  
Sbjct  345   FLFSYIWANDRRVQKALGIREGTIPEWVRCNNSLA----------YTHDVFSTVAYIQKL  394

Query  537   TNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYE  358
               K    LIYSGDHDM+VPH+ T++WI SL + +  DW PWFV+ QVAG++++YS  +  
Sbjct  395   HEKGYGGLIYSGDHDMLVPHMGTQEWINSLNLSISKDWEPWFVDGQVAGFSIEYSNSKRG  454

Query  357   LTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             +T+ATVKG GHTAPEYKP+ECL MI RWL+ YPL
Sbjct  455   MTFATVKGGGHTAPEYKPKECLAMIYRWLAYYPL  488



>ref|XP_006369794.1| hypothetical protein POPTR_0001s31980g [Populus trichocarpa]
 gb|ERP66363.1| hypothetical protein POPTR_0001s31980g [Populus trichocarpa]
Length=472

 Score =   356 bits (913),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 180/424 (42%), Positives = 253/424 (60%), Gaps = 37/424 (9%)
 Frame = -3

Query  1437  QLFYYFIESEKSP------------EtdplllwltggpgplTINYANSTGDIPDLELNPY  1294
             +LFY F+ES+  P                 L       GPL  N  +  G +P+L  NPY
Sbjct  56    ELFYLFVESQGKPLEDPLLVYLVGGPGCSALTGFFFQVGPLIFNTTDYLGGLPELLYNPY  115

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
             +WTK A+IIF+D PVGTGYSY+  S+ Y+  DT SA+  + FL  WL+DHP F   P +V
Sbjct  116   SWTKTASIIFIDYPVGTGYSYATRSEGYHMTDTGSAKLVHQFLRTWLIDHPEFTKIPFFV  175

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFL  934
             A D+Y+GI  P+V + I+DG E+G++P +N+KG + G+P T    + N+RV   YR+  +
Sbjct  176   ASDTYAGIITPIVAKEIFDGNEAGLQPHINLKGFVSGSPHTDTALEHNSRVPLAYRLALI  235

Query  933   SDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC----------  784
             S +LY+S+K+SC GNY+D  P N+ C  DL+++ +C  +IN   IL P C          
Sbjct  236   SRSLYESSKKSCKGNYVDVDPSNAPCLEDLEKINQCITQINKENILYPKCARLSPNSNNE  295

Query  783   -NPEILLSLDGENLP-------QQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRC  628
                   L  + +  P         WC++  Y+    WAN++ V+ AL VR GT+T W  C
Sbjct  296   ERSRRFLKANSQRFPALSSKIQDYWCQNFEYVLVDVWANDERVRDALHVRRGTVTTWYTC  355

Query  627   NHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESL  448
             N  L       +   Y +NV   VDY+++ T K  ++LIYSGDHDM+VP++STEKWI SL
Sbjct  356   NSFL-------QDVLYTYNVFTAVDYYQNLTRKGLQILIYSGDHDMVVPYISTEKWINSL  408

Query  447   KVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLS  268
              + V+ DWRPWFVE QVAGYT+KY+   + LT+AT+KGAGH+  +Y PR C  M +RW+ 
Sbjct  409   NITVDRDWRPWFVEGQVAGYTVKYTDYGFRLTFATLKGAGHSPTQYTPRWCYNMFERWIH  468

Query  267   IYPL  256
              YPL
Sbjct  469   YYPL  472



>ref|XP_003633198.1| PREDICTED: serine carboxypeptidase-like 13 isoform X3 [Vitis 
vinifera]
Length=450

 Score =   354 bits (909),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 194/414 (47%), Positives = 265/414 (64%), Gaps = 28/414 (7%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtdplllwltggpgplTIN-YANSTGDIPDLELNPYAWTK  1282
             V EN ++QLFYYF++S+++P  DPL+LWL+GGPG  T+  +    G +P+L L    WTK
Sbjct  52    VGENEEVQLFYYFVKSQRNPVFDPLMLWLSGGPGCSTLTAFFYENGGLPNLYLKENTWTK  111

Query  1281  VANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDS  1102
               NIIFVD PVG+G+SYS+T + Y   D   A  TY FL +WL+DHP FL N LYV GDS
Sbjct  112   TLNIIFVDAPVGSGFSYSKTQEGYIMEDLKYAAQTYEFLKKWLVDHPEFLKNELYVGGDS  171

Query  1101  YSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFLSDNL  922
             YSGI VP+VV+ IY G      P LN++G + GNPLT   +D N+R+ + +R+  +SD L
Sbjct  172   YSGIPVPMVVQEIYYG-----SPSLNLQGYVLGNPLTDTDNDVNSRIPFAHRLTLISDEL  226

Query  921   YKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC------------NP  778
             Y+S K SCNG+Y+     N  C  D++ ++K  ++I + Q+LEP C            N 
Sbjct  227   YESAKTSCNGDYVTVNASNEQCVADMEAISKLIDQIYIMQVLEPNCGISSRKPKEGELNH  286

Query  777   EILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEA  598
                L+  GE     +C + NY+F+  WANNK V++AL VREGT   W+RCN T       
Sbjct  287   THFLTQLGEK-SAYFCHEYNYVFSEIWANNKDVREALRVREGTKGHWVRCNIT-------  338

Query  597   ERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRP  418
               +  +  +V +TV YH++ TN   R LIYSGDHDM +PH+ T++WI SL + +ED WR 
Sbjct  339   --NLAFTKDVTSTVAYHQNLTNTGLRALIYSGDHDMSIPHIGTQEWINSLNLTLEDPWRT  396

Query  417   WFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             W  + QVAGYT  ++  +++LT+ATVKGAGH A EYKP+EC  MI RW + YPL
Sbjct  397   WCTDGQVAGYTETFTNDDFDLTFATVKGAGHVAIEYKPKECYAMIDRWFAHYPL  450



>dbj|BAF99696.1| 1-O-acylglucose:anthocyanin-O-acyltransferase- like protein [Gentiana 
triflora]
Length=481

 Score =   355 bits (911),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 186/421 (44%), Positives = 258/421 (61%), Gaps = 30/421 (7%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V EN ++QLFYYFIESE+ P  D                 L    GPLT ++ +  G +P
Sbjct  71    VGENEELQLFYYFIESERDPANDPLVIWLTGGPGCSAFSGLIFEIGPLTFDFESYQGGVP  130

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L  NP++WTK A+IIFVD PVGTGYSYS T + Y++ D  ++   Y+FL +WLL HP F
Sbjct  131   TLNYNPHSWTKEASIIFVDSPVGTGYSYSNTFEGYHSTDHKASDDLYAFLRKWLLKHPKF  190

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L NP+YV GDSY G  V LV   I  G+++G EPR+N++G I GNP+   F D N  + +
Sbjct  191   LKNPVYVGGDSYGGKFVALVTWRISQGIDAGHEPRINLQGYIVGNPVADGFIDGNAPLPF  250

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
              +RMG +SD+++K  +E+CNGNYI A   N  C   +++  +CT  I    ILEP C  +
Sbjct  251   AHRMGLISDDIHKMAEENCNGNYIKADQSNGLCLEAIKQYEECTADICFDNILEPNCQEK  310

Query  774   I------LLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLS  613
             +      LL L  E   + WCR D+Y   + WAN+  VQKAL +REGT+ EW+RCN+++S
Sbjct  311   MTSHDISLLKLPSELKEEPWCRKDSYFLTHVWANDPSVQKALHIREGTIKEWVRCNYSIS  370

Query  612   GPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVE  433
                       Y   +   ++YH   + +  + L YSGDHD+ +P+ +T +WI +L + V 
Sbjct  371   ----------YSEKLDTVLEYHHLLSKRGYKTLAYSGDHDLYIPYTATLEWIHTLNLPVA  420

Query  432   DDWRPWFVEDQVAGYTMKYSQKEYE--LTYATVKGAGHTAPEYKPRECLPMIQRWLSIYP  259
             D+WRPW V++QVAGYT ++   E    +T+ATVK AGHTAPEYK RECL M+ R+ S  P
Sbjct  421   DEWRPWKVDNQVAGYTKRFIHNETGKYVTFATVKAAGHTAPEYKRRECLAMVARFFSDSP  480

Query  258   L  256
             L
Sbjct  481   L  481



>ref|XP_010656845.1| PREDICTED: serine carboxypeptidase-like 13 [Vitis vinifera]
Length=480

 Score =   355 bits (910),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 197/434 (45%), Positives = 272/434 (63%), Gaps = 43/434 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtdplllwltggpgplTIN---YANS--------TGDIPD  1312
             V EN  +QLFYYF++S+++P  DPL+LWLTGGPG  T++   Y +          G +P 
Sbjct  57    VGENESVQLFYYFVKSQRNPVLDPLVLWLTGGPGCSTLSAFFYESGPVSFNLTYNGGLPT  116

Query  1311  LELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFL  1132
             LEL  Y WT+  NII++D PVGTG+SYS T + Y T+D  SA   Y FL +WL+ HP FL
Sbjct  117   LELKEYTWTETLNIIYLDAPVGTGFSYSTTQEGYTTDDYKSAAQIYEFLKKWLIQHPEFL  176

Query  1131  NNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNM--KGCIEGNPLTHRFSDTNNRVV  958
              N LY+ GDSYSGI VP++V++IY   E G  PRLN+  +G + GNP+T  + D N+RV 
Sbjct  177   KNNLYIGGDSYSGIPVPMIVQDIYYDSERGGSPRLNLNLQGYVLGNPVTDAYIDKNSRVP  236

Query  957   YGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC--  784
             + +R+  +SD LY+S K +CNG+Y++A   +  C+ D+Q + +    IN+ QIL+P C  
Sbjct  237   FAHRLTLISDGLYESAKANCNGDYVNANASSEQCESDVQEIEELLRDINIQQILDPDCTF  296

Query  783   ------------------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVR  658
                               NP   LS  GE     +C D  Y+ + +WANN+ V++AL VR
Sbjct  297   SSPIPNEEKSNLQRSLAENPTDFLSQLGEE-TMYFCHDYMYILSETWANNRDVREALHVR  355

Query  657   EGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPH  478
             EGT   W RCN  +SG         Y  +V ++V YHR+ +    R LIYSGDHDM VPH
Sbjct  356   EGTKGYWKRCN--ISGL-------AYTEDVISSVAYHRNLSKTGLRALIYSGDHDMSVPH  406

Query  477   VSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRE  298
             + T++WI+SL + + D WR W+ E QVAGYT +Y+  ++ LTYATVKGAGH APEYKP++
Sbjct  407   IGTQQWIDSLNLTLADTWRAWYTEGQVAGYTKRYTNDDFALTYATVKGAGHVAPEYKPQQ  466

Query  297   CLPMIQRWLSIYPL  256
             C  M++RW + Y L
Sbjct  467   CYAMLKRWFAYYQL  480



>ref|XP_010682454.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=459

 Score =   353 bits (907),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 183/415 (44%), Positives = 257/415 (62%), Gaps = 24/415 (6%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYAN--STGD  1321
             V ++ ++QLFYYFIESE+  E D                 L    GPLT NY+   S   
Sbjct  55    VGKSEEVQLFYYFIESERDVERDPVLIWLTGGPGCSAYSGLVYEIGPLTFNYSAPYSEAS  114

Query  1320  IPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHP  1141
             IP  +LNPY+WTKVA+IIF+D PVGTG+SY  TSDAY ++D L +Q+ Y FL +WL  HP
Sbjct  115   IPKFQLNPYSWTKVASIIFLDSPVGTGFSYGTTSDAYYSDDILQSQNIYEFLQKWLTGHP  174

Query  1140  TFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRV  961
                 NPLYVAGDSYSG+ VP++V+ I DG +     ++N+ G I GNP+T     TN R+
Sbjct  175   KLKANPLYVAGDSYSGLIVPILVQEILDGNKKRHMQKINLMGYILGNPVTDGDISTNERI  234

Query  960   VYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN  781
              Y +R+  LSD +Y+S K +CN ++ +   +N+ C    + +T+    +N P ILE  C 
Sbjct  235   KYMHRVSLLSDEIYESAKANCNNDFANIDANNTKCLESFEAITEIRASVNTPHILESKCI  294

Query  780   PEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPE  601
                   ++  ++  + CR+ +Y+ +Y+WAN+  VQ+AL VREGT+  W+RCN +LS    
Sbjct  295   YVSPKPVNKVSIAAERCRNQHYMLSYTWANDVDVQEALHVREGTVDLWVRCNRSLS----  350

Query  600   AERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWR  421
                   Y  +V++++ YHR+F     R LIYSGD D  +P+V + +WI  L++  +  W 
Sbjct  351   ------YTLSVRSSISYHRNFAKTLLRALIYSGDQDAAIPYVDSLEWINQLELSTDTHWN  404

Query  420   PWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             PWFV  QVAGY  +Y +  Y LT+ T+KG GHTAPEYKPRECL MI RWL++ PL
Sbjct  405   PWFVNGQVAGYVTEYLRFPYRLTFTTIKGGGHTAPEYKPRECLAMIDRWLNLSPL  459



>gb|KDP44530.1| hypothetical protein JCGZ_16363 [Jatropha curcas]
Length=467

 Score =   354 bits (908),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 185/423 (44%), Positives = 263/423 (62%), Gaps = 39/423 (9%)
 Frame = -3

Query  1449  NLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLE  1306
             N ++QLFYYF+ESE++P+ D              L  +    GPL  NYAN T   P L 
Sbjct  51    NEEVQLFYYFVESERNPKDDPLVLWFTAGPGCSSLSAILYQHGPLHFNYANPTSSKPTLV  110

Query  1305  LNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNN  1126
             LNP++WTKVANII++D PVGTG+SY+ T   YN  D  SA  TY FL +WL+ HP FL+N
Sbjct  111   LNPHSWTKVANIIYLDAPVGTGFSYATTWRGYNIGDLSSAAQTYDFLRKWLMAHPKFLSN  170

Query  1125  PLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYR  946
             P+YV  DSY G+ VP++V+ I  G + G +P++N+KG I GNP+T   +D ++R+ Y ++
Sbjct  171   PMYVGSDSYGGLVVPIIVQEITTGNDKGNKPKINLKGYILGNPVTDYKNDLSSRIPYAHQ  230

Query  945   MGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNP----  778
                +S  LY+S KESC G Y++    N  C  +LQ V K  E++ +  ILEP C      
Sbjct  231   KALISSQLYESIKESCKGEYLNPDRSNKICISNLQAVNKTFEELYLYNILEPKCRSWDLS  290

Query  777   ---------EILLSLD---GENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWL  634
                       ++  +D      L ++WCRD   L+++ WAN+K VQ AL VREGT+TEW 
Sbjct  291   PLLGGTDLLTLMKKIDVFAATQLSREWCRDYMLLYSHIWANDKSVQSALHVREGTITEWP  350

Query  633   RCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSC-RVLIYSGDHDMIVPHVSTEKWI  457
             RCN +L           Y F+V + V YHR+FT  S  RVLI+SGDHD+ +P+++T  WI
Sbjct  351   RCNLSLR----------YDFDVLSVVQYHRNFTKTSAYRVLIFSGDHDLALPYLATYAWI  400

Query  456   ESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQR  277
             ++L + V  +W+PW V+ QVAG+ + YS+++Y LT+A V+G  H+A E +P+EC  MI R
Sbjct  401   QTLNLTVTKNWQPWLVDHQVAGHVIAYSKRKYNLTFAIVQGGSHSASEIRPKECFAMIDR  460

Query  276   WLS  268
             WL+
Sbjct  461   WLA  463



>ref|XP_010040884.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
Length=456

 Score =   353 bits (906),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 198/426 (46%), Positives = 249/426 (58%), Gaps = 52/426 (12%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             +QLFYYFIESE+SP+ D              L  L    GPL  NY NS+G+ P   LNP
Sbjct  52    VQLFYYFIESERSPKDDPLMLWLTGGPGCSSLSGLIYEIGPLNFNYKNSSGNRPTFLLNP  111

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTKVANI F          YS T + Y + D  SA  TY F V+WL+ HP F++NPLY
Sbjct  112   YSWTKVANISFWTN-CRRWILYSTTQEGYYSADLRSAAETYQFCVRWLVGHPQFMSNPLY  170

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             + GDSYSG+T+P++V  I +G E G  P LN+KG + GNPLT    D N+RVV+ +R   
Sbjct  171   IGGDSYSGMTLPIIVTEIVNGNEVGHLPPLNIKGYLLGNPLTDVLYDLNSRVVFAHRKAL  230

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---NP----  778
             +S+ +Y+S K +C G Y+   P N  C  DLQ V KC EKI    ILEP C   NP    
Sbjct  231   ISNEIYESAKNNCKGEYMHVDPENVDCGVDLQSVVKCIEKIFNAHILEPKCGTLNPTPNF  290

Query  777   ----EILLSLDGENL--------PQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWL  634
                   +L   G  +        P  WCR+ +YL+ Y WAN+K          GT TEW+
Sbjct  291   LKWDRRILGDGGSEINPLALLESPGPWCRNYDYLYCYVWANDK----------GTKTEWI  340

Query  633   RCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIE  454
             RCN           S +Y  +V  + DYH++ T K  R LIYSGDHDM+VP++ T  WIE
Sbjct  341   RCN----------ESSSYAHDVIKSTDYHQNLTEKKLRALIYSGDHDMVVPYIGTMAWIE  390

Query  453   SLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRW  274
             +L + +  DW  WFV+ QVAGYT +Y    YELTYATVKGAGHTAPEYKP+E L MI RW
Sbjct  391   TLNLSLSTDWEAWFVDGQVAGYTQQYEHDNYELTYATVKGAGHTAPEYKPKETLAMIYRW  450

Query  273   LSIYPL  256
              + YPL
Sbjct  451   FAHYPL  456



>ref|XP_010028342.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Eucalyptus 
grandis]
Length=430

 Score =   352 bits (904),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 198/431 (46%), Positives = 258/431 (60%), Gaps = 74/431 (17%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E  ++QLFYYFIESE+SP+ D              L  L    GPL  +Y++S+ + P
Sbjct  44    VGELQEVQLFYYFIESERSPKDDPLLLWLTGGPGCSALSGLLFEIGPLQFDYSDSSENRP  103

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L+LNPY+WTK+ANIIF+D PVGTG+SY+    AYN++DT SA  TY FL +WL+ HP F
Sbjct  104   VLKLNPYSWTKIANIIFLDAPVGTGFSYATAWRAYNSSDTSSATQTYEFLRKWLMSHPRF  163

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L NPLY+ GDSYSG+ VP++V+ +YDG E+G EP +N+K                     
Sbjct  164   LTNPLYITGDSYSGVVVPIIVKEVYDGNEAGREPPMNLK---------------------  202

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN--  781
                          STK+ CNG+Y++  P N AC  DL+ V+K  EKI + QILEP CN  
Sbjct  203   -------------STKKDCNGDYVNVDPTNGACLTDLEMVSKRLEKIYLAQILEPICNFM  249

Query  780   ----------PEILLS--LDGENLPQQ---WCRDDNYLFAYSWANNKIVQKALGVREGTM  646
                         IL    ++  ++P Q   WCR+ NYL++Y WAN++ VQ+AL +REGT 
Sbjct  250   SPNHTRLKWSRSILEENIINVVSMPLQSRPWCRNYNYLYSYIWANDRNVQEALHIREGTK  309

Query  645   TEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTE  466
              EW RCN +LS          Y  +V N+V YHR  +  S R LIYSGDHDM +P+V T 
Sbjct  310   PEWDRCNESLS----------YTKDVLNSVVYHRYLSKTSLRALIYSGDHDMAIPYVGTL  359

Query  465   KWIESLKVGVEDDWRPWFVEDQVAGYTMKY-SQKEYELTYATVKGAGHTAPEYKPRECLP  289
              WI SL + +   W PWFV  QVAGY+  Y    +Y+LTY T+KG GHTAPEYKP+EC  
Sbjct  360   DWIRSLNLTLLGMWSPWFVGGQVAGYSTLYVVGMKYDLTYTTIKGGGHTAPEYKPKECFA  419

Query  288   MIQRWLSIYPL  256
             M+ RW S YPL
Sbjct  420   MVDRWFSYYPL  430



>ref|XP_002266867.3| PREDICTED: serine carboxypeptidase-like 17 [Vitis vinifera]
 emb|CBI25151.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   353 bits (907),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 194/425 (46%), Positives = 259/425 (61%), Gaps = 41/425 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtdplllwltggpgplTIN---------YANST---GDIPDLELNP  1297
             I+ FYYF+ES+ +P  DPL+L++ GGPG   +N           N+T   G +P     P
Sbjct  48    IEFFYYFVESQGNPGADPLILYMNGGPGCSGLNGFFYQVGPVVFNTTDYIGGLPTFLPYP  107

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             ++WTK ANIIFVD PVGTG+SY+ TS AY T+DTLS   T  FL  WL DHP F  NPL+
Sbjct  108   HSWTKTANIIFVDAPVGTGFSYATTSQAYTTSDTLSVIQTLGFLRNWLNDHPDFKLNPLF  167

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             +  DSYSG+  P++ + I DG   G EP +N+KG + G+P T    + N+R+VY +RM  
Sbjct  168   IGADSYSGLIAPIIAQEIMDGNGVGEEPHINLKGYLIGSPHTDTTIELNSRIVYAHRMAL  227

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-------NP  778
             +SD LY++ K  CNG Y+D  P N+ C   L+ ++ C E++++  ILEP C       N 
Sbjct  228   ISDALYEAAKTGCNGRYVDIDPSNAKCVEALESISLCIEQVSLQDILEPKCSFISPKQNK  287

Query  777   EILLSLDGEN-----LPQQ------WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLR  631
             EI  SL  EN     LP Q      WCR+  +  +  WAN K VQ AL +R GT+ E+ R
Sbjct  288   EIRRSLR-ENSRSFLLPSQYRTGNDWCRNFEHSLSDIWANYKSVQDALYIRPGTVEEFFR  346

Query  630   CNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIES  451
             CN +LS          Y  NV N   YH++ TN   RVL++SGDHDM++PHV  E+WI+S
Sbjct  347   CNISLS----------YTENVNNVFGYHKNLTNSGLRVLVFSGDHDMVIPHVGIEQWIKS  396

Query  450   LKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
             L + +  DWRPWFV+ Q+ GYT KY  K Y LTY+T+KGAGH+  EY+ RE   M  RW+
Sbjct  397   LNISLGSDWRPWFVDGQIGGYTRKYVNKAYSLTYSTLKGAGHSPTEYRRRESYEMFYRWI  456

Query  270   SIYPL  256
               YPL
Sbjct  457   HHYPL  461



>emb|CAN78674.1| hypothetical protein VITISV_009248 [Vitis vinifera]
Length=461

 Score =   353 bits (905),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 194/425 (46%), Positives = 257/425 (60%), Gaps = 41/425 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtdplllwltggpgplTIN---------YANST---GDIPDLELNP  1297
             I+ FYYF+ES+ +P  DPL+L++ GGPG   +N           N+T   G  P     P
Sbjct  48    IEFFYYFVESQGNPGADPLILYMNGGPGCSGLNGFFYQVGPVVFNTTDYXGGJPTXLPYP  107

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
              +WTK ANIIFVD PVGTG+SY+ TS AY T+DTLS   T  FL  WL DHP F  NPL+
Sbjct  108   XSWTKTANIIFVDAPVGTGFSYATTSQAYTTSDTLSVIQTLGFLRNWLNDHPDFKLNPLF  167

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             +  DSYSG+  P++ + I DG   G EP +N+KG + G+P T    + N+R+VY +RM  
Sbjct  168   IGADSYSGLIAPIIAQEIMDGNGVGEEPHINLKGYLIGSPHTDTTIELNSRIVYAHRMAL  227

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-------NP  778
             +SD LY++ K  CNG Y+D  P N+ C   L+ ++ C E++++  ILEP C       N 
Sbjct  228   ISDALYEAAKTGCNGRYVDIDPSNAKCVEALESISLCIEQVSLQDILEPKCSFISPKQNK  287

Query  777   EILLSLDGEN-----LPQQ------WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLR  631
             EI  SL  EN     LP Q      WCR+  +  +  WAN K VQ AL +R GT+ E+ R
Sbjct  288   EIRRSLR-ENSRSFLLPSQYRTGNDWCRNFEHSLSDIWANYKSVQDALYIRPGTVEEFFR  346

Query  630   CNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIES  451
             CN +LS          Y  NV N   YH++ TN   RVL++SGDHDM++PHV  E+WI+S
Sbjct  347   CNSSLS----------YTENVNNVFGYHKNLTNSGLRVLVFSGDHDMVIPHVGIEQWIKS  396

Query  450   LKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
             L + +  DWRPWFV+ Q+ GYT KY  K Y LTY+T+KGAGH+  EY+ RE   M  RW+
Sbjct  397   LNISLGSDWRPWFVDGQIGGYTRKYVNKAYSLTYSTLKGAGHSPTEYRRRESYEMFYRWI  456

Query  270   SIYPL  256
               YPL
Sbjct  457   HHYPL  461



>ref|XP_010046975.1| PREDICTED: serine carboxypeptidase-like 17 [Eucalyptus grandis]
 gb|KCW78695.1| hypothetical protein EUGRSUZ_C00147 [Eucalyptus grandis]
Length=504

 Score =   354 bits (908),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 179/424 (42%), Positives = 253/424 (60%), Gaps = 40/424 (9%)
 Frame = -3

Query  1437  QLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNPY  1294
             QLFYYF+ES++SP  D             +L       GP+  +Y    G +P + +NP+
Sbjct  91    QLFYYFVESQRSPALDPLMLWLTGGPGCSVLSAFFYESGPVEFSYVGYNGSLPSMHVNPH  150

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
              WT+  NII+VD P+GTG+SYS T++ Y  +D  ++   Y FL +WL+ HP FL N LY+
Sbjct  151   TWTQGLNIIYVDAPIGTGFSYSTTAENYYIDDYRASYEIYQFLRKWLIQHPQFLKNILYI  210

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFL  934
              GDSYSGI +P+VV+ IYDG   G  P LN+KG + GNP T  F D N+RV + +R+  +
Sbjct  211   GGDSYSGIPLPMVVKLIYDGNGDGAVPYLNLKGYVLGNPKTDDFVDDNSRVPFAHRLTLI  270

Query  933   SDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC----------  784
             S   ++   E+CNG++++    N+ C  D+  +    E+IN+  +LEP C          
Sbjct  271   STEQFEEATEACNGDFVNINASNADCDTDIGAIDVMVEEINLMHVLEPICQVAYSRPAKT  330

Query  783   --NPEILLSLDGENL------PQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRC  628
                  ++   D EN       P  WCRD NY+ +  WAN+K V+ ALGVREGT   W RC
Sbjct  331   IRGKTVVFEEDYENFLATGAKPAHWCRDYNYVLSAIWANDKTVRAALGVREGTKGVWNRC  390

Query  627   NHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESL  448
             N +L+          Y  +V ++V YH++ +  + R LIYSGDHDM V HV T+ WI SL
Sbjct  391   NSSLA----------YTKSVTSSVGYHQNLSTTNLRALIYSGDHDMSVTHVGTQNWIYSL  440

Query  447   KVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLS  268
              + + D WRPWFV+ Q+AGYT ++   ++ L YAT+KGAGH APEYKP++C  M+ RWL+
Sbjct  441   NLTLYDVWRPWFVDGQIAGYTQEFINDDFTLDYATIKGAGHVAPEYKPKQCYEMLDRWLA  500

Query  267   IYPL  256
              YPL
Sbjct  501   YYPL  504



>emb|CBI17847.3| unnamed protein product [Vitis vinifera]
Length=530

 Score =   355 bits (910),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 197/434 (45%), Positives = 272/434 (63%), Gaps = 43/434 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtdplllwltggpgplTIN---YANS--------TGDIPD  1312
             V EN  +QLFYYF++S+++P  DPL+LWLTGGPG  T++   Y +          G +P 
Sbjct  107   VGENESVQLFYYFVKSQRNPVLDPLVLWLTGGPGCSTLSAFFYESGPVSFNLTYNGGLPT  166

Query  1311  LELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFL  1132
             LEL  Y WT+  NII++D PVGTG+SYS T + Y T+D  SA   Y FL +WL+ HP FL
Sbjct  167   LELKEYTWTETLNIIYLDAPVGTGFSYSTTQEGYTTDDYKSAAQIYEFLKKWLIQHPEFL  226

Query  1131  NNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNM--KGCIEGNPLTHRFSDTNNRVV  958
              N LY+ GDSYSGI VP++V++IY   E G  PRLN+  +G + GNP+T  + D N+RV 
Sbjct  227   KNNLYIGGDSYSGIPVPMIVQDIYYDSERGGSPRLNLNLQGYVLGNPVTDAYIDKNSRVP  286

Query  957   YGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC--  784
             + +R+  +SD LY+S K +CNG+Y++A   +  C+ D+Q + +    IN+ QIL+P C  
Sbjct  287   FAHRLTLISDGLYESAKANCNGDYVNANASSEQCESDVQEIEELLRDINIQQILDPDCTF  346

Query  783   ------------------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVR  658
                               NP   LS  GE     +C D  Y+ + +WANN+ V++AL VR
Sbjct  347   SSPIPNEEKSNLQRSLAENPTDFLSQLGEE-TMYFCHDYMYILSETWANNRDVREALHVR  405

Query  657   EGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPH  478
             EGT   W RCN  +SG         Y  +V ++V YHR+ +    R LIYSGDHDM VPH
Sbjct  406   EGTKGYWKRCN--ISGL-------AYTEDVISSVAYHRNLSKTGLRALIYSGDHDMSVPH  456

Query  477   VSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRE  298
             + T++WI+SL + + D WR W+ E QVAGYT +Y+  ++ LTYATVKGAGH APEYKP++
Sbjct  457   IGTQQWIDSLNLTLADTWRAWYTEGQVAGYTKRYTNDDFALTYATVKGAGHVAPEYKPQQ  516

Query  297   CLPMIQRWLSIYPL  256
             C  M++RW + Y L
Sbjct  517   CYAMLKRWFAYYQL  530



>ref|XP_010936146.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Elaeis 
guineensis]
Length=394

 Score =   350 bits (898),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 179/383 (47%), Positives = 235/383 (61%), Gaps = 35/383 (9%)
 Frame = -3

Query  1347  INYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSF  1168
              + A  T  +P L  NPY+WTKV +IIF+D PVGTG+SYS   ++Y T DT +A+  ++F
Sbjct  28    FDVAGYTEGLPTLVYNPYSWTKVCSIIFLDSPVGTGFSYSSVEESYETGDTKAARQVHTF  87

Query  1167  LVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTH  988
             L +WL+DH  FL+NPLY+ GDSYSGI VP+V + I  G + G E   N+KG + GNP+T 
Sbjct  88    LRKWLIDHLEFLSNPLYIGGDSYSGIVVPVVAQEIAKGAQDGDELLYNLKGYLVGNPVTD  147

Query  987   RFSDTNNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINM  808
                D    V Y + MG +SD LY+STK+SC G Y  A P N  C   LQ + KC E IN 
Sbjct  148   EKFDNGAFVPYAHGMGLISDELYESTKKSCGGEY--ASPTNEQCASHLQSINKCIEGINT  205

Query  807   PQILEPAC-----NPEILLS--------------LDGENLPQQWCRDDNYLFAYSWANNK  685
             PQILEP C      P I+ +              L   +LP + CR   YL +Y WANN 
Sbjct  206   PQILEPVCFFVSPKPSIVAAYSRRLLKEDIKEFPLLKADLPLE-CRSSGYLLSYFWANND  264

Query  684   IVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYS  505
              V++ L + +GT+ +W RCN+ L           Y  ++ +++ +H + T++  R L+YS
Sbjct  265   TVREVLNIHKGTVQQWQRCNYGLP----------YAHDIPSSLKFHLNLTSRGHRALVYS  314

Query  504   GDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGH  325
             GDHDMIVP V T+ WI SL   + DDWRPW    QVAG+T  YS     LT+ATVKGAGH
Sbjct  315   GDHDMIVPFVGTQAWIRSLNFSIVDDWRPWSAYGQVAGFTRTYSNN---LTFATVKGAGH  371

Query  324   TAPEYKPRECLPMIQRWLSIYPL  256
             TAPEY+P+ECL M+QRWLS  PL
Sbjct  372   TAPEYRPKECLVMLQRWLSGAPL  394



>ref|XP_002522136.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF40336.1| serine carboxypeptidase, putative [Ricinus communis]
Length=421

 Score =   351 bits (900),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 184/397 (46%), Positives = 249/397 (63%), Gaps = 36/397 (9%)
 Frame = -3

Query  1443  KIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELN  1300
             ++Q+FY F+ESE+SP+ D              L       GPL+ NYAN +G+ P L LN
Sbjct  17    EVQMFYLFLESERSPKDDPLILWLIGGPGCSALSAFLYQTGPLSFNYANISGNKPTLMLN  76

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             PY+WTKVAN+I++D PVGTG+SYS + + Y T D  SA   Y FL +WL+ HP FL+NPL
Sbjct  77    PYSWTKVANMIYLDSPVGTGFSYSTSFEGYRTGDRSSAAQLYEFLRKWLVAHPKFLSNPL  136

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMG  940
             YV GDSY+GI  P+VV  I +G + G +P++N+KG + GNP+TH   D N+R+ Y ++ G
Sbjct  137   YVGGDSYAGIVAPVVVHEISNGNDKGNKPQMNLKGFVLGNPVTHLDIDLNSRIPYAHQKG  196

Query  939   FLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN-------  781
              + DNLYK+TKE+C G Y      N  C  +LQ V +  EK+ M  I+EP C        
Sbjct  197   IIPDNLYKATKENCKGEYRHPDRRNEMCINNLQAVNETFEKLYMYNIVEPKCTWDLSALL  256

Query  780   -----PEILLSLDGENLPQ---QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCN  625
                   EI+  +D     Q   +WCRD   ++ + WAN+K VQ AL VREGT+ EW+RCN
Sbjct  257   GENDLLEIMRKIDVYTASQNSVEWCRDFMLVYVHFWANDKSVQDALHVREGTIEEWIRCN  316

Query  624   HTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLK  445
              +L           Y F+V  T++Y RSFT +S R LI+SGDHD+ +P+V T +WIESLK
Sbjct  317   SSLV---------RYEFDVPTTLEYQRSFTKRSYRALIFSGDHDLAIPYVGTHQWIESLK  367

Query  444   VGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKG  334
             +    DW+PWFVEDQ AG  + YS+K+Y LTYATV+ 
Sbjct  368   LKTTSDWKPWFVEDQFAGNVITYSKKKYNLTYATVQA  404



>ref|XP_010936150.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Elaeis 
guineensis]
 ref|XP_010936151.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Elaeis 
guineensis]
Length=476

 Score =   352 bits (904),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 192/425 (45%), Positives = 248/425 (58%), Gaps = 47/425 (11%)
 Frame = -3

Query  1437  QLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNPY  1294
             QLFYYFI+SE  PE D                 L    GPL  + A  T  +P L  NPY
Sbjct  68    QLFYYFIKSESKPEEDPLMVWLTGGPGCSAFSGLVYEIGPLKFDVAGYTEGLPTLVYNPY  127

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
             +WTKV NIIF+D PVGTG+SYS    +Y T DT +AQ  ++FL +WL+DHP FL+NPLY+
Sbjct  128   SWTKVCNIIFLDSPVGTGFSYSSVEKSYETGDTKAAQQVHTFLRKWLIDHPEFLSNPLYI  187

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFL  934
              GDSYSGI VP+V + I  G   G E   N+KG + GNP+T    D    V Y + MG +
Sbjct  188   GGDSYSGIVVPVVAQEIAKGDRDGDELLYNLKGYLVGNPVTDEKFDNGAFVPYAHGMGLI  247

Query  933   SDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-----NPEIL  769
             SD LY+STK+SC G Y  A P N  C   LQ + +C E IN  QILEP C      P I+
Sbjct  248   SDELYESTKKSCGGEY--ASPRNEQCANYLQSINECIEGINEGQILEPVCFFVSPKPHIV  305

Query  768   --------------LSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLR  631
                            SL   +LP + CR   YL +Y WA+N  V++ L + +GT+  W R
Sbjct  306   AAYSRRLLKEDIKEFSLLKSDLPLE-CRSSGYLLSYFWADNDTVREVLNIHKGTVQHWQR  364

Query  630   CNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIES  451
             CN+ L           Y  ++ +++ +H + T++  R L+YSGDHDM+VP + T+ WI S
Sbjct  365   CNYGLP----------YAHDIPSSLKFHLNLTSRGYRALVYSGDHDMVVPFLGTQAWIRS  414

Query  450   LKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
             L   + DDWR W  + QVAG+T  YS     LT+ATVKG GHTAPEY+P+ECL M+QRWL
Sbjct  415   LNFSIVDDWRSWSADGQVAGFTRTYSNN---LTFATVKGGGHTAPEYRPKECLVMLQRWL  471

Query  270   SIYPL  256
             S  PL
Sbjct  472   SGAPL  476



>ref|XP_003633199.2| PREDICTED: serine carboxypeptidase-like 13 isoform X2 [Vitis 
vinifera]
Length=461

 Score =   352 bits (903),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 189/425 (44%), Positives = 256/425 (60%), Gaps = 39/425 (9%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSP------------EtdplllwltggpgplTINYANSTGDIP  1315
             V EN ++QLFYYF++S+++P                 L       GPLT N     G +P
Sbjct  52    VGENEEVQLFYYFVKSQRNPVFDPLMLWLSGGPGCSTLTAFFYENGPLTFNIQEYEGGLP  111

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
             +L L    WTK  NIIFVD PVG+G+SYS+T + Y   D   A  TY FL +WL+DHP F
Sbjct  112   NLYLKENTWTKTLNIIFVDAPVGSGFSYSKTQEGYIMEDLKYAAQTYEFLKKWLVDHPEF  171

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L N LYV GDSYSGI VP+VV+ IY G      P LN++G + GNPLT   +D N+R+ +
Sbjct  172   LKNELYVGGDSYSGIPVPMVVQEIYYG-----SPSLNLQGYVLGNPLTDTDNDVNSRIPF  226

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
              +R+  +SD LY+S K SCNG+Y+     N  C  D++ ++K  ++I + Q+LEP C   
Sbjct  227   AHRLTLISDELYESAKTSCNGDYVTVNASNEQCVADMEAISKLIDQIYIMQVLEPNCGIS  286

Query  783   ---------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLR  631
                      N    L+  GE     +C + NY+F+  WANNK V++AL VREGT   W+R
Sbjct  287   SRKPKEGELNHTHFLTQLGEK-SAYFCHEYNYVFSEIWANNKDVREALRVREGTKGHWVR  345

Query  630   CNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIES  451
             CN T         +  +  +V +TV YH++ TN   R LIYSGDHDM +PH+ T++WI S
Sbjct  346   CNIT---------NLAFTKDVTSTVAYHQNLTNTGLRALIYSGDHDMSIPHIGTQEWINS  396

Query  450   LKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
             L + +ED WR W  + QVAGYT  ++  +++LT+ATVKGAGH A EYKP+EC  MI RW 
Sbjct  397   LNLTLEDPWRTWCTDGQVAGYTETFTNDDFDLTFATVKGAGHVAIEYKPKECYAMIDRWF  456

Query  270   SIYPL  256
             + YPL
Sbjct  457   AHYPL  461



>ref|XP_010936155.1| PREDICTED: serine carboxypeptidase-like 18 [Elaeis guineensis]
Length=476

 Score =   352 bits (904),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 196/425 (46%), Positives = 250/425 (59%), Gaps = 47/425 (11%)
 Frame = -3

Query  1437  QLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNPY  1294
             QLFYYFI+SE  PE D                 L    GPL  + A  T  +P L  +PY
Sbjct  68    QLFYYFIKSESKPEEDPLMVWLTGGPGCSAFSGLVYEIGPLKFDVAGYTEGLPTLVYHPY  127

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
             +WTKV NIIF+D PVGTG+SYS    +Y T DT +A+  ++FL +WL+DHP FL+NPLY+
Sbjct  128   SWTKVCNIIFLDSPVGTGFSYSSVEKSYETGDTKAARQVHTFLRKWLIDHPEFLSNPLYI  187

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFL  934
              GDSYSGI VP+V + I  G   G E   N+KG I GNP T    D    V Y + MG +
Sbjct  188   GGDSYSGIVVPVVAQEIAKGDRDGDELLYNLKGYIVGNPGTDAKFDNGAFVPYAHGMGLI  247

Query  933   SDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-----NPEIL  769
             SD LY+STK+SC G Y  A P N  C   LQ + +C E IN  QILEP C      P I+
Sbjct  248   SDELYESTKKSCGGEY--ASPRNEQCANHLQSINECIEGINTGQILEPLCFFASPKPSIV  305

Query  768   LS--------------LDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLR  631
              +              L   +LP + CR   YL +Y WA+N  V++AL + +GT+ +W R
Sbjct  306   AAYSRRLLKEDIKEFPLLKADLPLE-CRTYGYLLSYIWADNDTVREALNIHKGTVQQWQR  364

Query  630   CNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIES  451
             CN+ L           Y  +V +++ +H + T+   R L+YSGDHDMIVP V T+ WI S
Sbjct  365   CNYGLP----------YAHDVPSSLKFHLNLTSIGYRALVYSGDHDMIVPFVGTQAWIRS  414

Query  450   LKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
             L   + DDWRPW  + QVAG+T  YS     LT+ATVKGAGHTAPEY+P+ECL M+QRWL
Sbjct  415   LNFSIVDDWRPWSADGQVAGFTRTYSNN---LTFATVKGAGHTAPEYRPKECLVMLQRWL  471

Query  270   SIYPL  256
             S  PL
Sbjct  472   SDAPL  476



>ref|XP_012079434.1| PREDICTED: serine carboxypeptidase-like 7 [Jatropha curcas]
 gb|KDP32094.1| hypothetical protein JCGZ_12555 [Jatropha curcas]
Length=472

 Score =   352 bits (903),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 178/421 (42%), Positives = 249/421 (59%), Gaps = 43/421 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             +QLFYYFIESE++P  D              L  L    GPL  N     G +P L+LNP
Sbjct  61    VQLFYYFIESERNPREDPLLLWLTGGPGCSSLSGLIFEIGPLQFNIVEYNGSLPTLKLNP  120

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             ++WTKV++IIF+D PVGTG+SYS +  +  T DT+ A HTY+FL +WLL HP F+ NPLY
Sbjct  121   HSWTKVSSIIFLDAPVGTGFSYSRSYHSSETGDTIQAIHTYTFLKKWLLSHPEFIKNPLY  180

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             +AGDSYSG+ VP++ + I  G+E G++P++N+KG + GNP T    D N R+ + +RM  
Sbjct  181   IAGDSYSGMVVPVITKQISIGIELGVQPQINLKGYLLGNPATDYKFDENARIPFAHRMAL  240

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPEILL---  766
             +SD LY+S K +C G Y+D    N  C+ DLQ +++C  +I +  ILEP CN    L   
Sbjct  241   ISDELYESAKRNCKGEYVDVDHKNIKCKNDLQSISECISRIEITHILEPQCNITFRLLNQ  300

Query  765   ---------------SLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLR  631
                             L     P   CR+ N L    WAN+  VQ AL   +G + EW+R
Sbjct  301   IDKFRRYLIDNNEDFLLIPPRFPHPGCRNYNSLLCNIWANDASVQIALQASKGKLREWMR  360

Query  630   CNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIES  451
             CN +L           Y+ +V++T+ +H     +  R LIYSGDHDMI+P++ T  WI+S
Sbjct  361   CNQSL----------YYMHDVQSTIGHHLYLNTRGYRALIYSGDHDMIIPYLGTLSWIKS  410

Query  450   LKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
             + + + + WRPW V+ QVAGY M++S    +  + TVKG GHT PEY+PREC    +RW+
Sbjct  411   MNLSIVEHWRPWLVDGQVAGYLMEFSN---QFMFVTVKGGGHTPPEYRPRECFATFKRWI  467

Query  270   S  268
             S
Sbjct  468   S  468



>dbj|BAO04183.1| putative acyl-glucose-dependent anthocyanin acyltransferase [Delphinium 
grandiflorum]
Length=470

 Score =   351 bits (901),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 186/424 (44%), Positives = 259/424 (61%), Gaps = 43/424 (10%)
 Frame = -3

Query  1437  QLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNPY  1294
             +LFYYF +SE  P  D              L  +T   GPL+   +   G +P L+LNPY
Sbjct  60    ELFYYFFQSENKPSDDPILFWFTGGPGCSGLSAVTFENGPLSFKISKYNGSLPTLKLNPY  119

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
             +WTKV+NI+F+D P GTG+SYS     Y  +D  S++  Y F+ +WL+DH  FL+NPLY+
Sbjct  120   SWTKVSNIVFLDAPPGTGFSYSRNLKGY-PSDKKSSKQGYIFIRKWLVDHQKFLSNPLYI  178

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFL  934
             +GDSYSGIT+P + + I+DG+ESG E  +N KG + GNP T  + D N+++ + + M  L
Sbjct  179   SGDSYSGITIPPIGQYIFDGIESGDELLINFKGYLLGNPKTDLYYDHNSKIPFAHGMALL  238

Query  933   SDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC----------  784
             S  L++S K++C G Y +A P N  C+ DLQ V++CT+ +N P ILEP C          
Sbjct  239   STELFESVKKNCGGEYYNADPENVQCRKDLQLVSECTKGVNDPHILEPKCLLVTPKSNKW  298

Query  783   ---NPEILLSLDGE-----NLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRC  628
                   + ++L         +P+  CR   Y+ +Y WAN+K VQKAL +R+ T+ EW+RC
Sbjct  299   NKRRSSLEMTLPNNLRFPFGIPEFGCRSYGYMLSYYWANDKEVQKALHIRKDTVPEWIRC  358

Query  627   NHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESL  448
             N         +    Y+++  +++ YH   + K CR LIYSGDHD +VP +STE WI SL
Sbjct  359   N---------QEGLNYLYDNISSIGYHLYLSRKGCRSLIYSGDHDFLVPFLSTETWITSL  409

Query  447   KVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLS  268
                + DDWRPWFV  QVAGYT  Y+     +T+ATVKGAGHTAPEYKP EC  M+++WLS
Sbjct  410   NYSITDDWRPWFVGGQVAGYTRSYAN---NMTFATVKGAGHTAPEYKPYECFSMMKKWLS  466

Query  267   IYPL  256
               PL
Sbjct  467   YEPL  470



>ref|XP_010936145.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Elaeis 
guineensis]
Length=394

 Score =   348 bits (894),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 178/383 (46%), Positives = 235/383 (61%), Gaps = 35/383 (9%)
 Frame = -3

Query  1347  INYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSF  1168
              + A  T  +P L  NPY+WTKV +IIF+D PVGTG+SYS   ++Y T DT +A+  ++F
Sbjct  28    FDVAGYTEGLPTLVYNPYSWTKVCSIIFLDSPVGTGFSYSSVEESYETGDTKAARQVHTF  87

Query  1167  LVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTH  988
             L +WL+DH  FL+NPLY+ GDSYSGI VP+V + I  G + G E   N+KG + GNP+T 
Sbjct  88    LRKWLIDHLEFLSNPLYIGGDSYSGIVVPVVAQEIAKGAQDGDELLYNLKGYLVGNPVTD  147

Query  987   RFSDTNNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINM  808
                D    V Y + MG +SD LY+STK+SC G Y  A P N  C   LQ + KC E IN 
Sbjct  148   EKFDNGAFVPYAHGMGLISDELYESTKKSCGGEY--ASPTNEQCASHLQSINKCIEGINT  205

Query  807   PQILEPAC-----NPEILLS--------------LDGENLPQQWCRDDNYLFAYSWANNK  685
             PQILEP C      P I+ +              L   +LP + CR   YL +Y WA+N 
Sbjct  206   PQILEPVCFFVSPKPSIVAAYSRRLLKEDIKEFPLLKADLPLE-CRSSGYLLSYFWADND  264

Query  684   IVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYS  505
              V++ L + +GT+ +W RCN+ L           Y  ++ +++ +H + T++  R L+YS
Sbjct  265   TVREVLNIHKGTVQQWQRCNYGLP----------YAHDIPSSLKFHLNLTSRGHRALVYS  314

Query  504   GDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGH  325
             GDHDMIVP V T+ WI SL   + DDWRPW    QVAG+T  YS     LT+ATVKGAGH
Sbjct  315   GDHDMIVPFVGTQAWIRSLNFSIVDDWRPWSAYGQVAGFTRTYSNN---LTFATVKGAGH  371

Query  324   TAPEYKPRECLPMIQRWLSIYPL  256
             TAPEY+P+ECL M+QRWLS  PL
Sbjct  372   TAPEYRPKECLVMLQRWLSGAPL  394



>ref|XP_008236344.1| PREDICTED: serine carboxypeptidase-like 13 [Prunus mume]
Length=509

 Score =   352 bits (904),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 196/467 (42%), Positives = 264/467 (57%), Gaps = 80/467 (17%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEt-------------dplllwltggpgplTINYANSTGDIPDLELN  1300
             +QLFYYF ESE SPE                    +    GP + + A+S G+ P L+LN
Sbjct  51    VQLFYYFFESEGSPEYDPLVLWLTGGPGCSAFSALVYENLGPFSFDSAHSIGNKPKLKLN  110

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAY-NTNDTLSAQHTYSFLVQWLLDHPTFLNNP  1123
             PY+WTKVANIIF+D PVGTG+SY++  + Y N NDT+SA  TY FL +WL+DH  F NNP
Sbjct  111   PYSWTKVANIIFLDAPVGTGFSYTKNWEGYTNLNDTVSAAQTYEFLRKWLMDHSKFYNNP  170

Query  1122  LYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRM  943
             LY+AGDSYSGI VP++V+ I DG +    P +N+KG + GNP T    D N+RV++ Y  
Sbjct  171   LYIAGDSYSGIIVPMLVQEISDGNQDEHAPSMNLKGYVLGNPQTDSEKDKNSRVLFAYLK  230

Query  942   GFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQ-----------RVTKCTEKINMPQIL  796
               +SD LY+S K +C G+YI+   +N+ C  DL+            +   T  +N   IL
Sbjct  231   ALISDELYQSMKTNCKGDYINVDLNNTLCVDDLELYNEVSGKKTNSLVSTTTYVNDVHIL  290

Query  795   EPACN-------------------PEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQK  673
             EP C                      + L L    L + WCR   YL +Y WAN+K VQ+
Sbjct  291   EPVCTVHSPKPAQSKRYADDRTNRDSVNLLLSFPQLRRPWCRSYTYLLSYIWANDKTVQE  350

Query  672   ALGVRE--GTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGD  499
             AL ++E  G++ EW RCN TL         E Y+ +V +++ YH +   +  RVL+YSGD
Sbjct  351   ALHIQENQGSIKEWERCNKTL--------QEFYISDVSSSLVYHENLIKQGYRVLVYSGD  402

Query  498   HDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQ-----------------  370
             HDM +P++ST  WIESL + V+  W+PWFV+ QVAG+    S                  
Sbjct  403   HDMNIPYMSTMGWIESLNLTVDSRWKPWFVDGQVAGFVSISSSFYFVSSLVRKSDYNYLI  462

Query  369   ---------KEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                      ++Y+LTYAT+KGAGHTAP+YKP EC  MI RWL+ YPL
Sbjct  463   VMIQSAVHIQKYQLTYATIKGAGHTAPDYKPEECFAMISRWLAYYPL  509



>ref|XP_012093155.1| PREDICTED: serine carboxypeptidase-like 18 [Jatropha curcas]
Length=467

 Score =   350 bits (899),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 183/423 (43%), Positives = 261/423 (62%), Gaps = 39/423 (9%)
 Frame = -3

Query  1449  NLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLE  1306
             N ++QLFYYF+ESE++P+ D              L  +    GPL  NYA  T   P L 
Sbjct  51    NEEVQLFYYFVESERNPKDDPLVLWFTAGPGCSSLSAILYQHGPLHFNYATPTSSKPTLV  110

Query  1305  LNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNN  1126
             LNP++W KVANII++D PVGTG+SY+ T   YN  D  SA  TY FL +WL+ HP FL+N
Sbjct  111   LNPHSWAKVANIIYLDAPVGTGFSYATTWRGYNIGDLSSAAQTYDFLRKWLMAHPKFLSN  170

Query  1125  PLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYR  946
             P+YV  DSY G+ VP++V+ I  G + G +P++N+KG I GNP+T   +D ++R+ Y ++
Sbjct  171   PMYVGSDSYGGLVVPIIVQEITTGNDKGNKPKINLKGYILGNPVTDYKNDLSSRIPYAHQ  230

Query  945   MGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNP----  778
                +S  LY+S KESC G Y++    N  C  +LQ V K  E++ +  ILEP C      
Sbjct  231   KALISSQLYESIKESCKGEYLNPDRSNKICISNLQAVNKTFEELYLYNILEPKCRSWDLS  290

Query  777   ---------EILLSLD---GENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWL  634
                       ++  +D      L ++WCRD   L+++ WAN+K VQ AL VREGT+TEW 
Sbjct  291   PLLGGTDLLTLMKKIDVFAATQLSREWCRDYMLLYSHIWANDKSVQSALHVREGTITEWP  350

Query  633   RCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSC-RVLIYSGDHDMIVPHVSTEKWI  457
             RCN +L           Y F+V + V YHR+FT  S  RVLI+SGDHD+ +P+++T  WI
Sbjct  351   RCNLSLR----------YDFDVLSVVQYHRNFTKTSAYRVLIFSGDHDLALPYLATYAWI  400

Query  456   ESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQR  277
             ++L + V  +W+PW V+ QVAG+ + YS+++Y LT+A V+G  H+A E +P+EC  MI R
Sbjct  401   QTLNLTVTKNWQPWLVDHQVAGHVIAYSKRKYNLTFAIVQGGSHSASEIRPKECFAMIDR  460

Query  276   WLS  268
             WL+
Sbjct  461   WLA  463



>ref|XP_011045684.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Populus 
euphratica]
Length=472

 Score =   350 bits (899),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 178/424 (42%), Positives = 252/424 (59%), Gaps = 37/424 (9%)
 Frame = -3

Query  1437  QLFYYFIESEKSP------------EtdplllwltggpgplTINYANSTGDIPDLELNPY  1294
             +LFY F+ES++ P                 L       GPL  N  +  G +P+L  NPY
Sbjct  56    ELFYLFVESQEKPLEDPLLVYLVGGPGCSALTGFFFQVGPLIFNTTDYLGGLPELLYNPY  115

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
             +WTK A+IIFVD PV TGYSY+  S+  +  DT SA+  + FL +WL+DHP F   P +V
Sbjct  116   SWTKTASIIFVDYPVSTGYSYATRSEGSHMTDTASAKLAHQFLRKWLIDHPEFTKIPFFV  175

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFL  934
             A D+Y+GI  P+V + I+DG E+G++P +N+KG + G+P T    + N+RV + YR+  +
Sbjct  176   ASDTYAGIITPIVAKEIFDGNEAGLQPHINLKGFVCGSPHTDTALEHNSRVPFAYRLALI  235

Query  933   SDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC----------  784
             S +LY++ K SC GNY+D    N+ C  DL+++ +C  +IN   IL P C          
Sbjct  236   SRSLYEAAKNSCKGNYVDVDTSNAPCLEDLEKINQCITQINKENILYPKCARLSPNSNNE  295

Query  783   -NPEILLSLDGENLP-------QQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRC  628
                   L  + +  P         WC++  Y+   +WAN++ V+ AL VR GT+T W RC
Sbjct  296   EQSRRFLKANSQRFPVLSSKIQDYWCQNFEYVLLDAWANDERVRDALHVRRGTVTTWYRC  355

Query  627   NHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESL  448
             N  L       +   Y +NV   VDY+++ T K  ++LIYSGDHDM+VP++STEKWI SL
Sbjct  356   NSFL-------QDVLYTYNVFTAVDYYQNLTRKGLQILIYSGDHDMVVPYISTEKWINSL  408

Query  447   KVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLS  268
              + V+ DWRPWFVE QVAGYT+KY+     LT+AT+KGAGH+  +Y PR C  M +RW+ 
Sbjct  409   NITVDRDWRPWFVEGQVAGYTVKYTDYGLRLTFATLKGAGHSPTQYTPRWCYNMFERWIH  468

Query  267   IYPL  256
              YPL
Sbjct  469   YYPL  472



>gb|KCW55058.1| hypothetical protein EUGRSUZ_I01033, partial [Eucalyptus grandis]
Length=412

 Score =   348 bits (893),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 188/413 (46%), Positives = 252/413 (61%), Gaps = 66/413 (16%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E  ++QLFYYFIESE+SP+ D              L  L    GPL  +Y+NS+G  P
Sbjct  44    VGELEEVQLFYYFIESERSPKDDPLLLWLTGGPGCSALSGLLFEIGPLQFDYSNSSGIRP  103

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L+LNPY+WTK+ANIIF+D PVGTG+SY+ T  AY+ NDT SA  +Y FL +WL+ HP F
Sbjct  104   ILKLNPYSWTKIANIIFLDAPVGTGFSYATTWTAYDINDTSSAAQSYEFLRKWLMSHPKF  163

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L N LY+ GDSYSG+  P++V+ +YDG E+G EP +N+KG + GNP+T    D + R+ Y
Sbjct  164   LTNSLYITGDSYSGVVAPIIVKEVYDGNEAGREPPMNLKGYVLGNPVTCEVKDISQRIPY  223

Query  954   GYRMGFLSDNLY---------KSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQ  802
             G++M  +SD LY         +STK +CNG+Y++  P N AC  DL+ V+          
Sbjct  224   GHKMALISDELYEVNLLYILTRSTKTNCNGDYVNVDPTNGACLADLEMVSIAY-------  276

Query  801   ILEPACNPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNH  622
                                        NYL++Y WAN++ V +AL +REGT  EW RCN+
Sbjct  277   ---------------------------NYLYSYIWANDRNVHEALHIREGTKPEWDRCNN  309

Query  621   TLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKV  442
             +LS          Y  +V N+V YHR  +  S R LIYSGDHD+ +P+V T  WI SL +
Sbjct  310   SLS----------YTKDVLNSVVYHRYLSKTSLRALIYSGDHDLAIPYVGTLDWIRSLNL  359

Query  441   GVEDDWRPWFVEDQVAGYTMKYSQ-KEYELTYATVKGAGHTAPEYKPRECLPM  286
              +   W PWFVE QVAGY++ YS+  +Y+LT+ T+KG GHTAPEYKP+ECL M
Sbjct  360   TLLGQWAPWFVEGQVAGYSILYSENNKYDLTFTTIKGGGHTAPEYKPKECLAM  412



>ref|XP_010936154.1| PREDICTED: serine carboxypeptidase-like 18 [Elaeis guineensis]
Length=499

 Score =   350 bits (899),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 196/436 (45%), Positives = 252/436 (58%), Gaps = 57/436 (13%)
 Frame = -3

Query  1437  QLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNPY  1294
             QLFYYFI+SE  PE D                 L    GPL  + A  T  +P L  NPY
Sbjct  79    QLFYYFIKSEGKPEEDPLIVWLTGGPGCSAFSGLVFEIGPLKFDIAGYTEGLPTLVYNPY  138

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFL------------VQWLL  1150
             +WTKV +IIF+D PVGTG+SYS    +Y T DT +A+  + FL            +QWL+
Sbjct  139   SWTKVCSIIFLDSPVGTGFSYSSVEKSYETGDTKAARQVHIFLKKCDRFTSSQVVMQWLI  198

Query  1149  DHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTN  970
             DHP FL+NPLY+ GDSYSGI VP+VV+ I  G + G E   N+KG + GNP+T    D  
Sbjct  199   DHPEFLSNPLYIGGDSYSGIVVPVVVQEIAKGDQDGDELLYNLKGYLVGNPVTDEKFDNG  258

Query  969   NRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEP  790
               V Y + MG +SD LY+STK+SC G Y  A P N  C   LQ + KC E IN  QILEP
Sbjct  259   AFVPYAHGMGLISDELYESTKKSCGGEY--ASPTNEQCASHLQSINKCIEGINTVQILEP  316

Query  789   AC-----NPEI-------LLSLDGENLP------QQWCRDDNYLFAYSWANNKIVQKALG  664
              C      P I       LL  D +  P         CR   YL +Y WA+N  V++AL 
Sbjct  317   VCFFASPKPGIVAAYSRRLLKEDIKGFPLLKADLSLECRTSGYLLSYFWADNDTVREALN  376

Query  663   VREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIV  484
             + +GT+ +W RCN+ L           Y  ++ +++ +H + T++  R L+YSGDHD++V
Sbjct  377   IHKGTVQQWQRCNYGLP----------YAHDIPSSLKFHLNLTSRGYRALVYSGDHDLLV  426

Query  483   PHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKP  304
             P V T+ WI SL   + DDWRPW  + QVAG+T  YS     LT+ATVKGAGHTAPEY+P
Sbjct  427   PFVGTQAWIRSLNFSIVDDWRPWSADGQVAGFTRTYSNN---LTFATVKGAGHTAPEYRP  483

Query  303   RECLPMIQRWLSIYPL  256
             +ECL M+QRWLS  PL
Sbjct  484   KECLVMLQRWLSGAPL  499



>ref|XP_010656846.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Vitis 
vinifera]
Length=474

 Score =   349 bits (896),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 190/438 (43%), Positives = 257/438 (59%), Gaps = 52/438 (12%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSP-------------------------Etdplllwltggpgp  1354
             V EN ++QLFYYF++S+++P                         E        T   GP
Sbjct  52    VGENEEVQLFYYFVKSQRNPVFDPLMLWLSGGPGCSTLTAFFYENECTFKQNVRTFCIGP  111

Query  1353  lTINYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTY  1174
             LT N     G +P+L L    WTK  NIIFVD PVG+G+SYS+T + Y   D   A  TY
Sbjct  112   LTFNIQEYEGGLPNLYLKENTWTKTLNIIFVDAPVGSGFSYSKTQEGYIMEDLKYAAQTY  171

Query  1173  SFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPL  994
              FL +WL+DHP FL N LYV GDSYSGI VP+VV+ IY G      P LN++G + GNPL
Sbjct  172   EFLKKWLVDHPEFLKNELYVGGDSYSGIPVPMVVQEIYYG-----SPSLNLQGYVLGNPL  226

Query  993   THRFSDTNNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKI  814
             T   +D N+R+ + +R+  +SD LY+S K SCNG+Y+     N  C  D++ ++K  ++I
Sbjct  227   TDTDNDVNSRIPFAHRLTLISDELYESAKTSCNGDYVTVNASNEQCVADMEAISKLIDQI  286

Query  813   NMPQILEPAC------------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKA  670
              + Q+LEP C            N    L+  GE     +C + NY+F+  WANNK V++A
Sbjct  287   YIMQVLEPNCGISSRKPKEGELNHTHFLTQLGEK-SAYFCHEYNYVFSEIWANNKDVREA  345

Query  669   LGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDM  490
             L VREGT   W+RCN T         +  +  +V +TV YH++ TN   R LIYSGDHDM
Sbjct  346   LRVREGTKGHWVRCNIT---------NLAFTKDVTSTVAYHQNLTNTGLRALIYSGDHDM  396

Query  489   IVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEY  310
              +PH+ T++WI SL + +ED WR W  + QVAGYT  ++  +++LT+ATVKGAGH A EY
Sbjct  397   SIPHIGTQEWINSLNLTLEDPWRTWCTDGQVAGYTETFTNDDFDLTFATVKGAGHVAIEY  456

Query  309   KPRECLPMIQRWLSIYPL  256
             KP+EC  MI RW + YPL
Sbjct  457   KPKECYAMIDRWFAHYPL  474



>ref|XP_011003871.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Populus 
euphratica]
Length=472

 Score =   349 bits (895),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 178/424 (42%), Positives = 251/424 (59%), Gaps = 37/424 (9%)
 Frame = -3

Query  1437  QLFYYFIESEKSP------------EtdplllwltggpgplTINYANSTGDIPDLELNPY  1294
             +LFY F+ES++ P                 L       GPL  N  +  G +P+L  NPY
Sbjct  56    ELFYLFVESQEKPLEDPLLVYLVGGPGCSALTGFFFQVGPLIFNTTDYLGGLPELLYNPY  115

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
             +WTK A+IIFVD PV TGYSY+  S+  +  DT SA+  + FL +WL+DHP F   P +V
Sbjct  116   SWTKTASIIFVDYPVSTGYSYATRSEGSHMTDTASAKLAHQFLRKWLIDHPEFTKIPFFV  175

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFL  934
             A D+Y+GI  P+V + I+DG E+G++P +N+KG + G+P T    + N+RV + YR+  +
Sbjct  176   ASDTYAGIITPIVAKEIFDGNEAGLQPHINLKGFVCGSPHTDTALEHNSRVPFAYRLALI  235

Query  933   SDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC----------  784
             S +LY+S K SC G Y+D    N+ C  DL+++ +C  +IN   IL P C          
Sbjct  236   SRSLYESAKNSCKGKYVDVDTSNAPCLEDLEKINQCITQINKENILYPKCARLSPNSNNE  295

Query  783   -NPEILLSLDGENLP-------QQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRC  628
                   L  + +  P         WC++  Y+   +WAN++ V+ AL VR GT+T W RC
Sbjct  296   EQSRRFLKANSQRFPVLSSKIQDYWCQNFEYVLLDAWANDERVRDALHVRRGTVTTWYRC  355

Query  627   NHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESL  448
             N  L       +   Y +NV   VDY+++ T K  ++LIYSGDHDM+VP++STEKWI SL
Sbjct  356   NSFL-------QDVLYTYNVFTAVDYYQNLTRKGLQILIYSGDHDMVVPYISTEKWINSL  408

Query  447   KVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLS  268
              + V+ DWRPWFVE QVAGYT+KY+     LT+AT+KGAGH+  +Y PR C  M +RW+ 
Sbjct  409   NITVDRDWRPWFVEGQVAGYTVKYTDYGLRLTFATLKGAGHSPTQYTPRWCYNMFERWIH  468

Query  267   IYPL  256
              YPL
Sbjct  469   YYPL  472



>emb|CBI17848.3| unnamed protein product [Vitis vinifera]
Length=563

 Score =   352 bits (902),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 189/425 (44%), Positives = 256/425 (60%), Gaps = 39/425 (9%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSP------------EtdplllwltggpgplTINYANSTGDIP  1315
             V EN ++QLFYYF++S+++P                 L       GPLT N     G +P
Sbjct  154   VGENEEVQLFYYFVKSQRNPVFDPLMLWLSGGPGCSTLTAFFYENGPLTFNIQEYEGGLP  213

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
             +L L    WTK  NIIFVD PVG+G+SYS+T + Y   D   A  TY FL +WL+DHP F
Sbjct  214   NLYLKENTWTKTLNIIFVDAPVGSGFSYSKTQEGYIMEDLKYAAQTYEFLKKWLVDHPEF  273

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L N LYV GDSYSGI VP+VV+ IY G      P LN++G + GNPLT   +D N+R+ +
Sbjct  274   LKNELYVGGDSYSGIPVPMVVQEIYYG-----SPSLNLQGYVLGNPLTDTDNDVNSRIPF  328

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
              +R+  +SD LY+S K SCNG+Y+     N  C  D++ ++K  ++I + Q+LEP C   
Sbjct  329   AHRLTLISDELYESAKTSCNGDYVTVNASNEQCVADMEAISKLIDQIYIMQVLEPNCGIS  388

Query  783   ---------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLR  631
                      N    L+  GE     +C + NY+F+  WANNK V++AL VREGT   W+R
Sbjct  389   SRKPKEGELNHTHFLTQLGEK-SAYFCHEYNYVFSEIWANNKDVREALRVREGTKGHWVR  447

Query  630   CNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIES  451
             CN T         +  +  +V +TV YH++ TN   R LIYSGDHDM +PH+ T++WI S
Sbjct  448   CNIT---------NLAFTKDVTSTVAYHQNLTNTGLRALIYSGDHDMSIPHIGTQEWINS  498

Query  450   LKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
             L + +ED WR W  + QVAGYT  ++  +++LT+ATVKGAGH A EYKP+EC  MI RW 
Sbjct  499   LNLTLEDPWRTWCTDGQVAGYTETFTNDDFDLTFATVKGAGHVAIEYKPKECYAMIDRWF  558

Query  270   SIYPL  256
             + YPL
Sbjct  559   AHYPL  563



>gb|KCW55074.1| hypothetical protein EUGRSUZ_I01040 [Eucalyptus grandis]
Length=426

 Score =   347 bits (890),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 186/380 (49%), Positives = 242/380 (64%), Gaps = 39/380 (10%)
 Frame = -3

Query  1443  KIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELN  1300
             ++QLFYYFIESE+SP  D              L  L    GPL  +Y+NS+G  P  ELN
Sbjct  49    EVQLFYYFIESERSPNDDPLLLWLTGGPGCSALSGLLFEIGPLQFDYSNSSGIRPLFELN  108

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             PY+WTK+ANIIF+D PVGTG+SY+ T  AYN NDT SA  TY FL +WLL HP FL N L
Sbjct  109   PYSWTKIANIIFLDAPVGTGFSYAMTWAAYNINDTSSAAQTYEFLRKWLLAHPKFLTNQL  168

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMG  940
             Y++GDSYSG+ VP++V+ IYDG E+G EP +N+KG + GNP+T    D + R+ YGY+  
Sbjct  169   YISGDSYSGVVVPIIVKEIYDGNEAGREPPMNLKGYVLGNPVTCEVKDISQRIPYGYKTA  228

Query  939   FLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNP------  778
              +SD LY+STK  CNG+Y++  P N A   DL+ V+ C EKIN+PQILEP C+       
Sbjct  229   LISDELYESTKTDCNGDYMNVDPTNGAYLRDLEMVSICLEKINLPQILEPKCSALSPNHT  288

Query  777   ------EILLS--LDGENLPQQ---WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLR  631
                    IL    +D  ++PQQ   WCR  NYL++Y WAN++ VQ+AL +REG   EW R
Sbjct  289   RLKWSRSILKENIIDVISMPQQSKPWCRSYNYLYSYIWANDRNVQEALHIREGMKPEWNR  348

Query  630   CNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIES  451
             CN ++S          Y  ++ N+V YHR  +  S R LIYSGDHDM +P+V T  WI S
Sbjct  349   CNESIS----------YTKDILNSVVYHRYLSKTSLRALIYSGDHDMGIPYVGTLDWIRS  398

Query  450   LKVGVEDDWRPWFVEDQVAG  391
             L + +   W PW+V+ QVAG
Sbjct  399   LNLTLLGPWGPWYVDGQVAG  418



>ref|XP_010028338.1| PREDICTED: serine carboxypeptidase-like 13 [Eucalyptus grandis]
 gb|KCW55061.1| hypothetical protein EUGRSUZ_I01037 [Eucalyptus grandis]
Length=473

 Score =   348 bits (893),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 188/427 (44%), Positives = 254/427 (59%), Gaps = 41/427 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             +QLFYYFIES++ P  D                 L    GPLT +Y    G +P L +N 
Sbjct  56    VQLFYYFIESQRDPANDPLVFWMTGGPGCSGFSALAFEIGPLTFDYGTYNGTLPSLLINK  115

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WT+ ANIIF+D PVG G+SY+ T +   T+D  SA   Y+FL +WLL HP FL N LY
Sbjct  116   YSWTQAANIIFIDAPVGAGFSYATTEEGKYTSDIESAYQYYTFLRKWLLSHPQFLGNELY  175

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             V GDSYSGIT+P+VV+NI +G+E+G+ P++ ++G + GNP+T  F DTN+R+ Y +R+  
Sbjct  176   VGGDSYSGITLPIVVKNILEGIEAGVRPKMELQGYLLGNPVTDDFIDTNSRIPYVHRVNL  235

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---------  784
             +SD  Y+  KE C GNYID   +N+AC   LQ + +C  +IN+ QILEP C         
Sbjct  236   ISDEYYEDAKEYCGGNYIDVDANNTACVATLQLIKECLLQINLCQILEPQCAFSSKRRRE  295

Query  783   ---------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVR-EGTMTE-W  637
                         I   L    LP+  CR   Y+ AY W N++ VQ+AL VR E   T+ W
Sbjct  296   LEWDLRVQEAETIDNILSNSRLPELPCRGFTYVMAYKWLNDERVQEALYVRPESVPTDGW  355

Query  636   LRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWI  457
              RC    S         TY   V +++ YH++ +    R LIYSGDHD+ VP + T  WI
Sbjct  356   KRCPKNFS---------TYTEEVTSSIAYHKNLSETGLRALIYSGDHDVSVPWIGTLSWI  406

Query  456   ESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQR  277
             +SL V V D+WR W+V+ Q+AGY +K+    + LTY TVKGAGHTAPEYK +E L M  R
Sbjct  407   KSLGVAVFDEWRAWYVDGQIAGYQVKFMNDHFRLTYVTVKGAGHTAPEYKHKETLAMFDR  466

Query  276   WLSIYPL  256
             +L+ YP+
Sbjct  467   FLARYPI  473



>ref|XP_002283413.1| PREDICTED: serine carboxypeptidase-like 2 [Vitis vinifera]
Length=469

 Score =   348 bits (892),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 204/431 (47%), Positives = 263/431 (61%), Gaps = 43/431 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtdplllwltggpgplTIN---------YANST---GDIP  1315
             V E+ ++QLFYYF++SE +P  DPLLLWLTGGPG    +         Y  S    G +P
Sbjct  52    VGESEEVQLFYYFVKSENNPTEDPLLLWLTGGPGCSAFSALFYEIGPLYFESVPYHGSLP  111

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              LELNP++WT+V+NIIF+D PVGTG+SY+ TS A ++ D  +    + FL +WL+DHP F
Sbjct  112   TLELNPHSWTQVSNIIFLDAPVGTGFSYATTSRASHSGDFQATHQAHEFLRKWLIDHPEF  171

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L+NP+YV GDSYSGITVP+VV++I +G E   EP +N+KG + GNP+T + ++T  +  +
Sbjct  172   LSNPVYVGGDSYSGITVPVVVQHISNGNEDDTEPFINLKGYLLGNPVTEQGTETTAQFRF  231

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN--  781
              + M  +SD LY+S K SC   Y    P N  C  D+Q   KC   I   QILEP C   
Sbjct  232   AHGMALISDELYESLKTSCGDEYPFKYPINIQCIKDVQAFYKCISGIQFGQILEPVCGFG  291

Query  780   ---PE-ILLS----LDGE--------NLPQQWCRDDNYLFAYSWANNKIVQKALGVREGT  649
                PE I LS    L G+        +L    CR D Y+ A  WANN  VQ+AL +R+ T
Sbjct  292   SLKPEDIFLSGRRYLIGKLRERRPEPSLSAFECRTDGYILAPYWANNATVQEALHIRKNT  351

Query  648   MTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVST  469
             + EW RC   LS  PE E S           +YH + + K  R LIYSGDHDMIVP  ST
Sbjct  352   IREWQRCAMGLSYTPEIESS----------FEYHVTLSKKGYRSLIYSGDHDMIVPFFST  401

Query  468   EKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLP  289
             + WI SL   + DDWR W VE QV GYT  YS    ++T+ATVKG GHTAPEY+P+EC  
Sbjct  402   QAWIRSLNYSIVDDWRSWMVEGQVGGYTRTYSN---QMTFATVKGGGHTAPEYRPKECFG  458

Query  288   MIQRWLSIYPL  256
             M +RW+S  PL
Sbjct  459   MYKRWVSGQPL  469



>ref|XP_010046973.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW78694.1| hypothetical protein EUGRSUZ_C00146 [Eucalyptus grandis]
Length=478

 Score =   348 bits (892),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 183/432 (42%), Positives = 257/432 (59%), Gaps = 41/432 (9%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E   +QLFYYF+ES++SP  D              LL      GPL+  Y+   G +P
Sbjct  57    VGETEDVQLFYYFVESQRSPAMDPVVLWLTGGPGCSTLLAFFYESGPLSFVYSGYNGSLP  116

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L LNPY WTK  NII++DQPVGTG+SYS T D Y+T DT SA  TY F+ +W+L HP F
Sbjct  117   SLTLNPYTWTKALNIIYLDQPVGTGFSYSTTQDGYDTGDTRSAALTYEFIRKWMLSHPNF  176

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
              +N LYV GDSYSG+TVPLV++ I D  +  + P++N+KG I GNP T  + D N+R+ +
Sbjct  177   KSNQLYVGGDSYSGVTVPLVIQAIMDSNQEQVYPQMNLKGYILGNPKTDTYIDDNSRLSF  236

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
               R+  + D L+     SC G+++     N  C+  +Q     T +IN+ Q+LEPAC   
Sbjct  237   ANRLTLIPDELFLIANASCGGDFVTEQTDNEKCEAAMQTFEDLTRQINLQQVLEPACTMT  296

Query  783   NPEI-LLSLDGENLPQQ--------------WCRDDNYLFAYSWANNKIVQKALGVREGT  649
             +PE   +++D  +L +Q              WCR+  ++ +  WAN+K VQ+AL +R+GT
Sbjct  297   SPEPNEMNVDRRSLREQSRELLRLHTKDTAYWCRNYRHVLSGIWANDKSVQEALHIRDGT  356

Query  648   MTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKS-CRVLIYSGDHDMIVPHVS  472
             +T W  CN ++S   E +          + + YH++F+  S  R LIYSGDHDM +PH++
Sbjct  357   ITLWKMCNSSMSYDEEFD----------SVISYHKNFSESSELRALIYSGDHDMSIPHLA  406

Query  471   TEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECL  292
             T +WI+S  + + D WRPWFV  QVAGYT +Y   +Y L + TVKG GH A EYK  +C 
Sbjct  407   TRQWIQSFDMTLLDTWRPWFVNAQVAGYTEEYENNDYTLHFVTVKGGGHIAAEYKQEQCA  466

Query  291   PMIQRWLSIYPL  256
              M+ RW + YPL
Sbjct  467   AMMDRWFAYYPL  478



>ref|XP_010048652.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW80985.1| hypothetical protein EUGRSUZ_C02352 [Eucalyptus grandis]
Length=495

 Score =   348 bits (894),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 184/431 (43%), Positives = 255/431 (59%), Gaps = 40/431 (9%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E+ + QLFYYF+ES+++P  D             +L       GPL   Y    G IP
Sbjct  75    VGESNESQLFYYFVESQRTPSQDPLMLWLTGGPGCSVLSAFLYEGGPLAFTYEGYNGSIP  134

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L  NPYAWT+  N++FVD P+GTG+SYS T++ Y T+D  S+  TY FL ++LL HP F
Sbjct  135   SLHQNPYAWTQGLNMLFVDAPIGTGFSYSTTAENYYTDDFKSSNETYEFLQKFLLSHPQF  194

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             + N LY+ GDSYSGI +P++V+ I+DG   G EP +N+KG + GNP T  F D N+R+ +
Sbjct  195   IENMLYIGGDSYSGIPLPIIVQKIFDGNLLGEEPFMNLKGYVLGNPKTDDFIDDNSRIPF  254

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
              +R+  +SD LY    ESC GNY+D   +N+ C  D++ +     +IN+ QILEP C   
Sbjct  255   AHRVALISDELYADAMESCGGNYVDVSANNTECLEDIEEIDALLLQINLMQILEPNCQTA  314

Query  774   I------------LLSLDGENL------PQQWCRDDNYLFAYSWANNKIVQKALGVREGT  649
                          +L  D E        P  WCR+ NY+ +  WANN+ V+ ALG+REGT
Sbjct  315   YSRPVEANRGYRRVLEDDYEGFLAAQPNPALWCREYNYVLSGVWANNEDVRAALGIREGT  374

Query  648   MTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVST  469
                W RCN +L+          Y   V ++V YH++ +N + R LIYSGDHDM V ++ T
Sbjct  375   KGVWKRCNSSLA----------YTKTVSSSVPYHQNLSNTNLRALIYSGDHDMSVTYLGT  424

Query  468   EKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLP  289
               WI SL + +   WR W+V  QVAGYT +++  ++ L +ATVKG GH APEYKPREC  
Sbjct  425   HFWIFSLNLTLSTAWREWYVNGQVAGYTEEFTSNQFTLDFATVKGGGHVAPEYKPRECYE  484

Query  288   MIQRWLSIYPL  256
             M+ RWL+ + L
Sbjct  485   MLDRWLAYWYL  495



>ref|XP_010028337.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW55060.1| hypothetical protein EUGRSUZ_I01035 [Eucalyptus grandis]
Length=485

 Score =   348 bits (892),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 187/423 (44%), Positives = 259/423 (61%), Gaps = 39/423 (9%)
 Frame = -3

Query  1437  QLFYYFIESEKSPEtdplllwltggpgplTIN------------YANSTGDIPDLELNPY  1294
             +LFYYFIES+ +PE DP+ LWLTGGPG  + N              N  G +P L    Y
Sbjct  73    ELFYYFIESQGNPEEDPIFLWLTGGPGCSSFNGLIYEIGPMEFDIENYKGGLPKLRPYEY  132

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
             AWTK A+IIFVD PVGTG+SYS T + + ++D+ SA+  Y FL +W+++HP +L   L++
Sbjct  133   AWTKTASIIFVDSPVGTGFSYSTTDEGWYSSDSSSAEQAYEFLREWMVEHPQYLELQLFI  192

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFL  934
              GDSYSG+ VPLV + + +  + G+ PRLN+KG + G+P T    D N+++V+ +RM  +
Sbjct  193   GGDSYSGMMVPLVTQYVVEANKDGVAPRLNLKGYLIGSPRTDSVVDENSKIVFAHRMALI  252

Query  933   SDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-------NPE  775
             SD LY++ K SCN  Y++  P N+ C   L  + +C + +    ILEP C       NPE
Sbjct  253   SDELYEAAKISCNETYVNVDPSNTECWTALGAIKRCVKDLFKNDILEPKCVFASPKMNPE  312

Query  774   I----------LLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCN  625
             I             L    +P+ WCR  NY  +Y+W+N+  VQKAL VR GT+ +W RCN
Sbjct  313   IGRRSVQEDTTEFILSPPRIPEYWCRTFNYALSYTWSNDLRVQKALNVRPGTVMDWKRCN  372

Query  624   HTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLK  445
              +L+          Y  ++++ V+ H++ +     VL+  GD DM+VP V T +WI+ L 
Sbjct  373   KSLA----------YTKDIQSVVEVHKNLSTLGLEVLVECGDRDMVVPFVGTVEWIKRLN  422

Query  444   VGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSI  265
             + V +DWRPWFV+ QVAGYT KYS+  Y LTYATVKGAGHTAPEY  REC  M  RW+  
Sbjct  423   LTVVNDWRPWFVDGQVAGYTKKYSEHGYRLTYATVKGAGHTAPEYYRRECYEMFMRWVHY  482

Query  264   YPL  256
             YPL
Sbjct  483   YPL  485



>ref|XP_012093161.1| PREDICTED: serine carboxypeptidase-like 18 [Jatropha curcas]
Length=465

 Score =   347 bits (890),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 186/421 (44%), Positives = 256/421 (61%), Gaps = 37/421 (9%)
 Frame = -3

Query  1437  QLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNPY  1294
             +LFYYF+ES+ +P+ D               + L    GPL  +  N TG +P L+  PY
Sbjct  55    ELFYYFLESQGNPQEDPLFLWLTGGPGCSSFIGLIYQIGPLEFDIDNYTGGLPKLKYYPY  114

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
             AWTK A+IIF+D PVGTG+SY+ T + ++T+D+ SA+ +Y FL +WLL++P +L   L++
Sbjct  115   AWTKTASIIFLDAPVGTGFSYARTQEGWSTSDSKSAEQSYQFLRKWLLENPQYLLVQLFI  174

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFL  934
              GDSYSGITVPLV + + +G E+ + P LN+KG + G+P T    D N+++++ YRM  +
Sbjct  175   GGDSYSGITVPLVTQKVVEGNEAKVYPYLNLKGYLLGSPYTDSVIDENSKIIFAYRMALI  234

Query  933   SDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---NPE----  775
             S   +++ K+SCN  Y++  P N+AC   LQ    C + +    ILEP C   +PE    
Sbjct  235   SKKQFQNLKKSCNEMYVNVDPSNTACVAALQTYEMCVKDLYKGDILEPKCLFVSPEANRR  294

Query  774   ------ILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLS  613
                       L    +P  WCR  NY  +Y WANN  VQ AL VR+G +  W RCN TLS
Sbjct  295   SMKEKSTNFILSPPRIPDLWCRTFNYAMSYVWANNMEVQDALHVRKGLVPYWSRCNRTLS  354

Query  612   GPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVE  433
                       Y  NV + V  +R  + K   +L+ SGD DM+VP V TEKWI+SL + V+
Sbjct  355   ----------YTKNVPSVVQVNRYLSTKRLVLLVESGDRDMVVPFVGTEKWIKSLNLTVD  404

Query  432   DDWRPWFVEDQVAGYTMKY--SQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYP  259
             D+WRPW V+ Q+AGYT+KY  S+ E+ LTYATVKG GHTAPEY  REC  M QRW+  YP
Sbjct  405   DNWRPWLVDGQIAGYTIKYCSSEDEFYLTYATVKGGGHTAPEYYRRECYEMFQRWIHYYP  464

Query  258   L  256
             L
Sbjct  465   L  465



>ref|XP_011100016.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Sesamum 
indicum]
Length=416

 Score =   345 bits (886),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 187/413 (45%), Positives = 246/413 (60%), Gaps = 56/413 (14%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E  ++QLFYYFIESE  P+TD                 L    GPL  +     G  P
Sbjct  48    VGEEDEVQLFYYFIESENDPQTDPLILWLTGGPGCSGFSGLVYEIGPLAFDVEAFDGSFP  107

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
                 NPY+WTKVANIIF+D PVGTG+SY+ TS AYNT+DT S +H Y FL +WL +HP F
Sbjct  108   SFITNPYSWTKVANIIFIDSPVGTGFSYATTSQAYNTSDTKSVEHNYLFLRKWLSNHPEF  167

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             + N LY+AGDSY G  VP+V   I  G E+ IEPR+ ++G I GN  T    D N ++ Y
Sbjct  168   VKNHLYIAGDSYGGKIVPMVALEIAKGNEARIEPRILIQGYIVGNSRTDPNKDENEKLPY  227

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
              +RM  +SD  ++  K +CNG Y+   P N  C Y LQ V +                  
Sbjct  228   AHRMALVSDEYFELAKRNCNGEYVSPDPDNIGCLYALQLVNE------------------  269

Query  774   ILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAE  595
                             + NY+ +Y WANN+ VQ+AL +R+GT+++W RCN +LS      
Sbjct  270   ----------------NYNYVSSYVWANNETVQEALQIRQGTISDWKRCNRSLS------  307

Query  594   RSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPW  415
                 Y  +V +   +H+  ++K  + L YSGDHDMIVP++ST KWI  L + +++DWRPW
Sbjct  308   ----YEQDVLSVSKHHQLLSDKGFQALAYSGDHDMIVPYMSTLKWIRDLNLTLDEDWRPW  363

Query  414   FVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
              V+ QVAGYTMKY   + ELT+ATVKGAGHTAPEYKP++CL MI+RWLS+YPL
Sbjct  364   TVDGQVAGYTMKYKNNQAELTFATVKGAGHTAPEYKPKQCLAMIKRWLSLYPL  416



>ref|XP_011045683.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Populus 
euphratica]
Length=473

 Score =   347 bits (891),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 179/425 (42%), Positives = 252/425 (59%), Gaps = 38/425 (9%)
 Frame = -3

Query  1437  QLFYYFIESEKSP------------EtdplllwltggpgplTINYANSTGDIPDLELNPY  1294
             +LFY F+ES++ P                 L       GPL  N  +  G +P+L  NPY
Sbjct  56    ELFYLFVESQEKPLEDPLLVYLVGGPGCSALTGFFFQVGPLIFNTTDYLGGLPELLYNPY  115

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFL-VQWLLDHPTFLNNPLY  1117
             +WTK A+IIFVD PV TGYSY+  S+  +  DT SA+  + FL  QWL+DHP F   P +
Sbjct  116   SWTKTASIIFVDYPVSTGYSYATRSEGSHMTDTASAKLAHQFLRKQWLIDHPEFTKIPFF  175

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             VA D+Y+GI  P+V + I+DG E+G++P +N+KG + G+P T    + N+RV + YR+  
Sbjct  176   VASDTYAGIITPIVAKEIFDGNEAGLQPHINLKGFVCGSPHTDTALEHNSRVPFAYRLAL  235

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---------  784
             +S +LY++ K SC GNY+D    N+ C  DL+++ +C  +IN   IL P C         
Sbjct  236   ISRSLYEAAKNSCKGNYVDVDTSNAPCLEDLEKINQCITQINKENILYPKCARLSPNSNN  295

Query  783   --NPEILLSLDGENLP-------QQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLR  631
                    L  + +  P         WC++  Y+   +WAN++ V+ AL VR GT+T W R
Sbjct  296   EEQSRRFLKANSQRFPVLSSKIQDYWCQNFEYVLLDAWANDERVRDALHVRRGTVTTWYR  355

Query  630   CNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIES  451
             CN  L       +   Y +NV   VDY+++ T K  ++LIYSGDHDM+VP++STEKWI S
Sbjct  356   CNSFL-------QDVLYTYNVFTAVDYYQNLTRKGLQILIYSGDHDMVVPYISTEKWINS  408

Query  450   LKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
             L + V+ DWRPWFVE QVAGYT+KY+     LT+AT+KGAGH+  +Y PR C  M +RW+
Sbjct  409   LNITVDRDWRPWFVEGQVAGYTVKYTDYGLRLTFATLKGAGHSPTQYTPRWCYNMFERWI  468

Query  270   SIYPL  256
               YPL
Sbjct  469   HYYPL  473



>ref|XP_010028344.1| PREDICTED: serine carboxypeptidase-like 7 [Eucalyptus grandis]
Length=465

 Score =   347 bits (889),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 186/380 (49%), Positives = 242/380 (64%), Gaps = 39/380 (10%)
 Frame = -3

Query  1443  KIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELN  1300
             ++QLFYYFIESE+SP  D              L  L    GPL  +Y+NS+G  P  ELN
Sbjct  49    EVQLFYYFIESERSPNDDPLLLWLTGGPGCSALSGLLFEIGPLQFDYSNSSGIRPLFELN  108

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             PY+WTK+ANIIF+D PVGTG+SY+ T  AYN NDT SA  TY FL +WLL HP FL N L
Sbjct  109   PYSWTKIANIIFLDAPVGTGFSYAMTWAAYNINDTSSAAQTYEFLRKWLLAHPKFLTNQL  168

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMG  940
             Y++GDSYSG+ VP++V+ IYDG E+G EP +N+KG + GNP+T    D + R+ YGY+  
Sbjct  169   YISGDSYSGVVVPIIVKEIYDGNEAGREPPMNLKGYVLGNPVTCEVKDISQRIPYGYKTA  228

Query  939   FLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNP------  778
              +SD LY+STK  CNG+Y++  P N A   DL+ V+ C EKIN+PQILEP C+       
Sbjct  229   LISDELYESTKTDCNGDYMNVDPTNGAYLRDLEMVSICLEKINLPQILEPKCSALSPNHT  288

Query  777   ------EILLS--LDGENLPQQ---WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLR  631
                    IL    +D  ++PQQ   WCR  NYL++Y WAN++ VQ+AL +REG   EW R
Sbjct  289   RLKWSRSILKENIIDVISMPQQSKPWCRSYNYLYSYIWANDRNVQEALHIREGMKPEWNR  348

Query  630   CNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIES  451
             CN ++S          Y  ++ N+V YHR  +  S R LIYSGDHDM +P+V T  WI S
Sbjct  349   CNESIS----------YTKDILNSVVYHRYLSKTSLRALIYSGDHDMGIPYVGTLDWIRS  398

Query  450   LKVGVEDDWRPWFVEDQVAG  391
             L + +   W PW+V+ QVAG
Sbjct  399   LNLTLLGPWGPWYVDGQVAG  418



>emb|CBI19380.3| unnamed protein product [Vitis vinifera]
Length=503

 Score =   348 bits (892),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 204/431 (47%), Positives = 263/431 (61%), Gaps = 43/431 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtdplllwltggpgplTIN---------YANST---GDIP  1315
             V E+ ++QLFYYF++SE +P  DPLLLWLTGGPG    +         Y  S    G +P
Sbjct  86    VGESEEVQLFYYFVKSENNPTEDPLLLWLTGGPGCSAFSALFYEIGPLYFESVPYHGSLP  145

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              LELNP++WT+V+NIIF+D PVGTG+SY+ TS A ++ D  +    + FL +WL+DHP F
Sbjct  146   TLELNPHSWTQVSNIIFLDAPVGTGFSYATTSRASHSGDFQATHQAHEFLRKWLIDHPEF  205

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L+NP+YV GDSYSGITVP+VV++I +G E   EP +N+KG + GNP+T + ++T  +  +
Sbjct  206   LSNPVYVGGDSYSGITVPVVVQHISNGNEDDTEPFINLKGYLLGNPVTEQGTETTAQFRF  265

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN--  781
              + M  +SD LY+S K SC   Y    P N  C  D+Q   KC   I   QILEP C   
Sbjct  266   AHGMALISDELYESLKTSCGDEYPFKYPINIQCIKDVQAFYKCISGIQFGQILEPVCGFG  325

Query  780   ---PE-ILLS----LDGE--------NLPQQWCRDDNYLFAYSWANNKIVQKALGVREGT  649
                PE I LS    L G+        +L    CR D Y+ A  WANN  VQ+AL +R+ T
Sbjct  326   SLKPEDIFLSGRRYLIGKLRERRPEPSLSAFECRTDGYILAPYWANNATVQEALHIRKNT  385

Query  648   MTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVST  469
             + EW RC   LS  PE E S           +YH + + K  R LIYSGDHDMIVP  ST
Sbjct  386   IREWQRCAMGLSYTPEIESS----------FEYHVTLSKKGYRSLIYSGDHDMIVPFFST  435

Query  468   EKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLP  289
             + WI SL   + DDWR W VE QV GYT  YS    ++T+ATVKG GHTAPEY+P+EC  
Sbjct  436   QAWIRSLNYSIVDDWRSWMVEGQVGGYTRTYSN---QMTFATVKGGGHTAPEYRPKECFG  492

Query  288   MIQRWLSIYPL  256
             M +RW+S  PL
Sbjct  493   MYKRWVSGQPL  503



>emb|CDP08199.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   348 bits (893),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 175/379 (46%), Positives = 235/379 (62%), Gaps = 34/379 (9%)
 Frame = -3

Query  1326  GDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLD  1147
             G +P L  NPYAWTK+A+II +D PVGTG+SY+ TS  Y ++DT S +  Y FL +WLL+
Sbjct  152   GSLPSLHANPYAWTKIASIILLDLPVGTGFSYATTSQGYFSSDTKSTKDAYLFLQKWLLN  211

Query  1146  HPTFLNNPLYVAGDSYSGITVPLVVRNIYDGL-ESGIEPRLNMKGCIEGNPLTHRFSDTN  970
             HP F+ N LY+AGDSY+G  VP+VV  I +G  E+G++PR++++G + GNPLT    D N
Sbjct  212   HPRFMKNRLYIAGDSYAGKIVPMVVLEISNGGNEAGLKPRMSVEGYMVGNPLTDSRKDEN  271

Query  969   NRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEP  790
              +V Y +R+G +SD  Y+  K SCNG YI+  P+N+ C + L  + +C   I    ILEP
Sbjct  272   WKVPYAHRLGLISDEYYERAKSSCNGEYINPSPNNTECLFALHLIQECISGIYPANILEP  331

Query  789   AC-------------------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKAL  667
              C                   + +ILL    +  P+  CRDD Y+ +  W N+  VQ+AL
Sbjct  332   KCQHLASREGLQWDQDYLEEDSIDILLPSSDQEKPK--CRDDTYVLSRVWMNDPTVQEAL  389

Query  666   GVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMI  487
              +REGT  +W RCN          RS +Y  +V +  DYH+    K  + LIYSGDHDM+
Sbjct  390   QIREGTKEQWRRCN----------RSISYDMDVASVFDYHQVLIRKGYQALIYSGDHDMM  439

Query  486   VPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYE--LTYATVKGAGHTAPE  313
             VP++ T +WI  L + VEDDWRPWFV  Q+AGYT+ Y   E     T+ATV GAGHTAPE
Sbjct  440   VPYLGTLQWIRDLNLTVEDDWRPWFVNGQIAGYTLNYQFNEDVCCFTFATVMGAGHTAPE  499

Query  312   YKPRECLPMIQRWLSIYPL  256
             YKP+EC  MI RW + YPL
Sbjct  500   YKPKECFAMIDRWFTNYPL  518



>ref|XP_010030617.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
Length=432

 Score =   345 bits (885),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 182/380 (48%), Positives = 243/380 (64%), Gaps = 39/380 (10%)
 Frame = -3

Query  1443  KIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELN  1300
             ++QLFYYFIESE+SP+ D              L  L    GPL  +Y+NS+G  P L+LN
Sbjct  49    EVQLFYYFIESERSPKDDPLLLWLTGGPGCSALSGLLFEIGPLQFDYSNSSGIRPILKLN  108

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             PY+WTK+ANIIF+D PVGTG+SY+ T  AY+ NDT SA  +Y FL +WL+ HP FL N L
Sbjct  109   PYSWTKIANIIFLDAPVGTGFSYATTWTAYDINDTSSAAQSYEFLRKWLMSHPKFLTNSL  168

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMG  940
             Y+ GDSYSG+  P++V+ +YDG E+G EP +N+KG + GNP+T    D + R+ YG++M 
Sbjct  169   YITGDSYSGVVAPIIVKEVYDGNEAGREPPMNLKGYVLGNPVTCEVKDISQRIPYGHKMA  228

Query  939   FLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNP------  778
              +SD LY+STK +CNG+Y++  P N AC  DL+ V+ C EK+ + QILEP C+       
Sbjct  229   LISDELYESTKTNCNGDYVNVDPTNGACLADLEMVSICLEKLYLAQILEPMCSSISPNHT  288

Query  777   ------EILLS--LDGENLPQQ---WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLR  631
                    IL    +D  + PQQ   WCR  NYL++Y WAN++ V +AL +REGT  EW R
Sbjct  289   RLKWSRSILEKNIIDVVSAPQQSRPWCRAYNYLYSYIWANDRNVHEALHIREGTKPEWDR  348

Query  630   CNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIES  451
             CN++LS          Y  +V N+V YHR  +  S R LIYSGDHD+ +P+V T  WI S
Sbjct  349   CNNSLS----------YTKDVLNSVVYHRYLSKTSLRALIYSGDHDLAIPYVGTLDWIRS  398

Query  450   LKVGVEDDWRPWFVEDQVAG  391
             L + +   W PWFVE QVAG
Sbjct  399   LNLTLLGQWAPWFVEGQVAG  418



>ref|XP_011003870.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Populus 
euphratica]
Length=473

 Score =   346 bits (888),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 179/425 (42%), Positives = 251/425 (59%), Gaps = 38/425 (9%)
 Frame = -3

Query  1437  QLFYYFIESEKSP------------EtdplllwltggpgplTINYANSTGDIPDLELNPY  1294
             +LFY F+ES++ P                 L       GPL  N  +  G +P+L  NPY
Sbjct  56    ELFYLFVESQEKPLEDPLLVYLVGGPGCSALTGFFFQVGPLIFNTTDYLGGLPELLYNPY  115

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFL-VQWLLDHPTFLNNPLY  1117
             +WTK A+IIFVD PV TGYSY+  S+  +  DT SA+  + FL  QWL+DHP F   P +
Sbjct  116   SWTKTASIIFVDYPVSTGYSYATRSEGSHMTDTASAKLAHQFLRKQWLIDHPEFTKIPFF  175

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             VA D+Y+GI  P+V + I+DG E+G++P +N+KG + G+P T    + N+RV + YR+  
Sbjct  176   VASDTYAGIITPIVAKEIFDGNEAGLQPHINLKGFVCGSPHTDTALEHNSRVPFAYRLAL  235

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---------  784
             +S +LY+S K SC G Y+D    N+ C  DL+++ +C  +IN   IL P C         
Sbjct  236   ISRSLYESAKNSCKGKYVDVDTSNAPCLEDLEKINQCITQINKENILYPKCARLSPNSNN  295

Query  783   --NPEILLSLDGENLP-------QQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLR  631
                    L  + +  P         WC++  Y+   +WAN++ V+ AL VR GT+T W R
Sbjct  296   EEQSRRFLKANSQRFPVLSSKIQDYWCQNFEYVLLDAWANDERVRDALHVRRGTVTTWYR  355

Query  630   CNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIES  451
             CN  L       +   Y +NV   VDY+++ T K  ++LIYSGDHDM+VP++STEKWI S
Sbjct  356   CNSFL-------QDVLYTYNVFTAVDYYQNLTRKGLQILIYSGDHDMVVPYISTEKWINS  408

Query  450   LKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
             L + V+ DWRPWFVE QVAGYT+KY+     LT+AT+KGAGH+  +Y PR C  M +RW+
Sbjct  409   LNITVDRDWRPWFVEGQVAGYTVKYTDYGLRLTFATLKGAGHSPTQYTPRWCYNMFERWI  468

Query  270   SIYPL  256
               YPL
Sbjct  469   HYYPL  473



>ref|XP_011457835.1| PREDICTED: serine carboxypeptidase-like 7 [Fragaria vesca subsp. 
vesca]
Length=467

 Score =   345 bits (886),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 173/425 (41%), Positives = 258/425 (61%), Gaps = 38/425 (9%)
 Frame = -3

Query  1443  KIQLFYYFIESEKSP-EtdplllwltggpgplTINYA----------NSTGDIPDLELNP  1297
             ++ LFYYF+ES+++P E   +L    G        +A          +  G IP + +NP
Sbjct  52    EVNLFYYFVESDRNPIEDPLVLWLTGGPGCSGFSAFAYEIGPFTFDLHYNGSIPTIVMNP  111

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTKVANIIF+D PVG G+SYS +S+ + T+DT  A  TY+FL +WL  HP +  N LY
Sbjct  112   YSWTKVANIIFIDAPVGAGFSYSTSSEGWYTSDTKQAAQTYTFLRKWLYTHPEYQGNQLY  171

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             V GDSYSG+ VP++++NI +GLE+G+ PR+ ++G + GNP++  F D N R+ Y +R+  
Sbjct  172   VGGDSYSGLIVPILLKNILEGLEAGLRPRMQLQGYLLGNPVSDNFIDVNMRIPYVHRVSL  231

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC------NPE  775
             +SD +Y++ K +C+ +Y++   +N+ C   LQ++  C  +IN+ QILEP C        E
Sbjct  232   ISDEIYQAAKSNCSEDYVNYELNNTLCVTALQKIKDCLLQINLAQILEPQCAFASGKTTE  291

Query  774   ILLSLDGE------------NLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLR  631
             +   L                LP+  CR   Y+ AY W N++ V+ ALGVR GT+  W+R
Sbjct  292   LEFDLRAREASTMDYLLSESKLPELHCRGYTYVLAYRWMNDETVRAALGVRNGTVENWVR  351

Query  630   CNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIES  451
             C   L+          Y   + +++ Y ++ +    R LIYSGDHD+ VP ++T+ WI++
Sbjct  352   CPKALT---------YYTEEITSSLAYQKNLSETGLRALIYSGDHDISVPWIATQYWIKA  402

Query  450   LKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
             L V V D+WRPW+V  Q+AGY +K+    + LTY TVKGAGHTAPEYK +E L M  R+L
Sbjct  403   LDVAVFDEWRPWYVNGQIAGYQVKFMNDNFRLTYVTVKGAGHTAPEYKHKETLAMFDRFL  462

Query  270   SIYPL  256
             + YP+
Sbjct  463   ARYPI  467



>emb|CAN67390.1| hypothetical protein VITISV_034715 [Vitis vinifera]
Length=472

 Score =   345 bits (884),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 194/436 (44%), Positives = 259/436 (59%), Gaps = 52/436 (12%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtdplllwltggpgplTIN---------YANST---GDIPDLELNP  1297
             I+ FYYF+ES+ +P  DPL+L++ GGPG   +N           N+T   G +P     P
Sbjct  48    IEFFYYFVESQGNPGADPLILYMNGGPGCSGLNGFFYQVGPVVFNTTDYIGGLPTFLPYP  107

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             ++WTK ANIIFVD PVGTG+SY+ TS AY T+DTLS   T  FL  WL DHP F  NPL+
Sbjct  108   HSWTKTANIIFVDAPVGTGFSYATTSQAYTTSDTLSVIQTLGFLRNWLNDHPDFKLNPLF  167

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             +  DSYSG+  P++ + I DG   G EP +N+KG + G+P T    + N+R+VY +RM  
Sbjct  168   IGADSYSGLIAPIIAQEIMDGNGVGEEPHINLKGYLIGSPHTDTTIELNSRIVYAHRMAL  227

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-------NP  778
             +SD LY++ K  CNG Y+D  P N+ C   L+ ++ C E++++  ILEP C       N 
Sbjct  228   ISDALYEAAKTGCNGRYVDIDPSNAKCVEALESISLCIEQVSLQDILEPKCSFISPKQNK  287

Query  777   EILLSLDGEN-----LPQQ------WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLR  631
             EI  SL  EN     LP Q      WCR+  +  +  WAN K VQ AL +R GT+ E+ R
Sbjct  288   EIRRSLR-ENSRSFLLPSQYRTGNDWCRNFEHSLSDIWANYKSVQDALYIRPGTVEEFFR  346

Query  630   CNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIES  451
             CN +LS          Y  NV N   YH++ TN   RVL++SGDHDM++PHV  E+WI+S
Sbjct  347   CNISLS----------YTENVNNVFGYHKNLTNSGLRVLVFSGDHDMVIPHVGIEQWIKS  396

Query  450   LKVGVEDDWRPWFVEDQVAG-----------YTMKYSQKEYELTYATVKGAGHTAPEYKP  304
             L + +  DWRPWFV+ Q+ G           YT KY  K Y LTY+T+KGAGH+  EY+ 
Sbjct  397   LNISLGSDWRPWFVDGQIGGLIIIPLHICYRYTRKYVNKAYSLTYSTLKGAGHSPTEYRR  456

Query  303   RECLPMIQRWLSIYPL  256
             RE   M  RW+  YPL
Sbjct  457   RESYEMFYRWIHHYPL  472



>ref|XP_010048542.1| PREDICTED: serine carboxypeptidase-like 13 [Eucalyptus grandis]
 gb|KCW80817.1| hypothetical protein EUGRSUZ_C02185 [Eucalyptus grandis]
Length=471

 Score =   344 bits (883),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 177/432 (41%), Positives = 250/432 (58%), Gaps = 41/432 (9%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtdpl----------llwltggpgplTINYANS--TGDIP  1315
             V E+  +QLFYYF+ES++SP  DPL                      +N+  S   G +P
Sbjct  50    VGEDEVVQLFYYFVESDRSPSQDPLLLWIDGGPGCSSLAGFFFQNGPLNFQTSGYNGSLP  109

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L  NPY+WT+  NIIF+D PVGTG+SYS T+D YN +D     H+Y FL +W ++H  F
Sbjct  110   SLHPNPYSWTQGMNIIFLDAPVGTGFSYSTTTDGYNVDDYSFVAHSYEFLQKWFVNHTQF  169

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L N  Y+ G SYSG+ VP++V  I DG E+G EP +N+KG +  NP+T  F D N+R+ Y
Sbjct  170   LENQFYIGGSSYSGMAVPMLVETIVDGNEAGNEPTINVKGFLMSNPVTDAFIDDNSRIEY  229

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
             G RM  +SD LY++ K +C+G+Y++    N  C  DL  + + T K+    ILEP C+  
Sbjct  230   GNRMALISDQLYEAAKTNCDGDYVNVGDDNLQCVVDLNAINELTSKVLTVHILEPDCSNA  289

Query  774   ILLSLDGENL-------------------PQQWCRDDNYLFAYSWANNKIVQKALGVREG  652
             +    D  ++                   P  WCR+ N++  Y WAN K VQ+AL VR G
Sbjct  290   LPDPQDDASVRRYLQENATAASTDDPLKGPALWCRNYNHMVCYIWANLKSVQEALQVRPG  349

Query  651   TMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVS  472
             T T W  CN TL+          Y   + + VDYH++ T  + R LI+SGDHDM +PH+ 
Sbjct  350   TKTYWPYCNSTLA----------YTKVISSVVDYHKNLTKGNIRGLIFSGDHDMSIPHIG  399

Query  471   TEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECL  292
             T+ WI +L + +++ WR W V+ Q AGY  KY + +Y LT+ TVKGAGH A EYK +EC 
Sbjct  400   TQAWINALNLTLDESWRVWSVDGQTAGYAKKYIKDDYSLTFVTVKGAGHFAAEYKVKECF  459

Query  291   PMIQRWLSIYPL  256
              ++ RW++ YP+
Sbjct  460   QLVDRWMAYYPV  471



>ref|XP_008236293.1| PREDICTED: serine carboxypeptidase-like 18 isoform X3 [Prunus 
mume]
Length=439

 Score =   343 bits (879),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 179/388 (46%), Positives = 241/388 (62%), Gaps = 42/388 (11%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEt-------------dplllwltggpgplTINYANSTGDIPDLELN  1300
             +QLFYYF ESE SPE                    +    GPL+ +YA+S G+ P LELN
Sbjct  60    VQLFYYFFESEGSPEYDPLVLWLTGGPGCSAFSAIVYENLGPLSFDYAHSIGNKPKLELN  119

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAY-NTNDTLSAQHTYSFLVQWLLDHPTFLNNP  1123
             PY+WTKVANIIF+D PVGTG+SY++T + Y N NDTLSA  TY FL +WL+DHP F N+P
Sbjct  120   PYSWTKVANIIFLDAPVGTGFSYAKTWEGYSNLNDTLSAAQTYEFLRKWLMDHPKFYNSP  179

Query  1122  LYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRM  943
             LY+AGDSYSGITVP++V+ I DG +    P +N+KG + GNP T    D N +V++ Y  
Sbjct  180   LYIAGDSYSGITVPMLVQEISDGNQDEHVPPMNLKGYVLGNPGTDEKKDNNYQVLFAYLK  239

Query  942   GFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-------  784
               +SD LY+S K++C G YI+   +N+ C  DLQ   +C E I   QILEP+C       
Sbjct  240   ALISDELYQSMKKNCKGEYINVDLNNTLCLEDLQLYNECIEDIQSVQILEPSCTLVASPK  299

Query  783   -------------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMT  643
                             + L L    LP+ WCR  NYLF+Y WAN+K VQ AL ++EG++ 
Sbjct  300   SAGSKRNINYFSDKDSVNLLLSFPQLPRPWCRSYNYLFSYIWANDKTVQDALHIQEGSIK  359

Query  642   EWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEK  463
             EWLRCNHTL         ++Y+ +V +++ YH +   +  RVLIYSGDHDM+VP+V+T  
Sbjct  360   EWLRCNHTL--------QDSYISDVSSSLVYHENLIKQGYRVLIYSGDHDMLVPYVATMA  411

Query  462   WIESLKVGVEDDWRPWFVEDQVAGYTMK  379
             WIESL + V+  W+PWFV+ Q+    ++
Sbjct  412   WIESLNLTVDSRWKPWFVDGQIQSAVLR  439



>ref|XP_008790304.1| PREDICTED: uncharacterized protein LOC103707550 [Phoenix dactylifera]
Length=982

 Score =   357 bits (917),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 199/442 (45%), Positives = 259/442 (59%), Gaps = 48/442 (11%)
 Frame = -3

Query  1488  FHSNSILVT*VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTI  1345
             FH  +  VT V E    QLFYYFI+SE+ PE D                 L    GPL  
Sbjct  558   FHLETGYVT-VDEANDAQLFYYFIKSERKPEEDPLMVWQSGGPGCSAFSGLVFEIGPLKF  616

Query  1344  NYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFL  1165
             + A     +P L  NP+ WTKV NIIF+D PVG G+SYS    +Y T DT +A+  ++FL
Sbjct  617   DVAGYIDGLPTLVYNPHTWTKVCNIIFLDSPVGVGFSYSSVGKSYETGDTKTARQVHTFL  676

Query  1164  VQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHR  985
              +W +DHP FL+NPLY+ GDSYSGI VP+V + I  G + G E   N+KG + GNP+T  
Sbjct  677   RKWFIDHPKFLSNPLYIGGDSYSGIIVPVVAQKIAKGDQDGDELPYNLKGYLVGNPVTDE  736

Query  984   FSDTNNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMP  805
               D    V Y + MG +SD LY+STK+SC G Y  A P N  C   LQ V +CT+ IN  
Sbjct  737   KFDNGAVVPYAHGMGLISDELYESTKKSCGGEY--ASPRNEQCANYLQSVNECTKGINSE  794

Query  804   QILEPAC-----NPEILLS--------------LDGENLPQQWCRDDNYLFAYSWANNKI  682
             QILEP C      P ++ +              L   +LP + CR   YL +Y WA+N  
Sbjct  795   QILEPLCFSASPKPNMVAAYSRRLLKEDIKKFPLLNSDLPLE-CRSFGYLLSYFWADNDT  853

Query  681   VQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSG  502
             V++AL +R+GT+  W RCNH L           Y +++ +++ +H + T++  R L+YSG
Sbjct  854   VREALNIRKGTVQHWQRCNHDL----------LYTYDIPSSIKFHLNLTSRGYRALVYSG  903

Query  501   DHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHT  322
             DHDM VP V T+ WI SL   + DDWRPW V+ QVAG+T  YS     LT+ATVKGAGHT
Sbjct  904   DHDMGVPFVGTQGWIRSLNFSIVDDWRPWSVDGQVAGFTRTYSNN---LTFATVKGAGHT  960

Query  321   APEYKPRECLPMIQRWLSIYPL  256
             APEY+P+ECL M+QRWLS  PL
Sbjct  961   APEYRPKECLAMLQRWLSGAPL  982


 Score =   352 bits (904),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 193/425 (45%), Positives = 250/425 (59%), Gaps = 47/425 (11%)
 Frame = -3

Query  1437  QLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNPY  1294
             QLFYYFI+SE+ PE D                 L    GPL  + A  T  +P L  +PY
Sbjct  68    QLFYYFIKSERKPEEDPLMVWLSGGPGCSAFSGLVFEIGPLKFDVAGYTDGLPTLVYHPY  127

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
              WTKV +IIF+D PVGTG+SYS    +Y T DT +A+  ++FL +W +DHP FL+NPLYV
Sbjct  128   TWTKVCSIIFLDSPVGTGFSYSSMGKSYETGDTKAARQVHTFLRKWFIDHPEFLSNPLYV  187

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFL  934
              GDSYSGI VP+V + I  G + G E   N+KG + GNP T    D    V Y + MG +
Sbjct  188   GGDSYSGIVVPVVAQEIAKGDQDGDELPYNLKGYMVGNPSTDEKFDNGAFVPYAHGMGLI  247

Query  933   SDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-----NPEIL  769
             SD LY+STK+SC G Y  A P N  C   LQ + +C E IN  QILEP C      P ++
Sbjct  248   SDELYESTKKSCGGEY--ASPRNEQCANYLQSINECIEGINGAQILEPVCFFVSPKPNMV  305

Query  768   LS--------------LDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLR  631
              +              L   +LP + CR   YL +Y WA+N  V++AL +R+GT+  W R
Sbjct  306   AAYGRRLLKEDIKEFPLLNSDLPLE-CRSSAYLLSYFWADNDTVREALNIRKGTVQHWQR  364

Query  630   CNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIES  451
             CN  L           Y  NV +++ +H + T++  R L+YSGDHDM+VP + T+ WI S
Sbjct  365   CNSDL----------LYTHNVPSSLKFHLNLTSRGYRALVYSGDHDMLVPFLGTQGWIRS  414

Query  450   LKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
             L   + DDWRPW  + QVAG+T  YS     LT+ATVKGAGHTAPEY+P+ECL M+QRWL
Sbjct  415   LNFSIVDDWRPWSADGQVAGFTRTYSNN---LTFATVKGAGHTAPEYRPKECLAMLQRWL  471

Query  270   SIYPL  256
             S  PL
Sbjct  472   SGVPL  476



>ref|XP_007200900.1| hypothetical protein PRUPE_ppb017681mg [Prunus persica]
 gb|EMJ02099.1| hypothetical protein PRUPE_ppb017681mg [Prunus persica]
Length=416

 Score =   341 bits (875),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 193/442 (44%), Positives = 252/442 (57%), Gaps = 76/442 (17%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEt-------------dplllwltggpgplTINYANSTGDIPDLELN  1300
             +QLFYYF ESE SPE                    +    GPL+ + A+S G+ P L+LN
Sbjct  4     VQLFYYFFESEGSPEYDPLVLWLTGGPGCSAFSAIVYENLGPLSFDSAHSIGNKPKLKLN  63

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAY-NTNDTLSAQHTYSFL------------VQ  1159
             PY+WTKVANIIF+D PVGTG+SY++  + Y N NDT+SA  TY FL            VQ
Sbjct  64    PYSWTKVANIIFLDAPVGTGFSYTKNWEGYANLNDTISAAQTYEFLRKFSYIFVFTVVVQ  123

Query  1158  WLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFS  979
             WL+DHP F NNPLY+AGDSYSGI VP+VV+ I DG +    P +N+KG + GNP+T    
Sbjct  124   WLMDHPKFYNNPLYIAGDSYSGIIVPMVVQEISDGNQDEHAPPMNLKGYVLGNPVTDSEK  183

Query  978   DTNNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQI  799
             D N+RV++ Y    +S+ LY+S K +C G+YI+   +N+ C  DL+   +C E +N  QI
Sbjct  184   DDNSRVLFAYMKALISEELYQSMKINCKGDYINVDLNNTLCVDDLELYNECIEDVNDVQI  243

Query  798   LEPAC-------------------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQ  676
             LEP C                      + L L    L + WCR   YL +Y WAN+K VQ
Sbjct  244   LEPVCTVHSPKPAQSKGYADDRTNKDSVNLLLSFPQLRRPWCRSYAYLLSYIWANDKTVQ  303

Query  675   KALGVRE--GTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSG  502
             +AL ++E  G++ EW RCN TL         E Y+ +V +++ YH +   +  RVL+YSG
Sbjct  304   EALHIQENQGSVKEWERCNKTL--------QEFYISDVSSSLVYHENLIKQGYRVLVYSG  355

Query  501   DHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHT  322
             DHDM VP+V T  WIESL + V   W+PWFV+ Q                     GAGHT
Sbjct  356   DHDMNVPYVGTMGWIESLNLTVVSRWKPWFVDGQ---------------------GAGHT  394

Query  321   APEYKPRECLPMIQRWLSIYPL  256
             APEYKP EC  MI RWL+ YPL
Sbjct  395   APEYKPEECFAMISRWLAYYPL  416



>ref|XP_010040883.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW44821.1| hypothetical protein EUGRSUZ_L01608 [Eucalyptus grandis]
Length=418

 Score =   341 bits (874),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 180/385 (47%), Positives = 249/385 (65%), Gaps = 39/385 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E  ++QLFYYFIESE+SP+ D              L  L    GP+  ++++S+G  P
Sbjct  44    VGELEEVQLFYYFIESERSPKDDPLLLWLTGGPGCSSLSGLIYEIGPMQFDFSSSSGTKP  103

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L+ NPY+WTKVANIIF+D PVGTG+SY+ TS AY+ +DT SA  TY FL +WL+ HP+F
Sbjct  104   ILKYNPYSWTKVANIIFLDAPVGTGFSYATTSTAYDISDTSSAAQTYEFLRKWLVSHPSF  163

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L NPLYV GDSYSG+ +P++V+NI DG+E+G +P++N+ G   GNP+T    D + R+ Y
Sbjct  164   LANPLYVTGDSYSGVVIPIIVKNIQDGIEAGRQPQMNLVGYTMGNPVTCDKKDVSFRIPY  223

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN--  781
               +M  +SD LY++TK  CNG++ +  P N AC  DL+ V+ C EKI + QILEP+CN  
Sbjct  224   ANKMALVSDELYETTKIDCNGDFQNVDPTNGACLTDLEMVSLCLEKIYLQQILEPSCNVI  283

Query  780   ----------PEILL--SLDGENLPQQ---WCRDDNYLFAYSWANNKIVQKALGVREGTM  646
                         IL   ++D  ++PQQ   WCR  NY+++Y WAN++ V++ALGVREGT 
Sbjct  284   SPNYTRLKWSRSILEDDTVDIVSVPQQSRPWCRSANYIYSYIWANDEKVREALGVREGTK  343

Query  645   TEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTE  466
              EW RCN TLS          Y  +V + V YH   + K+ R L+YSGDHD+ +P+VST 
Sbjct  344   QEWNRCNFTLS----------YTKDVLDAVVYHEYLSEKTLRALVYSGDHDISIPYVSTL  393

Query  465   KWIESLKVGVEDDWRPWFVEDQVAG  391
              WI SL + ++  W PWFV+ Q+AG
Sbjct  394   DWIRSLNLSLKGSWSPWFVKGQIAG  418



>ref|XP_006350186.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X2 [Solanum 
tuberosum]
Length=389

 Score =   339 bits (870),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 172/337 (51%), Positives = 233/337 (69%), Gaps = 16/337 (5%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E  K+QLFYYF+ESE+ P+ D              L       GPLT +YANS+G+ P
Sbjct  45    VGEEEKLQLFYYFVESERDPQNDPLIIWLIGGPGCSGLSAFLYEIGPLTFDYANSSGNFP  104

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              LELN ++W+KVANIIF+DQPVG GYSY++TS+AYN+NDTLSA   Y FL +WL+DHP +
Sbjct  105   KLELNLHSWSKVANIIFIDQPVGAGYSYAKTSEAYNSNDTLSATLIYDFLRKWLMDHPEY  164

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L NPLYVAGDSY+GI + LV R IYDG+E G EP++N+KG I+GN LT R++  N+RV Y
Sbjct  165   LKNPLYVAGDSYAGIYIALVTRKIYDGVEVGDEPQMNIKGYIQGNALTDRYTTMNSRVKY  224

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
              Y MG +SD +Y+S K +CNGNY+D  P+N  C  DLQ+V KC   I    ILE  C   
Sbjct  225   AYHMGLISDKIYQSAKANCNGNYVDIDPNNILCLNDLQKVKKCLNSIRRDHILENWCELS  284

Query  774   ILLSLDGE--NLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLS-GPP  604
             +L+S       +P  WCR++NY+++  WAN+K VQKAL +REGT+ EW++CN ++  G  
Sbjct  285   VLMSNVHSLFPIPGPWCRENNYIYSKIWANDKAVQKALNIREGTILEWVKCNQSMRYGLH  344

Query  603   EA-ERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDH  496
             E  +RSE+YV++++ ++D HR  ++KSCR L+Y  D 
Sbjct  345   EGMKRSESYVYDIQTSIDDHRHLSSKSCRALVYRMDR  381



>emb|CDP08179.1| unnamed protein product [Coffea canephora]
Length=500

 Score =   343 bits (880),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 175/380 (46%), Positives = 235/380 (62%), Gaps = 35/380 (9%)
 Frame = -3

Query  1326  GDIPDLELNPYAWTK-VANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLL  1150
             G +P L  NPYAWTK +A+II +D PVGTG+SY+ TS  Y ++DT S +  Y FL +WLL
Sbjct  133   GSLPSLHANPYAWTKQIASIILLDLPVGTGFSYATTSQGYFSSDTKSTKDAYLFLQKWLL  192

Query  1149  DHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGL-ESGIEPRLNMKGCIEGNPLTHRFSDT  973
             +HP F+ N LY+AGDSY+G  VP+VV  I +G  E+G++PR++++G + GNPLT    D 
Sbjct  193   NHPRFMKNRLYIAGDSYAGKIVPMVVLEISNGGNEAGLKPRMSVEGYMVGNPLTDSRKDE  252

Query  972   NNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILE  793
             N +V Y +R+G +SD  Y+  K SCNG YI+  P+N+ C + L  + +C   I    ILE
Sbjct  253   NWKVPYAHRLGLISDEYYERAKSSCNGEYINPSPNNTECLFALHLIQECISGIYPANILE  312

Query  792   PAC-------------------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKA  670
             P C                   + +ILL    +  P+  CRDD Y+ +  W N+  VQ+A
Sbjct  313   PKCQHLASREGLQWDQDYLEEDSIDILLPSSDQEKPK--CRDDTYVLSRVWMNDPTVQEA  370

Query  669   LGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDM  490
             L +REGT  +W RCN          RS +Y  +V +  DYH+    K  + LIYSGDHDM
Sbjct  371   LQIREGTKEQWRRCN----------RSISYDMDVASVFDYHQVLIRKGYQALIYSGDHDM  420

Query  489   IVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYE--LTYATVKGAGHTAP  316
             +VP++ T +WI  L + VEDDWRPWFV  Q+AGYT+ Y   E     T+ATV GAGHTAP
Sbjct  421   MVPYLGTLQWIRDLNLTVEDDWRPWFVNGQIAGYTLNYQFNEDVCCFTFATVMGAGHTAP  480

Query  315   EYKPRECLPMIQRWLSIYPL  256
             EYKP+EC  MI RW + YPL
Sbjct  481   EYKPKECFAMIDRWFTNYPL  500



>ref|XP_010277006.1| PREDICTED: serine carboxypeptidase-like 1 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010277007.1| PREDICTED: serine carboxypeptidase-like 1 isoform X1 [Nelumbo 
nucifera]
Length=467

 Score =   342 bits (877),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 181/428 (42%), Positives = 251/428 (59%), Gaps = 42/428 (10%)
 Frame = -3

Query  1452  ENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDL  1309
             E+  + LFYYFI+SE+ P+ D              L  L    GPL I      G +P L
Sbjct  53    ESEDVHLFYYFIKSERDPKHDPLMLWLTGGPGCSALSGLLFEIGPLRIETMKYNGSLPSL  112

Query  1308  ELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLN  1129
              LNPY+WTK ++IIF+D P+GTG+SYS +     T D  S Q  Y FL +WL+DHP FL+
Sbjct  113   ALNPYSWTKASSIIFLDSPIGTGFSYSSSFQGSQTGDIKSCQQAYQFLRKWLMDHPEFLS  172

Query  1128  NPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGY  949
             N +Y+ GDSYSG T PLVV +I +G ++G EP +N+KG + GNP+T    D+N ++ + +
Sbjct  173   NAVYIGGDSYSGKTAPLVVIDILNGNDAGEEPFINIKGYLLGNPVTDVSYDSNKQLPHAH  232

Query  948   RMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN----  781
              +G +SD LY+S K +C G Y++  P N  C  D+Q  ++C   IN   ILEP C     
Sbjct  233   GLGLVSDELYQSAKINCQGEYVNINPSNVQCLQDMQAFSECLSGINTAHILEPLCGFASP  292

Query  780   -PEILLS------------LDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTE  640
              P+                LD +    ++CR D YL +Y WAN+  V+KAL +R+G++ E
Sbjct  293   KPKEKFGDRRYLEDNSREILDPQPSSTEFCRTDGYLLSYYWANDDNVRKALNIRKGSIGE  352

Query  639   WLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKW  460
             W RCN+ LS          Y   ++++  YH + + K  R LIYSGDHD+IVP ++T+ W
Sbjct  353   WRRCNYGLS----------YTAEIQSSFSYHVNLSRKGYRSLIYSGDHDLIVPFLATQAW  402

Query  459   IESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQ  280
             I SL   + D WR W V+ QV GYT  YS     +T+ATVKG GHTAPEY+P+ CL M +
Sbjct  403   IHSLNYSIVDGWRSWVVDGQVGGYTRTYSNN---MTFATVKGGGHTAPEYQPKACLAMYK  459

Query  279   RWLSIYPL  256
             RW+   PL
Sbjct  460   RWIDEEPL  467



>dbj|BAF56655.1| serine carboxypeptitase-like protein 1 [Diospyros kaki]
Length=452

 Score =   341 bits (875),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 190/426 (45%), Positives = 265/426 (62%), Gaps = 39/426 (9%)
 Frame = -3

Query  1443  KIQLFYYFIESEKSPEtdplllwltggpgplTINY-------------ANSTGDIPDLEL  1303
             ++QLFYYF+ES+  P  DPL+LWLTGGPG    +              +   G +P L  
Sbjct  36    EVQLFYYFVESQGDPSNDPLILWLTGGPGCSGFSALVYEIGPLLFKVQSWKPGTLPSLRA  95

Query  1302  NPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNP  1123
             +  +WTKVANIIF+DQPVGTG+SY  T+ AYN++DT++A   Y FL +WL+ +P F  NP
Sbjct  96    SKNSWTKVANIIFIDQPVGTGFSYGTTAAAYNSSDTVAAAQVYKFLRKWLMYNPKFGANP  155

Query  1122  LYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRM  943
             LYV GD YSGITVPL+V+ I DG+ SG  PR+ +KG + GNPLT  F D N+++ Y +R+
Sbjct  156   LYVGGDLYSGITVPLLVQTILDGIGSGSLPRMQLKGYLLGNPLTDDFIDANSKIPYAFRV  215

Query  942   GFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-------  784
               LSD LY+  + SCNG++++   +N+ C   LQ + +  + +N  Q   P C       
Sbjct  216   NLLSDELYEDAEVSCNGDFVNVDFNNTNCVAVLQGIKENLQLLNEAQNFGPLCALAKPKG  275

Query  783   --------NPEILLSLDGEN-LPQQWCRDDNYLFAYSWANNKIVQKALGVREGTM-TEWL  634
                       E   SL  ++ +PQ  CR  +++ +Y + N++ VQ+ALGV+EGTM + W 
Sbjct  276   EGIQWGAEEAEFTDSLILQDIIPQLTCRSSSWMLSYIYMNDEGVQRALGVKEGTMNSTWR  335

Query  633   RCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIE  454
             RC  +L           Y  +V +TV YH++FT  + R LIYSGD  + +P++ T +WI 
Sbjct  336   RCAKSLP---------FYEEDVSSTVAYHKNFTRTALRALIYSGDQALSIPYLGTLEWIN  386

Query  453   SLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRW  274
             SL V + D WRPWFV+ QVAGYT KY +  Y LT+ATVKGAG TAPEYK +E L M+ RW
Sbjct  387   SLGVPIFDTWRPWFVDGQVAGYTQKYEKNSYSLTFATVKGAGETAPEYKRKEALAMVNRW  446

Query  273   LSIYPL  256
              + YP+
Sbjct  447   FAGYPV  452



>ref|XP_007047573.1| Serine carboxypeptidase-like 2, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007047574.1| Serine carboxypeptidase-like 18, putative isoform 1 [Theobroma 
cacao]
 gb|EOX91730.1| Serine carboxypeptidase-like 2, putative isoform 1 [Theobroma 
cacao]
 gb|EOX91731.1| Serine carboxypeptidase-like 18, putative isoform 1 [Theobroma 
cacao]
Length=476

 Score =   342 bits (877),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 185/421 (44%), Positives = 242/421 (57%), Gaps = 43/421 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             ++ F+YFIESE++P  D              L  L    GPL  N     G +P   LNP
Sbjct  65    VEFFFYFIESERNPAEDPLFLWLTGGPGCSALSGLFFEIGPLQFNMVEYNGSLPTFALNP  124

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTKVA+IIF+D PVGTG+SYS T   + T D   A   Y+FL +WL  H  F+ NP Y
Sbjct  125   YSWTKVASIIFLDAPVGTGFSYSRTLQGFKTGDKQYADDAYNFLRKWLDSHRKFITNPFY  184

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             + GDSYSG+ VP++ + I DG+E    P +N+KG + GNP T    D N+++ + +R+  
Sbjct  185   IGGDSYSGMIVPIIAQAISDGIEDKGVPSINLKGYLLGNPGTDSKFDDNSKIPFYHRVAL  244

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPEI--LLS  763
             +SD LY+S K +C   Y++    N  C  DLQ +++CT  IN   ILEP C  E   L S
Sbjct  245   ISDELYESAKRNCKEEYVEVDISNVDCAKDLQAISECTVHINEGHILEPDCPTEFKPLNS  304

Query  762   LD----------------GENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLR  631
             LD                    PQ  CR+ N      WA +  VQKAL VR+GT+TEW+R
Sbjct  305   LDNNRKYFLETHEEYLRVAAEFPQFGCRNYNGYLCKVWATDISVQKALYVRQGTVTEWVR  364

Query  630   CNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIES  451
             CN +L           Y  +V++ V YHR    K  R LIYSGDHD +VP+V TE WI+S
Sbjct  365   CNSSL----------LYDKDVESAVGYHRYLNTKGYRALIYSGDHDTVVPYVGTEAWIKS  414

Query  450   LKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
             L   + DDWRPWFV+ QV GY+ +Y       T+ATVKG GHTAPEYKP+ECL M +RW+
Sbjct  415   LNFSIVDDWRPWFVDGQVGGYSREYGNN---FTFATVKGGGHTAPEYKPKECLAMFKRWI  471

Query  270   S  268
             S
Sbjct  472   S  472



>ref|XP_002272116.1| PREDICTED: serine carboxypeptidase-like 16 [Vitis vinifera]
 emb|CBI25133.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   341 bits (875),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 191/419 (46%), Positives = 260/419 (62%), Gaps = 35/419 (8%)
 Frame = -3

Query  1437  QLFYYFIESEKSPEtdplllwltggpgplTIN------------YANSTGDIPDLELNPY  1294
             +LFYYFIES+ +P+TDP  LWLTGGPG  + N              N  G +P L    Y
Sbjct  61    ELFYYFIESQGNPQTDPFFLWLTGGPGCSSFNGLIYEIGPMEFDIHNYPGGLPRLLPYKY  120

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
             AWTK A+I+F+D PVGTG+SYS ++D ++++DT SA  TY FL +WL++HP +L   LYV
Sbjct  121   AWTKTASILFLDAPVGTGFSYSTSADGWSSSDTDSALETYEFLRKWLIEHPKYLPLQLYV  180

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFL  934
              GDSYSGI VPLVV++I D ++    PR N++G + G+P T    +TN +VV+ +R+  +
Sbjct  181   GGDSYSGIIVPLVVKHIVDAIDEHTVPRFNLQGYLVGSPTTDENINTNAKVVFAHRLALI  240

Query  933   SDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---NPE-ILL  766
             SD LY++ KE+CNGNY D  P N+ C   L  +  C + +    ILEP C   +PE    
Sbjct  241   SDELYEAAKENCNGNYADVDPSNTKCLSSLGEIQHCVKDLFRNDILEPKCVFESPEPTRR  300

Query  765   SLDGE---------NLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLS  613
             SLD +          L + WCR+ NY  +Y WAN++ VQ+AL VR GT+  W RCN +LS
Sbjct  301   SLDEKPGDFILNTPKLEEFWCRNFNYALSYIWANDESVQEALNVRVGTVKYWSRCNKSLS  360

Query  612   GPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVE  433
                       Y  +V++ +D HR  + K   VL+  GD D++VP+    +WI  L + + 
Sbjct  361   ----------YTKDVQSVIDVHRYLSKKQLEVLVEVGDRDLVVPYPGAVEWIRLLNLTIV  410

Query  432   DDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
               WRPWFV+ ++AGYT K+SQ  Y LTYATVKGAGHTAPEY  REC  M +RW+  YPL
Sbjct  411   SPWRPWFVDGEIAGYTEKHSQNGYRLTYATVKGAGHTAPEYYRRECYYMFKRWVHYYPL  469



>ref|XP_006472320.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X1 [Citrus 
sinensis]
 ref|XP_006472321.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X2 [Citrus 
sinensis]
Length=467

 Score =   341 bits (875),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 186/433 (43%), Positives = 247/433 (57%), Gaps = 45/433 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E+ + QLFYYF++SEK+P+ D                 L    GP+  N     G +P
Sbjct  48    VGESEEAQLFYYFVKSEKNPKEDPLLLWLTGGPGCSAFSGLAYEIGPVNFNTVEYNGSLP  107

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L LNPY+WTK A+I+FVD PVGTG+SY+ T  A  T D     H   FL +WL+DHP F
Sbjct  108   TLRLNPYSWTKEASILFVDSPVGTGFSYARTPHASQTGDFKQVHHLDQFLRKWLMDHPEF  167

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             ++NP YV GDSYSGITVP +V+ I +  E  I+P +N++G I GNP T    + N+++ +
Sbjct  168   ISNPFYVGGDSYSGITVPALVQRISNENEEDIKPLINLQGYILGNPRTDMVVEQNSQIPF  227

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
              + MG +S+ LY+S K +C G Y++  P+N  C  D+Q  +K T  +    ILEP C   
Sbjct  228   AHGMGLISNELYESLKITCGGEYVNVDPNNKDCLNDIQTFSKLTSGVEKSHILEPHCQFF  287

Query  783   ----------------NPEILLSLDGE-NLPQQWCRDDNYLFAYSWANNKIVQKALGVRE  655
                             N +    LD E   P   CR   YL A  W N+  V+KAL VR+
Sbjct  288   SPKPRASSRNRRSLNVNEQSQEFLDPEPTFPPIGCRSYGYLLARYWDNDHNVRKALHVRQ  347

Query  654   GTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHV  475
             G+  EW+RCN+ L           Y   + N+  YH S + K  R LIYSGDHDM++P +
Sbjct  348   GSKGEWIRCNYDLP----------YTHEIGNSFSYHVSLSTKGYRSLIYSGDHDMLIPFL  397

Query  474   STEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPREC  295
              TE WI+SL   + DDWRPW +  QVAGYT  YS    ++TYATVKG GHTAPEY+P EC
Sbjct  398   GTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSN---QMTYATVKGGGHTAPEYRPAEC  454

Query  294   LPMIQRWLSIYPL  256
               M QRW++  PL
Sbjct  455   YAMFQRWINHDPL  467



>ref|XP_002510077.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF52264.1| serine carboxypeptidase, putative [Ricinus communis]
Length=468

 Score =   340 bits (872),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 181/430 (42%), Positives = 255/430 (59%), Gaps = 45/430 (10%)
 Frame = -3

Query  1452  ENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDL  1309
             E+  +QLFYYF++S+++ + D              L  L    GPLT       G +P L
Sbjct  53    ESEDVQLFYYFVKSQRNAKEDPLLLWLTGGPGCSGLSGLLYEIGPLTFEVVEYNGSLPTL  112

Query  1308  ELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLN  1129
              LNP++WT+VA+IIF+D PVGTG+SY++T  A  + D       + FL +WL DHP FL 
Sbjct  113   ILNPHSWTQVASIIFIDIPVGTGFSYAQTQLAAYSTDLTQVHQAHLFLRKWLRDHPEFLA  172

Query  1128  NPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGY  949
             NP+Y+AGDSYSGIT+P +V++I +G E G EP +N++G I GNP+T    DTN+ V + +
Sbjct  173   NPVYIAGDSYSGITLPAIVQHISNGNEKGTEPLINLQGYIIGNPVTDSSFDTNSGVPFAH  232

Query  948   RMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-----  784
              MG +SD L++S K SC  +Y+   P N+ C   LQ   KC  ++   QILEP C     
Sbjct  233   GMGLISDELFESLKRSCGEDYVSIDPSNTECLQYLQDFDKCRSELQQGQILEPICGFASP  292

Query  783   --------------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTM  646
                           N +  L +D  ++P   CR   Y  +Y W +++ V++AL +REG++
Sbjct  293   KPFQLFGKRRSLNENSQYFLDID-PSIPSIGCRTYAYTLSYIWVDDRSVRQALHIREGSV  351

Query  645   TEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTE  466
              +WLRCN+ +           Y  ++ +++ YH   + K  R LIYSGDHDMIVP + T+
Sbjct  352   KQWLRCNYGIP----------YASDIPSSIKYHAYLSKKGYRSLIYSGDHDMIVPFLGTQ  401

Query  465   KWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPM  286
              W+ SL   + DDWRPW V+ QVAGYT  YS +   +T+ATVKG GHTAPEYKP ECL M
Sbjct  402   GWVRSLNYSITDDWRPWKVQGQVAGYTRTYSNR---MTFATVKGGGHTAPEYKPAECLAM  458

Query  285   IQRWLSIYPL  256
              +RW +  PL
Sbjct  459   FKRWTNQEPL  468



>gb|KJB48748.1| hypothetical protein B456_008G084200 [Gossypium raimondii]
Length=455

 Score =   339 bits (870),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 185/419 (44%), Positives = 245/419 (58%), Gaps = 39/419 (9%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             ++ FYYFIESE++P  D              L       GPL  N     G +P   LN 
Sbjct  52    LEFFYYFIESERNPAEDPLVLWLTGGPGCSSLSGFFLEIGPLRFNMVEYNGSLPTFFLNQ  111

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             YAWTKV++IIF+D PVGTG+SYS T+  + T D   A   Y+FL +WL  HP F++NPLY
Sbjct  112   YAWTKVSSIIFLDAPVGTGFSYSRTAQGFKTGDMKHAISCYNFLRKWLQSHPKFISNPLY  171

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             +AGDSYSG+ VP++ + I D +E+  +P LN+KG + GNP T    D N++++Y  RM  
Sbjct  172   IAGDSYSGMIVPIITQAISDDIEA--KPVLNLKGYLLGNPFTDAKFDGNSKIIYYNRMAL  229

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPEI-----  772
             +SD LY+S K +C   YID    N  C  DLQ +++CT  IN   ILEP C  E      
Sbjct  230   ISDELYESAKSNCKQEYIDVEISNRMCVKDLQTISECTAHINTMHILEPYCPSEFPEVRK  289

Query  771   -LLSLDGENL------PQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLS  613
              LL    ++L      PQ  CR+        WA +  VQKAL +R+GT+ EW+RCN    
Sbjct  290   YLLETHEDSLHLSDGYPQFGCRNYYCYLCKVWATDISVQKALHIRKGTIKEWVRCN----  345

Query  612   GPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVE  433
                   +S  Y ++V + V YH     +  R LIYSGDHD+ V +V TE WI+SL + + 
Sbjct  346   ------KSMDYDYDVASVVSYHLCLNTRGYRALIYSGDHDLAVTYVGTESWIKSLNLSIV  399

Query  432   DDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             DDWRPW V+ QVAGY+ +Y       T+ATVKGAGHTAPEYKP+E   M +RW+S  PL
Sbjct  400   DDWRPWIVDGQVAGYSREYGNN---FTFATVKGAGHTAPEYKPKESFSMFKRWISQQPL  455



>gb|KDO81468.1| hypothetical protein CISIN_1g012276mg [Citrus sinensis]
Length=467

 Score =   339 bits (870),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 184/433 (42%), Positives = 247/433 (57%), Gaps = 45/433 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E+ + QLFYYF++S+K+P+ D                 L    GP+  N     G +P
Sbjct  48    VGESEEAQLFYYFVKSDKNPKEDPLLLWLTGGPGCSAFSGLAYEIGPVNFNTVEYNGSLP  107

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L LNPY+WTK A+I+FVD PVGTG+SY+ T  A  T D     H   FL +WL+DHP F
Sbjct  108   TLRLNPYSWTKEASILFVDSPVGTGFSYARTPHASQTGDFKQVHHLDQFLRKWLMDHPEF  167

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             ++NP YV GDSYSGITVP +V+ I +  E  I+P +N++G I GNP T    + N+++ +
Sbjct  168   ISNPFYVGGDSYSGITVPALVQRISNENEEDIKPLINLQGYILGNPRTDMVVEQNSQIPF  227

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
              + MG +S+ LY+S K +C G Y++  P+N  C  D+Q  +K T  +    ILEP C   
Sbjct  228   AHGMGLISNELYESLKITCGGEYVNVDPNNKDCLNDIQTFSKLTSGVEKSHILEPHCQFF  287

Query  783   ----------------NPEILLSLDGE-NLPQQWCRDDNYLFAYSWANNKIVQKALGVRE  655
                             N +    LD E   P   CR   YL A  W N+  V+KAL +R+
Sbjct  288   SPKPRASSRNRRSLNVNEQSQEFLDPEPTFPPIGCRSYGYLLARYWDNDHNVRKALHIRQ  347

Query  654   GTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHV  475
             G+  EW+RCN+ L           Y   + N+  YH S + K  R LIYSGDHDM++P +
Sbjct  348   GSKGEWIRCNYDLP----------YTHEIGNSFSYHVSLSTKGYRSLIYSGDHDMLIPFL  397

Query  474   STEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPREC  295
              TE WI+SL   + DDWRPW +  QVAGYT  YS    ++TYATVKG GHTAPEY+P EC
Sbjct  398   GTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSN---QMTYATVKGGGHTAPEYRPAEC  454

Query  294   LPMIQRWLSIYPL  256
               M QRW++  PL
Sbjct  455   YAMFQRWINHDPL  467



>ref|XP_010936156.1| PREDICTED: serine carboxypeptidase-like 18 [Elaeis guineensis]
Length=394

 Score =   337 bits (863),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 175/383 (46%), Positives = 234/383 (61%), Gaps = 35/383 (9%)
 Frame = -3

Query  1347  INYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSF  1168
              + A  T  +P L  NPY+WTKV +IIF+D PVGTG+SYS    +Y T DT +A+  ++F
Sbjct  28    FDVAGYTEGLPSLVNNPYSWTKVCSIIFLDSPVGTGFSYSSVEKSYETGDTKAARQVHTF  87

Query  1167  LVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTH  988
             L +WL+DHP F++NPLY+ GDSYSGI VP+V + I  G + G +   N+KG + GNP+T 
Sbjct  88    LRKWLIDHPEFISNPLYIGGDSYSGIVVPVVAQEIAKGDQDGDKLLYNLKGYLVGNPVTD  147

Query  987   RFSDTNNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINM  808
                D    V + + MG +SD LY+STK+SC   Y  A P N  C   L+ + +CTE IN+
Sbjct  148   DKFDKGAFVPFAHGMGLISDELYESTKKSCGEEY--ASPRNDQCANYLESIEECTEGINI  205

Query  807   PQILEPAC---NPE---------ILLSLD-------GENLPQQWCRDDNYLFAYSWANNK  685
              QILEP C   +P+          LL  D          LP + CR   YL +Y WA+N 
Sbjct  206   FQILEPVCFYASPKPGRVAAYGRRLLKEDIKEFRLLKSGLPLE-CRSSGYLLSYFWADNN  264

Query  684   IVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYS  505
              V++AL +R+GT+  W RCNH L           Y ++V +++ +H + T+   R L+YS
Sbjct  265   TVREALNIRKGTVQHWQRCNHDLH----------YAYDVPSSLKFHLNLTSIGYRALVYS  314

Query  504   GDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGH  325
             GDHDMIVP V T+ WI SL   + DDWRPW  + QVAG+T  YS     LT+ TVKG GH
Sbjct  315   GDHDMIVPFVGTQAWIRSLNFSIVDDWRPWSADGQVAGFTRTYSNN---LTFVTVKGGGH  371

Query  324   TAPEYKPRECLPMIQRWLSIYPL  256
              APEY+P+ECL M+QRWLS  PL
Sbjct  372   LAPEYRPKECLVMLQRWLSGAPL  394



>ref|XP_010061646.1| PREDICTED: serine carboxypeptidase-like 2 [Eucalyptus grandis]
 gb|KCW68630.1| hypothetical protein EUGRSUZ_F02236 [Eucalyptus grandis]
Length=477

 Score =   339 bits (870),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 181/439 (41%), Positives = 254/439 (58%), Gaps = 42/439 (10%)
 Frame = -3

Query  1488  FHSNSILVT*VWENLKIQLFYYFIESEKSPEtdpl----------llwltggpgplTINY  1339
             FH  +  V  V E+ +IQLFYYF ESE++ + D L                      +N+
Sbjct  53    FHLETGYVA-VGESEEIQLFYYFAESERNSKEDALFLWLTGGPGCSALSGLIYEIGPLNF  111

Query  1338  ANSTGD--IPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFL  1165
                  D  +P+  LNPY+WTK ++IIFVD PVGTG+SY+E   AY T D    QH + FL
Sbjct  112   NIKAYDRSLPEFVLNPYSWTKASSIIFVDSPVGTGFSYAENPLAYETGDFRQVQHLHQFL  171

Query  1164  VQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHR  985
              +WL+ HP F++NP+Y+ GDSYSG+T+P++V+ I DG + G  P +N++G + GNPLT  
Sbjct  172   RRWLISHPEFISNPVYIGGDSYSGLTLPILVQEIMDGNDEGKSPAINIQGYVLGNPLTDP  231

Query  984   FSDTNNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMP  805
               D N  V++ + MG +SD LY+S K +C G+Y  +   ++ C  DL    +CT  +   
Sbjct  232   AFDQNAPVLFAHGMGLISDELYESLKRTCKGHYQFSESSDADCMNDLMAFHQCTSGLQTA  291

Query  804   QILEPACNPEIL----LSLDGENLPQQW------------CRDDNYLFAYSWANNKIVQK  673
             QILEP C    +    +  D  +L + +            CR   Y  +YSW N+  V++
Sbjct  292   QILEPLCGYASMKPGEMFGDRRSLLENFFLVREPTDLDLGCRTYGYRLSYSWTNDDNVRE  351

Query  672   ALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHD  493
             AL +R+G++ +W RCN+ L+          Y  ++ +T+ YH   + + CR LIYSGDHD
Sbjct  352   ALHIRKGSIGDWQRCNNELN----------YTNDISSTLQYHAKLSARGCRSLIYSGDHD  401

Query  492   MIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPE  313
             MIVP + T+ WI SL   + DDWR W V  QVAGYT  YS     +T+ATVKG GHTAPE
Sbjct  402   MIVPFMGTQAWIRSLNYSIIDDWRSWMVRGQVAGYTRTYSNG---MTFATVKGGGHTAPE  458

Query  312   YKPRECLPMIQRWLSIYPL  256
             YKP EC  M +RW+S  PL
Sbjct  459   YKPEECFAMFERWISREPL  477



>ref|XP_007201000.1| hypothetical protein PRUPE_ppa005249mg [Prunus persica]
 gb|EMJ02199.1| hypothetical protein PRUPE_ppa005249mg [Prunus persica]
Length=429

 Score =   337 bits (865),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 174/388 (45%), Positives = 238/388 (61%), Gaps = 42/388 (11%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEt-------------dplllwltggpgplTINYANSTGDIPDLELN  1300
             +QLFYYF ESE SPE                    +    GPL+ +YA+S G+ P L+LN
Sbjct  50    VQLFYYFFESEGSPEYDPLVLWLNGGPGCSAFSGLVYENLGPLSFDYAHSIGNKPKLKLN  109

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNT-NDTLSAQHTYSFLVQWLLDHPTFLNNP  1123
             PY+WTKVANIIF+D PVGTG+SY++  + YN  NDTLSA  TY FL +WL+DHP F NNP
Sbjct  110   PYSWTKVANIIFLDAPVGTGFSYAKNWEGYNNLNDTLSAAQTYEFLRKWLMDHPKFYNNP  169

Query  1122  LYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRM  943
             LY+ GDSYSGI VP+VV+ I DG +    P +N+KG + GNP+T    D N +V++ Y  
Sbjct  170   LYITGDSYSGIIVPMVVQEISDGNQDEHVPPMNLKGYVLGNPVTDEKKDNNYKVLFAYLK  229

Query  942   GFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNP-----  778
               +SD LY+S +++C G YI+   +N+ C  DL+   +C E I   QILEP C       
Sbjct  230   ALISDELYQSMRKNCKGEYINVDLNNTLCVGDLELYNECIEDIQSAQILEPTCTSVASPK  289

Query  777   ---------------EILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMT  643
                             + L L    L + WCR  NYLF+Y WAN+K VQ AL ++EG++ 
Sbjct  290   SAGSKWNINYFSDKDSVNLLLSFPELTRPWCRSYNYLFSYIWANDKTVQDALHIQEGSIK  349

Query  642   EWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEK  463
             EWLRCNHTL         ++Y+F+V +++ YH +   +  RVLIYSGDHDM++P+V+T  
Sbjct  350   EWLRCNHTL--------KDSYIFDVSSSLVYHENLIKQGYRVLIYSGDHDMVIPYVATMA  401

Query  462   WIESLKVGVEDDWRPWFVEDQVAGYTMK  379
             WIESL + V+  W+PWFV+ Q+    ++
Sbjct  402   WIESLNLTVDSRWKPWFVDGQIQSAVLR  429



>ref|XP_009601001.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Nicotiana 
tomentosiformis]
Length=464

 Score =   338 bits (868),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 183/423 (43%), Positives = 255/423 (60%), Gaps = 44/423 (10%)
 Frame = -3

Query  1437  QLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNPY  1294
             QLFYYFI+SE +PE+D              L  L    GP+T       G +P + LNPY
Sbjct  57    QLFYYFIKSESNPESDPILLWITGGPGCSALSGLIYEIGPITFEPVEYNGSLPTMILNPY  116

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
             +WTKVA+IIF+D PVGTG+SY+ T  A  +++  ++   Y FL +W LDHP FL NPLYV
Sbjct  117   SWTKVASIIFLDLPVGTGFSYARTPAALQSSNLQASDQAYEFLYRWFLDHPEFLKNPLYV  176

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFL  934
             AGDSYSG+ VP++ + I    E GI+P +++KG + GNP T +  + N  + + Y MG +
Sbjct  177   AGDSYSGMLVPIITQIIETKNEMGIKPFMDLKGYLLGNPSTFK-GEKNYEIPFAYGMGLI  235

Query  933   SDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN-----PEIL  769
             SD LY+S K +C G Y +  P N+ C  D+Q   +  ++IN P ILEP C      P +L
Sbjct  236   SDELYESLKRNCKGVYQNTDPSNTQCLQDVQTFQELLKRINNPHILEPNCQFASPKPHLL  295

Query  768   LSL------------DGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCN  625
                            + + LP   CR+D Y+ +  WA++  V++AL +R+GT+ +W+RC 
Sbjct  296   FGQKRSLNVKFHQLNNPQQLPALKCRNDWYILSSHWADDSQVREALHIRKGTIGKWVRC-  354

Query  624   HTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLK  445
                        S  Y   V +++ YH + + K  R LIYSGDHD +V  +ST+ WI+SL 
Sbjct  355   ----------ASLQYQKTVMSSIPYHANLSAKGYRSLIYSGDHDKVVTFLSTQAWIKSLN  404

Query  444   VGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSI  265
               + DDWRPW V++QVAGYT  YS +   +T+ TVKGAGHTAPEYKPRECL M++RW+S 
Sbjct  405   YSIVDDWRPWIVDNQVAGYTRSYSNR---MTFVTVKGAGHTAPEYKPRECLAMLKRWMSY  461

Query  264   YPL  256
              PL
Sbjct  462   KPL  464



>ref|XP_006433655.1| hypothetical protein CICLE_v10001060mg [Citrus clementina]
 gb|ESR46895.1| hypothetical protein CICLE_v10001060mg [Citrus clementina]
Length=467

 Score =   338 bits (868),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 184/433 (42%), Positives = 247/433 (57%), Gaps = 45/433 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E+ + QLFYYF++S+K+P+ D                 L    GP+  N     G +P
Sbjct  48    VGESEEAQLFYYFVKSDKNPKEDPLLLWLTGGPGCSAFSGLAYEIGPVNFNTVEYNGSLP  107

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L LNPY+WTK A+I+FVD PVGTG+SY+ T  A  T D     H   FL +WL+DHP F
Sbjct  108   TLRLNPYSWTKEASILFVDSPVGTGFSYARTPHASQTGDFKQVHHLDQFLRKWLMDHPEF  167

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             ++NP YV GDSYSGITVP +V+ I +  E  I+P +N++G I GNP T    + N+++ +
Sbjct  168   ISNPFYVGGDSYSGITVPALVQRISNENEEDIKPLINLQGYILGNPRTDMVVEQNSQIPF  227

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
              + MG +S+ LY+S K +C G Y++  P+N  C  D+Q  +K T  +    ILEP C   
Sbjct  228   AHGMGLISNELYESLKITCGGEYVNVDPNNKDCLNDIQTFSKLTSGVEKSHILEPHCQFF  287

Query  783   ----------------NPEILLSLDGE-NLPQQWCRDDNYLFAYSWANNKIVQKALGVRE  655
                             N +    L+ E   P   CR   YL A  W N+  V+KAL +R+
Sbjct  288   SPKPRASSHNRRSLNVNEQSQEFLNPEPTFPPIGCRSYGYLLARYWDNDHNVRKALHIRQ  347

Query  654   GTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHV  475
             G+  EW+RCN+ L           Y   + N+  YH S + K  R LIYSGDHDMI+P +
Sbjct  348   GSKGEWIRCNYDLP----------YTHEIGNSFSYHVSLSTKGYRSLIYSGDHDMIIPFL  397

Query  474   STEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPREC  295
              TE WI+SL   + DDWRPW +  QVAGYT  YS    ++TYATVKG GHTAPEY+P EC
Sbjct  398   GTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSN---QMTYATVKGGGHTAPEYRPAEC  454

Query  294   LPMIQRWLSIYPL  256
               M QRW++  PL
Sbjct  455   YAMFQRWINHDPL  467



>ref|XP_011100014.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Sesamum 
indicum]
Length=416

 Score =   337 bits (863),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 182/413 (44%), Positives = 245/413 (59%), Gaps = 56/413 (14%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E  ++QLFYYFIESE  P+TD                 L    GPL  +     G  P
Sbjct  48    VGEEDEVQLFYYFIESENDPQTDPLILWLTGGPGCSGFSGLVYEIGPLAFDLEAFDGSFP  107

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
                 NPY+WTKVANIIF+D PVGTG+SY+ TS+AYNT+DT S +  YSFL +WL +HP F
Sbjct  108   SFITNPYSWTKVANIIFIDSPVGTGFSYATTSEAYNTSDTKSVEQNYSFLRKWLSNHPEF  167

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             + N LY+AG+SY G  VP+V   I  G E+G EPR++++G I GN  T    D N ++ Y
Sbjct  168   VKNHLYIAGNSYGGKIVPMVALEIAKGNEAGFEPRISLQGYITGNSWTDPNKDENEKLPY  227

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
              +RM  +SD  ++  K +CNG Y++  P N  C Y L+ V +                  
Sbjct  228   AHRMALVSDEYFELAKSNCNGEYVNPDPDNIGCLYALRLVNE------------------  269

Query  774   ILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAE  595
                             + NY  +Y WANN+ VQ+AL +R+GT+++W RCN +LS      
Sbjct  270   ----------------NYNYAASYVWANNETVQEALQIRQGTISDWKRCNKSLS------  307

Query  594   RSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPW  415
                 Y  +V +   +H+  ++K  + L YSGDHDM VP++ST KWI +L + +++DWR W
Sbjct  308   ----YEQDVVSVFKHHQLLSDKGFQALAYSGDHDMEVPYMSTLKWIRNLNLTLDEDWRSW  363

Query  414   FVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
              V+ QVAGYTMKY   + ELT+ATVKGAGHTA  YKP+ECL MI+RWLS+YPL
Sbjct  364   TVDGQVAGYTMKYKNNQAELTFATVKGAGHTASAYKPKECLAMIKRWLSLYPL  416



>ref|XP_004299780.2| PREDICTED: serine carboxypeptidase-like 13 [Fragaria vesca subsp. 
vesca]
Length=498

 Score =   339 bits (869),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 177/434 (41%), Positives = 245/434 (56%), Gaps = 44/434 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             + +N ++Q+FY F+ESE +P  D              L       GP+T  + N  G +P
Sbjct  76    IGDNEEVQIFYLFVESEGAPADDPLLLWFNGGPGCSGLAGFFFESGPVTFKFGNYNGSLP  135

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              +  NP+ WTK  N+I++D PVG G+SYS+T   Y  +D      +Y FL +WL  HP +
Sbjct  136   AVLDNPFRWTKDVNMIYIDAPVGAGFSYSKTQSGYVMDDYKYVAQSYEFLHKWLEAHPAY  195

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L N LY+ GDS+SGI VP++V+ I DG E+G  P +N+KG + GNP+T    DTN R+ Y
Sbjct  196   LENVLYIGGDSFSGIIVPMIVQQILDGNENGTLPLMNLKGYVIGNPVTDTVIDTNARIPY  255

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN--  781
              +R+  +SD LY++ + SC+G+Y++    N AC  D+  +   T  INM  ILEP C+  
Sbjct  256   AHRLTLISDQLYQAARTSCSGDYVNVNSSNDACISDIDAIDALTNDINMLHILEPVCSDS  315

Query  780   -------------------PEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVR  658
                                PE LLS    N P  WCR  N++ AY WAN+  VQ ALGVR
Sbjct  316   LPRPKEKEIGTARRSLNDFPEGLLS-SATNGPAYWCRSYNHMLAYIWANHPSVQDALGVR  374

Query  657   EGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPH  478
              GT   W  CN TL+          Y   V + +  H+S      R LIYSGDHDM +PH
Sbjct  375   RGTKRFWQYCNSTLA----------YTQEVTSVISLHQSLATVGLRALIYSGDHDMTIPH  424

Query  477   VSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRE  298
             ++T+KWI  L + + + WR W V++Q AGYT K+  + + LT+ATVKG GH A EYK +E
Sbjct  425   IATQKWINLLNLTLNETWRAWSVDNQTAGYTKKFVNEVFNLTFATVKGGGHIAAEYKVKE  484

Query  297   CLPMIQRWLSIYPL  256
             C  MI RW++  PL
Sbjct  485   CSEMIDRWMAQTPL  498



>ref|XP_012068198.1| PREDICTED: serine carboxypeptidase-like 17 [Jatropha curcas]
Length=464

 Score =   338 bits (866),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 189/430 (44%), Positives = 251/430 (58%), Gaps = 48/430 (11%)
 Frame = -3

Query  1452  ENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDL  1309
             E  ++QLFYYFI+SE + + D              L  L    GPLT       G +P L
Sbjct  52    EAEEVQLFYYFIKSEGNVKEDPLLLWLTGGPGCSALSGLLYEIGPLTFEVVEYNGSLPKL  111

Query  1308  ELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLN  1129
              LNP++WTK A+IIFVD PVGTG+SY++T  A +++D +       FL +WL DHP FL 
Sbjct  112   ILNPHSWTKAASIIFVDMPVGTGFSYAKTQPANHSSDLIQVHQADQFLRKWLRDHPEFLL  171

Query  1128  NPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGY  949
             NP+Y+AGDSYSGITVP + + I +G E GIEP +N+KG I GNP T  F D N++V Y +
Sbjct  172   NPVYIAGDSYSGITVPAITQKISNGNEEGIEPPINLKGYILGNPATGDF-DQNSKVPYAH  230

Query  948   RMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-----  784
              MG +SD LYKS K SC  NY  +  +N+ C  +++   KC   +   QILEP C     
Sbjct  231   GMGLISDELYKSLKISCGENYFTS--NNTECLKNMEDFNKCILGLQPGQILEPICGFASP  288

Query  783   --------------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTM  646
                           N    L +D    P   CR   Y+ AY W ++  V+KAL + EG++
Sbjct  289   KPFEIFDKRRSLSDNSPNFLEID-PRYPSIGCRTYGYVLAYIWVDDSKVRKALHIHEGSV  347

Query  645   TEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTE  466
              +WLRCN+ +S          Y  ++ ++ +YH S   +  R LIYSGDHDM+VP + T+
Sbjct  348   KQWLRCNYGIS----------YTSDIPSSFEYHVSLGKQGYRSLIYSGDHDMVVPFLGTQ  397

Query  465   KWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPM  286
              WI +L   + DDWRPWFV+ QVAGYT  YS    ++T+ATVKG GHTAPEYKP EC  M
Sbjct  398   AWIRALNYSIVDDWRPWFVQGQVAGYTRTYSN---QMTFATVKGGGHTAPEYKPEECFAM  454

Query  285   IQRWLSIYPL  256
              +RW S  PL
Sbjct  455   FKRWTSHEPL  464



>gb|AIW39897.1| serine carboxypeptidase-like protein [Camellia sinensis]
Length=480

 Score =   338 bits (866),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 182/424 (43%), Positives = 248/424 (58%), Gaps = 40/424 (9%)
 Frame = -3

Query  1437  QLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNPY  1294
             +LFYYFIES+ +P+ D                 L  G GPL     N TG +P L   PY
Sbjct  67    ELFYYFIESQGNPQEDPIFLWLPGGPGCSSFCELVYGIGPLEFVIQNYTGGLPKLRYYPY  126

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
             AWTK A+IIF+D PVGTG+SYS T+D + T+D+ SA+ +Y FL +W  +HP +L   L+V
Sbjct  127   AWTKTASIIFLDAPVGTGFSYSRTADGWPTSDSKSAEQSYQFLREWFDEHPQYLAVQLFV  186

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFL  934
              G+SYSG+ VPLV + I DG + G++P +N+KG + G+P T    D N++VV+ +RM  +
Sbjct  187   GGNSYSGMIVPLVTKKIVDGNKDGVKPFMNLKGYLLGSPRTDSVIDENSKVVFAHRMALI  246

Query  933   SDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---------N  781
             SD +Y++ K+ CN  Y++  P N+AC   L  +  C + +    ILEP C          
Sbjct  247   SDEIYENAKKGCNDTYVNIDPANTACIVALGNIKTCIKDLYRNDILEPKCVFATPDPGEE  306

Query  780   PEILLSLD---------GENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRC  628
             P    SLD            +P  WCR+ NY+ +Y W+N+  VQ+AL VR+G++  W RC
Sbjct  307   PAARRSLDEGPSDFLLSPPMIPNLWCRNFNYVLSYIWSNDDTVQEALHVRKGSVLNWERC  366

Query  627   NHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESL  448
             N +LS          Y  ++   V  H         VL+ +GD DM+VP V T KWI+SL
Sbjct  367   NKSLS----------YTKDILTVVPVHEELKELGLEVLVETGDRDMVVPFVGTVKWIKSL  416

Query  447   KVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLS  268
              + V +DWRPWFV+ QVAGYT+ YS+  Y LTYATVKGAGHTAPEY   EC  M  RW  
Sbjct  417   NLTVVNDWRPWFVDGQVAGYTINYSEHGYRLTYATVKGAGHTAPEYYRMECYYMFDRWTH  476

Query  267   IYPL  256
              YP+
Sbjct  477   YYPI  480



>ref|XP_004289772.1| PREDICTED: serine carboxypeptidase-like 18 [Fragaria vesca subsp. 
vesca]
Length=484

 Score =   338 bits (867),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 178/430 (41%), Positives = 253/430 (59%), Gaps = 45/430 (10%)
 Frame = -3

Query  1443  KIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELN  1300
             ++Q FYYFIES++ P  D                 L    GPLT +Y    G  P    N
Sbjct  66    QLQFFYYFIESQRDPVKDPLLLWLTGGPGCSGFSGLVYEIGPLTFDYIAFNGSFPTFVDN  125

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             P++WT++ANIIF+D PVGTG+SYS T + YN++DT S++  Y FL +W+L HP FL NPL
Sbjct  126   PFSWTQIANIIFIDAPVGTGFSYSTTQEGYNSSDTESSEAVYQFLRKWMLKHPKFLYNPL  185

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMG  940
             Y+ GDSYSGI VP V   + DG  +G+ P + ++G + GNP+T   SD N+R+ + +R+ 
Sbjct  186   YITGDSYSGIIVPQVTLKVSDGNRNGVRPPMKLQGYLLGNPVTELHSDENSRMEFYHRVT  245

Query  939   FLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN-------  781
              +S  LY S +E+C G Y+     NS C  D+  V +CT +++   IL+P C+       
Sbjct  246   LISSELYASIQENCQGEYVYPNVSNSDCMDDIGLVAECTIRVDDANILQPKCSWASPKLA  305

Query  780   --------------PEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMT  643
                           P+ ++    E   + WCR+ NY+ +Y WAN++ VQ+AL +R GT+T
Sbjct  306   DRSIKRGQKFFDDIPDEIIRSPTER-ERHWCRNSNYVLSYIWANDESVQEALSIRNGTIT  364

Query  642   EWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEK  463
             +W RCN +L+          Y ++V + V+YH     +  R LIYSGDHD ++P+V T  
Sbjct  365   DWKRCNKSLA----------YEYDVLSVVNYHDELIGRGYRSLIYSGDHDGLIPYVGTLA  414

Query  462   WIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYE-LTYATVKGAGHTAPEYKPRECLPM  286
             WI  L + V D WRPW+V   VAG+T KY     + LT+AT+KGAGHTAPEY P + L M
Sbjct  415   WINYLNLTVSDGWRPWYVNGNVAGFTEKYINDVSDGLTFATLKGAGHTAPEYMPEQALDM  474

Query  285   IQRWLSIYPL  256
             + RWL+ YPL
Sbjct  475   VDRWLAYYPL  484



>gb|KJB58677.1| hypothetical protein B456_009G221000 [Gossypium raimondii]
Length=455

 Score =   337 bits (863),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 188/427 (44%), Positives = 251/427 (59%), Gaps = 39/427 (9%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V ++ + QLFYYF++SE  PE D                 L    GPL        G +P
Sbjct  42    VGDSEEAQLFYYFVKSEGKPEDDPLLFWLTGGPGCSAFSGLVFEIGPLKFKVDVYNGSLP  101

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L  NPYAWTKV+NIIF+D PVGTG+SY+  + A  T D     H + FL +WL+ HP F
Sbjct  102   TLVYNPYAWTKVSNIIFIDSPVGTGFSYATNNRAAQTGDLKQVHHLHQFLRKWLMAHPDF  161

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             ++NP+YV+GDSYSGI VP++ + I +G E GI+P ++++G I GNP T    +   ++ Y
Sbjct  162   ISNPVYVSGDSYSGIPVPVLAQEISNGNEEGIKPVIHLQGYILGNPKTVPNLEKKLKIPY  221

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
              Y MG +SD LY+S K +CNG Y +   +N AC  D+Q + KC   IN    LEP C   
Sbjct  222   VYGMGLISDELYESLKRNCNGQYQNVDLNNKACLADIQYLDKCISGINNAHFLEPDCGLD  281

Query  783   NPEILLS-----LDG------ENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEW  637
             +P+   +     LDG      E LP   CR   Y     WAN+  V+ AL +R+G++ +W
Sbjct  282   SPKPRKNGRRRFLDGHQLLNDEPLPPLACRTYAYYLCRHWANDDNVRNALHIRKGSIGKW  341

Query  636   LRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWI  457
             LRCNH L           Y  +V  ++ YH + + K  R LIYSGDHDM+VPH++T+ WI
Sbjct  342   LRCNHGLP----------YNNDVPTSLPYHANLSAKGYRYLIYSGDHDMVVPHLATQAWI  391

Query  456   ESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQR  277
               L   + DDWRPW V+ QVAGYT  YS +   +T+ATVKG GHTAPEYKP ECL M+ R
Sbjct  392   RFLNYPIIDDWRPWMVQSQVAGYTRTYSNR---MTFATVKGGGHTAPEYKPAECLAMLTR  448

Query  276   WLSIYPL  256
             W+S  PL
Sbjct  449   WISGQPL  455



>ref|XP_012069145.1| PREDICTED: serine carboxypeptidase-like 11 [Jatropha curcas]
 gb|KDP40909.1| hypothetical protein JCGZ_24908 [Jatropha curcas]
Length=472

 Score =   337 bits (865),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 174/424 (41%), Positives = 249/424 (59%), Gaps = 38/424 (9%)
 Frame = -3

Query  1437  QLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNPY  1294
             +LFY F+ES+  PE D              L       GPL +N  +  G +P L  NPY
Sbjct  57    ELFYLFVESQGKPEQDPVLVYLIGGPGCSALNGFFFQTGPLILNETDYAGGLPKLMYNPY  116

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
              WTK ++IIF+D PVG+GYSY+ +S  Y   DT SA  TYSFL  W  DHP + NN  ++
Sbjct  117   TWTKTSSIIFIDAPVGSGYSYATSSGGYYITDTESAAQTYSFLRNWFNDHPEYKNNRFFI  176

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFL  934
             A DSYSGI  P++ + I DG E+G++P++N++G I G+P      + N+R++  Y +G +
Sbjct  177   ASDSYSGIITPVLAQAIIDGNEAGLQPQINLEGIISGSPHISHALEANSRILLCYHLGLI  236

Query  933   SDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPEILLSLDG  754
             S  +Y+S K SCN +Y+  +  ++ C   L+ + +C + IN   ILEP C   I    DG
Sbjct  237   SKTVYESAKNSCNEDYL-GIDSSAECLEYLEEIDECIDPINEENILEPKCAELIPKQSDG  295

Query  753   ENLPQQ------------------WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRC  628
             +   +                   WCR+ +Y     WANNK VQ AL VR GT+ EW RC
Sbjct  296   KKFRRSLRATSRNSHFPILSRQDYWCRNFDYKLLDIWANNKTVQDALHVRNGTIKEWYRC  355

Query  627   NHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESL  448
             N++L+         TY +N+ +  DY+++ TN   +VL+YSGDHD++VP+ ST +WIE L
Sbjct  356   NNSLA-------HNTYTYNIGSAADYYQNLTNSGIQVLLYSGDHDLVVPYTSTLEWIEDL  408

Query  447   KVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLS  268
              + V+  WRPWFV+ QVAGYT++     + +T+AT+KGAGH+  EYKP EC  M +RW+ 
Sbjct  409   NLTVDYAWRPWFVDGQVAGYTLRNEYHGFRITFATLKGAGHSPTEYKPVECYKMFERWIH  468

Query  267   IYPL  256
              YPL
Sbjct  469   YYPL  472



>ref|XP_002525293.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF37121.1| serine carboxypeptidase, putative [Ricinus communis]
Length=596

 Score =   341 bits (875),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 176/424 (42%), Positives = 250/424 (59%), Gaps = 47/424 (11%)
 Frame = -3

Query  1452  ENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDL  1309
             E   +QLFYYFIESE++   D              L  L    GPL  N     G +P L
Sbjct  65    EKEDVQLFYYFIESERNAREDPLVLWLTGGPGCSALSGLAFEIGPLLFNMVEYNGSLPTL  124

Query  1308  ELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLN  1129
             +LNPY+WTKV+++IF+D PVGTG+SYS +     T DT+ A  T +FL +WLL HP F+ 
Sbjct  125   KLNPYSWTKVSSVIFLDAPVGTGFSYSRSFQGSKTADTIYATQTSTFLKKWLLCHPQFIK  184

Query  1128  NPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGY  949
              PLY+AGDSYSGI VP++ + + +G+E G +P++N++G + GNP T    D N+++ + +
Sbjct  185   IPLYIAGDSYSGIIVPIITKELSEGIELGEQPQINLEGYLLGNPGTDSKFDGNSKIPFAH  244

Query  948   RMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-----  784
             RM  +SD LYKS K +C G Y+   P+N+ C  DL+ ++KCT +I    ILEP C     
Sbjct  245   RMAIISDELYKSAKRNCKGEYVKVNPNNTKCLDDLEAISKCTSRIKKSHILEPQCSTTFR  304

Query  783   ---------------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGT  649
                            N + LL   G   P   CR  N +    WAN+  VQ+AL   +G 
Sbjct  305   ALNKIYGVRRYLLQNNKDFLLLPPG--FPHYGCRGYNSVLCNIWANDASVQRALHAWKGN  362

Query  648   MTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVST  469
             + +W+RCN +L           Y+ +V++T+ +H     +  R LIYSGDHDM++P++ T
Sbjct  363   LRKWIRCNESL----------YYIHDVQSTLGHHLYLNERGYRALIYSGDHDMVIPYLGT  412

Query  468   EKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLP  289
               WI++L + + + W PW V+ QVAGY+M++S      T+ATVKGAGHTAPEYKPREC  
Sbjct  413   LSWIKALNISILEQWHPWMVDGQVAGYSMEFSN---HFTFATVKGAGHTAPEYKPRECFA  469

Query  288   MIQR  277
             M +R
Sbjct  470   MFKR  473



>ref|XP_008790306.1| PREDICTED: uncharacterized protein LOC103707552 [Phoenix dactylifera]
Length=972

 Score =   350 bits (899),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 194/436 (44%), Positives = 252/436 (58%), Gaps = 58/436 (13%)
 Frame = -3

Query  1437  QLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNPY  1294
             QLFYYFI+SE++PE D              L  L    GPL  + A+ TG +P L  NPY
Sbjct  553   QLFYYFIKSERNPEEDPLIVWLTGGPGCSGLSALAIQIGPLKFDVASYTGGLPTLVYNPY  612

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
              WTKV NIIF+D PVGTG+SYS    +Y T DT +A+  ++FL +W +DHP FL+NPLYV
Sbjct  613   TWTKVCNIIFLDSPVGTGFSYSSVGKSYKTGDTKAARQVHTFLRKWFIDHPEFLSNPLYV  672

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMK-----------GCIEGNPLTHRFSDTNN  967
              GDSYSGI VP+  + I  G + G E   N+K           G + GNP T    D   
Sbjct  673   GGDSYSGIVVPVAAQEIAKGDQDGDELSYNLKVGEPYQKIYLNGYLVGNPRTDEKFDKGA  732

Query  966   RVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPA  787
              V Y + M  +SD LY+STK+SC G Y    P N  C   LQ V +C E IN+ QILEP 
Sbjct  733   VVPYAHGMALISDELYESTKKSCGGEYTS--PRNEQCANYLQAVNECIEGINIFQILEPV  790

Query  786   C-----NPEILLS--------------LDGENLPQQWCRDDNYLFAYSWANNKIVQKALG  664
             C      P ++ +              L   +LP + CR   YL +Y WA+N  V++AL 
Sbjct  791   CFVASPKPGMVAAYSRRLLKEDIKKFPLLKSDLPLE-CRSSGYLLSYFWADNDTVREALN  849

Query  663   VREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIV  484
             + +GT+  W RCNH L           Y +++ +++ +H + T++  R L+YSGDHDM V
Sbjct  850   IHKGTVQHWQRCNHDL----------LYTYDIPSSIKFHLNLTSRGYRALVYSGDHDMAV  899

Query  483   PHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKP  304
             P V T+ WI SL   + DDWRPW  + QVAG+T  YS     LT+ATVKGAGHTAPEY+P
Sbjct  900   PFVGTQGWIRSLNFSIVDDWRPWSADGQVAGFTRTYSNN---LTFATVKGAGHTAPEYRP  956

Query  303   RECLPMIQRWLSIYPL  256
             +ECL M+QRWLS  PL
Sbjct  957   KECLAMLQRWLSGVPL  972


 Score =   346 bits (888),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 186/425 (44%), Positives = 250/425 (59%), Gaps = 47/425 (11%)
 Frame = -3

Query  1437  QLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNPY  1294
             QLFYYFI+SE+ PE D                 L    GPL  + A  T  +P L  NP+
Sbjct  68    QLFYYFIKSERKPEEDPLIVWLTGGPGCSGFSALVFEIGPLKFDVAGYTEGLPALVYNPH  127

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
              WTKV NIIF+D PVGTG+SYS    +Y   DT +A+  ++FL +W +DH  FL+NPLY+
Sbjct  128   TWTKVCNIIFLDSPVGTGFSYSSMGKSYEMGDTKAARQVHTFLRKWFIDHLEFLSNPLYI  187

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFL  934
              GDSYSGI VP+V + I  G + G E   N+KG + GNP+T    D    V Y + MG +
Sbjct  188   GGDSYSGIVVPVVAQEIAKGDQDGDELSYNLKGYLVGNPVTDEKFDNEAFVPYAHGMGLI  247

Query  933   SDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-----NPEIL  769
             SD LY+STK+SC G Y  A P N  C   LQ V +CTE +N+ QILEP C      P ++
Sbjct  248   SDELYESTKKSCGGEY--ASPRNEQCANYLQSVNECTEGLNIMQILEPVCFFASPKPNMV  305

Query  768   LS--------------LDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLR  631
              +              L   +LP + CR   YL +Y WA+N  V++AL + +GT+  W R
Sbjct  306   AAYSRRLLKEDVKEFPLLKSDLPLE-CRSSGYLLSYIWADNDTVREALNIHKGTVQHWQR  364

Query  630   CNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIES  451
             CNH L           Y +++ +++ +H + T++  R L+YSGDHD+++P + T+ WI S
Sbjct  365   CNHDL----------LYTYDIPSSIKFHLNLTSRGYRALVYSGDHDLLIPFLGTQGWIRS  414

Query  450   LKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
             L   + DDWRPW  + QVAG+T  YS     LT+ATVKGAGH APEY+P+E L M+QRWL
Sbjct  415   LNFSIVDDWRPWSADGQVAGFTRAYSNN---LTFATVKGAGHLAPEYRPKESLAMLQRWL  471

Query  270   SIYPL  256
             S  PL
Sbjct  472   SGAPL  476



>ref|XP_009382032.1| PREDICTED: serine carboxypeptidase-like 7 [Musa acuminata subsp. 
malaccensis]
Length=479

 Score =   337 bits (864),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 192/425 (45%), Positives = 258/425 (61%), Gaps = 44/425 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtdplllwltggpgplTINY-------------ANSTGDIPDLELN  1300
             +QLFYYFI+SE+ P+ DPLLLWLTGGPG   ++                + G +P L   
Sbjct  69    VQLFYYFIKSEREPKDDPLLLWLTGGPGCSGLSGLIYEIGPLEFDVDGYTEGLLPSLLYK  128

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             P +WTKV++IIF+D PVGTG+SY+    A  T+D  S+   ++FL +W +DHP+F+ NPL
Sbjct  129   PTSWTKVSSIIFLDSPVGTGFSYTTCKQALKTSDIKSSVDVHTFLRKWYVDHPSFIANPL  188

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMG  940
             Y+AGDSYSG TVP+V + I DG E+G    LN+KG + GNP T    D +  V Y +  G
Sbjct  189   YIAGDSYSGFTVPVVAQYIADGNEAGYGVHLNLKGYLVGNPCTDANYDGDAIVAYAHGFG  248

Query  939   FLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN-------  781
             F+SD LY+S K+SC G Y +  P N+ C   +  V +    IN  QILEP C+       
Sbjct  249   FISDELYESAKKSCGGRYQN--PSNAECARWVDTVKQDLSGINAAQILEPQCSFPESPKP  306

Query  780   ----------PEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLR  631
                        E L  L   N     CR+  YL +++WANN  V++ALG+REG++  WLR
Sbjct  307   NIITADRRRLLEALSELPTSNTNDPLCRNYWYLLSHAWANNDTVRQALGIREGSVQIWLR  366

Query  630   CNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIES  451
             C+  L+          Y ++V +++ YH S T++  R L+YSGDHD+ VP + T+ WI S
Sbjct  367   CDIGLN---------NYTYDVLSSIKYHLSLTSRGYRALVYSGDHDLTVPFLGTQAWIRS  417

Query  450   LKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
             L   + DDWRPW VE QVAG+T  YS     LT+ATVKG GHTAPEY+P+EC  M+QRWL
Sbjct  418   LNFSIVDDWRPWSVEGQVAGFTRSYSNN---LTFATVKGGGHTAPEYQPKECFAMVQRWL  474

Query  270   SIYPL  256
             S  PL
Sbjct  475   SGAPL  479



>ref|XP_007199857.1| hypothetical protein PRUPE_ppa006297mg [Prunus persica]
 gb|EMJ01056.1| hypothetical protein PRUPE_ppa006297mg [Prunus persica]
Length=418

 Score =   335 bits (859),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 181/404 (45%), Positives = 248/404 (61%), Gaps = 54/404 (13%)
 Frame = -3

Query  1443  KIQLFYYFIESEKSPEtdplllwltggpgplTI--------NYANSTGDIPDLELNPYAW  1288
             ++Q+FYYF ESE SPE DPLLLW+TGGP   +         N+    G+  +L++ P  +
Sbjct  61    ELQMFYYFTESESSPENDPLLLWMTGGPRCSSFYGLVYEIGNFFPIDGE--NLKIGPIIY  118

Query  1287  TKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAG  1108
              +VANIIF+D P  TGYSYS T +   ++DTL A   Y FL +WL+ HP FL+NPLY++G
Sbjct  119   FQVANIIFLDAPAATGYSYSTTLEGLISSDTLHATRAYQFLQKWLVAHPQFLSNPLYISG  178

Query  1107  DSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFLSD  928
             DS++G  VP++V++I  G+E+G+EP LN+KG I GNP T+   D N+R+ Y +R+  +SD
Sbjct  179   DSFTGKIVPIIVQHITQGIEAGMEPALNLKGYIIGNPSTNAKEDFNSRIEYAHRLALISD  238

Query  927   NLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPEILLSLDGEN  748
              +Y+S+K +C G Y+D  P N  C   LQ   +                           
Sbjct  239   RVYESSKRNCKGEYVDVDPKNQLCLNSLQAFKE---------------------------  271

Query  747   LPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNV  568
                    +D   +A  W N+  V+KAL +REGT  EW +CN T            Y F+V
Sbjct  272   -------EDRIRYAVLWQNDINVRKALNIREGTKGEWAKCNKT----------TPYTFDV  314

Query  567   KNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGY  388
              ++VDYHR+ + K  R ++YSGDHD+ +P++ST  WIESL + +EDDW+PWF + QVAGY
Sbjct  315   PSSVDYHRNLSQKHLRAIVYSGDHDITIPYISTLAWIESLNLTLEDDWKPWFSDHQVAGY  374

Query  387   TMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             TM YS  EY LTYAT+KG GHTAPEY P+EC  MI RWL+  PL
Sbjct  375   TMYYSNNEYNLTYATIKGGGHTAPEYNPKECFDMINRWLAHSPL  418



>ref|XP_010094886.1| Serine carboxypeptidase-like 18 [Morus notabilis]
 gb|EXB57415.1| Serine carboxypeptidase-like 18 [Morus notabilis]
Length=427

 Score =   335 bits (859),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 183/409 (45%), Positives = 244/409 (60%), Gaps = 57/409 (14%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             +QLFYYF+ESE+SPE D              +  L    GPL+ +Y+NS  D   L LNP
Sbjct  62    LQLFYYFVESERSPENDPLLLWLTGGPCCSSVSALLYEIGPLSFDYSNSNTDTAPLILNP  121

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTKVANIIF+D P GTG+SYS +S+ Y T DTL     + F+ +WL+ HP F+ NPLY
Sbjct  122   YSWTKVANIIFLDAPAGTGFSYSISSEGYPTTDTLFGAQVFEFIKKWLVSHPKFIINPLY  181

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             + GDSYSG  VP+VV+ + +G+E+G +P +N+KG I GNP+T    +    + + +RMG 
Sbjct  182   IGGDSYSGKIVPIVVQQLSNGIEAGDQPPINLKGYILGNPVTDTRKEHYAFLEFAHRMGL  241

Query  936   LSDNLYKSTKESCNGNYIDAL-PHNSACQYDLQRVTKCTEKINMPQILEPACNPEILLSL  760
             LSD +YKS   +C G   D + P+N  C  DL+ V +                       
Sbjct  242   LSDRIYKSAARNCKGEDTDDVDPNNVPCIEDLKVVNEIEAG-------------------  282

Query  759   DGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETY  580
                    +W   +       W N K V+K+L VRE T T W RCN          RS  Y
Sbjct  283   -------RWLTKN-------WGNKKEVKKSLKVREETKTTWTRCN----------RSIPY  318

Query  579   VFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVE-D  403
              F+V+++V YHR+ T K  R LIYSGDHDM+VP+ ST +WIESL + ++ DWRPWF +  
Sbjct  319   TFDVQSSVVYHRNLTKKFLRALIYSGDHDMVVPYFSTIEWIESLGLAIDYDWRPWFSDHH  378

Query  402   QVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             +V GYTMKY+ K+Y+LTYAT+KG GHTAP+Y P EC  M  RWL+ YPL
Sbjct  379   EVLGYTMKYTNKKYQLTYATIKGGGHTAPQYYPEECFRMFDRWLAHYPL  427



>dbj|BAO04182.1| hypothetical protein [Delphinium grandiflorum]
Length=475

 Score =   336 bits (862),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 183/421 (43%), Positives = 257/421 (61%), Gaps = 43/421 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtdpll---lwltggpgplTINYANS---------TGDIPDLELNP  1297
             +++FYYFI SE  P  DPLL       G  G  +I + N           G +P L+LNP
Sbjct  64    VEMFYYFISSESKPSDDPLLFWFTGGPGCSGFSSIAFENGPVSFKITKYNGSLPTLKLNP  123

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             ++WTKV+NI+F D P+GTG+SYS   + Y  +D  S++  Y+ + +WL+DHP FL+N +Y
Sbjct  124   FSWTKVSNIVFFDAPIGTGFSYSNNLNDY-PSDKKSSKQAYNVIRKWLIDHPKFLSNAMY  182

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             V GDSYSG TVP+ V++I +G+E+G +  +N KG + GNP+T       + + + + MG 
Sbjct  183   VGGDSYSGKTVPITVQHISNGIEAGDKLLINFKGYLLGNPITDPDLGEYSTIQFAHGMGI  242

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-----NPEI  772
             +S+ L++S  ++C G Y++  P N  C  D+QRV+KCT  +N   ILEP C      P  
Sbjct  243   ISEELFESITKNCKGEYVNINPDNVKCTKDIQRVSKCTNGLNRAHILEPHCLLVTPKPNE  302

Query  771   LLS---LDGENLPQQW----------CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLR  631
             ++    L  +N P  +          CR   Y+ +Y WAN+K VQKAL +R+G + EW+R
Sbjct  303   IIKERRLLEKNSPTTFALPPVDPGFECRSYGYMLSYYWANDKEVQKALKIRKGMVQEWVR  362

Query  630   CNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIES  451
             CN         +    YV++VK +  YH + + K  R LIYSGDHDMIVP++ TE WI+S
Sbjct  363   CN---------KEDLHYVYDVKASTGYHLNLSRKGYRSLIYSGDHDMIVPYMGTEAWIKS  413

Query  450   LKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
             L   + DDWR WFV  QVAGYT  Y+     +T+ATVKG GHTAPEYKP ECL M++RWL
Sbjct  414   LNYSIIDDWRSWFVGGQVAGYTRTYAN---NMTFATVKGGGHTAPEYKPCECLAMLKRWL  470

Query  270   S  268
             S
Sbjct  471   S  471



>ref|XP_010065870.1| PREDICTED: serine carboxypeptidase-like 13 isoform X2 [Eucalyptus 
grandis]
Length=441

 Score =   335 bits (859),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 182/421 (43%), Positives = 243/421 (58%), Gaps = 70/421 (17%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             +QLFYYF+ESE+SP  D              L  L    GP T NY  ST   P L+LN 
Sbjct  55    VQLFYYFVESERSPRDDPLVLWLTGGPGCSALSGLIYEIGPFTFNYEKSTRFRPSLKLND  114

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTKVANIIF+DQPVGTG+SY+   ++YN ND +S   +Y FL +WL  HP FL+NPLY
Sbjct  115   YSWTKVANIIFLDQPVGTGFSYANNWESYNINDNISVAESYEFLRKWLKLHPQFLSNPLY  174

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             +AGDSYSG+TVP V   +  G E+G+EP++N++G + GNPLT+  SD N+RV + +  G 
Sbjct  175   IAGDSYSGVTVPRVALEVDKGNEAGLEPKMNLEGYVLGNPLTNYDSDLNSRVPFAHLKGL  234

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---------  784
             + + LY                             +C E I+   ILEP C         
Sbjct  235   IPNELY-----------------------------ECVENIDTANILEPNCVTQSPKSTV  265

Query  783   ----NPEIL------LSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWL  634
                 +P ++      L L  E   + WCR+ NYL+ Y WA+ K+V+ AL +REGT+ +W+
Sbjct  266   SDRWDPTLINRDPSPLLLPTERASRVWCRNYNYLYIYIWASAKVVRDALHIREGTVEKWV  325

Query  633   RCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIE  454
             RCN TLS          Y  N    +D H+    +  RVLIYSGDHDM++P+V T+ WI+
Sbjct  326   RCNKTLS----------YTSNFLVVIDIHKELIKRGFRVLIYSGDHDMVIPYVGTQAWID  375

Query  453   SLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRW  274
             +L + + +DW  WFV+ QVAGY   YS      T+ TVKGAGHTAPEYKP+EC  +I RW
Sbjct  376   TLNLTISEDWHAWFVDGQVAGYATLYSSFPSLFTFVTVKGAGHTAPEYKPKECFALISRW  435

Query  273   L  271
              
Sbjct  436   F  436



>gb|KHG24307.1| Serine carboxypeptidase-like 18 [Gossypium arboreum]
Length=446

 Score =   335 bits (859),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 182/422 (43%), Positives = 239/422 (57%), Gaps = 46/422 (11%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             ++ FYYFI+SE+ P  D              L  L    GPL  N     G +P   LNP
Sbjct  36    LEFFYYFIQSERDPSKDPLILWLTGGPGCSALSGLFFEIGPLQFNMVEHNGSLPTFALNP  95

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTKVANIIF+D PVGTG+SYS T   + T D   A   Y+FL +WL  HP F+ N LY
Sbjct  96    YSWTKVANIIFLDAPVGTGFSYSTTLQGFETGDKRFANDGYNFLRKWLQSHPKFITNSLY  155

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             +AGDSY+G  VP++V  I DG+     P  N+KG + GNP T    D N+++ +  RM  
Sbjct  156   IAGDSYAGKIVPIIVHAISDGIVDENFPAFNLKGYLVGNPATGSKYDDNSKIPFYNRMAL  215

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPEI-----  772
             +SD LY+S K +C   Y++    N  C  DLQ +++C   IN P ILEP C  +      
Sbjct  216   ISDELYESAKRNCKEEYVEVEMSNVICAKDLQAISECIAHINKPHILEPECPSDFDPPDS  275

Query  771   -------LLSLDGENL-------PQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWL  634
                     L    E+        P+  CR+ N      WA++  VQ+ALG+R+GT+ EW+
Sbjct  276   SVNERKYFLETREEDCLQAPAEYPKFGCRNYNTYLCKIWASDDSVQQALGIRKGTIREWI  335

Query  633   RCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIE  454
             RCN +L           Y  +V + VDYH S   K  R LIYSGDHD +VP+V TE WI+
Sbjct  336   RCNESL----------LYDKDVGSVVDYHLSLNTKGYRALIYSGDHDRLVPYVGTESWIK  385

Query  453   SLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRW  274
             SL + + DDWRPWFV+DQVAGY+ +Y      LT+AT  G GHTAPE+KP+EC  M  RW
Sbjct  386   SLNLSIVDDWRPWFVDDQVAGYSREYGNN---LTFAT--GGGHTAPEFKPKECFAMFNRW  440

Query  273   LS  268
             +S
Sbjct  441   IS  442



>gb|KJB48749.1| hypothetical protein B456_008G084200 [Gossypium raimondii]
Length=455

 Score =   335 bits (859),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 183/419 (44%), Positives = 243/419 (58%), Gaps = 39/419 (9%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             ++ FYYFIESE++P  D              L       GPL  N     G +P   LN 
Sbjct  52    LEFFYYFIESERNPAEDPLVLWLTGGPGCSSLSGFFLEIGPLRFNMVEYNGSLPTFFLNQ  111

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             YAWTKV++IIF+D PVGTG+SYS T+  + T D   A   Y+FL +WL  HP F++NPLY
Sbjct  112   YAWTKVSSIIFLDAPVGTGFSYSRTAQGFKTGDMKHAISCYNFLRKWLQSHPKFISNPLY  171

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             +AGDSYSG+ VP++ + I D +E+  +P LN+KG + GNP T    D N++++Y  RM  
Sbjct  172   IAGDSYSGMIVPIITQAISDDIEA--KPVLNLKGYLLGNPFTDAKFDGNSKIIYYNRMAL  229

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPEI-----  772
             +SD LY+S K +C   YID    N  C  DLQ +++CT  IN   ILEP C  E      
Sbjct  230   ISDELYESAKSNCKQEYIDVEISNRMCVKDLQTISECTAHINTMHILEPYCPSEFPEVRK  289

Query  771   -LLSLDGENL------PQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLS  613
              LL    ++L      PQ  CR+        WA +  VQKAL +R+GT+ EW+RCN    
Sbjct  290   YLLETHEDSLHLSDGYPQFGCRNYYCYLCKVWATDISVQKALHIRKGTIKEWVRCN----  345

Query  612   GPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVE  433
                   +S  Y ++V + V YH     +  R LIYSGDHD+ V +V TE WI+SL + + 
Sbjct  346   ------KSMDYDYDVASVVSYHLCLNTRGYRALIYSGDHDLAVTYVGTESWIKSLNLSIV  399

Query  432   DDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             DDWRPW V+ QVAGY+ +Y       T+ATVK  GHTAPEYKP+E   M +RW+S  PL
Sbjct  400   DDWRPWIVDGQVAGYSREYGNN---FTFATVKATGHTAPEYKPKESFSMFKRWISQQPL  455



>ref|XP_010694001.1| PREDICTED: serine carboxypeptidase-like 10 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=453

 Score =   335 bits (858),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 171/414 (41%), Positives = 245/414 (59%), Gaps = 35/414 (8%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEt--------------dplllwltggpgplTINYANSTGD  1321
             V +N  +QLFYYFI+SE++P+T                  L L  GP     +  N    
Sbjct  60    VGDNEGVQLFYYFIKSERNPQTDPLILWLTGGPGCSALSGLVLEIGPLIFNTSAFNWHSK  119

Query  1320  IPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHP  1141
              P  +LNP++WTKVA+IIF+D PVGTG+SY+   + Y T+D  S++H Y FL +WL+DH 
Sbjct  120   APTFQLNPFSWTKVASIIFLDSPVGTGFSYATDPEHYYTDDITSSEHIYQFLRKWLMDHV  179

Query  1140  TFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRV  961
              F NNPLY+ GDSYSG+ VP+VV+ I  G +  ++P +N++G + GNP T       ++ 
Sbjct  180   GFQNNPLYICGDSYSGMIVPIVVKEISKGNKVHVQPIMNLQGYVLGNPTTREEDMKKSKF  239

Query  960   VYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN  781
              +  R+  LSD +YKST+ SCNG + D    N  C  +L+ ++   + +    +L+P C 
Sbjct  240   DFARRVSLLSDEIYKSTRISCNGTFEDVDAENIRCSRNLKAISYNLDPVFAAHVLKPKCI  299

Query  780   PEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPE  601
              +           + WC+D  Y   Y WAN+  V+ AL +++GT + W RCN TL+    
Sbjct  300   SD-----------RTWCQDSIYRLFYYWANDIQVRTALDIQKGTKSHWTRCNRTLA----  344

Query  600   AERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWR  421
                   Y  N+ + VDYH++ T +S   LIYSGD DM+V ++ T +WI+ L + + +DWR
Sbjct  345   ------YAHNLTSVVDYHQNLTMESIHALIYSGDQDMVVSYLGTLEWIKMLNITIAEDWR  398

Query  420   PWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYP  259
             PWF   QVAGY  KYS   Y LTYATVKGAGHTAPEYK  EC  M+ +W +++P
Sbjct  399   PWFANGQVAGYITKYSNDNYHLTYATVKGAGHTAPEYKRAECFTMLTKWFAMHP  452



>gb|KJB73512.1| hypothetical protein B456_011G236800 [Gossypium raimondii]
Length=466

 Score =   335 bits (859),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 180/422 (43%), Positives = 238/422 (56%), Gaps = 44/422 (10%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             ++ FYYFI+SE+ P  D              L  L    GPL  N     G +P   LNP
Sbjct  54    VEFFYYFIQSERDPSKDPLILWLTGGPGCSALSGLFFEIGPLQFNMVEYNGSLPTFVLNP  113

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTKVANIIF+D PVGTG+SYS T   + T D   A   Y+FL +WL  H  F+ N LY
Sbjct  114   YSWTKVANIIFLDAPVGTGFSYSTTLQGFETGDKRFANDGYNFLRKWLQSHLKFITNSLY  173

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             + GDSY+G  VP++V  I DG+E    P  N+KG + GNP T    + N+++ +  RM  
Sbjct  174   ITGDSYAGKIVPIIVHAISDGIEDESVPAFNLKGYLVGNPSTGSKYEDNSKIPFYNRMAL  233

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPEI-----  772
             +SD LY+S K +C   Y++    N  C  DLQ +++C   IN P ILEP C  E      
Sbjct  234   ISDELYESAKRNCKEEYVEVEMSNVKCAKDLQAISECIAYINKPHILEPHCPSEFNTPNS  293

Query  771   -------LLSLDGEN-------LPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWL  634
                     L    E+        P+  CR+ N      WA++  VQ+ALG+R+GT+ EW+
Sbjct  294   LVNERKYFLETREEDYLQAPAEYPKFGCRNYNTYLCKIWASDDGVQQALGIRKGTIREWI  353

Query  633   RCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIE  454
             RCN  L           Y  +V + VDYH S   +  R LIYSGDHD +VP+V TE W++
Sbjct  354   RCNENL----------LYDKDVGSVVDYHLSLNTEGYRALIYSGDHDTVVPYVGTESWVK  403

Query  453   SLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRW  274
             SL + + DDWRPWFV+DQVAGY+ +Y       T+ATVKG GHTAPE+KP+EC  M  RW
Sbjct  404   SLNLSIVDDWRPWFVDDQVAGYSREYGNN---FTFATVKGGGHTAPEFKPKECFAMFSRW  460

Query  273   LS  268
             +S
Sbjct  461   IS  462



>ref|XP_010694004.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=451

 Score =   334 bits (857),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 176/412 (43%), Positives = 252/412 (61%), Gaps = 37/412 (9%)
 Frame = -3

Query  1443  KIQLFYYFIESEKSPEtdpll----------lwltggpgplTINYANSTGD----IPDLE  1306
             +++LFYYFI+SE+ PE DPL+           +         + + NS  D     P  +
Sbjct  61    EVKLFYYFIKSERDPERDPLMLWLTGGPGCSAFSGLVIEIGPLIFNNSACDWHSKSPTFQ  120

Query  1305  LNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNN  1126
             LNP +WTKVA+IIF+D PVGTG+SY+   + Y ++D  S++H Y FL +WL DH  F N+
Sbjct  121   LNPSSWTKVASIIFLDSPVGTGFSYATNPEGYYSDDITSSRHIYQFLTKWLADHAGFHNH  180

Query  1125  PLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSD--TNNRVVYG  952
             PLY+AGDSY G  VP+VV+ I+ G + G +P +N++G I GNPLT +  +  +++++ Y 
Sbjct  181   PLYIAGDSYCGRIVPVVVQEIFQGNKVGFQPFMNLQGYILGNPLTWKEDEMKSHSQLNYA  240

Query  951   YRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPEI  772
             +R+  LSD LY+ST  SCNG Y D    N  C  +LQ ++   + +    +L+P C  + 
Sbjct  241   HRVSLLSDELYESTITSCNGAYQDVDMDNINCTLNLQAISYNLDPLFDAHVLKPKCISD-  299

Query  771   LLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAER  592
                       + WC++  Y   Y+WAN+  VQ AL ++EGT   W+RCN TL+       
Sbjct  300   ----------KTWCQESIYGLLYNWANDIQVQAALHIQEGTKRYWIRCNKTLA-------  342

Query  591   SETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWF  412
                Y +NV++TV YH++ T +   VLIYSGD DM + +V T  WI+ L + + +DWRPWF
Sbjct  343   ---YEYNVESTVGYHQNLTQEFIHVLIYSGDQDMKISYVGTLGWIKMLNISISEDWRPWF  399

Query  411   VEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             V DQVAGYT +++   Y LT+ATVKGAGHTAPEYK  EC  M+ +WL   PL
Sbjct  400   VNDQVAGYTTRFANDRYNLTFATVKGAGHTAPEYKRAECFNMLMKWLESRPL  451



>ref|XP_003571685.1| PREDICTED: serine carboxypeptidase-like 17 [Brachypodium distachyon]
Length=467

 Score =   335 bits (858),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 184/422 (44%), Positives = 250/422 (59%), Gaps = 43/422 (10%)
 Frame = -3

Query  1434  LFYYFIESEKSPEtdpl----------llwltggpgplTINYANSTG----DIPDLELNP  1297
             LFYYF+ESE++PE DP+            +         +++ + +      +P L   P
Sbjct  60    LFYYFVESERNPEEDPVLLWLTGGPGCSAFSGLVYEIGPLSFESPSSYVDDALPKLVYRP  119

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
              +WTKVAN+IF+D PVG+G+SYS T D Y + DT +     +FL +W   HP FL NPLY
Sbjct  120   DSWTKVANVIFLDSPVGSGFSYSITDDGYKSCDTKAVNQIANFLTKWYQRHPNFLYNPLY  179

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             +AGDSYSG+ VP ++  I  G+E G +P LN+KG + GNPLT R  D  ++V Y + MG 
Sbjct  180   IAGDSYSGLIVPPLIFQIARGIEMGDQPILNLKGYVIGNPLTDRKFDLPSQVPYAHGMGL  239

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPEILLSLD  757
             +SD  Y+  KESC+ +    +  +  C+     + KC + IN+  ILEP C+     + D
Sbjct  240   ISDEQYEMYKESCSAD-TTGITRSVQCENCHDAINKCLKGINIHHILEPECSSAYKGNSD  298

Query  756   GE-------------NLPQ--QWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNH  622
                            NL +    CRD  Y  +  WANN  V+ ALGV +GT+  WLRCNH
Sbjct  299   RSSRMTLEQYSSADLNLSEISSECRDAGYRLSSIWANNGAVRAALGVHKGTVPLWLRCNH  358

Query  621   TLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKV  442
                G P       Y  +++++V+YHRS T++  R LIYSGDHDM+VP V T+ WI SL  
Sbjct  359   ---GTP-------YTKDIRSSVEYHRSLTSRGYRSLIYSGDHDMVVPFVGTQAWIRSLGF  408

Query  441   GVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIY  262
              V+D+WRPW+V  QVAG+T  YS     LT+ATVKG GHTAPEYKP+ECL M+ RWLS +
Sbjct  409   SVQDEWRPWYVNAQVAGFTRTYSNN---LTFATVKGGGHTAPEYKPKECLDMVARWLSGH  465

Query  261   PL  256
             PL
Sbjct  466   PL  467



>gb|KCW55070.1| hypothetical protein EUGRSUZ_I010391, partial [Eucalyptus grandis]
Length=329

 Score =   329 bits (844),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 162/336 (48%), Positives = 222/336 (66%), Gaps = 27/336 (8%)
 Frame = -3

Query  1347  INYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSF  1168
              +Y+NS+G+ P L+LNPY+WTK+ANIIF+D PVGTG+SY+ T  AY+ +DT SA  TY F
Sbjct  4     FDYSNSSGNRPVLKLNPYSWTKIANIIFLDAPVGTGFSYATTWTAYDNSDTSSAAQTYEF  63

Query  1167  LVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTH  988
             L +WL+ HP FL NPLY+ GDSYSG+ VP++V+ +YDG E+G EP +N+KG + GNP+T 
Sbjct  64    LRKWLMAHPKFLTNPLYITGDSYSGVIVPIIVKEVYDGNEAGREPPMNLKGYVLGNPVTC  123

Query  987   RFSDTNNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINM  808
                D + R+ YG++   +SD LY++TK  CNG+Y++  P N AC  DL+ V+ C EKI +
Sbjct  124   EVKDISQRIPYGHKTALISDELYEATKTDCNGDYVNVDPTNGACLTDLEMVSICLEKIYL  183

Query  807   PQILEPAC------------NPEILLS--LDGENLPQQ---WCRDDNYLFAYSWANNKIV  679
              QILEP C            +  IL    ++  ++P Q   WCR+ NYL++Y WAN++ V
Sbjct  184   AQILEPMCSFLSPNHTKLKWSRSILQENIINVVSMPLQSRPWCRNYNYLYSYIWANDRNV  243

Query  678   QKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGD  499
             Q+AL +REGT  EW RCN +LS          Y  +V N+V YHR  +  S R LIYSGD
Sbjct  244   QEALHIREGTKPEWDRCNESLS----------YTKDVLNSVVYHRYLSKTSLRALIYSGD  293

Query  498   HDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAG  391
             HD+ +P++ T  WI SL + +   W PWFV  QVAG
Sbjct  294   HDLAIPYIGTLDWIRSLNLTLLGPWAPWFVNGQVAG  329



>ref|XP_010028343.1| PREDICTED: serine carboxypeptidase-like 18 isoform X3 [Eucalyptus 
grandis]
Length=426

 Score =   333 bits (853),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 188/430 (44%), Positives = 255/430 (59%), Gaps = 76/430 (18%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E  ++QLFYYFIESE+SP+ D              L  L    GPL  +Y++S+ + P
Sbjct  44    VGELQEVQLFYYFIESERSPKDDPLLLWLTGGPGCSALSGLLFEIGPLQFDYSDSSENRP  103

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L+LNPY+WTK+ANIIF+D PVGTG+SY+    AYN++DT SA  TY FL +WL+ HP F
Sbjct  104   VLKLNPYSWTKIANIIFLDAPVGTGFSYATAWRAYNSSDTSSATQTYEFLRKWLMSHPRF  163

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L NPLY+ GDSYSG+ VP++V+ +YDG E+G EP +N+KG + GNP+T    D + R+ +
Sbjct  164   LTNPLYITGDSYSGVVVPIIVKEVYDGNEAGREPPMNLKGYVLGNPVTCEVKDISQRIPF  223

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN--  781
             G++   +SD LY+STK+ CNG+Y++  P N AC  DL+ V+K  EKI + QILEP CN  
Sbjct  224   GHKTALISDELYESTKKDCNGDYVNVDPTNGACLTDLEMVSKRLEKIYLAQILEPICNFM  283

Query  780   ----------PEILLS--LDGENLPQQ---WCRDDNYLFAYSWANNKIVQKALGVREGTM  646
                         IL    ++  ++P Q   WCR+ NYL++Y WAN++ VQ+AL +REGT 
Sbjct  284   SPNHTRLKWSRSILEENIINVVSMPLQSRPWCRNYNYLYSYIWANDRNVQEALHIREGTK  343

Query  645   TEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTE  466
              EW RCN +LS          Y  +V N+V YHR  +  S R LIY              
Sbjct  344   PEWDRCNESLS----------YTKDVLNSVVYHRYLSKTSLRALIY--------------  379

Query  465   KWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPM  286
             ++     VG+                       +Y+LTY T+KG GHTAPEYKP+EC  M
Sbjct  380   RYSTLYVVGM-----------------------KYDLTYTTIKGGGHTAPEYKPKECFAM  416

Query  285   IQRWLSIYPL  256
             + RW S YPL
Sbjct  417   VDRWFSYYPL  426



>ref|XP_009600999.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Nicotiana 
tomentosiformis]
Length=465

 Score =   334 bits (856),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 183/424 (43%), Positives = 255/424 (60%), Gaps = 45/424 (11%)
 Frame = -3

Query  1437  QLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNPY  1294
             QLFYYFI+SE +PE+D              L  L    GP+T       G +P + LNPY
Sbjct  57    QLFYYFIKSESNPESDPILLWITGGPGCSALSGLIYEIGPITFEPVEYNGSLPTMILNPY  116

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
             +WTKVA+IIF+D PVGTG+SY+ T  A  +++  ++   Y FL +W LDHP FL NPLYV
Sbjct  117   SWTKVASIIFLDLPVGTGFSYARTPAALQSSNLQASDQAYEFLYRWFLDHPEFLKNPLYV  176

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFL  934
             AGDSYSG+ VP++ + I    E GI+P +++KG + GNP T +  + N  + + Y MG +
Sbjct  177   AGDSYSGMLVPIITQIIETKNEMGIKPFMDLKGYLLGNPSTFK-GEKNYEIPFAYGMGLI  235

Query  933   SDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN-----PEIL  769
             SD LY+S K +C G Y +  P N+ C  D+Q   +  ++IN P ILEP C      P +L
Sbjct  236   SDELYESLKRNCKGVYQNTDPSNTQCLQDVQTFQELLKRINNPHILEPNCQFASPKPHLL  295

Query  768   LSL------------DGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCN  625
                            + + LP   CR+D Y+ +  WA++  V++AL +R+GT+ +W+RC 
Sbjct  296   FGQKRSLNVKFHQLNNPQQLPALKCRNDWYILSSHWADDSQVREALHIRKGTIGKWVRC-  354

Query  624   HTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIY-SGDHDMIVPHVSTEKWIESL  448
                        S  Y   V +++ YH + + K  R LIY SGDHD +V  +ST+ WI+SL
Sbjct  355   ----------ASLQYQKTVMSSIPYHANLSAKGYRSLIYSSGDHDKVVTFLSTQAWIKSL  404

Query  447   KVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLS  268
                + DDWRPW V++QVAGYT  YS +   +T+ TVKGAGHTAPEYKPRECL M++RW+S
Sbjct  405   NYSIVDDWRPWIVDNQVAGYTRSYSNR---MTFVTVKGAGHTAPEYKPRECLAMLKRWMS  461

Query  267   IYPL  256
               PL
Sbjct  462   YKPL  465



>ref|XP_004288266.1| PREDICTED: serine carboxypeptidase-like 2 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=485

 Score =   335 bits (858),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 184/440 (42%), Positives = 245/440 (56%), Gaps = 58/440 (13%)
 Frame = -3

Query  1452  ENLKIQLFYYFIESEKSPE------------tdplllwltggpgplTINYANSTGDIPDL  1309
             E   +QLFYYF+ESE++P             T   L  L    GP+  N     G +P  
Sbjct  63    EKDDVQLFYYFVESERNPRDDPLLLWLTGGPTCSALSGLAFEIGPIKFNMVEYNGSLPTF  122

Query  1308  ELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLN  1129
              LNPY+WTKV++IIFVD PVGTG+SY  +     ++D L   H YSFL++WL+ HP F+ 
Sbjct  123   VLNPYSWTKVSSIIFVDAPVGTGFSYPRSLQW--SSDALFVNHIYSFLMKWLIYHPKFIT  180

Query  1128  NPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGY  949
             NP+Y+AGDSY G+ VP++ + I  G+E G  P +N+KG + GNP T    D N++V Y +
Sbjct  181   NPIYIAGDSYCGMIVPVIAQEIVKGIEVGDIPAINLKGYLLGNPSTDISFDENSKVAYAH  240

Query  948   RMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-----  784
             RM  + D LYKS K++C G Y   +  N  C  DLQ +  CTEK+N   ILEP C     
Sbjct  241   RMALIPDELYKSAKKNCRGQYTGIVKSNKQCAKDLQAIASCTEKLNHEHILEPRCHSSFP  300

Query  783   -----------------------NPEIL-LSLDGENLPQQWCRDDNYLFAYSWANNKIVQ  676
                                    NP  L L     + P   CR+      + WAN+  VQ
Sbjct  301   VVSMMNGNRKYHIERLREPSLAVNPSHLGLGPKHVDFPIFGCRNYQNFLMHVWANDADVQ  360

Query  675   KALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDH  496
             KALGV++     W RCN +L           Y    ++ + YH+S T +  R LIYSGDH
Sbjct  361   KALGVQKRMF--WARCNTSLP----------YERYFRSVLSYHQSLTTRGYRALIYSGDH  408

Query  495   DMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAP  316
             DMI+PH+ T  WI+SL   + D WRPW V+ QVAGY+++YS      T+ATVKG GHTAP
Sbjct  409   DMIIPHLGTLAWIKSLNFIIVDHWRPWLVDGQVAGYSVEYSN---NFTFATVKGGGHTAP  465

Query  315   EYKPRECLPMIQRWLSIYPL  256
             EY+P+EC  M +RW+S  PL
Sbjct  466   EYQPKECFAMFKRWISDEPL  485



>ref|XP_012093158.1| PREDICTED: serine carboxypeptidase-like 18 [Jatropha curcas]
 gb|KDP44533.1| hypothetical protein JCGZ_16366 [Jatropha curcas]
Length=471

 Score =   334 bits (856),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 174/423 (41%), Positives = 251/423 (59%), Gaps = 39/423 (9%)
 Frame = -3

Query  1437  QLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNPY  1294
             ++FYYFIESE +P+ D                 L    GPL  N ++  G +P L   PY
Sbjct  59    EMFYYFIESEGNPKEDPLLLWYSGGPGCSAFNGLIYEIGPLEFNISDYEGGLPSLSYYPY  118

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
             +WTK A+I+FVD PVGTG+SY+ T D +  +DT++ +  Y FL  W +DHP +L   L+V
Sbjct  119   SWTKTASILFVDAPVGTGFSYATTEDGWAMSDTVTGEQVYEFLKNWFMDHPQYLKLQLFV  178

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFL  934
               DSYSGI+  L V++I DG   G EP LN+KG I G P        N+++++ +RM  +
Sbjct  179   GADSYSGISATLAVQHILDGNGYGQEPHLNLKGYILGCPRIDGQIQENSKIIFAHRMALI  238

Query  933   SDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---NPEIL--  769
             SD LYK+ K +C+ +Y      ++AC   L+ + KC + IN   ILEP C   +P+ +  
Sbjct  239   SDELYKAAKNACDSDYYGVTSSDAACYEYLKLIKKCYKDINKNDILEPKCTYASPDPVQE  298

Query  768   ---LSLDGENL---------PQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCN  625
                 SL G ++          ++WC + NY  +Y WAN++ VQ AL VR  T+ +W RCN
Sbjct  299   SARRSLRGSSVDLIMSPVRSSEKWCHNFNYSLSYVWANDESVQSALNVRRKTVRDWKRCN  358

Query  624   HTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLK  445
              +L           Y ++V + + YHR+FT K  + L+Y+GDHD  +P+V T++WI+ L 
Sbjct  359   KSLD----------YDYDVTSVISYHRNFTTKGLQALVYNGDHDFTIPNVGTQQWIKELN  408

Query  444   VGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSI  265
             + + +DWRPW V+ QVAGYT+KYS+  Y LTYATVKGAGH+  EYK REC  M  R++  
Sbjct  409   LTIVNDWRPWLVDGQVAGYTIKYSENGYRLTYATVKGAGHSPQEYKRRECYDMFDRFIHY  468

Query  264   YPL  256
             YP+
Sbjct  469   YPI  471



>ref|XP_011621823.1| PREDICTED: serine carboxypeptidase-like 17 [Amborella trichopoda]
Length=469

 Score =   334 bits (856),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 186/425 (44%), Positives = 259/425 (61%), Gaps = 49/425 (12%)
 Frame = -3

Query  1437  QLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNPY  1294
             +LFYYFI+SE +P  D                 L    GPL        G +P L+LNP+
Sbjct  63    RLFYYFIKSENNPSKDPLILWLTGGPGCSGFSGLVFETGPLRFKVVEYDGTVPALQLNPH  122

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
             +WTKVANI++VD PVGTG+SYS+T   Y T+D+ + +    FL  W +++P FL+NPLY+
Sbjct  123   SWTKVANILYVDSPVGTGFSYSKTPGDYATSDSKTVKDLLKFLTNWFIEYPEFLSNPLYI  182

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFL  934
             AGDSYSGITVP++   I +G++SG  P  N+KG + GNP T    D+   V + + MG +
Sbjct  183   AGDSYSGITVPVLTYEIANGIDSGYRPVFNLKGYLVGNPGTDVEFDS-QLVPFAHGMGLI  241

Query  933   SDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---NPEILLS  763
             SD L+++TK SCNGNY  A P  S C  ++Q V +C  +IN   ILEP+C   +P   L 
Sbjct  242   SDELFEATKISCNGNY--AHPKGSQCNLNMQAVQECLSRINEVHILEPSCPFASPRPRLE  299

Query  762   LDGENLPQQW----------------CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLR  631
             + G  L ++W                CR+  Y+ ++ WAN++ V +AL V++GT+ +W R
Sbjct  300   I-GTGL-RRWLDDKSSDIHLQSTPIVCREYGYILSHYWANDERVGEALHVKKGTVEDWKR  357

Query  630   CNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIES  451
             CN  +          T+  +VK++V YH + T +S   LIYSGDHD  VP + T+ WI S
Sbjct  358   CNFGI----------TFKADVKSSVLYHHNLTMRSYSALIYSGDHDAKVPFIGTQAWIRS  407

Query  450   LKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
             L+  + DDWR W V+ QVAGYT +Y+     LT+ATVKGAGHTAPEYKP+ECL M++RW+
Sbjct  408   LEFPIIDDWRAWVVDGQVAGYTRRYANN---LTFATVKGAGHTAPEYKPKECLAMLRRWI  464

Query  270   SIYPL  256
             S  PL
Sbjct  465   SHEPL  469



>ref|XP_004292764.2| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=476

 Score =   334 bits (856),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 178/429 (41%), Positives = 252/429 (59%), Gaps = 45/429 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtdpl----------llwltggpgplTINYA--NSTGDIP  1315
             V E+ ++QLFYYF++SE++PE DPL                      +N+      G +P
Sbjct  57    VGESEELQLFYYFVKSERNPEKDPLMLWLTGGPGCSAVSALFFEIGPLNFKVEQYNGSLP  116

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L LNP++WTKV +IIF+D PVGTG+SY+ TS A    D    QH   FL +WL+DHP+F
Sbjct  117   TLVLNPHSWTKVCSIIFIDSPVGTGFSYARTSFASQPGDLEQVQHALQFLRRWLVDHPSF  176

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             ++NP Y+ GDSYSGI VP++   I +G E+G++P +N++G I GNP+T R  + N+ + +
Sbjct  177   MSNPFYIGGDSYSGIPVPVLAEQISNGNEAGVKPIINLQGYILGNPVTVRQYEVNSEIPF  236

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
              + MG +SD LY+S   SC G++ D  P N  C  ++Q   +CT  IN   ILE  C+  
Sbjct  237   AHGMGLISDELYESLTTSCRGDFQDVDPSNVECVKNVQAFDECTSHINFAHILERHCDGL  296

Query  774   I---LLSLDGEN----------------LPQQWCRDDNYLFAYSWANNKIVQKALGVREG  652
             I   L  + G+                 LP   CR   YL +  WAN+ +V+K L +R+G
Sbjct  297   ISPKLQHMLGKRRYLSDNNGLHHHSRSPLPTFGCRTYGYLLSQYWANDPVVRKVLHIRKG  356

Query  651   TMTEWLRCNHTLSGPPEAERSETYVFN-VKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHV  475
             ++  W RC++ +           YV + + N++ YH + + K    LIYSGDHDM+VP +
Sbjct  357   SIGNWQRCDYDMP----------YVADLLGNSLQYHVNLSAKGYPSLIYSGDHDMLVPFL  406

Query  474   STEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPREC  295
              T+ WI SL   + DDWRPWFV  Q+AGYT  Y+ +   +T+ATVKGAGHTAPEYK  EC
Sbjct  407   GTQAWIRSLNYSIVDDWRPWFVHSQIAGYTRTYANR---MTFATVKGAGHTAPEYKREEC  463

Query  294   LPMIQRWLS  268
             L M  RW+S
Sbjct  464   LNMFTRWIS  472



>ref|XP_012093160.1| PREDICTED: serine carboxypeptidase-like 7 [Jatropha curcas]
 gb|KDP44534.1| hypothetical protein JCGZ_16367 [Jatropha curcas]
Length=465

 Score =   333 bits (854),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 179/424 (42%), Positives = 254/424 (60%), Gaps = 39/424 (9%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtdplllwltggpgplTIN------------YANSTGDIPDLELNP  1297
             I+ FYYF+ SE +P  DPLLL+L GGPG   +N              N TG +P L   P
Sbjct  52    IEFFYYFVHSENNPAADPLLLYLNGGPGCSGLNGFFYQIGPLKFDIHNYTGGLPKLVYEP  111

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
              AW+K +NI+F+D PVGTG+SY+ T+DA+NT DT SA+  Y FL +WL+DHP F  NP+Y
Sbjct  112   AAWSKTSNILFLDSPVGTGFSYATTADAWNTTDTKSAEQAYKFLRKWLIDHPAFRTNPVY  171

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             +  DSY+GI +P++  +I  G  +G+EP +N+KG   G P T   ++TN ++ + +R+  
Sbjct  172   LGSDSYAGIVLPILALDIIKGNTAGLEPFVNLKGLSLGCPHTDTIAETNAKIPFAHRLAL  231

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---NPE---  775
             +SD +Y+S K SCNG+Y D    N+ C   L  +T+C E IN   IL+P C   +P+   
Sbjct  232   ISDYMYESAKISCNGSYADVDSANTECVESLDAITECVELINRQNILDPNCALLSPKEKE  291

Query  774   --ILLSLDG---------ENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRC  628
               +  SL             L + +C +  YL +  W N + VQ AL VR+  + E+ RC
Sbjct  292   KMVRRSLRAMRRNFIRPLPTLGELYCHNFPYLLSDIWTNYRSVQAALKVRQAMIPEFHRC  351

Query  627   NHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESL  448
             N +L           Y  ++   + YH++ T    +VL++SGDHDM++PH   E+WI SL
Sbjct  352   NISLG----------YTVDMDTVIPYHKNLTKTGLQVLVFSGDHDMVMPHNGIEQWITSL  401

Query  447   KVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLS  268
              + ++ DWRPWFV+ QVAGYT KY+   Y LTYATVKGAGH+  E+K +EC  M  RW+ 
Sbjct  402   DLTIDTDWRPWFVDGQVAGYTRKYTNTGYRLTYATVKGAGHSPQEFKRKECFDMFHRWIH  461

Query  267   IYPL  256
              YPL
Sbjct  462   YYPL  465



>ref|XP_010694000.1| PREDICTED: serine carboxypeptidase-like 7 [Beta vulgaris subsp. 
vulgaris]
Length=451

 Score =   332 bits (852),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 178/417 (43%), Positives = 253/417 (61%), Gaps = 37/417 (9%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtdpll----------lwltggpgplTINYANSTGD----  1321
             V ++ +++LFYYFI+SE+ PE DPL+           +         + + NS  D    
Sbjct  56    VGKDEEVKLFYYFIKSERDPERDPLMLWLTGGPGCSAFSGLVIEIGPLMFNNSACDWHSK  115

Query  1320  IPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHP  1141
              P  +LNP +WTKVA+IIF+D PVGTG+SY+   + Y ++D  +++H Y FL +WL DH 
Sbjct  116   SPTFQLNPSSWTKVASIIFLDSPVGTGFSYATNPEGYYSDDITASRHIYQFLTKWLADHA  175

Query  1140  TFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNN--  967
              F N+ LYVAGDSYSG  VP+VV+ I+ G + G +P +N++G + GNPLT +  +TN+  
Sbjct  176   EFHNHSLYVAGDSYSGRIVPVVVQEIFQGNKVGFQPFMNLQGYVLGNPLTWKEDETNSHS  235

Query  966   RVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPA  787
             ++ Y +R+  LSD LY+ST  SCN  Y D    N  C  +LQ ++   + +    IL+P 
Sbjct  236   QLNYDHRVSLLSDELYESTIRSCNDAYQDVDMDNINCTLNLQAISYNLDPLFDAHILKPK  295

Query  786   CNPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGP  607
             C  +           + WC++  Y   Y+WAN+  VQ AL ++EGT   W+RCN TL+  
Sbjct  296   CISD-----------KTWCQESIYGLLYNWANDIQVQAALHIQEGTKRYWIRCNRTLA--  342

Query  606   PEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDD  427
                     Y +NV++TV YH++ T +    LIYSGD D  V +V T  WI+ L + + +D
Sbjct  343   --------YEYNVRSTVGYHQNLTQEFLHALIYSGDQDRKVSYVGTLGWIKMLNISISED  394

Query  426   WRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             WRPWFV DQVAGYT ++S   Y LT+ATVKGAGHTAPEYK  EC  M+ +WL  +PL
Sbjct  395   WRPWFVNDQVAGYTTRFSNDRYNLTFATVKGAGHTAPEYKRAECFNMLMKWLESHPL  451



>ref|XP_010656847.1| PREDICTED: serine carboxypeptidase-like 18 isoform X4 [Vitis 
vinifera]
Length=381

 Score =   329 bits (843),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 165/352 (47%), Positives = 223/352 (63%), Gaps = 27/352 (8%)
 Frame = -3

Query  1275  NIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYS  1096
             NIIFVD PVG+G+SYS+T + Y   D   A  TY FL +WL+DHP FL N LYV GDSYS
Sbjct  45    NIIFVDAPVGSGFSYSKTQEGYIMEDLKYAAQTYEFLKKWLVDHPEFLKNELYVGGDSYS  104

Query  1095  GITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFLSDNLYK  916
             GI VP+VV+ IY G      P LN++G + GNPLT   +D N+R+ + +R+  +SD LY+
Sbjct  105   GIPVPMVVQEIYYG-----SPSLNLQGYVLGNPLTDTDNDVNSRIPFAHRLTLISDELYE  159

Query  915   STKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC------------NPEI  772
             S K SCNG+Y+     N  C  D++ ++K  ++I + Q+LEP C            N   
Sbjct  160   SAKTSCNGDYVTVNASNEQCVADMEAISKLIDQIYIMQVLEPNCGISSRKPKEGELNHTH  219

Query  771   LLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAER  592
              L+  GE     +C + NY+F+  WANNK V++AL VREGT   W+RCN T         
Sbjct  220   FLTQLGEK-SAYFCHEYNYVFSEIWANNKDVREALRVREGTKGHWVRCNIT---------  269

Query  591   SETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWF  412
             +  +  +V +TV YH++ TN   R LIYSGDHDM +PH+ T++WI SL + +ED WR W 
Sbjct  270   NLAFTKDVTSTVAYHQNLTNTGLRALIYSGDHDMSIPHIGTQEWINSLNLTLEDPWRTWC  329

Query  411   VEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
              + QVAGYT  ++  +++LT+ATVKGAGH A EYKP+EC  MI RW + YPL
Sbjct  330   TDGQVAGYTETFTNDDFDLTFATVKGAGHVAIEYKPKECYAMIDRWFAHYPL  381



>ref|XP_011457832.1| PREDICTED: serine carboxypeptidase-like 17 [Fragaria vesca subsp. 
vesca]
Length=471

 Score =   332 bits (850),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 177/427 (41%), Positives = 256/427 (60%), Gaps = 43/427 (10%)
 Frame = -3

Query  1443  KIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELN  1300
             K ++FYYFIESE +P  D             +   L    GPL  NY    G +P     
Sbjct  57    KSEMFYYFIESEGNPTEDPLLLWYSGGPGCSVFNGLIYENGPLAFNYTAYEGGLPSTYYY  116

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             PY+WT+ A+++FVD PVGTG+SY+ ++D Y  +D  +A     FL +WL +HP FL   L
Sbjct  117   PYSWTRTASVLFVDAPVGTGFSYATSADEYPLSDLKAAAQVTGFLRKWLEEHPHFLKLEL  176

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMG  940
             ++  DSYSG+T  + V+ I D  ++G+ PRLN+KG + G PLT +  + N++ V+ +RMG
Sbjct  177   FIGADSYSGLTGTIAVKYIIDDNDAGVLPRLNLKGYVLGCPLTDQTLNGNSKYVFSHRMG  236

Query  939   FLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC--------  784
              +SD LY++ KESCN ++      +  C  D+Q +    + IN   I+EP C        
Sbjct  237   LVSDELYEAAKESCNSSFYGVTTSDPECYEDIQLMANQIKDINKLCIVEPKCTWASPDQD  296

Query  783   ----------NP-EILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEW  637
                       NP E + +L  +  P+ +CR+ NY+ AY WAN+  V+KAL VREG++ +W
Sbjct  297   GETARRYLHENPKEFIRTLPKD--PEYYCRNFNYMLAYVWANDDGVRKALNVREGSLLDW  354

Query  636   LRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWI  457
              RCN +LS          Y  +V++ ++YH+  + K  +VLI++GDHD+ VP+ +TE+WI
Sbjct  355   KRCNKSLS----------YTKDVESVIEYHKYLSTKGLQVLIFNGDHDLTVPNTATEQWI  404

Query  456   ESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQR  277
               L + V +DWRPW V+ Q+AGYT+KYS   Y LTYATVKGAGH+APEYK REC  M  R
Sbjct  405   RDLDLPVVNDWRPWLVDGQIAGYTIKYSSNGYRLTYATVKGAGHSAPEYKRRECYIMFDR  464

Query  276   WLSIYPL  256
             ++  YPL
Sbjct  465   FIHYYPL  471



>gb|KCW55062.1| hypothetical protein EUGRSUZ_I01038 [Eucalyptus grandis]
Length=341

 Score =   327 bits (838),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 164/336 (49%), Positives = 222/336 (66%), Gaps = 27/336 (8%)
 Frame = -3

Query  1347  INYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSF  1168
              +Y++S+ + P L+LNPY+WTK+ANIIF+D PVGTG+SY+    AYN++DT SA  TY F
Sbjct  16    FDYSDSSENRPVLKLNPYSWTKIANIIFLDAPVGTGFSYATAWRAYNSSDTSSATQTYEF  75

Query  1167  LVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTH  988
             L +WL+ HP FL NPLY+ GDSYSG+ VP++V+ +YDG E+G EP +N+KG + GNP+T 
Sbjct  76    LRKWLMSHPRFLTNPLYITGDSYSGVVVPIIVKEVYDGNEAGREPPMNLKGYVLGNPVTC  135

Query  987   RFSDTNNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINM  808
                D + R+ +G++   +SD LY+STK+ CNG+Y++  P N AC  DL+ V+K  EKI +
Sbjct  136   EVKDISQRIPFGHKTALISDELYESTKKDCNGDYVNVDPTNGACLTDLEMVSKRLEKIYL  195

Query  807   PQILEPACN--------PEILLSLDGEN------LPQQ---WCRDDNYLFAYSWANNKIV  679
              QILEP CN         +   S+  EN      +P Q   WCR+ NYL++Y WAN++ V
Sbjct  196   AQILEPICNFMSPNHTRLKWSRSILEENIINVVSMPLQSRPWCRNYNYLYSYIWANDRNV  255

Query  678   QKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGD  499
             Q+AL +REGT  EW RCN +LS          Y  +V N+V YHR  +  S R LIYSGD
Sbjct  256   QEALHIREGTKPEWDRCNESLS----------YTKDVLNSVVYHRYLSKTSLRALIYSGD  305

Query  498   HDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAG  391
             HDM +P+V T  WI SL + +   W PWFV  QVAG
Sbjct  306   HDMAIPYVGTLDWIRSLNLTLLGMWSPWFVGGQVAG  341



>ref|XP_002268517.1| PREDICTED: serine carboxypeptidase-like 17 [Vitis vinifera]
 emb|CBI17849.3| unnamed protein product [Vitis vinifera]
Length=472

 Score =   332 bits (850),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 175/431 (41%), Positives = 252/431 (58%), Gaps = 39/431 (9%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSP------------EtdplllwltggpgplTINYANSTGDIP  1315
             V EN ++QLFY F++S+++P                       G GPL+ +Y N TG +P
Sbjct  51    VGENEEVQLFYMFVKSQRNPVLDPLVMWLTGGPGCSTFSAFFYGNGPLSFDYKNYTGGLP  110

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L LN Y WT   NII+VD PVG G+SYS T + Y ++D  S+ HTY FL +WLLDHP F
Sbjct  111   SLLLNEYTWTSGLNIIYVDTPVGAGFSYSRTQEGYYSDDYKSSTHTYEFLNKWLLDHPEF  170

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L N LYV GDSYSGI +P++   IY G   G   ++N++G I GNP+T  + D N ++  
Sbjct  171   LKNNLYVGGDSYSGIVLPMITEKIYYGNGIGTFLQMNLQGYILGNPVTDSYIDGNAQIKI  230

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
              +R+  + DNLY+S K SCNG+++     N  C  D++ +++    I   Q+LEP C   
Sbjct  231   AHRLTLIPDNLYESAKASCNGDFVTVNASNEECVADMEAISELISPIYTMQVLEPNCGIS  290

Query  783   --------NPEILLSLDGENLPQQW-------CRDDNYLFAYSWANNKIVQKALGVREGT  649
                     + +  L  + ++ P          C +  Y+F+  W+N++ V++AL VREGT
Sbjct  291   SQKPNKWKSQQRSLIENSKHFPSGLGKKAAYHCHEYMYVFSEIWSNDESVREALHVREGT  350

Query  648   MTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVST  469
                W+RCN  +SG         Y  +VK+++ Y R+ T    R LIYSGDHDM +PHV T
Sbjct  351   KGHWVRCN--VSGL-------AYTRDVKSSIPYQRNLTQTGLRALIYSGDHDMSIPHVGT  401

Query  468   EKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLP  289
             ++WI  L + + D WR W+ + QV+GYT +++  ++ LT+ATVKGAGH A EYK +EC  
Sbjct  402   QEWINLLNLTLADTWRAWYTDAQVSGYTQRFTNDDFSLTFATVKGAGHVAIEYKAKECYA  461

Query  288   MIQRWLSIYPL  256
             MI+RW   YPL
Sbjct  462   MIKRWFGYYPL  472



>ref|XP_002300280.2| hypothetical protein POPTR_0001s29810g [Populus trichocarpa]
 gb|EEE85085.2| hypothetical protein POPTR_0001s29810g [Populus trichocarpa]
Length=446

 Score =   330 bits (847),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 185/437 (42%), Positives = 256/437 (59%), Gaps = 68/437 (16%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGD-I  1318
             V E   +QLFYYFIESE+SP+ D              L  L    GPL+ +YA S+G   
Sbjct  42    VGELEAVQLFYYFIESERSPKDDPLVLWLTGGPGCSALSGLIYEIGPLSFDYAKSSGGGK  101

Query  1317  PDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPT  1138
             P   LNPY+WTK+ANIIFVD PVGTG+SYS T + Y  +DTLSA  TY FL +       
Sbjct  102   PVFALNPYSWTKLANIIFVDAPVGTGFSYSTTWEGYQVSDTLSAAETYEFLRK-------  154

Query  1137  FLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVV  958
                             ++ ++V+ I DG E G +P +N+KG + GNPLT    DTN+ V 
Sbjct  155   ---------------ASLHIIVQEISDGNEVGRQPTMNLKGYVLGNPLTDHEIDTNSIVP  199

Query  957   YGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC--  784
             + +    +SD LY+S  ++C G Y++    N++C  D+  + +C   ++  QILEPAC  
Sbjct  200   FAHLKALISDKLYESFMKTCKGEYLNPDQSNASCMEDILAIKECIGNLHNTQILEPACKV  259

Query  783   ----------NPEILLSLDGENL------PQQWCRDDNYLFAYSWANNKIVQKALGVREG  652
                       +P  L++ D + L      P  WCR  ++ + Y WAN++ V+ AL +R+G
Sbjct  260   VSPKPVALKWDPRFLIADDADILLSSPRVPGPWCRSYDHEYIYGWANDETVRDALHIRKG  319

Query  651   TMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVS  472
             T+ +W RCN TL+          Y +NV++TVDYHR+ T K  R LIYSGDHDM++P+V 
Sbjct  320   TIKDWRRCNKTLA----------YSYNVESTVDYHRNLTKKPYRALIYSGDHDMLIPYVG  369

Query  471   TEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKE-----YELTYATVKGAGHTAPEYK  307
             T +WIESL + ++ DW PWFV+ QVAGY M Y+        Y+LT+ATVKG GHTAPEY+
Sbjct  370   TLEWIESLNLTIKYDWEPWFVDGQVAGYAMLYADNAQDYITYDLTFATVKGGGHTAPEYR  429

Query  306   PRECLPMIQRWLSIYPL  256
             P +C  M+ RW + YPL
Sbjct  430   PEQCFAMMDRWFNYYPL  446



>ref|XP_007018461.1| Serine carboxypeptidase-like 7, putative [Theobroma cacao]
 gb|EOY15686.1| Serine carboxypeptidase-like 7, putative [Theobroma cacao]
Length=473

 Score =   331 bits (848),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 182/436 (42%), Positives = 252/436 (58%), Gaps = 48/436 (11%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtdpl----------llwltggpgplTINYANST---GDI  1318
             V ++  +QLFYYF++SE++PE DPL            +         +N+       G +
Sbjct  51    VGDSEDVQLFYYFVKSERNPEEDPLLLWLTGGPGCSAFSGLVFEIGPLNFKADVEYNGSL  110

Query  1317  PDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPT  1138
             P L LNPY+WTKV+NIIFVD PVGTG+SY+  + A  T D   A   + FL +WL DHP 
Sbjct  111   PTLVLNPYSWTKVSNIIFVDSPVGTGFSYARNNLAALTGDFKQANQLHQFLRKWLKDHPD  170

Query  1137  FLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVV  958
             F+++P+YV+GDSYSGI +P++ + I +G E GI P ++++G + GNP T    + N ++ 
Sbjct  171   FISSPVYVSGDSYSGIPIPVLAQEILNGNEEGIRPIISLQGYVLGNPATVPSLEANLKIP  230

Query  957   YGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC--  784
             Y + MG +SD LY+S K SC+G Y    P N  C+ D+Q  +KC   I   QILEP C  
Sbjct  231   YAHGMGLISDELYESLKRSCDGEYQTVDPSNVECEKDIQYFSKCISGIQPAQILEPICPF  290

Query  783   -----------------NPEILLSLDGENLPQQW---CRDDNYLFAYSWANNKIVQKALG  664
                              + E+LL  +    P      CR   YL  Y WAN+  VQKAL 
Sbjct  291   ASPRPQEIGGKRDLEEQHGEVLLEDEPPPPPPLPTLGCRTYAYLLCYYWANDNNVQKALH  350

Query  663   VREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIV  484
             +R+G++ +W RC  TL  P        Y  +V ++  YH + + +  R LIYSGDHD+ V
Sbjct  351   IRKGSIGQWQRC--TLGLP--------YTADVPSSFPYHANLSARGIRALIYSGDHDLTV  400

Query  483   PHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKP  304
             P ++T+ WI SL   + DDWRPW +  QV GYT  YS +   +T+ATVKG GHTAPEY+P
Sbjct  401   PFLATQAWIRSLNYTIVDDWRPWVLRGQVVGYTRTYSNR---MTFATVKGGGHTAPEYRP  457

Query  303   RECLPMIQRWLSIYPL  256
              ECL M +RW+S  PL
Sbjct  458   AECLAMFKRWISEEPL  473



>ref|XP_011627623.1| PREDICTED: serine carboxypeptidase-like 7 [Amborella trichopoda]
Length=469

 Score =   331 bits (848),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 180/423 (43%), Positives = 253/423 (60%), Gaps = 45/423 (11%)
 Frame = -3

Query  1437  QLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNPY  1294
             +LFYY I+SE +P  D                 L    GPL I      G +P L  NPY
Sbjct  63    RLFYYLIKSENNPSKDPLLLWLTGGPGCSGFSGLVIETGPLRIKVEEYNGTLPALRYNPY  122

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
             +WTKVAN+I+VD P+GTG+SYS++   Y T+D+ + +  + FL  W +++P FL+NPLY+
Sbjct  123   SWTKVANVIYVDSPIGTGFSYSKSPPDYATSDSKTVKDLHKFLTNWFIEYPEFLSNPLYI  182

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFL  934
             AGDSYSGITVP++   I +G++SG  P  N+KG + GNP+T    D+   V + + MG +
Sbjct  183   AGDSYSGITVPVLTSEIANGIDSGYRPVFNLKGYLVGNPVTDVEFDS-QVVPFAHGMGLI  241

Query  933   SDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-----NPEIL  769
             SD L+++TK SCNG Y  A P  S C  ++Q V +C  +IN P ILEP C      P + 
Sbjct  242   SDELFEATKISCNGKY--AFPKGSQCNLNMQAVHECLSRINTPHILEPLCPFASPRPRVE  299

Query  768   LSL----------DGENLPQQ--WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCN  625
             +             G +L     +CR   Y+ ++ WANN+ VQ+ L V++GT+ EW RCN
Sbjct  300   IGTGLRRWLHENSSGIHLQSTPIFCRTYGYMLSHYWANNERVQEVLHVKKGTVNEWKRCN  359

Query  624   HTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLK  445
             + ++          +  +V ++V YH + T +    LIYSGDHD  VP + T+ WI SL+
Sbjct  360   YGIN----------FKADVASSVVYHYNLTMRGYSALIYSGDHDSSVPFIGTQAWIRSLE  409

Query  444   VGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSI  265
               + DDWR W V+ QV GYT KY+     LT+ATVKGAGHTAPEYKP+EC+ M++RW+S 
Sbjct  410   FPIIDDWRAWLVDGQVVGYTRKYTNN---LTFATVKGAGHTAPEYKPKECVAMLKRWISN  466

Query  264   YPL  256
              PL
Sbjct  467   EPL  469



>ref|XP_009384628.1| PREDICTED: serine carboxypeptidase-like 18 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009384629.1| PREDICTED: serine carboxypeptidase-like 18 [Musa acuminata subsp. 
malaccensis]
Length=472

 Score =   331 bits (848),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 189/426 (44%), Positives = 246/426 (58%), Gaps = 47/426 (11%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANST-GDIPDLELN  1300
             +QLFYYFI SE+ P  D                 L    GPL  + A  T G +P L  N
Sbjct  63    VQLFYYFIMSERKPADDPLMVWITGGPGCSAFSGLMFEIGPLQFDVAGYTDGLLPSLIYN  122

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             P +WTKV++IIF+D PVGTG+SYS+T       DT SA H  +FL +W +DHP+F+ NPL
Sbjct  123   PISWTKVSSIIFLDSPVGTGFSYSDTEQGLRITDTKSAIHVCTFLKKWYVDHPSFIKNPL  182

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMG  940
             Y+ GDSYSG+ VP++ + I DG E+G     N+KG + GNP T    D N  + Y + MG
Sbjct  183   YIGGDSYSGLLVPVIAQYISDGNEAGDGLHFNLKGYLVGNPSTDGEYDGNAIIPYVHGMG  242

Query  939   FLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---NPE--  775
              +SD LY++TK SC   Y    P N+ C   LQ V +    IN   ILEP C   +P+  
Sbjct  243   LISDELYEATKRSCGEQYQS--PRNAECASCLQAVNQGLFGINNVHILEPLCFFASPKRN  300

Query  774   ILLS-------------LDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWL  634
             IL +             L   +LP Q CR   Y+ +Y WANN  V++ALGVREGT   W+
Sbjct  301   ILTADRRKLLEEHLEQPLSKSDLPLQ-CRSSGYVLSYFWANNDTVREALGVREGTKQMWV  359

Query  633   RCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIE  454
             RCN+ ++          Y  +V +++ YH S T++  R L YSGDHDM VP V T+ WI 
Sbjct  360   RCNYGIN----------YTNDVSSSLKYHLSLTSRGYRALAYSGDHDMSVPFVGTQAWIR  409

Query  453   SLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRW  274
             SL   + DDWR WFV+ QVAG+T  YS     LT+ T+KG GHTAPEYKP+ECL M+ RW
Sbjct  410   SLNFSIVDDWRSWFVDGQVAGFTRTYSNN---LTFVTIKGGGHTAPEYKPKECLAMVDRW  466

Query  273   LSIYPL  256
              +  PL
Sbjct  467   FAGSPL  472



>ref|XP_012068194.1| PREDICTED: serine carboxypeptidase-like 17 [Jatropha curcas]
 gb|KDP41600.1| hypothetical protein JCGZ_16007 [Jatropha curcas]
Length=472

 Score =   329 bits (843),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 187/433 (43%), Positives = 241/433 (56%), Gaps = 45/433 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIES----EKSPEtdplllwltggpgplTI--------NYANSTGDIP  1315
             V E+  +QLFYYF+ S    EK P    L            I              G +P
Sbjct  53    VGESEDVQLFYYFVRSQGNAEKDPLLLWLTGGPGCSALSGFIYEIGPLYFEVVEYNGSLP  112

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L LNP +WTKVA+IIF+D PVGTG+SY  T  A  + D +    T  FL +WL DHP F
Sbjct  113   TLFLNPNSWTKVASIIFIDSPVGTGFSYPRTPLASVSGDFIQINQTEQFLRKWLNDHPEF  172

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L+NP+YV GDSYSGI +P VV+ I  G E G +P +N+KG + GN  T    D N++V +
Sbjct  173   LSNPVYVGGDSYSGIPLPGVVQKISIGNEEGRKPFINLKGYLLGNAGTDFSFDGNSQVPF  232

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
              + MG +SD LY+S K +C G Y    P N+ C   +Q  T CT  ++   ILEP C   
Sbjct  233   AHGMGLISDELYESLKRTCGGEYTFISPSNAECLKHMQEFTNCTSGLDGAHILEPLCAFV  292

Query  783   NPEIL-------LSLDGEN----------LPQQWCRDDNYLFAYSWANNKIVQKALGVRE  655
             +P+ +        SL   N          LP   CR   YL +  WAN+  V+KAL +RE
Sbjct  293   SPKPIEISFRERRSLIDSNSREFVDSDPFLPTIGCRTYGYLLSIYWANDNSVRKALHIRE  352

Query  654   GTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHV  475
             GT+ EW+RCN+ ++          Y   + +T+ +H   +NK  R LIYSGDHDM+V  V
Sbjct  353   GTVGEWIRCNYGIN----------YRREISSTIKHHLYLSNKGYRSLIYSGDHDMLVSFV  402

Query  474   STEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPREC  295
              T+ WI SL   + DDWRPW +E QVAGYT  YS K   +TYAT+KG GHTAPEYKP EC
Sbjct  403   GTQAWIRSLNFSIVDDWRPWHLEGQVAGYTRSYSNK---MTYATIKGGGHTAPEYKPEEC  459

Query  294   LPMIQRWLSIYPL  256
               M +RW S  PL
Sbjct  460   FAMFKRWTSQEPL  472



>gb|EPS73196.1| hypothetical protein M569_01551 [Genlisea aurea]
Length=444

 Score =   328 bits (841),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 166/406 (41%), Positives = 235/406 (58%), Gaps = 22/406 (5%)
 Frame = -3

Query  1437  QLFYYFIESEKSPEt-------dplllwltggpgplTINYANSTGDIPDLELNPYAWTKV  1279
             +LFYYFIESE+ P T                      I      G  P L+LNPY+WTK 
Sbjct  49    ELFYYFIESERDPVTDPLIIWITGGPGCSALSGLVYEIGPMTFNGSSPVLKLNPYSWTKA  108

Query  1278  ANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSY  1099
             A+I+FVD PVGTG+SYS T   Y T+DT +AQ  YSFL +WLL HP F+ NPL++AGDSY
Sbjct  109   ASIVFVDSPVGTGFSYSTTPQGYQTSDTQTAQDNYSFLKKWLLSHPEFMTNPLFIAGDSY  168

Query  1098  SGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFLSDNLY  919
              G    L+   +  G+E+G+EPRL ++G + GN +T    D N R+ Y +R+G LSD+ Y
Sbjct  169   GGKMAILLALLVAQGIEAGVEPRLLLQGYLIGNTVTETAKDYNQRLPYAHRLGLLSDDYY  228

Query  918   KSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPEI-----LLSLDG  754
                K  CNG Y++  P N  C   L     C + ++   ILEP C         L+ L  
Sbjct  229   ALAKRHCNGEYVNPDPGNMLCNNALHLFQMCLKDVDYAHILEPKCISSSGTVGGLIRLIP  288

Query  753   ENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVF  574
                 +  CR+  Y+ +  WAN++ V+ +L VR+GT++EW+RCN ++S          Y +
Sbjct  289   NQNDEPECREGTYVSSAIWANDETVRDSLHVRKGTISEWVRCNDSVS----------YAY  338

Query  573   NVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVA  394
             +V+    ++R    K    L+YSGDHDM++P+++T + +  L + + + WRPW V  Q+A
Sbjct  339   DVQTVFHHYRVLIEKGYDGLLYSGDHDMVIPYLATLETVRELNLTLHEAWRPWRVNKQIA  398

Query  393   GYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             GYT  Y      + +ATVKG GHTAPEY+PRECL M++R+ S  PL
Sbjct  399   GYTQSYKHNGAYVVFATVKGGGHTAPEYRPRECLEMMKRYTSKLPL  444



>gb|KJB73511.1| hypothetical protein B456_011G236800 [Gossypium raimondii]
Length=470

 Score =   329 bits (843),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 180/426 (42%), Positives = 238/426 (56%), Gaps = 48/426 (11%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             ++ FYYFI+SE+ P  D              L  L    GPL  N     G +P   LNP
Sbjct  54    VEFFYYFIQSERDPSKDPLILWLTGGPGCSALSGLFFEIGPLQFNMVEYNGSLPTFVLNP  113

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTKVANIIF+D PVGTG+SYS T   + T D   A   Y+FL +WL  H  F+ N LY
Sbjct  114   YSWTKVANIIFLDAPVGTGFSYSTTLQGFETGDKRFANDGYNFLRKWLQSHLKFITNSLY  173

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMK----GCIEGNPLTHRFSDTNNRVVYGY  949
             + GDSY+G  VP++V  I DG+E    P  N+K    G + GNP T    + N+++ +  
Sbjct  174   ITGDSYAGKIVPIIVHAISDGIEDESVPAFNLKHLLQGYLVGNPSTGSKYEDNSKIPFYN  233

Query  948   RMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPEI-  772
             RM  +SD LY+S K +C   Y++    N  C  DLQ +++C   IN P ILEP C  E  
Sbjct  234   RMALISDELYESAKRNCKEEYVEVEMSNVKCAKDLQAISECIAYINKPHILEPHCPSEFN  293

Query  771   -----------LLSLDGEN-------LPQQWCRDDNYLFAYSWANNKIVQKALGVREGTM  646
                         L    E+        P+  CR+ N      WA++  VQ+ALG+R+GT+
Sbjct  294   TPNSLVNERKYFLETREEDYLQAPAEYPKFGCRNYNTYLCKIWASDDGVQQALGIRKGTI  353

Query  645   TEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTE  466
              EW+RCN  L           Y  +V + VDYH S   +  R LIYSGDHD +VP+V TE
Sbjct  354   REWIRCNENL----------LYDKDVGSVVDYHLSLNTEGYRALIYSGDHDTVVPYVGTE  403

Query  465   KWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPM  286
              W++SL + + DDWRPWFV+DQVAGY+ +Y       T+ATVKG GHTAPE+KP+EC  M
Sbjct  404   SWVKSLNLSIVDDWRPWFVDDQVAGYSREYGNN---FTFATVKGGGHTAPEFKPKECFAM  460

Query  285   IQRWLS  268
               RW+S
Sbjct  461   FSRWIS  466



>ref|XP_011030309.1| PREDICTED: serine carboxypeptidase-like 18 isoform X3 [Populus 
euphratica]
Length=446

 Score =   328 bits (840),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 191/461 (41%), Positives = 253/461 (55%), Gaps = 89/461 (19%)
 Frame = -3

Query  1515  KLCLVSQQNFHSNSILV-----T*VWENLKIQLFYYFIESEKSPEtd------------p  1387
             K  + S   FH N   V       V E   +QLFYYF+ESE+SP+ D             
Sbjct  34    KSIIKSLPGFHGNLPFVLETGYIGVGELEAVQLFYYFVESERSPKDDPLVLWLTGGPGCS  93

Query  1386  lllwltggpgplTINYANSTGD-IPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAY  1210
              L       GPL+ +YA S+G   P L LNPY+WTK+ANIIFVD PVGTG+SYS T + Y
Sbjct  94    ALSGFIYEIGPLSFDYAKSSGGGKPVLALNPYSWTKIANIIFVDAPVGTGFSYSTTWEGY  153

Query  1209  NTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPR  1030
             + +DTLSA  TY FL +WL+DHP FL NPLYVAGDSYSGI  P++V+ I DG E G +P 
Sbjct  154   DVSDTLSAAETYEFLRKWLVDHPKFLTNPLYVAGDSYSGIVAPIIVQEISDGNEVGRQPT  213

Query  1029  LNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQY  850
             +N+KG + GNP+T    DTN+RV + Y    +SD LY+S  ++C G Y++    N++C  
Sbjct  214   MNLKGYVLGNPVTDDEIDTNSRVPFAYLKALISDKLYESFMKNCKGEYLNPDQSNASCME  273

Query  849   DLQRVTKCTEKINMPQILEPAC------------NPEILLSLDGENL------PQQWCRD  724
             D+  + +C   +   QILEPAC            +P  L++ D + L      P QWCR 
Sbjct  274   DILAIKECIGTVFTGQILEPACKSVSPKPVALKWDPRFLIADDADILLPRPRVPGQWCRS  333

Query  723   DNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHR  544
              N+++ Y WAN++ V+ AL +R+GT+ +W RCN TL+          Y +NVK+TVDYHR
Sbjct  334   YNHVYIYGWANDETVRDALHIRKGTIKDWRRCNKTLA----------YSYNVKSTVDYHR  383

Query  543   SFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKE  364
             + T K  R LIY                                       Y M Y+   
Sbjct  384   NLTKKPYRALIYR--------------------------------------YAMLYADNA  405

Query  363   -----YELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                  Y+LT+ATVKG GHTAPEY+P +C  M+ RW   YPL
Sbjct  406   QEYITYDLTFATVKGGGHTAPEYRPEQCFAMMDRWFDYYPL  446



>gb|KDP41601.1| hypothetical protein JCGZ_16008 [Jatropha curcas]
Length=478

 Score =   328 bits (842),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 186/441 (42%), Positives = 249/441 (56%), Gaps = 56/441 (13%)
 Frame = -3

Query  1452  ENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDL  1309
             E  ++QLFYYFI+SE + + D              L  L    GPLT       G +P L
Sbjct  52    EAEEVQLFYYFIKSEGNVKEDPLLLWLTGGPGCSALSGLLYEIGPLTFEVVEYNGSLPKL  111

Query  1308  ELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLN  1129
              LNP++WTK A+IIFVD PVGTG+SY++T  AY+++D +       FL +WL DHP FL 
Sbjct  112   ILNPHSWTKAASIIFVDMPVGTGFSYAKTQPAYHSSDLIQVHQADQFLRKWLRDHPEFLP  171

Query  1128  NPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN-----------MKGCIEGNPLTHRF  982
             +P+Y+AGDSYSGI +P +V+ I +G E G+EP +N           +KG I GNP+T   
Sbjct  172   SPVYIAGDSYSGIPLPAIVQQISNGNEEGMEPLINLKVLFKKKKKNLKGYILGNPITDPN  231

Query  981   SDTNNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQ  802
              DTN++V Y + MG +SD LY+S K SC GNY+D  P N+ C  ++Q   KC E +    
Sbjct  232   FDTNSKVSYAHGMGLISDELYESLKRSCRGNYVDIEPSNTECLRNMQGFNKCVEGLQTGY  291

Query  801   ILEPAC-------------------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIV  679
             ILEP+C                   N    L +D    P   C    Y+ +Y W N+  V
Sbjct  292   ILEPSCGFASPKPFEIFDKRRSLIQNSPDFLQID-PTYPSFGCPAYGYVLSYIWVNDSSV  350

Query  678   QKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGD  499
             ++AL +REG++ +W+RCN  LS          Y  ++  ++ YH S   K  R LIYSGD
Sbjct  351   REALHIREGSIEQWVRCNTELS----------YTSDIPISLVYHVSLGKKGYRSLIYSGD  400

Query  498   HDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTA  319
              DM+VP + T+ WI SL   + DDWRPW V  Q+AGYT  YS    ++T+ATVKG GHTA
Sbjct  401   QDMVVPFLGTQAWIRSLNYSIVDDWRPWLVRGQIAGYTRTYSN---QMTFATVKGGGHTA  457

Query  318   PEYKPRECLPMIQRWLSIYPL  256
             P YKP  C  M +RW S  PL
Sbjct  458   PTYKPEVCFAMFKRWKSHEPL  478



>ref|XP_006369725.1| hypothetical protein POPTR_0001s29900g [Populus trichocarpa]
 gb|ERP66294.1| hypothetical protein POPTR_0001s29900g [Populus trichocarpa]
Length=441

 Score =   327 bits (838),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 174/381 (46%), Positives = 238/381 (62%), Gaps = 41/381 (11%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGD-IPDLELN  1300
             +QLFYYFIESE+SP+ D              L  +    GPL+ +YA S+G   P L LN
Sbjct  49    VQLFYYFIESERSPKDDPLVLWLTGGPGCSALSGIIYEIGPLSFDYAKSSGGGKPVLALN  108

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPL  1120
             PY+WTK+ANIIFVD PVGTG+SYS T + Y+ +DT+SA  TY FL +WL+DHP FL NPL
Sbjct  109   PYSWTKIANIIFVDAPVGTGFSYSTTWEGYHVSDTISAAETYEFLRKWLVDHPKFLTNPL  168

Query  1119  YVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMG  940
             YVAGDSY+GI  P++V+ I DG E G +P +N+KG + GNP T      N+ V + +   
Sbjct  169   YVAGDSYTGIVAPIIVQEISDGNEVGHQPTMNLKGYVLGNPRTDYEIQINSIVPFAHLKV  228

Query  939   FLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC--------  784
              +SD LY+S  ++C G Y++    N++C  D+  + +C   +    ILEP C        
Sbjct  229   LISDKLYESFMKNCKGEYLNPDQRNASCMEDILAIKECIRNLCNAHILEPTCKDISPKPV  288

Query  783   ----NPEILLSLDGENL------PQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWL  634
                 +P  L++ D + L      P  WCR  NY++ Y WAN++ V+ AL +R+GT+ +W 
Sbjct  289   PLKWDPRFLIADDADILLSSPRVPGPWCRSYNYVYIYMWANDETVRDALHIRKGTIKDWR  348

Query  633   RCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIE  454
             RCN TL+          Y +NVK+TVDYHR+ T K  R LIYSGDHDM++P+V T +WIE
Sbjct  349   RCNKTLA----------YSYNVKSTVDYHRNLTKKPYRALIYSGDHDMLIPYVGTLEWIE  398

Query  453   SLKVGVEDDWRPWFVEDQVAG  391
             SL + ++ DW PWFV+ QVAG
Sbjct  399   SLNLTIKYDWEPWFVDGQVAG  419



>dbj|BAH89272.1| putative serine carboxypeptidase-like acyltransferase [Diospyros 
kaki]
Length=491

 Score =   329 bits (843),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 174/437 (40%), Positives = 247/437 (57%), Gaps = 53/437 (12%)
 Frame = -3

Query  1437  QLFYYFIESEKSP------------EtdplllwltggpgplTINYANSTGDIPDLELNPY  1294
             +LFYYFIESE +P                 L  +    GP+  +  N TG +P L   P 
Sbjct  65    ELFYYFIESEGNPLEDPLMLWLTGGPGCSSLYGIIYEMGPMEFDIHNYTGGLPKLRYYPD  124

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
             AWTK A+IIF+DQPVGTG+SYS T + + ++DT S++ +Y FL +WL ++P +L   L+V
Sbjct  125   AWTKTASIIFLDQPVGTGFSYSTTQEGWPSSDTKSSEQSYEFLKKWLEENPQYLKVQLFV  184

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFL  934
              GDSY+G  VPLV R I DG ++G  P LN+KG + G+P T    D N++VV+ +RM  +
Sbjct  185   GGDSYAGKIVPLVTRLIADGNKNGGTPYLNLKGMVLGSPRTDNIIDENSKVVFAHRMALI  244

Query  933   SDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC----------  784
             SD +Y++ KE+CNG+Y +A P+N+AC   ++ +T+C   +    ILEP C          
Sbjct  245   SDEMYENAKEACNGSYSNAAPNNTACHLAIEEITRCIRDLFRGNILEPRCLFVAPPQTES  304

Query  783   ---------------------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKAL  667
                                  +  +   L    +   WCR  NY+ AY W N+  VQ+AL
Sbjct  305   DAIHAERRSLQAQAQEEDEDEDGTLDFLLSPPRIQNLWCRAFNYVLAYEWGNDIAVQEAL  364

Query  666   GVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMI  487
              VR+GT+  W+RCN +LS          Y  ++ + V  H      + +VL+ SGD DM+
Sbjct  365   HVRQGTVAYWMRCNFSLS----------YTKDIHSVVSVHEYLKTIALQVLVASGDRDMV  414

Query  486   VPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYK  307
             VP V T KWI++L + V + WRPWF++ QV GYT KY    Y LTY TVKGAGHTAPEY 
Sbjct  415   VPFVGTVKWIKALDLSVSEYWRPWFLDGQVQGYTEKYDNNGYYLTYVTVKGAGHTAPEYH  474

Query  306   PRECLPMIQRWLSIYPL  256
              ++   +  RW+  YP+
Sbjct  475   RKQVYHLFDRWIHYYPV  491



>gb|KJB73510.1| hypothetical protein B456_011G236800 [Gossypium raimondii]
Length=492

 Score =   328 bits (842),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 166/379 (44%), Positives = 220/379 (58%), Gaps = 32/379 (8%)
 Frame = -3

Query  1347  INYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSF  1168
              N     G +P   LNPY+WTKVANIIF+D PVGTG+SYS T   + T D   A   Y+F
Sbjct  123   FNMVEYNGSLPTFVLNPYSWTKVANIIFLDAPVGTGFSYSTTLQGFETGDKRFANDGYNF  182

Query  1167  LVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTH  988
             L +WL  H  F+ N LY+ GDSY+G  VP++V  I DG+E    P  N+KG + GNP T 
Sbjct  183   LRKWLQSHLKFITNSLYITGDSYAGKIVPIIVHAISDGIEDESVPAFNLKGYLVGNPSTG  242

Query  987   RFSDTNNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINM  808
                + N+++ +  RM  +SD LY+S K +C   Y++    N  C  DLQ +++C   IN 
Sbjct  243   SKYEDNSKIPFYNRMALISDELYESAKRNCKEEYVEVEMSNVKCAKDLQAISECIAYINK  302

Query  807   PQILEPACNPEI------------LLSLDGEN-------LPQQWCRDDNYLFAYSWANNK  685
             P ILEP C  E              L    E+        P+  CR+ N      WA++ 
Sbjct  303   PHILEPHCPSEFNTPNSLVNERKYFLETREEDYLQAPAEYPKFGCRNYNTYLCKIWASDD  362

Query  684   IVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYS  505
              VQ+ALG+R+GT+ EW+RCN  L           Y  +V + VDYH S   +  R LIYS
Sbjct  363   GVQQALGIRKGTIREWIRCNENL----------LYDKDVGSVVDYHLSLNTEGYRALIYS  412

Query  504   GDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGH  325
             GDHD +VP+V TE W++SL + + DDWRPWFV+DQVAGY+ +Y       T+ATVKG GH
Sbjct  413   GDHDTVVPYVGTESWVKSLNLSIVDDWRPWFVDDQVAGYSREYGNN---FTFATVKGGGH  469

Query  324   TAPEYKPRECLPMIQRWLS  268
             TAPE+KP+EC  M  RW+S
Sbjct  470   TAPEFKPKECFAMFSRWIS  488



>ref|XP_006433654.1| hypothetical protein CICLE_v10001055mg [Citrus clementina]
 gb|ESR46894.1| hypothetical protein CICLE_v10001055mg [Citrus clementina]
Length=468

 Score =   328 bits (840),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 181/433 (42%), Positives = 242/433 (56%), Gaps = 45/433 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E+   QLFYYF++SEK+P  D                 L    GP+  N     G +P
Sbjct  49    VGESGDAQLFYYFVKSEKNPREDPLLLWLTGGPGCSAFSGLAYEIGPINFNVVEYNGSLP  108

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L LNPY+WTK A+I+FVD PVGTGYSY++T  A    D    Q    FL +WLLDHP  
Sbjct  109   TLHLNPYSWTKEASILFVDSPVGTGYSYAKTPLASQAGDFKQVQQVDQFLRKWLLDHPEL  168

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L+NP+Y+ GDSYSG+ VP +V+ I +  E  I+P +N++G I GN  T    + N+++ +
Sbjct  169   LSNPVYIGGDSYSGLVVPALVQQISNENEEDIKPLINLQGYILGNAATEPTVEENSKIPF  228

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
              + MG +S+ LY+S K  C G Y++  P N  C  D+Q  +K T +I    ILEP C   
Sbjct  229   AHGMGLISNELYESLKMGCGGEYVNVDPKNEVCLNDIQAFSKLTSEIEGAHILEPRCPFS  288

Query  783   --------NPEILLSLDGEN---------LPQQWCRDDNYLFAYSWANNKIVQKALGVRE  655
                          L+++ ++         LP   CR   YL +Y W N+  V+KAL +R 
Sbjct  289   SPKPRESSRKRRSLNVNEQSQEFLVPEPPLPTIGCRTYGYLLSYYWNNDYNVRKALRIRL  348

Query  654   GTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHV  475
             G+  EW RCN  L           Y   + ++  YH S + K  R LIYSGDHDM+VP +
Sbjct  349   GSKGEWQRCNFGL----------PYAREIHSSFSYHVSLSTKGYRSLIYSGDHDMMVPFL  398

Query  474   STEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPREC  295
              TE WI+SL   + DDWRPW +  QVAGYT  YS +   +TYATVKG GHTAPEY+P EC
Sbjct  399   GTEAWIKSLNYSIADDWRPWILHSQVAGYTRTYSNR---MTYATVKGGGHTAPEYRPAEC  455

Query  294   LPMIQRWLSIYPL  256
               M QRW++  PL
Sbjct  456   YAMFQRWINHDPL  468



>ref|XP_009393004.1| PREDICTED: serine carboxypeptidase-like 2 [Musa acuminata subsp. 
malaccensis]
Length=468

 Score =   328 bits (840),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 175/424 (41%), Positives = 244/424 (58%), Gaps = 45/424 (11%)
 Frame = -3

Query  1437  QLFYYFIESEKSP------------EtdplllwltggpgplTINYANSTGDIPDLELNPY  1294
             +LFYYF  SE  P            +   +   L    GP+    +   G IP L  NPY
Sbjct  60    ELFYYFTASEGDPSQDPLLLWLTGGDRCSVFSGLAFELGPVKFVISEYNGSIPTLTYNPY  119

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
             +WTKV++IIFVD PVG G+S+S   + Y+ +DT ++   + FLV+W +DHP +L NPLY+
Sbjct  120   SWTKVSSIIFVDSPVGAGFSFSRDDEGYDIDDTAASMQVHKFLVKWFIDHPQYLPNPLYI  179

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFL  934
             AGDSY+GI VPLV + I    E+G++P LN+KG I GNP T    D N+R+ Y + MG +
Sbjct  180   AGDSYAGIYVPLVAQAISQDNEAGLQPHLNLKGYILGNPATGEKIDRNSRIPYAHGMGII  239

Query  933   SDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-----NPEIL  769
             SD +++ST+ +C+G      P  + C   L  V K   +I  P IL+P C      PE  
Sbjct  240   SDEMFESTQRNCDGQDY-RYPTTTLCSKSLDAVEKFFSEIMKPYILDPKCAFVSPKPEAT  298

Query  768   LSLDGENLPQQ-------------WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRC  628
             ++ D   + +              +CR   Y+ +Y WANN++ ++AL +++GT  EW RC
Sbjct  299   VA-DRRTMEESDIKLLKPPPLPPLYCRTYAYVLSYYWANNQVTREALHIKKGTKEEWRRC  357

Query  627   NHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESL  448
             N  L    E          VK+T+ YH + T +  R L+YSGDHD++VP + T  WI+SL
Sbjct  358   NEDLPFRKE----------VKSTIKYHANLTRRGYRALVYSGDHDLVVPFLGTMAWIKSL  407

Query  447   KVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLS  268
                + DDWR W V+ QVAGYTM Y      LT+ATVK  GHT PEY+P+ECL MI+RW+S
Sbjct  408   NYSIVDDWRSWHVDGQVAGYTMTYVNN---LTFATVKNGGHTTPEYRPKECLAMIRRWIS  464

Query  267   IYPL  256
               PL
Sbjct  465   YQPL  468



>ref|XP_012068195.1| PREDICTED: serine carboxypeptidase-like 17 isoform X1 [Jatropha 
curcas]
Length=478

 Score =   328 bits (840),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 185/441 (42%), Positives = 249/441 (56%), Gaps = 56/441 (13%)
 Frame = -3

Query  1452  ENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDL  1309
             E  ++QLFYYF++SE + + D              L  L    GPLT       G +P L
Sbjct  52    EAEEVQLFYYFLKSEGNVKEDPLLLWLTGGPGCSALSGLLYEVGPLTFEVVEYNGSLPKL  111

Query  1308  ELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLN  1129
              LNP++WTK A+IIFVD PVGTG+SY++T  AY+++D +       FL +WL DHP FL 
Sbjct  112   ILNPHSWTKAASIIFVDMPVGTGFSYAKTQPAYHSSDLIQVHQADQFLRKWLRDHPEFLP  171

Query  1128  NPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN-----------MKGCIEGNPLTHRF  982
             +P+Y+AGDSYSGI +P +V+ I +G E G+EP +N           +KG I GNP+T   
Sbjct  172   SPVYIAGDSYSGIPLPAIVQQISNGNEEGMEPLINLKVLFKKKKKNLKGYILGNPITDPN  231

Query  981   SDTNNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQ  802
              DTN++V Y + MG +SD LY+S K SC GNY+D  P N+ C  ++Q   KC E +    
Sbjct  232   FDTNSKVSYAHGMGLISDELYESLKRSCRGNYVDIEPSNTECLRNMQGFNKCVEGLQTGY  291

Query  801   ILEPAC-------------------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIV  679
             ILEP+C                   N    L +D    P   C    Y+ +Y W N+  V
Sbjct  292   ILEPSCGFASPKPFEIFDKRRSLIQNSPDFLQID-PTYPSFGCPAYGYVLSYIWVNDSSV  350

Query  678   QKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGD  499
             ++AL +REG++ +W+RCN  LS          Y  ++  ++ YH S   K  R LIYSGD
Sbjct  351   REALHIREGSIEQWVRCNTELS----------YTSDIPISLVYHVSLGKKGYRSLIYSGD  400

Query  498   HDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTA  319
              DM+VP + T+ WI SL   + DDWRPW V  Q+AGYT  YS    ++T+ATVKG GHTA
Sbjct  401   QDMVVPFLGTQAWIRSLNYSIVDDWRPWLVRGQIAGYTRTYSN---QMTFATVKGGGHTA  457

Query  318   PEYKPRECLPMIQRWLSIYPL  256
             P YKP  C  M +RW S  PL
Sbjct  458   PTYKPEVCFAMFKRWKSHEPL  478



>ref|XP_009626153.1| PREDICTED: serine carboxypeptidase-like 13 [Nicotiana tomentosiformis]
Length=466

 Score =   327 bits (839),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 181/417 (43%), Positives = 246/417 (59%), Gaps = 33/417 (8%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E  ++QLFYYF++SE  P  D                 L    GPL        G +P
Sbjct  59    VGEYEEVQLFYYFLKSESEPTKDPVLVWLSGGPGCSSFTALVYQIGPLYFEPNKYNGSLP  118

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L LNP +WTKVANIIF+DQPV +G+SY+ TS  + + D  +  H Y FL +WL+ HP F
Sbjct  119   KLTLNPNSWTKVANIIFLDQPVNSGFSYATTSTTFKSTDLQACDHIYLFLRKWLIKHPEF  178

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             + NP+Y+ GDSYSGIT+P++ + I +G+E+G +P +N+KG I GNP T      N  + Y
Sbjct  179   IRNPMYIGGDSYSGITLPVITQLISNGIEAGHKPSINLKGYILGNPSTFPL-QYNYWIPY  237

Query  954   GYRMGFLSDNLYKSTKESCNG---NYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC  784
              + MG +SD LYK  KE+CNG    Y+D  P N  C    Q   +    IN P ILEP+C
Sbjct  238   AHGMGLISDELYKLLKETCNGENLQYVD--PSNVLCYQHYQTFEQLISGINKPHILEPSC  295

Query  783   NPEILLSLDGE--NLPQQW---CRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHT  619
               +    L GE  +L + +   CR + +  +  WAN+  VQ+AL VR+G +  W RC   
Sbjct  296   GSDAESRLFGERRSLYENYSIKCRVEVHRLSTYWANDPRVQEALNVRKGAIERWTRCR--  353

Query  618   LSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVG  439
                  E+  ++TY+   ++++ YH   + K  R LIYSGDHDM +P  ST+ WI+ L   
Sbjct  354   -----ESIVNKTYIITFQDSIPYHVELSKKLYRSLIYSGDHDMGIPFQSTQFWIKFLNYS  408

Query  438   VEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLS  268
             + D+WRPW V+DQVAGYT  YS    ++T+ATVKGAGH APEYKP+EC  M  RWLS
Sbjct  409   IVDEWRPWIVDDQVAGYTRSYSN---QMTFATVKGAGHVAPEYKPKECFTMFHRWLS  462



>ref|XP_010694009.1| PREDICTED: serine carboxypeptidase-like 7 [Beta vulgaris subsp. 
vulgaris]
Length=451

 Score =   327 bits (837),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 175/417 (42%), Positives = 252/417 (60%), Gaps = 37/417 (9%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtdpll----------lwltggpgplTINYANSTGD----  1321
             V ++ +++LFYYFI+SE+ PE DPL+           +         + + NS  D    
Sbjct  56    VGKDEEVKLFYYFIKSERDPERDPLMLWLTGGPGCSAFSGLVLEIGPLIFNNSACDWHSK  115

Query  1320  IPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHP  1141
              P  +LNP +WTKVA+IIF+D PVGTG+SY+   + Y ++D  S++H Y FL +WL DH 
Sbjct  116   SPTFQLNPSSWTKVASIIFLDSPVGTGFSYATNPEGYYSDDITSSRHIYQFLTKWLADHA  175

Query  1140  TFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDT--NN  967
              F NNPLY+AG SY G  VP+VV  I+ G + G +P +N++G + GNPLT +  +   + 
Sbjct  176   GFHNNPLYIAGVSYCGKIVPVVVHEIFQGNKVGFQPFMNLQGYVLGNPLTWKEDEKRYHP  235

Query  966   RVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPA  787
             ++ Y +R+  LSD LY+ST  SCNG Y DA  +N  C ++LQ ++   + +    +L+P 
Sbjct  236   QLNYAHRVSLLSDELYESTIISCNGAYQDADTNNINCTHNLQAISYNLDPLFDAHVLKPK  295

Query  786   CNPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGP  607
             C  +           + WC++       +WAN+  VQ AL ++EGT   W+RCN TL+  
Sbjct  296   CISD-----------KTWCQESITGLLDNWANDIQVQAALHIQEGTKRYWIRCNRTLA--  342

Query  606   PEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDD  427
                     Y +NV++TV YH++ T +   VLIYSGD DM + +V T  WI+ L + + +D
Sbjct  343   --------YEYNVQSTVGYHQNLTQEFIHVLIYSGDQDMKISYVGTLGWIKMLNISISED  394

Query  426   WRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             WRPWFV DQVAGY+ ++S   Y LT+ATVKGAGHTAPEYK  EC  M+ +WL   PL
Sbjct  395   WRPWFVNDQVAGYSTRFSNDRYNLTFATVKGAGHTAPEYKRAECFNMVMKWLESRPL  451



>ref|XP_010682455.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=335

 Score =   323 bits (827),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 153/342 (45%), Positives = 219/342 (64%), Gaps = 10/342 (3%)
 Frame = -3

Query  1281  VANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDS  1102
             VA+IIF+D PVGTG+SY  TSDAY ++D L +Q+ Y FL +WL  HP    NPLYVAGDS
Sbjct  4     VASIIFLDSPVGTGFSYGTTSDAYYSDDILQSQNIYEFLQKWLTGHPKLKANPLYVAGDS  63

Query  1101  YSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFLSDNL  922
             YSG+ VP++V+ I DG +     ++N+ G I GNP+T     TN R+ Y +R+  LSD +
Sbjct  64    YSGLIVPILVQEILDGNKKRHMQKINLMGYILGNPVTDGDISTNERIKYMHRVSLLSDEI  123

Query  921   YKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPEILLSLDGENLP  742
             Y+S K +CN ++ +   +N+ C    + +T+    +N P ILE  C       ++  ++ 
Sbjct  124   YESAKANCNNDFANIDANNTKCLESFEAITEIRASVNTPHILESKCIYVSPKPVNKVSIA  183

Query  741   QQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKN  562
              + CR+ +Y+ +Y+WAN+  VQ+AL VREGT+  W+RCN +LS          Y  +V++
Sbjct  184   AERCRNQHYMLSYTWANDVDVQEALHVREGTVDLWVRCNRSLS----------YTLSVRS  233

Query  561   TVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTM  382
             ++ YHR+F     R LIYSGD D  +P+V + +WI  L++  +  W PWFV  QVAGY  
Sbjct  234   SISYHRNFAKTLLRALIYSGDQDAAIPYVDSLEWINQLELSTDTHWNPWFVNGQVAGYVT  293

Query  381   KYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             +Y +  Y LT+ T+KG GHTAPEYKPRECL MI RWL++ PL
Sbjct  294   EYLRFPYRLTFTTIKGGGHTAPEYKPRECLAMIDRWLNLSPL  335



>gb|KDO81471.1| hypothetical protein CISIN_1g012205mg [Citrus sinensis]
Length=468

 Score =   327 bits (838),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 181/433 (42%), Positives = 242/433 (56%), Gaps = 45/433 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E+   QLFYYF++SEK+P  D                 L    GP+  N     G +P
Sbjct  49    VGESGDAQLFYYFVKSEKNPREDPLLLWLTGGPGCSAFSGLAYEIGPINFNVVEYNGSLP  108

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L LNPY+WTK A+I+FVD PVGTGYSY++T  A    D    Q    FL +WLLDHP  
Sbjct  109   TLHLNPYSWTKEASILFVDSPVGTGYSYAKTPLASQAGDFKQVQQVDQFLRKWLLDHPEL  168

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L+NP+Y+ GDSYSG+ VP +V+ I +  E  I+P +N++G I GN  T    + N+++ +
Sbjct  169   LSNPVYIGGDSYSGLVVPALVQQISNENEEDIKPLINLQGYILGNAATEPTVEENSKIPF  228

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
              + MG +S+ LY+S K  C G Y++  P N  C  D+Q  +K T +I    ILEP C   
Sbjct  229   AHGMGLISNELYESLKMGCGGEYVNVDPKNEVCLNDIQAFSKLTSEIEGAHILEPRCPFS  288

Query  783   --------NPEILLSLDGEN---------LPQQWCRDDNYLFAYSWANNKIVQKALGVRE  655
                          L+++ ++         LP   CR   YL +Y W N+  V+KAL +R 
Sbjct  289   SPKPRESSRKRRSLNVNEQSQEFLVPEPPLPTIGCRTYGYLLSYYWNNDYNVRKALRIRL  348

Query  654   GTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHV  475
             G+  EW RCN  L           Y   + ++  YH S + K  R LIYSGDHDM+VP +
Sbjct  349   GSKGEWQRCNFGL----------PYAREIHSSFSYHVSLSTKGYRSLIYSGDHDMMVPFL  398

Query  474   STEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPREC  295
              TE WI+SL   + DDWRPW +  QVAGYT  YS +   +TYATVKG GHTAPEY+P EC
Sbjct  399   GTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNR---MTYATVKGGGHTAPEYRPAEC  455

Query  294   LPMIQRWLSIYPL  256
               M QRW++  PL
Sbjct  456   YAMFQRWINHDPL  468



>gb|ERN17425.1| hypothetical protein AMTR_s00037p00227730 [Amborella trichopoda]
Length=521

 Score =   328 bits (842),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 179/423 (42%), Positives = 252/423 (60%), Gaps = 45/423 (11%)
 Frame = -3

Query  1437  QLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNPY  1294
             +LFYY I+SE +P  D                 L    GPL I      G +P L  NPY
Sbjct  63    RLFYYLIKSENNPSKDPLLLWLTGGPGCSGFSGLVIETGPLRIKVEEYNGTLPALRYNPY  122

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
             +WTKVAN+I+VD P+GTG+SYS++   Y T+D+ + +  + FL  W +++P FL+NPLY+
Sbjct  123   SWTKVANVIYVDSPIGTGFSYSKSPPDYATSDSKTVKDLHKFLTNWFIEYPEFLSNPLYI  182

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFL  934
             AGDSYSGITVP++   I +G++SG  P  N+KG + GNP+T    D+   V + + MG +
Sbjct  183   AGDSYSGITVPVLTSEIANGIDSGYRPVFNLKGYLVGNPVTDVEFDS-QVVPFAHGMGLI  241

Query  933   SDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-----NPEIL  769
             SD L+++TK SCNG Y  A P  S C  ++Q V +C  +IN P ILEP C      P + 
Sbjct  242   SDELFEATKISCNGKY--AFPKGSQCNLNMQAVHECLSRINTPHILEPLCPFASPRPRVE  299

Query  768   LSL----------DGENLPQQ--WCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCN  625
             +             G +L     +CR   Y+ ++ WANN+ VQ+ L V++GT+ EW RCN
Sbjct  300   IGTGLRRWLHENSSGIHLQSTPIFCRTYGYMLSHYWANNERVQEVLHVKKGTVNEWKRCN  359

Query  624   HTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLK  445
             + ++          +  +V ++V YH + T +    LIYSGDHD  VP + T+ WI SL+
Sbjct  360   YGIN----------FKADVASSVVYHYNLTMRGYSALIYSGDHDSSVPFIGTQAWIRSLE  409

Query  444   VGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSI  265
               + DDWR W V+ QV GYT KY+     LT+ATVKGAGHTAPEYKP+EC+ M++RW+S 
Sbjct  410   FPIIDDWRAWLVDGQVVGYTRKYTNN---LTFATVKGAGHTAPEYKPKECVAMLKRWISN  466

Query  264   YPL  256
              P 
Sbjct  467   EPF  469



>ref|XP_002446557.1| hypothetical protein SORBIDRAFT_06g018070 [Sorghum bicolor]
 gb|EES10885.1| hypothetical protein SORBIDRAFT_06g018070 [Sorghum bicolor]
Length=468

 Score =   327 bits (838),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 173/421 (41%), Positives = 236/421 (56%), Gaps = 41/421 (10%)
 Frame = -3

Query  1452  ENLKIQLFYYFIESEKSP-------------EtdplllwltggpgplTINYANSTGDIPD  1312
             E   +QLFYYF+ SEK P              +  +            ++     G  P 
Sbjct  59    EQHGVQLFYYFVRSEKEPGEDPLLLWLSGGPGSSGISGLAYEIGPLQFVDAHGYRGGFPT  118

Query  1311  LELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFL  1132
             L   P  WTKV+NIIFVD PVGTG+SY++T +   T DT + +    FL +WL DHP FL
Sbjct  119   LRYRPETWTKVSNIIFVDSPVGTGFSYAKTKEGLKTGDTKAVKQLLIFLRKWLHDHPRFL  178

Query  1131  NNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYG  952
             +NPLY+AGDSYSG  +P +   I+  ++ G +   N+KG I GNPLT    DT+ ++ Y 
Sbjct  179   SNPLYIAGDSYSGRIIPALTLEIHRSIKLGEKTFSNLKGYIAGNPLTDNQFDTDGKIPYF  238

Query  951   YRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC----  784
             + MG +SD LY++ +E C G Y  + P ++ C   +Q +  CT  IN   IL+PAC    
Sbjct  239   HGMGLVSDELYENAREKCGGKY--SAPLHAICAEAVQAIYNCTRDINQQYILDPACPDDD  296

Query  783   --NPEILLSLDGEN-------LPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLR  631
               +P+ +   DG +       L    C +  Y  +Y+W N++ VQ++LGVR+GT+ EW R
Sbjct  297   LWSPKTVAETDGMSRVMLESALLASKCTESLYSLSYTWGNDETVQESLGVRKGTIGEWKR  356

Query  630   CNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIES  451
              NH L           Y  ++++ V YH     K  R LIYSGDHD +VPHV T+ WI  
Sbjct  357   FNHEL----------LYNHDIQSAVGYHSRLATKGYRALIYSGDHDAVVPHVGTQAWIRY  406

Query  450   LKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
             L + + DDWRPW+V  QVAG+T  Y+     LTYATVKGAGH AP YKP EC  M+ RW+
Sbjct  407   LNLTIVDDWRPWYVGGQVAGFTRSYASG---LTYATVKGAGHIAPMYKPLECQKMLIRWI  463

Query  270   S  268
             S
Sbjct  464   S  464



>ref|XP_006653168.1| PREDICTED: serine carboxypeptidase-like 18-like, partial [Oryza 
brachyantha]
Length=444

 Score =   326 bits (835),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 173/417 (41%), Positives = 242/417 (58%), Gaps = 38/417 (9%)
 Frame = -3

Query  1437  QLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNPY  1294
             + FYYF+ESE+SPE D                 L    GPL  ++    G +P+L     
Sbjct  43    RFFYYFVESERSPEEDPLLLWLTGGPGCSAFSGLVYEIGPLYFDFHGYKGGLPNLLYKAD  102

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
             +WTK++N+IFVD P GTG+SY+ T+    ++DT      Y+F+ +WL DHP F +NPLY+
Sbjct  103   SWTKISNVIFVDSPPGTGFSYATTAQGLKSSDTTVVHQLYTFVQKWLDDHPQFSSNPLYI  162

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFL  934
             +GDSYSGI +P +   I  G+ES  +  LN+KG I GNPLT    D N+R  Y +RMG +
Sbjct  163   SGDSYSGIIIPTLAMEIAKGIESSDKRHLNLKGYIAGNPLTDPAHDANSRFPYLHRMGII  222

Query  933   SDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE---ILLS  763
              D LY+  +++C G+YI+  P N+ C   +Q +  C  ++N   ILEP C  +   IL +
Sbjct  223   DDELYEGARKNCKGDYIN--PSNTQCANSVQALWDCISEMNDVHILEPRCEEDRSPILNN  280

Query  762   LDG--------ENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGP  607
             +D         E+     CR+  Y+ +  WAN + V+++LGV +GT+  W RCN+ +   
Sbjct  281   IDSHDRRARLLESAVSSICRNATYVLSKIWANEETVKESLGVHKGTVATWKRCNYEVP--  338

Query  606   PEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDD  427
                     Y  ++ + V+YH S   K  R L+YSGDHD  +  V TE WI SL + + D+
Sbjct  339   --------YTMDIHSAVEYHLSLITKGYRGLVYSGDHDSKISFVGTEGWIRSLNLSITDN  390

Query  426   WRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             WRPW+   QV G+T  YS     LTYATVKGAGHTAPEY P+ECL M+ RWLS  PL
Sbjct  391   WRPWYFNSQVVGFTKTYSNN---LTYATVKGAGHTAPEYMPKECLAMVDRWLSGQPL  444



>ref|XP_006343160.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X1 [Solanum 
tuberosum]
Length=480

 Score =   327 bits (838),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 188/426 (44%), Positives = 245/426 (58%), Gaps = 42/426 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E  ++QLFYYF++SE  PETD              L  LT   GPL  +     G +P
Sbjct  64    VGEGEEVQLFYYFVKSESDPETDPLILWITGGPGCSSLEGLTMEFGPLHFDDMEYNGSLP  123

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L LN ++WTKVA+IIF+D PV TG+SY+ T  A  TN+  + +H Y FL +WL +H  F
Sbjct  124   TLSLNTHSWTKVASIIFLDLPVKTGFSYATTEKANQTNNLQTGEHAYQFLQKWLANHSKF  183

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L NP+Y+ GDSYSG TVP+VV+ I +G ++  +P +N+KG I GNPLT    + N R+ +
Sbjct  184   LQNPIYIGGDSYSGTTVPIVVQTISNGNDAKTKPMINLKGYILGNPLTINPDELNYRIPF  243

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
              + MG LSD+LYK+   +C G Y +  P+NSAC   +Q   K  E IN   ILEP C+  
Sbjct  244   AHGMGLLSDDLYKALVSNCGGEYQNIAPNNSACSNSVQTFNKLCEGINKEHILEPLCDSV  303

Query  774   ILLSLDG--------------EN---LPQQWCRDDNYLFAYSWANNKIVQKALGVREGTM  646
              L                   EN   LP   C +D    +  WAN+  VQ+AL VR+GT+
Sbjct  304   SLKRYRSVGRRTSLYAKLHKLENSMVLPGVKCLEDWRKLSVHWANDDSVQEALHVRKGTI  363

Query  645   TEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTE  466
               W RC   LS          + +NV N V YH + + K  R LIYSGDHD+ +P +STE
Sbjct  364   QNWTRCRGDLS----------FTYNVYNVVPYHANLSAKGYRSLIYSGDHDLTIPFISTE  413

Query  465   KWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPM  286
              WI SL   V DDWR W V  QVAGYT  YS     LT+ATVKG+GH AP +KP ECL M
Sbjct  414   AWIGSLNYSVTDDWRKWIVNGQVAGYTKSYSN---NLTFATVKGSGHVAPLWKPLECLTM  470

Query  285   IQRWLS  268
             + +W+S
Sbjct  471   LTKWIS  476



>ref|XP_006422775.1| hypothetical protein CICLE_v10028360mg [Citrus clementina]
 ref|XP_006422776.1| hypothetical protein CICLE_v10028360mg [Citrus clementina]
 gb|ESR36015.1| hypothetical protein CICLE_v10028360mg [Citrus clementina]
 gb|ESR36016.1| hypothetical protein CICLE_v10028360mg [Citrus clementina]
Length=330

 Score =   322 bits (824),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 159/339 (47%), Positives = 217/339 (64%), Gaps = 33/339 (10%)
 Frame = -3

Query  1203  NDTLSAQHTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLN  1024
             NDTLSA   Y FL +WL+ HP+FL NPLY+ GDSYSGI VP++V++I DG++ G  PR+N
Sbjct  2     NDTLSAAQNYYFLRKWLIAHPSFLANPLYIGGDSYSGIIVPMIVQHISDGIDVGHRPRMN  61

Query  1023  MKGCIEGNPLTHRFSDTNNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDL  844
             +KG + GNPLT    + N+   + Y    +S  +Y+S K +C G Y++  P N  C  DL
Sbjct  62    LKGYLLGNPLTDSTENQNSVPHFAYLNALISHEIYESAKRNCQGEYVNVDPSNGLCIADL  121

Query  843   QRVTKCTEKINMPQILEPACNPEILL----------------SLDGENLPQQ------WC  730
             + +T+C  ++N  QI EP+C    +                 SLD  + P Q      WC
Sbjct  122   ENITECISRVNHAQIYEPSCRGPFISPRRKLFNWNRSIIEEDSLDFLSSPTQPAASGTWC  181

Query  729   RDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDY  550
             R  NY+++Y WAN+K VQ+A+GV+EGT+  W+RCN +LS          Y  +V +++ Y
Sbjct  182   RFHNYVYSYIWANDKTVQRAIGVQEGTVKYWVRCNQSLS----------YTKDVSSSLAY  231

Query  549   HRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQ  370
             HR+   K  +VLIYSGD DM VP+V+TE WI+SL + +E  W+PWFVE QVAGY  +Y +
Sbjct  232   HRNLIKKGYQVLIYSGDVDMKVPYVATEAWIKSLNLTIETGWQPWFVEGQVAGYWYRYKE  291

Query  369   K-EYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
             K  Y LT+ATVKGAGHTAPEYKP+ECL MI RW + +PL
Sbjct  292   KNNYHLTFATVKGAGHTAPEYKPKECLGMIDRWFACHPL  330



>gb|KDO81474.1| hypothetical protein CISIN_1g012236mg [Citrus sinensis]
Length=467

 Score =   326 bits (836),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 181/433 (42%), Positives = 244/433 (56%), Gaps = 45/433 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E+   QLFYYF++SEK+P+ D                 L    GP+  N     G +P
Sbjct  48    VGESEDAQLFYYFVKSEKNPKEDPLLLWLTGGPGCSAFSALVYEIGPINFNILEYNGSLP  107

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L LNPY+WTK A+I+FVD PVGTG+SY  T  A  T D         FL +WL+DHP F
Sbjct  108   TLHLNPYSWTKEASILFVDSPVGTGFSYVRTPLASQTGDFKQVHQVDQFLRKWLMDHPEF  167

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L+NP YV GDSYSGITVP +V+ I +  E GI+P +N++G I GNP T +  D N+++ +
Sbjct  168   LSNPFYVGGDSYSGITVPPLVQQISNENEEGIKPLINLQGYILGNPKTDKIVDKNSQIPF  227

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
              + MG +S+ LY+S K +C G+Y +  P N  C  D Q  ++    ++   ILEP C   
Sbjct  228   AHGMGLISNELYESLKITCGGDYANIDPSNVDCLNDNQAFSELISGLDQNHILEPRCPFF  287

Query  783   ----------------NPEILLSLDGE-NLPQQWCRDDNYLFAYSWANNKIVQKALGVRE  655
                             N +    LD E  LP   CR   Y+ + +W N+  V+KAL +R+
Sbjct  288   SPKPRDSNGKRRSLNDNEKSQEFLDPEPALPSIGCRSFGYMLSQNWENDYNVRKALQIRQ  347

Query  654   GTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHV  475
             G+  +W RCN+ L           Y   + ++  +H S + K  R LIYSGDHDM+VP +
Sbjct  348   GSKGKWQRCNYDL----------PYTQEIGSSFSFHVSLSTKGYRSLIYSGDHDMVVPFL  397

Query  474   STEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPREC  295
              TE WI+SL   + DDWRPW +  QVAGYT  YS +   +TYATVKG GH APEY+P EC
Sbjct  398   GTEAWIKSLNYSIIDDWRPWILHSQVAGYTRTYSNR---MTYATVKGGGHIAPEYRPAEC  454

Query  294   LPMIQRWLSIYPL  256
               M QRW++  PL
Sbjct  455   YAMFQRWINHDPL  467



>ref|XP_009764359.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
7 [Nicotiana sylvestris]
Length=461

 Score =   326 bits (835),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/374 (43%), Positives = 231/374 (62%), Gaps = 32/374 (9%)
 Frame = -3

Query  1326  GDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLD  1147
             G +P ++LNPY+WTKVA+IIF+D PVGTG+SY+ T  A  ++D  ++   Y FL +W LD
Sbjct  103   GSLPTMKLNPYSWTKVASIIFLDLPVGTGFSYARTPTALQSSDLQASDQAYEFLYKWFLD  162

Query  1146  HPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNN  967
             HP FL NPLYV GDSYSG+ VP++ + I    E GI+P ++++G + GNP T +  + N 
Sbjct  163   HPEFLKNPLYVGGDSYSGMVVPIITQIIATKNEMGIKPFVDLQGYLLGNPSTFK-GEKNY  221

Query  966   RVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPA  787
              + + Y MG +SD LY+S   +C G Y +  P N+ C  D+    +  ++IN P ILEP 
Sbjct  222   EIPFAYGMGLISDELYESLTRNCKGEYQNTDPSNTQCLQDVHTFQELLKRINNPHILEPK  281

Query  786   CN-----PEILLSL------------DGENLPQQWCRDDNYLFAYSWANNKIVQKALGVR  658
             C      P +L               + + LP   CR+D Y  +  WA++  V++AL +R
Sbjct  282   CQFASPKPHLLFGQRRSLNVKFHQLNNPQQLPALKCRNDWYKLSSHWADDGQVREALHIR  341

Query  657   EGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPH  478
             +GT+ +W+RC            S  Y   + +++ YH + + K  R LIYSGDHD +V  
Sbjct  342   KGTIGKWVRC-----------ASLQYQKTIMSSIPYHANLSAKGYRSLIYSGDHDKVVTF  390

Query  477   VSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRE  298
             +ST+ WI+SL   + DDWRPW V++QVAGYT  YS +   +T+ATVKGAGHTAPEYKPRE
Sbjct  391   LSTQAWIKSLNYSIVDDWRPWIVDNQVAGYTRSYSNR---MTFATVKGAGHTAPEYKPRE  447

Query  297   CLPMIQRWLSIYPL  256
             CL M++R +S  PL
Sbjct  448   CLAMLKRLMSYKPL  461



>ref|XP_010106919.1| Serine carboxypeptidase-like 18 [Morus notabilis]
 gb|EXC12635.1| Serine carboxypeptidase-like 18 [Morus notabilis]
Length=468

 Score =   325 bits (833),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 177/420 (42%), Positives = 241/420 (57%), Gaps = 41/420 (10%)
 Frame = -3

Query  1437  QLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNPY  1294
             Q FYYF+ESE SP  D             +L  LT   GPL  N     G +P L LN  
Sbjct  64    QFFYYFVESEGSPREDPLMLWFIGGPGCSVLSALTVEIGPLRFNIVEYNGSLPTLALNTL  123

Query  1293  AWTKVANIIFVDQPVGTGYSYSETS-DAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             +WTK A+IIF+D PVGTG+SYS++  + Y T+D L A  +  FL +WLL HP F++NPLY
Sbjct  124   SWTKAASIIFIDGPVGTGFSYSKSRREGYQTDDILFADQSLVFLKKWLLAHPKFISNPLY  183

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             + GDSY+GI VP+V   +   +E+   P+ N +G + GN LT    D N+RV++ +RM  
Sbjct  184   IGGDSYAGIIVPVVAEEVVKSIEANNAPKFNFQGYLVGNGLTDVNIDLNSRVLFAHRMAL  243

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---------  784
             +SD LY+S K +C G Y      N  C  DL  ++ CTEKIN+  ILEP C         
Sbjct  244   ISDELYESAKNNCKGQYHGNHDDNKLCGDDLNAISLCTEKINIQHILEPLCSSIFTLNGK  303

Query  783   ----NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTL  616
                 N + LL       P   CR  + +  + WAN++ VQ+AL VREGT   W+RC   L
Sbjct  304   VGFTNRKSLLEKSLPGFPDLGCRSYDTVLIHFWANDERVQQALHVREGTKKTWIRCPKNL  363

Query  615   SGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGV  436
                        Y   + + V YH+   ++  R LIYSGDHDM++P++ ++ WIESL + +
Sbjct  364   P----------YKEILPSVVSYHQRLNSRGYRALIYSGDHDMMIPYIGSQAWIESLNIPI  413

Query  435   EDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
                WRPW V+ Q+AGY  +YS     +T+AT  GAGHTAPEY+P+EC  M +RW+S  PL
Sbjct  414   VSQWRPWLVDHQIAGYVTEYSNG---ITFAT--GAGHTAPEYRPKECFAMFKRWISHEPL  468



>ref|XP_006472322.1| PREDICTED: serine carboxypeptidase-like 18-like [Citrus sinensis]
Length=468

 Score =   325 bits (833),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 180/433 (42%), Positives = 243/433 (56%), Gaps = 45/433 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtdpl----------llwltggpgplTINY--ANSTGDIP  1315
             V E+   QLFY+F++SEK+P  DPL            +         IN+      G +P
Sbjct  49    VGESGDAQLFYFFVKSEKNPREDPLLLWLTGGPGCSAFSGLAYEIGPINFKVVEYNGSLP  108

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L LNPY+WTK A+I+FVD PVGTGYSY++T  A    D    Q    FL +WLLDHP  
Sbjct  109   TLHLNPYSWTKEASILFVDSPVGTGYSYAKTPLASQAGDFKQVQQVDQFLRKWLLDHPEL  168

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L+NP+Y+ GDSYSG+ VP +V+ I +  E  I+P +N++G I GN  T    + N+++ +
Sbjct  169   LSNPVYIGGDSYSGLVVPALVQQISNENEEDIKPLINLQGYILGNAATEPTVEENSKIPF  228

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
              + MG +S+ LY+S K  C G Y++  P N  C  D+Q  +K T +I    ILEP C   
Sbjct  229   AHGMGLISNELYESLKMGCGGEYVNVDPKNEVCLNDIQAFSKLTSEIEGAHILEPRCPFS  288

Query  783   --------NPEILLSLDGEN---------LPQQWCRDDNYLFAYSWANNKIVQKALGVRE  655
                          L+++ ++         LP   CR   YL +Y W N+  V+KAL +R 
Sbjct  289   SPKPRESSRKRRSLNVNEQSQEFLVPEPPLPTIGCRTYGYLLSYYWNNDYNVRKALRIRL  348

Query  654   GTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHV  475
             G+  EW RCN  L           Y   + ++  YH S + K  R LIYSGDHDM+VP +
Sbjct  349   GSKGEWQRCNFGL----------PYAREIHSSFSYHVSLSTKGYRSLIYSGDHDMMVPFL  398

Query  474   STEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPREC  295
              TE WI+SL   + DDWRPW +  QVAGYT  YS +   +TYATVKG GHTAPEY+P EC
Sbjct  399   GTEAWIKSLNYSIVDDWRPWILHSQVAGYTRTYSNR---MTYATVKGGGHTAPEYRPAEC  455

Query  294   LPMIQRWLSIYPL  256
               M QRW++  PL
Sbjct  456   YAMFQRWINHDPL  468



>gb|KCW63573.1| hypothetical protein EUGRSUZ_G01198 [Eucalyptus grandis]
Length=441

 Score =   324 bits (831),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 172/384 (45%), Positives = 234/384 (61%), Gaps = 41/384 (11%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             +QLFYYF+ESE+SP  D              L  L    GP T NY  ST   P L+LN 
Sbjct  55    VQLFYYFVESERSPRDDPLVLWLTGGPGCSALSGLIYEIGPFTFNYEKSTRFRPSLKLND  114

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTKVANIIF+DQPVGTG+SY+   ++YN ND +S   +Y FL +WL  HP FL+NPLY
Sbjct  115   YSWTKVANIIFLDQPVGTGFSYANNWESYNINDNISVAESYEFLRKWLKLHPQFLSNPLY  174

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             +AGDSYSG+TVP V   +  G E+G+EP++N++G + GNPLT+  SD N+RV + +  G 
Sbjct  175   IAGDSYSGVTVPRVALEVDKGNEAGLEPKMNLEGYVLGNPLTNYDSDLNSRVPFAHLKGL  234

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---------  784
             + + LY+S K  CNG YI+    N+ C  DL+ V  C E I+   ILEP C         
Sbjct  235   IPNELYESAKTDCNGKYINVNESNADCVDDLKAVNLCVENIDTANILEPNCVTQSPKSTV  294

Query  783   ----NPEIL------LSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWL  634
                 +P ++      L L  E   + WCR+ NYL+ Y WA+ K+V+ AL +REGT+ +W+
Sbjct  295   SDRWDPTLINRDPSPLLLPTERASRVWCRNYNYLYIYIWASAKVVRDALHIREGTVEKWV  354

Query  633   RCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIE  454
             RCN TLS          Y  N    +D H+    +  RVLIYSGDHDM++P+V T+ WI+
Sbjct  355   RCNKTLS----------YTSNFLVVIDIHKELIKRGFRVLIYSGDHDMVIPYVGTQAWID  404

Query  453   SLKVGVEDDWRPWFVEDQVAGYTM  382
             +L + + +DW  WFV+ QVAG+ M
Sbjct  405   TLNLTISEDWHAWFVDGQVAGFGM  428



>ref|XP_010030620.1| PREDICTED: serine carboxypeptidase-like 1 [Eucalyptus grandis]
Length=558

 Score =   328 bits (840),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 175/383 (46%), Positives = 218/383 (57%), Gaps = 61/383 (16%)
 Frame = -3

Query  1347  INYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSF  1168
              NY NS+G+ P   LNPY+WTKVANIIF+DQPVG G+SYS T + Y + D  SA  TY F
Sbjct  218   FNYKNSSGNRPTFLLNPYSWTKVANIIFLDQPVGAGFSYSTTQEGYYSGDLRSAAETYQF  277

Query  1167  LVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTH  988
             L +   +                                E G  P LN+KG + GNPLT 
Sbjct  278   LRKVRCN--------------------------------EVGHLPPLNIKGYLLGNPLTD  305

Query  987   RFSDTNNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINM  808
                D N+RVV+ +R   +S+ +Y+S K +C G Y+   P N  C  DLQ V KC EKI  
Sbjct  306   VLYDLNSRVVFAHRKALISNEIYESAKNNCKGEYMHVDPENVDCGVDLQSVVKCIEKIFN  365

Query  807   PQILEPAC---NP--------EILLSLDGENL--------PQQWCRDDNYLFAYSWANNK  685
               ILEP C   NP          +L   G  +        P  WCR+ +YL+ Y WAN+K
Sbjct  366   AHILEPKCGTLNPTPNFLKWDRRILGDGGSEINPLALLESPGPWCRNYDYLYCYVWANDK  425

Query  684   IVQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYS  505
              VQKAL +REGT TEW+RCN           S +Y  +V  + DYH++ T K  R LIYS
Sbjct  426   TVQKALHIREGTKTEWIRCN----------ESSSYAHDVIKSTDYHQNLTEKKLRALIYS  475

Query  504   GDHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGH  325
             GDHDM+VP++ T  WIE+L + +  DW  WFV+ QVAGYT +Y    YELTYATVKGAGH
Sbjct  476   GDHDMVVPYIGTMAWIETLNLSLSTDWEAWFVDGQVAGYTQQYEHDNYELTYATVKGAGH  535

Query  324   TAPEYKPRECLPMIQRWLSIYPL  256
             TAPEYKP+E L MI RW + YPL
Sbjct  536   TAPEYKPKETLAMIYRWFAHYPL  558



>ref|XP_010936147.1| PREDICTED: serine carboxypeptidase-like 18 isoform X3 [Elaeis 
guineensis]
Length=370

 Score =   322 bits (824),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 168/369 (46%), Positives = 224/369 (61%), Gaps = 31/369 (8%)
 Frame = -3

Query  1347  INYANSTGDIPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSF  1168
              + A  T  +P L  NPY+WTKV +IIF+D PVGTG+SYS   ++Y T DT +A+  ++F
Sbjct  28    FDVAGYTEGLPTLVYNPYSWTKVCSIIFLDSPVGTGFSYSSVEESYETGDTKAARQVHTF  87

Query  1167  LVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTH  988
             L +WL+DH  FL+NPLY+ GDSYSGI VP+V + I  G + G E   N+KG + GNP+T 
Sbjct  88    LRKWLIDHLEFLSNPLYIGGDSYSGIVVPVVAQEIAKGAQDGDELLYNLKGYLVGNPVTD  147

Query  987   RFSDTNNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINM  808
                D    V Y + MG +SD LY+STK+SC G Y  A P N  C   LQ + KC E IN 
Sbjct  148   EKFDNGAFVPYAHGMGLISDELYESTKKSCGGEY--ASPTNEQCASHLQSINKCIEGINT  205

Query  807   PQILEPAC-----NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMT  643
             PQILEP C      P I+ +       ++  ++D   F    A+  +  +      GT+ 
Sbjct  206   PQILEPVCFFVSPKPSIVAAYS-----RRLLKEDIKEFPLLKADLPLECR------GTVQ  254

Query  642   EWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEK  463
             +W RCN+ L           Y  ++ +++ +H + T++  R L+YSGDHDMIVP V T+ 
Sbjct  255   QWQRCNYGLP----------YAHDIPSSLKFHLNLTSRGHRALVYSGDHDMIVPFVGTQA  304

Query  462   WIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMI  283
             WI SL   + DDWRPW    QVAG+T  YS     LT+ATVKGAGHTAPEY+P+ECL M+
Sbjct  305   WIRSLNFSIVDDWRPWSAYGQVAGFTRTYSNN---LTFATVKGAGHTAPEYRPKECLVML  361

Query  282   QRWLSIYPL  256
             QRWLS  PL
Sbjct  362   QRWLSGAPL  370



>ref|XP_006433653.1| hypothetical protein CICLE_v10001059mg [Citrus clementina]
 gb|ESR46893.1| hypothetical protein CICLE_v10001059mg [Citrus clementina]
Length=467

 Score =   324 bits (831),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 179/433 (41%), Positives = 244/433 (56%), Gaps = 45/433 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E+   QLFYYF++SEK+P+ D                 L    GP+  N     G +P
Sbjct  48    VGESEDAQLFYYFVKSEKNPKEDPLLLWLTGGPGCSAFSALVYEIGPINFNILEYNGSLP  107

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L LNPY+WTK A+I+FVD PVGTG+SY  T  A  T D         FL +WL+DHP F
Sbjct  108   TLHLNPYSWTKEASILFVDSPVGTGFSYVRTPLASQTGDFKQVHQVDQFLRKWLMDHPEF  167

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L+NP YV GDSYSGITVP +V+ I +  E GI+P +N++G I GNP T +  D N+++ +
Sbjct  168   LSNPFYVGGDSYSGITVPPLVQQISNENEEGIKPLINLQGYILGNPKTDKIVDKNSQIPF  227

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
              + MG +S+ LY+S K +C G+Y +  P N  C  D Q  ++    ++   ILEP C   
Sbjct  228   AHGMGLISNELYESLKITCGGDYANIDPSNVDCLNDNQAFSELISGLDQNHILEPRCPFF  287

Query  783   ----------------NPEILLSLDGE-NLPQQWCRDDNYLFAYSWANNKIVQKALGVRE  655
                             N +    LD E  LP   CR   Y+ + +W N+  V+KAL +R+
Sbjct  288   SPKPRDSNGKRRSLNDNEKSQEFLDPEPALPSIGCRSFGYMLSQNWENDYNVRKALQIRQ  347

Query  654   GTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHV  475
             G+  +W RCN+ L           Y   + ++  YH S + K  R LIYSGDHDM+VP +
Sbjct  348   GSKGKWQRCNYDL----------PYTEEIGSSFSYHVSLSTKGYRSLIYSGDHDMVVPFL  397

Query  474   STEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPREC  295
              TE WI++L   + DDWRPW +  QVAG+T  YS +   +TYA+VKG GH APEY+P EC
Sbjct  398   GTEAWIKTLNYSIIDDWRPWILHSQVAGFTRTYSNR---MTYASVKGGGHIAPEYRPAEC  454

Query  294   LPMIQRWLSIYPL  256
               M QRW++  PL
Sbjct  455   YAMFQRWINHDPL  467



>gb|KCW63574.1| hypothetical protein EUGRSUZ_G01198 [Eucalyptus grandis]
Length=436

 Score =   323 bits (828),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 171/382 (45%), Positives = 233/382 (61%), Gaps = 41/382 (11%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             +QLFYYF+ESE+SP  D              L  L    GP T NY  ST   P L+LN 
Sbjct  55    VQLFYYFVESERSPRDDPLVLWLTGGPGCSALSGLIYEIGPFTFNYEKSTRFRPSLKLND  114

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTKVANIIF+DQPVGTG+SY+   ++YN ND +S   +Y FL +WL  HP FL+NPLY
Sbjct  115   YSWTKVANIIFLDQPVGTGFSYANNWESYNINDNISVAESYEFLRKWLKLHPQFLSNPLY  174

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             +AGDSYSG+TVP V   +  G E+G+EP++N++G + GNPLT+  SD N+RV + +  G 
Sbjct  175   IAGDSYSGVTVPRVALEVDKGNEAGLEPKMNLEGYVLGNPLTNYDSDLNSRVPFAHLKGL  234

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---------  784
             + + LY+S K  CNG YI+    N+ C  DL+ V  C E I+   ILEP C         
Sbjct  235   IPNELYESAKTDCNGKYINVNESNADCVDDLKAVNLCVENIDTANILEPNCVTQSPKSTV  294

Query  783   ----NPEIL------LSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWL  634
                 +P ++      L L  E   + WCR+ NYL+ Y WA+ K+V+ AL +REGT+ +W+
Sbjct  295   SDRWDPTLINRDPSPLLLPTERASRVWCRNYNYLYIYIWASAKVVRDALHIREGTVEKWV  354

Query  633   RCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIE  454
             RCN TLS          Y  N    +D H+    +  RVLIYSGDHDM++P+V T+ WI+
Sbjct  355   RCNKTLS----------YTSNFLVVIDIHKELIKRGFRVLIYSGDHDMVIPYVGTQAWID  404

Query  453   SLKVGVEDDWRPWFVEDQVAGY  388
             +L + + +DW  WFV+ QVAG+
Sbjct  405   TLNLTISEDWHAWFVDGQVAGF  426



>ref|XP_010936152.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Elaeis 
guineensis]
Length=452

 Score =   323 bits (828),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 181/412 (44%), Positives = 239/412 (58%), Gaps = 45/412 (11%)
 Frame = -3

Query  1437  QLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNPY  1294
             QLFYYFI+SE  PE D                 L    GPL  + A  T  +P L  NPY
Sbjct  68    QLFYYFIKSESKPEEDPLMVWLTGGPGCSAFSGLVYEIGPLKFDVAGYTEGLPTLVYNPY  127

Query  1293  AWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLYV  1114
             +WTKV NIIF+D PVGTG+SYS    +Y T DT +AQ  ++FL +WL+DHP FL+NPLY+
Sbjct  128   SWTKVCNIIFLDSPVGTGFSYSSVEKSYETGDTKAAQQVHTFLRKWLIDHPEFLSNPLYI  187

Query  1113  AGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGFL  934
              GDSYSGI VP+V + I  G   G E   N+KG + GNP+T    D    V Y + MG +
Sbjct  188   GGDSYSGIVVPVVAQEIAKGDRDGDELLYNLKGYLVGNPVTDEKFDNGAFVPYAHGMGLI  247

Query  933   SDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-----NPEIL  769
             SD LY+STK+SC G Y  A P N  C   LQ + +C E IN  QILEP C      P I+
Sbjct  248   SDELYESTKKSCGGEY--ASPRNEQCANYLQSINECIEGINEGQILEPVCFFVSPKPHIV  305

Query  768   LSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVR-EGTMTEWLRCNHTLSGPPEAER  592
              +       ++  ++D   F+       +++  L +   GT+  W RCN+ L        
Sbjct  306   AAYS-----RRLLKEDIKEFS-------LLKSDLPLECRGTVQHWQRCNYGLP-------  346

Query  591   SETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDWRPWF  412
                Y  ++ +++ +H + T++  R L+YSGDHDM+VP + T+ WI SL   + DDWR W 
Sbjct  347   ---YAHDIPSSLKFHLNLTSRGYRALVYSGDHDMVVPFLGTQAWIRSLNFSIVDDWRSWS  403

Query  411   VEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL  256
              + QVAG+T  YS     LT+ATVKG GHTAPEY+P+ECL M+QRWLS  PL
Sbjct  404   ADGQVAGFTRTYSNN---LTFATVKGGGHTAPEYRPKECLVMLQRWLSGAPL  452



>sp|Q9C7Z9.2|SCP18_ARATH RecName: Full=Serine carboxypeptidase-like 18; Flags: Precursor 
[Arabidopsis thaliana]
Length=464

 Score =   323 bits (829),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 189/432 (44%), Positives = 252/432 (58%), Gaps = 48/432 (11%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E  K+QLFYYFI+SE +PE D              L  L    GPLT       G +P
Sbjct  50    VGEGEKVQLFYYFIKSENNPEEDPLIIWLTGGPACTALSALAFEIGPLTFKTEGYNGGLP  109

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L    Y+WTKVA+IIF+DQPVGTGYSYS T  +Y  +DT  A+ TY FL +WL+++P F
Sbjct  110   SLVSTSYSWTKVASIIFLDQPVGTGYSYSTTPLSYKPSDTGEAKQTYEFLQKWLVENPQF  169

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             ++NP+YV GDSY+GI VP +V+ I  G E G +P++N+KG I GNP T   SD N+++ Y
Sbjct  170   VSNPIYVGGDSYAGIVVPAIVQQISIGNEHGYKPQINLKGYILGNPSTDLDSDHNSKIPY  229

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
              +RMG +SD LY+S K +C GNY+   P N+ C   ++   KC  +IN   IL   C+  
Sbjct  230   AHRMGLISDELYESLKRTCQGNYVKVDPTNTKCLKLMEDYGKCVSRINEGLILIALCDLA  289

Query  774   ILLSLDGEN---------------LPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTE  640
                   GE+               LP   C    YL A  WAN++ V++ L V +G++ +
Sbjct  290   SPNPYSGEHGGRSYLQTLVQSDLSLPTPDCYMYRYLLASHWANDEDVRRELHVVKGSIGK  349

Query  639   WLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSC----RVLIYSGDHDMIVPHVS  472
             W+RCN  L           Y  ++K++V YHR   N S     R L+YS DHDM+VP++ 
Sbjct  350   WMRCNWDLP----------YEKDIKSSVPYHR---NNSIIGDYRSLVYSSDHDMMVPYIG  396

Query  471   TEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECL  292
             TE WI+SL   + DDWRPWFV +QV GYT  Y+     +T+AT+KG GHTA EYKP E  
Sbjct  397   TEAWIKSLNYSITDDWRPWFVNNQVIGYTRTYANN---MTFATIKGGGHTA-EYKPEESF  452

Query  291   PMIQRWLSIYPL  256
              M QRW+S  PL
Sbjct  453   MMFQRWISGRPL  464



>ref|XP_002510076.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF52263.1| serine carboxypeptidase, putative [Ricinus communis]
Length=453

 Score =   323 bits (827),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 179/426 (42%), Positives = 242/426 (57%), Gaps = 45/426 (11%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             +QLFYYF++S+ + + D              L  L    GPL        G +P L LNP
Sbjct  42    VQLFYYFVKSQGNAKEDPLLLWLTGGPGCSALSGLLYEIGPLHFKAVEYNGSLPTLILNP  101

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WT+VA+IIFVD PVGTG+SY+    A  + D    +    FL +WL+DH  FL+NP+Y
Sbjct  102   YSWTQVASIIFVDSPVGTGFSYARNQLASLSGDFRQIEQLDQFLRKWLIDHTEFLSNPVY  161

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             V GDSYSG+ +P +V+ I +G E G +P +N+KG + GN  T    D N++V + + MG 
Sbjct  162   VGGDSYSGMPLPPLVQRILNGNEEGSKPSVNLKGYLLGNAATDYTFDGNSQVPFAHGMGL  221

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPEI-----  772
             +SD L++S + +C G Y+   P N+ C   +Q   K T  +N  QILEP CN        
Sbjct  222   ISDELFESLRRTCGGEYVIIDPSNADCMKHMQEFNKVTSGLNTAQILEPLCNFAFPKPIE  281

Query  771   --------LLSLDGE------NLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWL  634
                     L +  G+      ++P   CR   YL +  W N+K V+KAL +REG++ EW 
Sbjct  282   ISFRRRRSLYAKSGDFADPDPSIPIG-CRTYAYLLSKYWVNDKSVRKALHIREGSIGEWT  340

Query  633   RCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIE  454
             RCN+ L          TY + V + + YH     K  R LIYSGDHDM+VP V T+ WI 
Sbjct  341   RCNYGL----------TYTYEVFSAIKYHLYLGKKGYRSLIYSGDHDMLVPFVGTQAWIR  390

Query  453   SLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRW  274
             SL   + DDW+PW +E QVAGYT  YS    ++TYATVKG GHTAPEYK  EC  M +RW
Sbjct  391   SLNFSIVDDWQPWHIEGQVAGYTRSYSN---QMTYATVKGGGHTAPEYKQAECFAMFKRW  447

Query  273   LSIYPL  256
             +S  PL
Sbjct  448   ISREPL  453



>gb|ACN30985.1| unknown [Zea mays]
Length=471

 Score =   322 bits (826),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 183/425 (43%), Positives = 246/425 (58%), Gaps = 41/425 (10%)
 Frame = -3

Query  1452  ENLKIQLFYYFIESEKSPEtdplllwltggpgplTINY-----------ANSTGDIPDLE  1306
             E   +QLFYYF+ SE  P  DPLLLWL+GGPG   I+            A   G  P L 
Sbjct  62    EQQGVQLFYYFVRSESDPYEDPLLLWLSGGPGCSGISGLAYEIGPLQFDAQGQGGFPTLL  121

Query  1305  LNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNN  1126
               P  WTKV+NIIFVD PVGTG+SY+++ +   T DT   +    FL +WL DHP F+ N
Sbjct  122   YRPETWTKVSNIIFVDSPVGTGFSYAKSEEGLETGDTKQVKQLVIFLRKWLQDHPRFVMN  181

Query  1125  PLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYR  946
             PLY+AGDSYSG+ +P +   I   +E G +    +KG I GNPLT    DT++++ Y + 
Sbjct  182   PLYIAGDSYSGLIIPTLALEIDRSIELGEKIFSGLKGYIAGNPLTGGQFDTDSQIPYFHA  241

Query  945   MGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC------  784
             MG +SD LYK+ +E+C G Y  + P N+ C   +Q +  CT  IN   IL+PAC      
Sbjct  242   MGLVSDELYKNARENCGGKY--SAPLNAVCAEAVQAINNCTRDINKQYILDPACPDDDLL  299

Query  783   NPEILLSLDGEN---------LPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLR  631
             +P+ +   DG +         L    C +  Y+ +Y+W N+  VQ++LG+R+GT+  W R
Sbjct  300   SPKTVAETDGTSRLMLESADFLLDSKCAEALYILSYAWGNDDTVQESLGIRKGTIGAWKR  359

Query  630   CNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIES  451
              +H L           Y +++++ VDYH     K  R LIYSGDHD +VPHV T+ WI  
Sbjct  360   YSHALP----------YNYDIQSAVDYHSGLATKGYRALIYSGDHDAVVPHVGTQAWIRY  409

Query  450   LKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
             L + + DDWRPW+V DQVAG+T  Y+     LT+ATVKGAGH AP YK  EC  M   W+
Sbjct  410   LNLTIVDDWRPWYVGDQVAGFTRSYASG---LTFATVKGAGHVAPLYKTLECQKMFITWI  466

Query  270   SIYPL  256
             S  PL
Sbjct  467   SGNPL  471



>ref|XP_010320198.1| PREDICTED: serine carboxypeptidase-like 17 [Solanum lycopersicum]
Length=476

 Score =   322 bits (826),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 178/432 (41%), Positives = 243/432 (56%), Gaps = 57/432 (13%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPE---------------tdplllwltggpgplTINY-----ANSTGD  1321
             +QLFYYF++SE +P+                   LL+  G      + Y     A   G 
Sbjct  65    VQLFYYFVKSESNPKSDPLILWLTGGPGCSALSGLLFEIGPITFEPVEYGDFKPAEYNGS  124

Query  1320  IPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHP  1141
              P L LNP+ WTKVA+ IF+D PV TG+SY+ TS A  ++D L++ H Y FL +W  DHP
Sbjct  125   FPSLVLNPHTWTKVASFIFLDLPVCTGFSYARTSVARQSDDLLASDHAYQFLHKWFNDHP  184

Query  1140  TFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRV  961
              F  NP YVAGDSY+GI +P++ + I +G E G+EP +++KG + GNP T    + N ++
Sbjct  185   EFFRNPFYVAGDSYAGIGIPIISQLIANGNEKGLEPFIDLKGYLLGNPATFH-GEYNYKI  243

Query  960   VYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN  781
              Y + +G +SD L++S K++C G Y D  P N+ C  D+Q   +    I    ILEP C 
Sbjct  244   SYAHGVGLISDELFESLKQNCKGEYFDIHPSNTKCWNDMQTYDQMLGGITNAHILEPKCE  303

Query  780   PEILLSLDGENLPQQW-----------------CRDDNYLFAYSWANNKIVQKALGVREG  652
                     G   PQ+W                 CR D    +Y WA++  V++AL VR G
Sbjct  304   -------FGSPRPQKWIGQRRSLDEMLYLGRLRCRFDWEKMSYHWADDDKVREALHVRRG  356

Query  651   TMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVS  472
             ++ +W RC         A  +  Y   + N++ YH + + K  R LIYSGDHD ++P+ S
Sbjct  357   SIGKWKRC---------AGDALPYQKIIGNSIPYHANLSVKGYRSLIYSGDHDTMIPYTS  407

Query  471   TEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECL  292
             TE WI SL   + DDWRPW V+ QVAGYT  YS K   +T+ATVKG GHTAPEYKP ECL
Sbjct  408   TEAWIRSLNYSIVDDWRPWIVDGQVAGYTRTYSNK---MTFATVKGGGHTAPEYKPVECL  464

Query  291   PMIQRWLSIYPL  256
              M++RWLS  PL
Sbjct  465   AMLRRWLSYQPL  476



>ref|XP_008661499.1| PREDICTED: uncharacterized protein LOC100216996 isoform X2 [Zea 
mays]
Length=432

 Score =   321 bits (822),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 182/425 (43%), Positives = 247/425 (58%), Gaps = 41/425 (10%)
 Frame = -3

Query  1452  ENLKIQLFYYFIESEKSPEtdplllwltggpgplTINY-----------ANSTGDIPDLE  1306
             E   +QLFYYF+ SE+ P  DPLLLWL+GGPG   I+            A   G+ P L 
Sbjct  23    EQQGVQLFYYFVRSERDPYEDPLLLWLSGGPGCSGISGLAYEIGPLKFDARGQGEFPTLL  82

Query  1305  LNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNN  1126
               P  WTKV+NIIFVD PVGTG+SY+++ +   T DT   +    FL +WL DHP F+ N
Sbjct  83    YRPETWTKVSNIIFVDSPVGTGFSYAKSEEGLETGDTKQVKQLVIFLRKWLQDHPRFVMN  142

Query  1125  PLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYR  946
             PLY+AGDSYSG+ +P +   I   +E G +    +KG I GNPLT    DT++++ Y + 
Sbjct  143   PLYIAGDSYSGLIIPTLALEIDRSIELGEKIFSGLKGYIAGNPLTGGQFDTDSQIPYFHA  202

Query  945   MGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC------  784
             MG +SD LYK+ +E+C G Y  + P N+ C   +Q +  CT  IN   IL+PAC      
Sbjct  203   MGLVSDELYKNARENCGGKY--SAPLNAVCAEAVQAINNCTRDINKQYILDPACPDDDLL  260

Query  783   NPEILLSLDGEN---------LPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLR  631
             +P+ +   DG +         L    C +  Y+ +Y+W N+  VQ++LG+R+GT+  W R
Sbjct  261   SPKTVAETDGTSRLMLESADFLLGSKCAEALYILSYAWGNDDTVQESLGIRKGTIGAWKR  320

Query  630   CNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIES  451
              +H L           Y +++++ VDYH     K  R LIYSGDHD +VPHV T+ WI  
Sbjct  321   YSHALP----------YNYDIQSVVDYHSRLATKGYRALIYSGDHDAVVPHVGTQAWIRY  370

Query  450   LKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
             L + + DDWRPW+V  QVAG+T  Y+     LT+ATVKGAGH AP YK  EC  M   W+
Sbjct  371   LNLTIVDDWRPWYVGGQVAGFTRSYASG---LTFATVKGAGHVAPLYKTLECQKMFITWI  427

Query  270   SIYPL  256
             S  PL
Sbjct  428   SGNPL  432



>ref|XP_011006024.1| PREDICTED: serine carboxypeptidase-like 3 isoform X2 [Populus 
euphratica]
Length=463

 Score =   322 bits (824),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 177/421 (42%), Positives = 235/421 (56%), Gaps = 45/421 (11%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             +QLFYYFI+S+++P+ D                 L    GP++       G +P L LNP
Sbjct  52    VQLFYYFIKSQRNPKDDPLLLWLTGGPGCSAFCGLVFEIGPISFEVKEYNGSLPTLVLNP  111

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WT+V++IIF+D P GTG+SY+ T  A   +D     H   FL +WL+DH  FL NP+Y
Sbjct  112   YSWTQVSSIIFLDLPAGTGFSYARTPLALQRSDFKQVSHAEQFLRKWLMDHQEFLANPIY  171

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             +AGDSYSG  VP +V+NI +G   GIEP LN+KG I GNP+T    D N+R+ + + MG 
Sbjct  172   IAGDSYSGKIVPAIVQNISNGNNDGIEPLLNVKGYILGNPITDPTFDFNSRIPFAHGMGL  231

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---------  784
             +SD LY+S K+SC G Y    P N+ C  +++   KC   I    ILE  C         
Sbjct  232   ISDELYESLKKSCAGEYQTIKPSNAECLKNVEAFDKCISDIEDAHILERKCPSDAPRLIE  291

Query  783   ----------NPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWL  634
                       NP  LL     +LP   CR   ++ A  WAN+  V+KAL VREG++ EW 
Sbjct  292   TLGKRRYLRENPRELLHFK-PDLPTIGCRAYGHVLAAYWANDDNVRKALHVREGSIEEWK  350

Query  633   RCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIE  454
             RCN+ L           Y + +K+++ YH     K  R LIYSGDHDM  P + T+ WI 
Sbjct  351   RCNYKLP----------YTYEIKSSIKYHIDLGIKGYRRLIYSGDHDMEAPFLGTQAWIR  400

Query  453   SLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRW  274
              L   V DDW+PW  + QVAGYT  YS    +L +ATVKG GHTAP Y+P EC  M  RW
Sbjct  401   YLNYSVVDDWQPWHYQGQVAGYTRTYSS---QLAFATVKGGGHTAPAYRPAECFAMFGRW  457

Query  273   L  271
             +
Sbjct  458   I  458



>ref|XP_007199818.1| hypothetical protein PRUPE_ppa005264mg [Prunus persica]
 gb|EMJ01017.1| hypothetical protein PRUPE_ppa005264mg [Prunus persica]
Length=451

 Score =   321 bits (823),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 170/382 (45%), Positives = 233/382 (61%), Gaps = 42/382 (11%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEt-------------dplllwltggpgplTINYANSTGDIPDLELN  1300
             +QLFYYF ESE SPE                    +    GPL+ +YA+S G+ P L+LN
Sbjct  50    VQLFYYFFESEGSPEYDPLVLWLNGGPGCSAFSGLVYENLGPLSFDYAHSIGNKPKLKLN  109

Query  1299  PYAWTKVANIIFVDQPVGTGYSYSETSDAY-NTNDTLSAQHTYSFLVQWLLDHPTFLNNP  1123
             PY+WTKVANIIF+D PVGTG+SY++  + Y N NDTLSA  TY FL +WL+DHP F NNP
Sbjct  110   PYSWTKVANIIFLDAPVGTGFSYAKNWEGYSNLNDTLSAAQTYEFLRKWLMDHPKFYNNP  169

Query  1122  LYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRM  943
             LY+AGDSYSGI VP+VV+ I DG +    P +N+KG + GNP+T +  D N +V++ Y  
Sbjct  170   LYIAGDSYSGIIVPMVVQEISDGNQDEHVPPMNLKGYVLGNPVTDKKKDYNYKVLFAYLK  229

Query  942   GFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNP-----  778
               +SD LY+S K++C G YI+   +N+ C  DL+   +C E I+   ILEP+C       
Sbjct  230   ALISDELYQSMKKNCKGEYINVDLNNTLCVEDLELYNECVEGIHSAHILEPSCTTIESPK  289

Query  777   ---------------EILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMT  643
                             + L L    L + WCR  NYL++  W N+K VQ AL ++EG++T
Sbjct  290   SAQSKWNGNYFSNKDSVNLLLSFLQLRRPWCRSYNYLYSSIWENDKTVQDALHIQEGSIT  349

Query  642   EWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEK  463
             EW RCN TL         E Y+ +V +++ YH +   +  RVL+YSGDHDM +P+V+T  
Sbjct  350   EWERCNKTL--------QELYISDVSSSLVYHENLIKQGYRVLVYSGDHDMDIPYVATMA  401

Query  462   WIESLKVGVEDDWRPWFVEDQV  397
             WIESL + V+  W+PWFV+ Q+
Sbjct  402   WIESLNLTVDSPWKPWFVDGQI  423



>ref|XP_006472316.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X2 [Citrus 
sinensis]
Length=467

 Score =   322 bits (824),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 179/433 (41%), Positives = 242/433 (56%), Gaps = 45/433 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E+   QLFYYF++SEK+P+ D                 L    GP+  N     G +P
Sbjct  48    VGESEDAQLFYYFVKSEKNPKEDPLLLWLTGGPGCSAFSALVYEIGPINFNILEYNGSLP  107

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L LNPY+WTK A+I+FVD PVGTG+SY  T  A  T D         FL +WL+DHP F
Sbjct  108   TLHLNPYSWTKEASILFVDSPVGTGFSYVRTPLASQTGDFKQVHQVDQFLRKWLMDHPEF  167

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L+N  YV GDSYSGITVP + + I +  E GI+P +N++G I GNP T +  D N+++ +
Sbjct  168   LSNTFYVGGDSYSGITVPPLAQQISNENEEGIKPLINLQGYILGNPKTDKIVDKNSQIPF  227

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC---  784
              + MG +S+ LY+S K +C G+Y +  P N  C  D Q  ++    ++   ILEP C   
Sbjct  228   AHGMGLISNELYESLKITCGGDYANIDPSNVDCLNDNQAFSELISGLDQNHILEPHCPFF  287

Query  783   ----------------NPEILLSLDGE-NLPQQWCRDDNYLFAYSWANNKIVQKALGVRE  655
                             N +    LD E  LP   CR   Y+ + +W N+  V+KAL +R+
Sbjct  288   SPKPRDSNGKRRSLNDNEKSQEFLDPEPALPSIGCRSFGYMLSQNWENDYNVRKALQIRQ  347

Query  654   GTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHV  475
             G+  +W RCN+ L           Y   + ++  +H S + K  R LIYSGDHDM+VP +
Sbjct  348   GSKGKWQRCNYDL----------PYTQEIGSSFSFHVSLSTKGYRSLIYSGDHDMVVPFL  397

Query  474   STEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPREC  295
              TE WI+SL   + DDWRPW +  QVAGYT  YS +   +TYATVKG GH APEY+P EC
Sbjct  398   GTEAWIKSLNYSIIDDWRPWILHSQVAGYTRTYSNR---MTYATVKGGGHIAPEYRPAEC  454

Query  294   LPMIQRWLSIYPL  256
               M QRW++  PL
Sbjct  455   YAMFQRWINHDPL  467



>ref|XP_004299781.1| PREDICTED: serine carboxypeptidase-like 13 [Fragaria vesca subsp. 
vesca]
Length=474

 Score =   321 bits (823),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 178/432 (41%), Positives = 236/432 (55%), Gaps = 41/432 (9%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V ++ ++QLFYYF+ES+++P  D               +      GPL   Y++  G +P
Sbjct  53    VGDDEEVQLFYYFVESQRTPAQDPLLLWIPAGPGCSGQIVFFFESGPLEFKYSDYNGSLP  112

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L  NPY WTK  N+++VD PVG GYSYS T   Y  +D       Y FL +WL  HPT+
Sbjct  113   TLHDNPYTWTKSLNLLYVDAPVGAGYSYSTTQSGYVLDDYKHVAQLYEFLQKWLDAHPTY  172

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L N LY+ GDSYSG+ VP++ + I +G E+G  P +N +G + GNP+T    D N ++ Y
Sbjct  173   LKNILYIGGDSYSGMPVPMLAQTIINGNENGSIPMMNFRGYVIGNPVTDTAVDGNAQIPY  232

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN--  781
              +R+  +SD LYKS K SCNG Y+     N AC  DL      T  IN   +LEP C+  
Sbjct  233   AHRLSLISDQLYKSLKTSCNGEYVIVNSSNHACIADLDAFDALTSDINTLHVLEPLCSNG  292

Query  780   ----PEILLS------------LDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGT  649
                  E++L+                N P  WCR    +    WAN+K VQ ALGVR GT
Sbjct  293   LPTQKEMVLTRRYLKETATGLQRSRPNGPALWCRSYRSMLNTIWANDKGVQDALGVRRGT  352

Query  648   MTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKS-CRVLIYSGDHDMIVPHVS  472
                W  CN TL           Y  +V + V YH+S +  +  RVLIYSGDHDM VPH+ 
Sbjct  353   KRLWQHCNTTLD----------YTEDVTSVVIYHQSLSKMADLRVLIYSGDHDMQVPHIG  402

Query  471   TEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECL  292
             T++WI +L +  ++ WR W VE Q AGYT K       LTYATVKG GH A E K +EC 
Sbjct  403   TQRWISTLNLTEDESWRTWSVEGQTAGYTKKLINGYMTLTYATVKGGGHIAAETKVKECA  462

Query  291   PMIQRWLSIYPL  256
              M+ RW++ YPL
Sbjct  463   AMVDRWMAYYPL  474



>ref|XP_008661498.1| PREDICTED: uncharacterized protein LOC100216996 isoform X1 [Zea 
mays]
Length=469

 Score =   321 bits (823),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 182/425 (43%), Positives = 247/425 (58%), Gaps = 41/425 (10%)
 Frame = -3

Query  1452  ENLKIQLFYYFIESEKSPEtdplllwltggpgplTINY-----------ANSTGDIPDLE  1306
             E   +QLFYYF+ SE+ P  DPLLLWL+GGPG   I+            A   G+ P L 
Sbjct  60    EQQGVQLFYYFVRSERDPYEDPLLLWLSGGPGCSGISGLAYEIGPLKFDARGQGEFPTLL  119

Query  1305  LNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNN  1126
               P  WTKV+NIIFVD PVGTG+SY+++ +   T DT   +    FL +WL DHP F+ N
Sbjct  120   YRPETWTKVSNIIFVDSPVGTGFSYAKSEEGLETGDTKQVKQLVIFLRKWLQDHPRFVMN  179

Query  1125  PLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYR  946
             PLY+AGDSYSG+ +P +   I   +E G +    +KG I GNPLT    DT++++ Y + 
Sbjct  180   PLYIAGDSYSGLIIPTLALEIDRSIELGEKIFSGLKGYIAGNPLTGGQFDTDSQIPYFHA  239

Query  945   MGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC------  784
             MG +SD LYK+ +E+C G Y  + P N+ C   +Q +  CT  IN   IL+PAC      
Sbjct  240   MGLVSDELYKNARENCGGKY--SAPLNAVCAEAVQAINNCTRDINKQYILDPACPDDDLL  297

Query  783   NPEILLSLDGEN---------LPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLR  631
             +P+ +   DG +         L    C +  Y+ +Y+W N+  VQ++LG+R+GT+  W R
Sbjct  298   SPKTVAETDGTSRLMLESADFLLGSKCAEALYILSYAWGNDDTVQESLGIRKGTIGAWKR  357

Query  630   CNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIES  451
              +H L           Y +++++ VDYH     K  R LIYSGDHD +VPHV T+ WI  
Sbjct  358   YSHALP----------YNYDIQSVVDYHSRLATKGYRALIYSGDHDAVVPHVGTQAWIRY  407

Query  450   LKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWL  271
             L + + DDWRPW+V  QVAG+T  Y+     LT+ATVKGAGH AP YK  EC  M   W+
Sbjct  408   LNLTIVDDWRPWYVGGQVAGFTRSYASG---LTFATVKGAGHVAPLYKTLECQKMFITWI  464

Query  270   SIYPL  256
             S  PL
Sbjct  465   SGNPL  469



>ref|XP_002265154.3| PREDICTED: serine carboxypeptidase-like 13 [Vitis vinifera]
Length=459

 Score =   321 bits (822),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 175/422 (41%), Positives = 250/422 (59%), Gaps = 32/422 (8%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V E+ ++QLFYYF+ES+ SP  D              L  L    GP+ +NY    G +P
Sbjct  49    VGESEEVQLFYYFVESQSSPSQDPLMLYIAGGPGCSSLSSLFYENGPIYLNYQYYDGGVP  108

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              L L+  AWT+  N+I++D PVGTG+SYS TS  Y  +D  +A  TY FL +WL+ HP F
Sbjct  109   SLNLSADAWTQGLNMIYIDAPVGTGFSYSNTSQGYYVDDAENAAQTYEFLRKWLVQHPDF  168

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             L N LY+AG SYSGI VP++V  I +G   G+ P +N+KG + G+P+T  F D N+++ +
Sbjct  169   LGNELYIAGVSYSGIPVPMIVNEIIEGNILGLSPGMNIKGYVLGSPVTDSFIDDNSKIPF  228

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
              + +  +S  LY S K +C GNY++    + AC  D++ + +    IN+ Q+L P C P 
Sbjct  229   AHGLSLISHELYNSAKTNCEGNYVNV--SSEACALDIEAIDELLRYINVAQVLHPYCYPF  286

Query  774   ILLSLDGENLPQQWCRDDNYLFA--YS------WANNKIVQKALGVREGTMTEWLRCNHT  619
              +   + +   +    + NY     YS      WAN++ V+ AL VR GT   W  CN +
Sbjct  287   TVKPSERQGNRRSSLEEANYRSCDLYSSVPISIWANDESVRAALNVRNGTKGNWQPCNSS  346

Query  618   LSGPPEAERSETYVFNVKNTVDYHRSFTN-KSCRVLIYSGDHDMIVPHVSTEKWIESLKV  442
             L+G         Y  +V  T+ YHR+F++  S R LIYSGDHDM +P++ T++WI SL +
Sbjct  347   LTG---------YTEDVTTTLAYHRNFSHTSSLRALIYSGDHDMSIPNIGTQEWIRSLNM  397

Query  441   GVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIY  262
              + D WR W V+ QVAGYT +Y+  ++ LTYATVKGAGH    YK R+C  MI+RWL+ Y
Sbjct  398   TLADTWRGWMVDAQVAGYTKRYTYGDFSLTYATVKGAGHIPATYKTRQCYEMIERWLAHY  457

Query  261   PL  256
             PL
Sbjct  458   PL  459



>ref|XP_010065814.1| PREDICTED: serine carboxypeptidase-like 18 [Eucalyptus grandis]
 gb|KCW63480.1| hypothetical protein EUGRSUZ_G01113 [Eucalyptus grandis]
Length=482

 Score =   322 bits (824),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 170/433 (39%), Positives = 248/433 (57%), Gaps = 50/433 (12%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             ++ FYYF++S  +P  D              L       GPL  N  + TG +P L   P
Sbjct  62    VEFFYYFVQSTGNPGVDPLLLYMNGGPGCSGLNAFLFQLGPLKFNITDYTGGLPTLIYEP  121

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
              AWTK ANIIF+D PVG G+SY+ T+ AY++ DT +     +FL  WL +HP+F  NP++
Sbjct  122   DAWTKTANIIFIDAPVGAGFSYATTASAYDSTDTSNTAQMQAFLRNWLAEHPSFQTNPVF  181

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             V  DSY+G+  P++   I  G E+G EP +++KG I   P T    +TN+++ + +R+  
Sbjct  182   VGSDSYAGVYTPMLATAILQGNEAGFEPYVHLKGMILSCPHTFTDLETNSKIPFAHRLAL  241

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC-------NP  778
             +SD LY+S +E+C GN++D+   N+ C  DL    +  E I+   +LEP C       N 
Sbjct  242   VSDALYESLEENCGGNFVDST--NTTCTEDLAAYDELIELISKQNVLEPDCAFLSPKSNK  299

Query  777   EILLSLDGE----------------NLPQQ---WCRDDNYLFAYSWANNKIVQKALGVRE  655
                 ++  +                +LP+    WC++ +YL    W N   VQ ALGVR+
Sbjct  300   AFKSAISNQEKHRRSIQEFTKDYLVSLPRPRDLWCKNFDYLLVDIWGNYPGVQDALGVRQ  359

Query  654   GTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHV  475
             GT++E+ RCN +LS          Y  +V N +DYH++ T+   +VL++SGDHDM++PH 
Sbjct  360   GTVSEFFRCNISLS----------YTVDVNNVLDYHKNLTSLGMQVLVFSGDHDMVIPHN  409

Query  474   STEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPREC  295
               E WI+ L +  + DWRPWFV+ QVAGYT KY+   Y LTYAT+KG+GH+ PEYK REC
Sbjct  410   GIETWIKWLDLTTDVDWRPWFVDGQVAGYTEKYTDGGYRLTYATIKGSGHSPPEYKRREC  469

Query  294   LPMIQRWLSIYPL  256
               M +RW+  YPL
Sbjct  470   YKMFERWIHYYPL  482



>ref|XP_010694003.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=472

 Score =   320 bits (821),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 176/438 (40%), Positives = 254/438 (58%), Gaps = 58/438 (13%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtdpll----------lwltggpgplTINYANSTGD----  1321
             V ++ +++LFYYFI+SE+ PE DPL+           +         + + NS  D    
Sbjct  56    VGKDEEVKLFYYFIKSERDPERDPLMLWLTGGPGCSAFSGLVIEIGPLIFNNSACDWHSK  115

Query  1320  IPDLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHP  1141
              P  +LNP +WTKVA+IIF+D PVGTG+SY+   + Y ++D  S++H Y FL +WL DH 
Sbjct  116   SPTFQLNPSSWTKVASIIFLDSPVGTGFSYATNPEGYYSDDITSSRHIYQFLTKWLADHA  175

Query  1140  TFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSD--TNN  967
              F N+PLY+AGDSY G  VP+VV+ I+ G + G +P +N++G I GNPLT +  +  +++
Sbjct  176   GFHNHPLYIAGDSYCGRIVPVVVQEIFQGNKVGFQPFMNLQGYILGNPLTWKEDEMKSHS  235

Query  966   RVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPA  787
             ++ Y +R+  LSD LY+ST  SCNG Y D    N  C  +LQ ++   + +    +L+P 
Sbjct  236   QLNYAHRVSLLSDELYESTITSCNGAYQDVDMDNINCTLNLQAISYNLDPLFDAHVLKPK  295

Query  786   CNPEILLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGP  607
             C  +           + WC++  Y   Y+WAN+  VQ AL ++EGT   W+RCN TL+  
Sbjct  296   CISD-----------KTWCQESIYGLLYNWANDIQVQAALHIQEGTKRYWIRCNKTLA--  342

Query  606   PEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYS---------------------GDHDM  490
                     Y +NV++TV YH++ T +   VLIY                      GD DM
Sbjct  343   --------YEYNVESTVGYHQNLTQEFIHVLIYRDEEEHVKHLERVLKLLEHCQCGDQDM  394

Query  489   IVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEY  310
              + +V T  WI+ L + + +DWRPWFV DQVAGYT +++   Y LT+ATVKGAGHTAPEY
Sbjct  395   KISYVGTLGWIKMLNISISEDWRPWFVNDQVAGYTTRFANDRYNLTFATVKGAGHTAPEY  454

Query  309   KPRECLPMIQRWLSIYPL  256
             K  EC  M+ +WL   PL
Sbjct  455   KRAECFNMLMKWLESRPL  472



>ref|XP_004299782.1| PREDICTED: serine carboxypeptidase-like 13 [Fragaria vesca subsp. 
vesca]
Length=473

 Score =   320 bits (821),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 173/433 (40%), Positives = 251/433 (58%), Gaps = 42/433 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtdplllwltggpgplTI------------NYANSTGDIP  1315
             V +N ++QLFY F++S++SP  DPL+L    GPG   +            N A+  G +P
Sbjct  51    VGDNEEVQLFYVFVDSQRSPAQDPLVLRFGAGPGCSGLHGFFFENGPLSFNSAHYNGSLP  110

Query  1314  DLELNPYAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTF  1135
              LE NPY+WT+  NIIF+D P G G+SYS T + +  ++   A+  Y FL +WL  HP +
Sbjct  111   TLEDNPYSWTEALNIIFLDAPAGAGFSYSTTQEGFYVDEYKYAEQGYEFLQKWLEAHPAY  170

Query  1134  LNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVY  955
             + N LY++G+S+SG+ VP++V+ I DG E+G  P +N+KG +  NP+T    D N  + Y
Sbjct  171   VENQLYISGESFSGLIVPMIVQKIVDGNENGSVPLMNIKGYLLQNPVTDSVIDGNAIIPY  230

Query  954   GYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACNPE  775
              +R+  +SD LY++ K SCNG Y++    N+AC  D++ + +  + IN   ILEP C+  
Sbjct  231   AHRLTLVSDQLYEAAKTSCNGEYVNVNSSNAACIADIEAIDQLIKDINPVNILEPDCSTS  290

Query  774   I-------------------LLSLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREG  652
             +                   LLS    N P  WCR+ NY+  Y WAN K V+ ALGVR G
Sbjct  291   LPRSKKISTARRYLKELYKGLLS-SPTNGPALWCREYNYMLLYIWANTKAVRDALGVRTG  349

Query  651   TMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKS-CRVLIYSGDHDMIVPHV  475
             T   W  CN TL+G         Y + V +++ YH + + K+  R LIYSGDHDM VPH+
Sbjct  350   TKLLWKPCNTTLTG---------YTYVVTSSLSYHLNLSKKADLRALIYSGDHDMSVPHI  400

Query  474   STEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPREC  295
              T+ WI  L + V++ WR W ++ Q  GYT K       L +ATVKGAGH A EY+P+E 
Sbjct  401   GTQAWINLLNLTVDESWRTWSLDGQTKGYTKKLINDYITLIFATVKGAGHLAAEYQPKEV  460

Query  294   LPMIQRWLSIYPL  256
               ++ RW++ YP+
Sbjct  461   ASLVGRWMAYYPV  473



>gb|EMT21721.1| Serine carboxypeptidase-like 17 [Aegilops tauschii]
Length=489

 Score =   320 bits (821),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 182/442 (41%), Positives = 245/442 (55%), Gaps = 62/442 (14%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             ++LFYYF++SE +P  D                 L    GPL+    + TG +P+L   P
Sbjct  63    VRLFYYFVQSEANPAEDPVLLWLTGGPGCSAFSGLVYEIGPLSFQPDSYTGGVPELVYRP  122

Query  1296  YAWTK----------------------VANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQ  1183
              +WTK                      VAN+IF+D PVG G+SYS T   Y + DT +  
Sbjct  123   DSWTKASIYSSSASHPSGTETRPPTKHVANVIFLDSPVGAGFSYSATDQGYKSCDTKAVD  182

Query  1182  HTYSFLVQWLLDHPTFLNNPLYVAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEG  1003
                 FL +W  +HP FL+NPL++AGDSYSG+  P +   I  G+E G +P LN+KG I G
Sbjct  183   QIAIFLTKWYEEHPQFLSNPLFIAGDSYSGLIAPPLTFQIAKGIEMGDKPLLNLKGYIIG  242

Query  1002  NPLTHRFSDTNNRVVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCT  823
             NPLT R  D   RV Y +RMG +SD  Y++ +ESC  +   ++  N  C+     + KC 
Sbjct  243   NPLTDRKFDLPARVPYAHRMGLISDEQYETYRESCGAD--TSMNRNIQCKNCHDAIDKCL  300

Query  822   EKINMPQILEPACNPE---------ILLSLDGENLP----QQWCRDDNYLFAYSWANNKI  682
             + IN+  ILEP C+ E          L    G  L        CR+  Y  +  WANN+ 
Sbjct  301   KGINIHHILEPECSSEYNGNSDSGRTLFDYGGAELGLSDISSECREKGYSMSGIWANNRS  360

Query  681   VQKALGVREGTMTEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSG  502
             V++ALGV +GT+  WLRCNH   G P       Y  ++++ V++HRS T++  R LIYSG
Sbjct  361   VREALGVHKGTVPLWLRCNH---GTP-------YTTDIRSIVEFHRSVTSRGYRSLIYSG  410

Query  501   DHDMIVPHVSTEKWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHT  322
             DHDM VP +ST+ WI SL   V D+WRPW+   QVAG+T  Y+     LT+ATVKG GHT
Sbjct  411   DHDMTVPFISTQAWIRSLGFAVVDEWRPWYATGQVAGFTTLYANN---LTFATVKGGGHT  467

Query  321   APEYKPRECLPMIQRWLSIYPL  256
             APEY P+ECL M+ RWLS  P+
Sbjct  468   APEYMPKECLAMVDRWLSGRPV  489



>ref|XP_006356866.1| PREDICTED: uncharacterized protein LOC102592829 [Solanum tuberosum]
Length=1021

 Score =   333 bits (855),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 182/421 (43%), Positives = 251/421 (60%), Gaps = 36/421 (9%)
 Frame = -3

Query  1440  IQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIPDLELNP  1297
             +QLFYYF ESE  P++D              L  L    GP+T       G  P + LNP
Sbjct  53    VQLFYYFTESETDPDSDPLMLWITGGPGCSALSGLLYEIGPITFEAVEYNGSFPKMILNP  112

Query  1296  YAWTKVANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHPTFLNNPLY  1117
             Y+WTKV++IIF+D PVGTG+SY+ T  A  ++D  ++ H Y FL +W +DHP FL NP Y
Sbjct  113   YSWTKVSSIIFLDLPVGTGFSYATTPAARQSSDLQASDHAYQFLRKWFVDHPEFLKNPFY  172

Query  1116  VAGDSYSGITVPLVVRNIYDGLESGIEPRLNMKGCIEGNPLTHRFSDTNNRVVYGYRMGF  937
             V GDSYSGI VP++ + I    E  +EP +N+KG + GNP T    D N R+ + Y MG 
Sbjct  173   VGGDSYSGIVVPIITQIIAIKNEMEVEPFINLKGYLLGNPWTFEGED-NYRIPFAYGMGL  231

Query  936   LSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPACN-----PEI  772
             +S+ LY+S K +C G Y++  P N  C  D+Q   +  + I++  ILEP C      P +
Sbjct  232   ISEELYESFKSNCKGEYLNINPSNKLCLQDVQTFIELLQGIDVVNILEPNCGFTSPRPHL  291

Query  771   LL----SLDGENLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTMTEWLRCNHTLSGPP  604
             L     SLD E   Q  CR+D Y F+Y W ++  V+ AL +R+G++ +W RC   L    
Sbjct  292   LFGQRRSLD-EKFHQLKCRNDLYKFSYQWTDDGQVRDALNIRKGSIGKWERCASNLQ---  347

Query  603   EAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTEKWIESLKVGVEDDW  424
                    Y   V +++ YH++ ++K  R LIYSGDHD++V   ST+ WI+SL   + DDW
Sbjct  348   -------YNRMVMSSIPYHKNLSSKGYRSLIYSGDHDIVVTFRSTQAWIKSLNYSIVDDW  400

Query  423   RPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPMIQRWLSIYPL*LLC  244
             R W V++QVAGYT  YS    ++T+ATVKGAGHTAPEYKPRECL M+ +W+S  P    C
Sbjct  401   RAWTVDNQVAGYTRSYSN---QMTFATVKGAGHTAPEYKPRECLAMLTKWMSYQPFHFHC  457

Query  243   K  241
             +
Sbjct  458   E  458


 Score =   322 bits (824),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 186/430 (43%), Positives = 252/430 (59%), Gaps = 43/430 (10%)
 Frame = -3

Query  1458  VWENLKIQLFYYFIESEKSPEtd------------plllwltggpgplTINYANSTGDIP  1315
             V ++  +QLFYYFIESE  P++D              L  L    GP+T       G  P
Sbjct  606   VGDSENVQLFYYFIESESEPDSDPLMLWITGGPGCSALSGLIYEIGPITFEAVEYNGSFP  665

Query  1314  DLELNPYAWTKV--ANIIFVDQPVGTGYSYSETSDAYNTNDTLSAQHTYSFLVQWLLDHP  1141
              + LNPY+WTKV  ++IIF+D PVGTG+SY+    A  ++D  +++H Y FL +W +DH 
Sbjct  666   TMILNPYSWTKVRVSSIIFLDLPVGTGFSYATIPAALQSSDLQASEHAYQFLHKWFVDHQ  725

Query  1140  TFLNNPLYVAGDSYSGITVPLVVRNIYDGLE-SGIEPRLNMKGCIEGNPLTHRFSDTNNR  964
              FL NP YV GDS SG+ VP++ + I    E   ++P +N+KG + GNP T    D N R
Sbjct  726   EFLENPFYVGGDSCSGMVVPVITQIIAIKNEIMEVKPFINLKGYLLGNPTTFEGED-NYR  784

Query  963   VVYGYRMGFLSDNLYKSTKESCNGNYIDALPHNSACQYDLQRVTKCTEKINMPQILEPAC  784
             + + Y MG +SD LY+S K +CNG Y +  P N  C  D+Q   +  + IN P ILEP C
Sbjct  785   IPFAYGMGLISDELYESLKSNCNGEYFNINPSNVLCLQDVQTFNELLKGINNPHILEPKC  844

Query  783   N-----PEILL----SLDGE-----NLPQQWCRDDNYLFAYSWANNKIVQKALGVREGTM  646
                   P  L     SLD +     NLP   CR++ Y  +Y WA++  V+ AL +R+GT+
Sbjct  845   KLFSPRPHQLFGERRSLDEKLHELNNLPGLKCRNNWYKHSYHWADDDQVRNALNIRKGTI  904

Query  645   TEWLRCNHTLSGPPEAERSETYVFNVKNTVDYHRSFTNKSCRVLIYSGDHDMIVPHVSTE  466
              +W RC   L           Y+  V N++ YH + ++K  R LIYSGDHD +V   ST+
Sbjct  905   GKWERCASNLQ----------YLMMVTNSIPYHENLSSKGYRSLIYSGDHDKLVTFQSTQ  954

Query  465   KWIESLKVGVEDDWRPWFVEDQVAGYTMKYSQKEYELTYATVKGAGHTAPEYKPRECLPM  286
              WI+SL   V DDWR W V+++VAGYT  YS    ++T+ATVKGAGHTAPEYKPRECL M
Sbjct  955   AWIKSLNYSVVDDWRAWTVDNEVAGYTRSYSN---QMTFATVKGAGHTAPEYKPRECLAM  1011

Query  285   IQRWLSIYPL  256
             + RW+S  PL
Sbjct  1012  LTRWMSYQPL  1021



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5110657488860