BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13775

Length=729
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009757733.1|  PREDICTED: uncharacterized protein LOC104210...    221   8e-63   Nicotiana sylvestris
ref|XP_006344876.1|  PREDICTED: uncharacterized protein LOC102590...    219   2e-62   Solanum tuberosum [potatoes]
ref|XP_004251904.1|  PREDICTED: uncharacterized protein LOC101263491    219   3e-62   Solanum lycopersicum
ref|XP_010324301.1|  PREDICTED: uncharacterized protein LOC101263625    218   1e-61   Solanum lycopersicum
ref|XP_006346182.1|  PREDICTED: uncharacterized protein LOC102598370    217   1e-61   Solanum tuberosum [potatoes]
ref|XP_009587919.1|  PREDICTED: uncharacterized protein LOC104085...    217   2e-61   Nicotiana tomentosiformis
ref|XP_009784977.1|  PREDICTED: uncharacterized protein LOC104233...    214   2e-60   Nicotiana sylvestris
ref|XP_009784976.1|  PREDICTED: uncharacterized protein LOC104233...    214   2e-60   Nicotiana sylvestris
ref|XP_009587918.1|  PREDICTED: uncharacterized protein LOC104085...    206   2e-57   Nicotiana tomentosiformis
ref|XP_011095470.1|  PREDICTED: uncharacterized protein LOC105174914    206   2e-57   Sesamum indicum [beniseed]
ref|XP_011097827.1|  PREDICTED: uncharacterized protein LOC105176655    203   2e-56   Sesamum indicum [beniseed]
emb|CDP13776.1|  unnamed protein product                                196   3e-54   Coffea canephora [robusta coffee]
ref|XP_009591348.1|  PREDICTED: uncharacterized protein LOC104088393    190   1e-51   Nicotiana tomentosiformis
gb|EPS67378.1|  hypothetical protein M569_07396                         172   3e-50   Genlisea aurea
ref|XP_007213672.1|  hypothetical protein PRUPE_ppa001040mg             182   9e-49   Prunus persica
ref|XP_006474990.1|  PREDICTED: uncharacterized protein LOC102609182    179   4e-48   Citrus sinensis [apfelsine]
gb|KDO62139.1|  hypothetical protein CISIN_1g003406mg                   179   4e-48   Citrus sinensis [apfelsine]
ref|XP_007020692.1|  RING/FYVE/PHD zinc finger superfamily protei...    179   5e-48   
ref|XP_008227014.1|  PREDICTED: uncharacterized protein LOC103326553    180   7e-48   Prunus mume [ume]
gb|KDO62140.1|  hypothetical protein CISIN_1g003406mg                   177   8e-48   Citrus sinensis [apfelsine]
ref|XP_010644503.1|  PREDICTED: uncharacterized protein LOC104877...    177   4e-47   Vitis vinifera
ref|XP_010644502.1|  PREDICTED: uncharacterized protein LOC104877...    177   4e-47   Vitis vinifera
ref|XP_010644501.1|  PREDICTED: uncharacterized protein LOC104877...    177   4e-47   Vitis vinifera
ref|XP_009334184.1|  PREDICTED: uncharacterized protein LOC103927011    175   3e-46   Pyrus x bretschneideri [bai li]
ref|XP_008385829.1|  PREDICTED: uncharacterized protein LOC103448356    175   3e-46   
ref|XP_010274120.1|  PREDICTED: uncharacterized protein LOC104609484    174   7e-46   Nelumbo nucifera [Indian lotus]
ref|XP_009361058.1|  PREDICTED: uncharacterized protein LOC103951422    174   7e-46   Pyrus x bretschneideri [bai li]
ref|XP_010270097.1|  PREDICTED: uncharacterized protein LOC104606535    171   3e-45   Nelumbo nucifera [Indian lotus]
ref|XP_011047530.1|  PREDICTED: uncharacterized protein LOC105141...    170   6e-45   Populus euphratica
ref|XP_011047529.1|  PREDICTED: uncharacterized protein LOC105141...    170   7e-45   Populus euphratica
ref|XP_011047528.1|  PREDICTED: uncharacterized protein LOC105141...    170   7e-45   Populus euphratica
ref|XP_011047531.1|  PREDICTED: uncharacterized protein LOC105141...    170   7e-45   Populus euphratica
ref|XP_004295852.1|  PREDICTED: uncharacterized protein LOC101311365    171   1e-44   Fragaria vesca subsp. vesca
ref|XP_012070920.1|  PREDICTED: uncharacterized protein LOC105633025    167   2e-43   Jatropha curcas
gb|KJB22162.1|  hypothetical protein B456_004G032700                    165   5e-43   Gossypium raimondii
ref|XP_010252618.1|  PREDICTED: uncharacterized protein LOC104594146    164   2e-42   Nelumbo nucifera [Indian lotus]
ref|XP_010063057.1|  PREDICTED: uncharacterized protein LOC104450...    163   3e-42   Eucalyptus grandis [rose gum]
ref|XP_007142347.1|  hypothetical protein PHAVU_008G272900g             159   9e-41   Phaseolus vulgaris [French bean]
ref|XP_002298842.1|  PHD finger family protein                          156   1e-39   
gb|EYU27390.1|  hypothetical protein MIMGU_mgv1a001625mg                155   2e-39   Erythranthe guttata [common monkey flower]
ref|XP_010913211.1|  PREDICTED: uncharacterized protein LOC105038...    155   3e-39   Elaeis guineensis
ref|XP_010913214.1|  PREDICTED: uncharacterized protein LOC105038...    153   6e-39   
ref|XP_008364724.1|  PREDICTED: uncharacterized protein LOC103428395    154   1e-38   
ref|XP_010675809.1|  PREDICTED: uncharacterized protein LOC104891755    152   2e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003519600.1|  PREDICTED: uncharacterized protein LOC100807139    152   4e-38   Glycine max [soybeans]
ref|XP_003545110.1|  PREDICTED: uncharacterized protein LOC100783208    149   3e-37   
ref|XP_008798852.1|  PREDICTED: uncharacterized protein LOC103713628    149   4e-37   
ref|XP_006452466.1|  hypothetical protein CICLE_v10007504mg             147   2e-36   
ref|XP_002531205.1|  conserved hypothetical protein                     146   6e-36   
ref|XP_010063058.1|  PREDICTED: uncharacterized protein LOC104450...    144   2e-35   Eucalyptus grandis [rose gum]
ref|XP_004491434.1|  PREDICTED: uncharacterized protein LOC101515...    144   2e-35   Cicer arietinum [garbanzo]
ref|XP_004491433.1|  PREDICTED: uncharacterized protein LOC101515...    142   7e-35   Cicer arietinum [garbanzo]
emb|CBI26703.3|  unnamed protein product                                130   1e-34   Vitis vinifera
gb|KEH28438.1|  PHD-finger protein                                      142   2e-34   Medicago truncatula
ref|XP_008775979.1|  PREDICTED: uncharacterized protein LOC103696...    142   2e-34   
gb|AET00610.2|  PHD-finger protein                                      141   2e-34   Medicago truncatula
ref|XP_003617651.1|  PHD finger protein                                 141   2e-34   
ref|XP_011624940.1|  PREDICTED: uncharacterized protein LOC18438183     139   5e-34   
ref|XP_010096087.1|  PHD finger protein                                 137   9e-33   
gb|KCW70246.1|  hypothetical protein EUGRSUZ_F03507                     135   3e-32   Eucalyptus grandis [rose gum]
ref|XP_010928147.1|  PREDICTED: uncharacterized protein LOC105050005    128   7e-30   Elaeis guineensis
ref|XP_008449200.1|  PREDICTED: uncharacterized protein LOC103491150    126   5e-29   
ref|XP_002967922.1|  hypothetical protein SELMODRAFT_408842             124   7e-29   
ref|XP_004149357.2|  PREDICTED: uncharacterized protein LOC101222...    125   8e-29   Cucumis sativus [cucumbers]
ref|XP_011650515.1|  PREDICTED: uncharacterized protein LOC101222...    125   8e-29   Cucumis sativus [cucumbers]
ref|XP_002964003.1|  hypothetical protein SELMODRAFT_405576             124   8e-29   
gb|KGN56088.1|  hypothetical protein Csa_3G073800                       125   1e-28   Cucumis sativus [cucumbers]
gb|ERN10016.1|  hypothetical protein AMTR_s00013p00237850               123   4e-28   Amborella trichopoda
gb|EMT32178.1|  PHD finger protein                                      119   6e-27   
ref|XP_008775980.1|  PREDICTED: uncharacterized protein LOC103696...    117   6e-26   Phoenix dactylifera
ref|XP_008775981.1|  PREDICTED: uncharacterized protein LOC103696...    117   6e-26   
ref|XP_004965320.1|  PREDICTED: uncharacterized protein LOC101774...    116   1e-25   Setaria italica
ref|XP_008775977.1|  PREDICTED: uncharacterized protein LOC103696...    112   2e-24   
ref|XP_007020693.1|  RING/FYVE/PHD zinc finger superfamily protei...    111   4e-24   
ref|XP_004965321.1|  PREDICTED: uncharacterized protein LOC101774...    106   2e-22   Setaria italica
ref|XP_004965319.1|  PREDICTED: uncharacterized protein LOC101774...    106   3e-22   
gb|EEE65588.1|  hypothetical protein OsJ_21107                          100   2e-20   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001057478.1|  Os06g0309000                                       100   2e-20   
gb|KHN23886.1|  PHD finger protein                                      100   3e-20   Glycine soja [wild soybean]
gb|KHN38237.1|  PHD finger protein                                    97.4    3e-19   Glycine soja [wild soybean]
ref|XP_010913212.1|  PREDICTED: uncharacterized protein LOC105038...  95.9    1e-18   
ref|XP_010913213.1|  PREDICTED: uncharacterized protein LOC105038...  89.7    1e-16   Elaeis guineensis
gb|KCW70247.1|  hypothetical protein EUGRSUZ_F03507                   88.6    2e-16   Eucalyptus grandis [rose gum]
ref|XP_008775982.1|  PREDICTED: uncharacterized protein LOC103696...  76.3    3e-12   
gb|EEC80475.1|  hypothetical protein OsI_22699                        72.4    3e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_009757734.1|  PREDICTED: uncharacterized protein LOC104210...  68.6    7e-10   Nicotiana sylvestris



>ref|XP_009757733.1| PREDICTED: uncharacterized protein LOC104210518 isoform X1 [Nicotiana 
sylvestris]
Length=832

 Score =   221 bits (562),  Expect = 8e-63, Method: Composition-based stats.
 Identities = 97/150 (65%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G+   V DDK +Y +CR+NG++YN++DYAL+RF N+RLIPSKL TMWED K G KWVTV
Sbjct  683  IGNVLQVADDKYYYHSCRVNGFIYNVQDYALVRFENERLIPSKLLTMWEDKKAGTKWVTV  742

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            N+CYFAR+LP SVGRPC   ++EVYLS + S VMAG I+GPCEV PP KF EE ERR   
Sbjct  743  NQCYFARELPQSVGRPCMENNNEVYLSTYISVVMAGSIQGPCEVHPPRKFTEESERRARL  802

Query  367  VTEKNDL-RPLYLCKWIFDEAKGLFRDVSC  281
                ND+ RPLY+CKWI+DE+KGLFRD+SC
Sbjct  803  AKGSNDVSRPLYICKWIYDESKGLFRDISC  832



>ref|XP_006344876.1| PREDICTED: uncharacterized protein LOC102590974 isoform X1 [Solanum 
tuberosum]
 ref|XP_006344877.1| PREDICTED: uncharacterized protein LOC102590974 isoform X2 [Solanum 
tuberosum]
Length=816

 Score =   219 bits (559),  Expect = 2e-62, Method: Composition-based stats.
 Identities = 97/150 (65%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G+   V DDK +Y +CRING++Y+++DYALIRF N+RLIPSKL  MWED K G KWVT+
Sbjct  667  IGNVLQVADDKYYYQSCRINGFIYSVQDYALIRFENERLIPSKLLAMWEDKKAGTKWVTI  726

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            N+CYFAR+LP SVGRPC   ++EVYLS + S VMAGLI+GPCEV PP KF EE E R   
Sbjct  727  NQCYFARELPQSVGRPCLENNNEVYLSTYSSIVMAGLIQGPCEVHPPRKFAEESESRARL  786

Query  367  VTEKNDL-RPLYLCKWIFDEAKGLFRDVSC  281
                ND+ RPLY+CKWI+DE+KGLFRDVSC
Sbjct  787  AKGSNDVSRPLYICKWIYDESKGLFRDVSC  816



>ref|XP_004251904.1| PREDICTED: uncharacterized protein LOC101263491 [Solanum lycopersicum]
Length=817

 Score =   219 bits (558),  Expect = 3e-62, Method: Composition-based stats.
 Identities = 97/150 (65%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            VG+   V DDK +Y +CRING++Y+++DYALIRF N+RLIPSKL  MWED K G KWV++
Sbjct  668  VGNVLQVADDKYYYQSCRINGFIYSVQDYALIRFENERLIPSKLLAMWEDKKAGTKWVSI  727

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            N+CYFAR+LP SVGRPC   ++EVYLS + S VMAGLI+GPCEV PP KF EE ERR   
Sbjct  728  NQCYFARELPQSVGRPCLENNNEVYLSTYSSIVMAGLIQGPCEVHPPRKFTEESERRARL  787

Query  367  VTEKNDL-RPLYLCKWIFDEAKGLFRDVSC  281
                ND+ +PLY+CKWI+DE+KGLFRDVSC
Sbjct  788  AKGSNDVSQPLYICKWIYDESKGLFRDVSC  817



>ref|XP_010324301.1| PREDICTED: uncharacterized protein LOC101263625 [Solanum lycopersicum]
 ref|XP_004244084.2| PREDICTED: uncharacterized protein LOC101263625 [Solanum lycopersicum]
Length=829

 Score =   218 bits (554),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 99/150 (66%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G    V D+K +Y +CR NG+VYN+++YA+IRF ++RLIPSKL  MWED K G KWVTV
Sbjct  680  IGDVLQVADEKHYYQSCRHNGFVYNVQEYAVIRFEDERLIPSKLLAMWEDIKAGKKWVTV  739

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            NRCYF RDLP +VG PCSLES+EVYLSN  + VMAG I+GPCEVLP SKF EERER +  
Sbjct  740  NRCYFPRDLPHAVGHPCSLESNEVYLSNCSTTVMAGQIQGPCEVLPLSKFNEERERISRL  799

Query  367  VTEKN-DLRPLYLCKWIFDEAKGLFRDVSC  281
             T  N  L+PLYLCKWI+DE+KGLFRD+SC
Sbjct  800  ETGPNGGLQPLYLCKWIYDESKGLFRDISC  829



>ref|XP_006346182.1| PREDICTED: uncharacterized protein LOC102598370 [Solanum tuberosum]
Length=823

 Score =   217 bits (553),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 99/150 (66%), Positives = 119/150 (79%), Gaps = 1/150 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G    V D+K +Y +CR NG++YN+++YA+IRF ++RLIPSKL  MWED K G KWVTV
Sbjct  674  IGDVLQVADEKHYYQSCRHNGFIYNVQEYAVIRFEDERLIPSKLLAMWEDIKAGKKWVTV  733

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            NRCYF RDLP +VG PCSLES+EVYLSN  + VMAG I+GPCEVLP SKF EERER +  
Sbjct  734  NRCYFPRDLPHAVGHPCSLESNEVYLSNCSTTVMAGQIQGPCEVLPLSKFNEERERISRL  793

Query  367  VTEKN-DLRPLYLCKWIFDEAKGLFRDVSC  281
             T  N  L+PLYLCKWI+DE+KGLFRDVSC
Sbjct  794  ETGPNGGLQPLYLCKWIYDESKGLFRDVSC  823



>ref|XP_009587919.1| PREDICTED: uncharacterized protein LOC104085559 isoform X2 [Nicotiana 
tomentosiformis]
Length=833

 Score =   217 bits (553),  Expect = 2e-61, Method: Composition-based stats.
 Identities = 98/150 (65%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G+   V DDK +Y +CRING+VYN++DYAL+RF N+RLIPSKL TMWED K G KWVTV
Sbjct  684  IGNILQVVDDKYYYHSCRINGFVYNVQDYALVRFENERLIPSKLLTMWEDKKAGTKWVTV  743

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            N+CYFAR+LP SVGRPC   ++EVYLS + S VMAG I+GPCEV P  KF EE ERR   
Sbjct  744  NQCYFARELPQSVGRPCVENNNEVYLSTYISVVMAGSIQGPCEVHPARKFTEESERRARL  803

Query  367  VTEKNDL-RPLYLCKWIFDEAKGLFRDVSC  281
                ND+ RPLY+CKWI+DE+KGLFRD+SC
Sbjct  804  AKGSNDVSRPLYICKWIYDESKGLFRDISC  833



>ref|XP_009784977.1| PREDICTED: uncharacterized protein LOC104233293 isoform X2 [Nicotiana 
sylvestris]
Length=844

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 119/149 (80%), Gaps = 1/149 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G+   V D+K +Y +C+ NG++YN+++YALIRF ++RLIPSKL  MWED K G KWVTV
Sbjct  695  IGNVLQVADEKHYYQSCQHNGFIYNVQEYALIRFEDERLIPSKLVAMWEDIKAGKKWVTV  754

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            NRCYF RDLP  VGRPCSLES+EVYLSN  S VMAG IEGPCEVLP SKF EERE+ +  
Sbjct  755  NRCYFPRDLPQGVGRPCSLESNEVYLSNCSSTVMAGQIEGPCEVLPSSKFNEEREKVSRL  814

Query  367  VTEKN-DLRPLYLCKWIFDEAKGLFRDVS  284
             T  N  LRPLY+CKWI+DE+KGLFRD+S
Sbjct  815  ETRSNGGLRPLYICKWIYDESKGLFRDIS  843



>ref|XP_009784976.1| PREDICTED: uncharacterized protein LOC104233293 isoform X1 [Nicotiana 
sylvestris]
Length=850

 Score =   214 bits (545),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 119/149 (80%), Gaps = 1/149 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G+   V D+K +Y +C+ NG++YN+++YALIRF ++RLIPSKL  MWED K G KWVTV
Sbjct  701  IGNVLQVADEKHYYQSCQHNGFIYNVQEYALIRFEDERLIPSKLVAMWEDIKAGKKWVTV  760

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            NRCYF RDLP  VGRPCSLES+EVYLSN  S VMAG IEGPCEVLP SKF EERE+ +  
Sbjct  761  NRCYFPRDLPQGVGRPCSLESNEVYLSNCSSTVMAGQIEGPCEVLPSSKFNEEREKVSRL  820

Query  367  VTEKN-DLRPLYLCKWIFDEAKGLFRDVS  284
             T  N  LRPLY+CKWI+DE+KGLFRD+S
Sbjct  821  ETRSNGGLRPLYICKWIYDESKGLFRDIS  849



>ref|XP_009587918.1| PREDICTED: uncharacterized protein LOC104085559 isoform X1 [Nicotiana 
tomentosiformis]
Length=852

 Score =   206 bits (523),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 98/169 (58%), Positives = 118/169 (70%), Gaps = 20/169 (12%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G+   V DDK +Y +CRING+VYN++DYAL+RF N+RLIPSKL TMWED K G KWVTV
Sbjct  684  IGNILQVVDDKYYYHSCRINGFVYNVQDYALVRFENERLIPSKLLTMWEDKKAGTKWVTV  743

Query  547  NRCYFARDLPASVGRPCSLESSE-------------------VYLSNFGSAVMAGLIEGP  425
            N+CYFAR+LP SVGRPC   ++E                   VYLS + S VMAG I+GP
Sbjct  744  NQCYFARELPQSVGRPCVENNNELFSSRGSIGNSLSALPGVGVYLSTYISVVMAGSIQGP  803

Query  424  CEVLPPSKFPEERERRTCAVTEKNDL-RPLYLCKWIFDEAKGLFRDVSC  281
            CEV P  KF EE ERR       ND+ RPLY+CKWI+DE+KGLFRD+SC
Sbjct  804  CEVHPARKFTEESERRARLAKGSNDVSRPLYICKWIYDESKGLFRDISC  852



>ref|XP_011095470.1| PREDICTED: uncharacterized protein LOC105174914 [Sesamum indicum]
Length=803

 Score =   206 bits (523),  Expect = 2e-57, Method: Composition-based stats.
 Identities = 95/149 (64%), Positives = 112/149 (75%), Gaps = 1/149 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            VG    V D+K++Y +C ING++Y   D+ LIR  N RL+PSKLQ MWED  T  KWVTV
Sbjct  656  VGDPVQVLDEKVYYISCCINGHLYKTLDHVLIRL-NGRLVPSKLQGMWEDRNTTTKWVTV  714

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            N+CYF  DLP +VGRPC LE SEVY S  G A+MAGLIEGPC+VLPP +F EE ERRT +
Sbjct  715  NQCYFPGDLPEAVGRPCGLEDSEVYESTRGRALMAGLIEGPCQVLPPRRFAEESERRTSS  774

Query  367  VTEKNDLRPLYLCKWIFDEAKGLFRDVSC  281
              + ND  PLYLCKWI+DEAKGLFRD+SC
Sbjct  775  SKQPNDHLPLYLCKWIYDEAKGLFRDISC  803



>ref|XP_011097827.1| PREDICTED: uncharacterized protein LOC105176655 [Sesamum indicum]
Length=794

 Score =   203 bits (516),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 93/150 (62%), Positives = 111/150 (74%), Gaps = 1/150 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            VG      D+K++Y +C ING+VY + D+ LI F ND+LIPSKLQ MWED  T  KWVTV
Sbjct  645  VGDPVQALDEKIYYTSCSINGHVYKVMDHVLIHFDNDKLIPSKLQAMWEDNHTSKKWVTV  704

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
             RCYF  DLP +VGRPC LESSEVY SN G  VMAGLI+ PC+VLP  KF EE E+R  +
Sbjct  705  KRCYFPGDLPEAVGRPCLLESSEVYESNCGRTVMAGLIQSPCDVLPAKKFAEETEKRCRS  764

Query  367  VTEKND-LRPLYLCKWIFDEAKGLFRDVSC  281
              +++D L PLYLC WIFDE+KGLFRD+SC
Sbjct  765  GAQQDDLLPPLYLCNWIFDESKGLFRDISC  794



>emb|CDP13776.1| unnamed protein product [Coffea canephora]
Length=799

 Score =   196 bits (499),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 91/150 (61%), Positives = 110/150 (73%), Gaps = 2/150 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G    V ++K FY +C I G VY L D+ LI+F NDRLIPSKLQ MWED K   +WV+V
Sbjct  651  IGGILKVDEEKAFYQSCCIRGVVYKLHDHVLIQF-NDRLIPSKLQAMWEDIKMKTRWVSV  709

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            N+CYF  DLP +VGRPC LESSEVY S     VMAGL++G CEVLPP +F EE+E+RT  
Sbjct  710  NKCYFPADLPQAVGRPCGLESSEVYESTISCTVMAGLVQGLCEVLPPGRFIEEKEKRTNG  769

Query  367  VTEKND-LRPLYLCKWIFDEAKGLFRDVSC  281
                N+ LRPLY+CKWI+DE KGLFRDV+C
Sbjct  770  GKRPNESLRPLYVCKWIYDEPKGLFRDVNC  799



>ref|XP_009591348.1| PREDICTED: uncharacterized protein LOC104088393 [Nicotiana tomentosiformis]
Length=849

 Score =   190 bits (482),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 105/135 (78%), Gaps = 1/135 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G+   V D+K +Y +CR NG++YN+++YALIRF ++RLIPSKL  MWED K G KWVTV
Sbjct  686  IGNVLQVADEKHYYQSCRHNGFIYNVQEYALIRFEDERLIPSKLVAMWEDIKAGKKWVTV  745

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            NRCYF RDLP  VGRPCSLES+EVYLSN  S VMAG IEGPCEVLP SKF EERER +  
Sbjct  746  NRCYFPRDLPQGVGRPCSLESNEVYLSNCSSTVMAGQIEGPCEVLPSSKFNEERERVSRL  805

Query  367  VTEKN-DLRPLYLCK  326
             T  N  LRPLY+CK
Sbjct  806  ETRSNGGLRPLYICK  820



>gb|EPS67378.1| hypothetical protein M569_07396, partial [Genlisea aurea]
Length=153

 Score =   172 bits (437),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 103/149 (69%), Gaps = 1/149 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
             G  + V +DK +Y +C I G +Y   ++ALIRF + +L+P+K+Q  WED  T  KWVT 
Sbjct  4    AGEPNHVSEDKHYYASCFIKGQLYKATEHALIRFDDGKLVPAKIQAFWEDKNTATKWVTA  63

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            NRCYF  DLP +VGRPC LE+SEV  S    A +AG IE  CEVLPP KF EE ERR+  
Sbjct  64   NRCYFPDDLPEAVGRPCGLENSEVCESTRDYAFLAGSIETHCEVLPPRKFSEECERRSRC  123

Query  367  VTEKND-LRPLYLCKWIFDEAKGLFRDVS  284
            V + ND L PLYLCKWI+DEAKGLFRD S
Sbjct  124  VEQLNDNLPPLYLCKWIYDEAKGLFRDAS  152



>ref|XP_007213672.1| hypothetical protein PRUPE_ppa001040mg [Prunus persica]
 gb|EMJ14871.1| hypothetical protein PRUPE_ppa001040mg [Prunus persica]
Length=925

 Score =   182 bits (462),  Expect = 9e-49, Method: Composition-based stats.
 Identities = 87/149 (58%), Positives = 109/149 (73%), Gaps = 1/149 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G    V D+KLFY  C I+G +Y L+D+AL      +LIPSKLQ+MWED KTG KWV V
Sbjct  776  IGDAVQVNDEKLFYRTCCIDGVMYKLQDHALFHSSLGKLIPSKLQSMWEDRKTGSKWVIV  835

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            NRCYF  DLP +VGRP + ES+EVY SN  S VMAGLI+GPCEVL P+KF +E E+R+  
Sbjct  836  NRCYFPGDLPENVGRPSTPESNEVYESNHDSTVMAGLIQGPCEVLTPTKFSKESEKRSNL  895

Query  367  VTE-KNDLRPLYLCKWIFDEAKGLFRDVS  284
              E  N+L+P++LCKWI+DE KGL + VS
Sbjct  896  GPEANNELQPIFLCKWIYDEFKGLLQPVS  924



>ref|XP_006474990.1| PREDICTED: uncharacterized protein LOC102609182 [Citrus sinensis]
Length=823

 Score =   179 bits (455),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 83/149 (56%), Positives = 104/149 (70%), Gaps = 1/149 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G    + D K FY +CRI G  Y ++D+ L+   N++L+PSKLQTMWED  TG KWV V
Sbjct  674  IGDVLQIVDGKKFYQSCRIGGVTYKVKDHVLLHSSNNKLMPSKLQTMWEDTGTGSKWVMV  733

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            NRC+F  DLP +VG PC+ ES+E+Y SN  S+VMAGLI GPCEVLPP KF EE ER    
Sbjct  734  NRCFFPGDLPEAVGCPCAPESNELYESNNESSVMAGLIRGPCEVLPPGKFKEENERLNHL  793

Query  367  VTEKNDLR-PLYLCKWIFDEAKGLFRDVS  284
              E N  R P++LC+W +DE KG+FR VS
Sbjct  794  GNEANKGRHPVFLCQWFYDELKGVFRPVS  822



>gb|KDO62139.1| hypothetical protein CISIN_1g003406mg [Citrus sinensis]
Length=823

 Score =   179 bits (455),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 83/149 (56%), Positives = 104/149 (70%), Gaps = 1/149 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G    + D K FY +CRI G  Y ++D+ L+   N++L+PSKLQTMWED  TG KWV V
Sbjct  674  IGDVLQIVDGKKFYQSCRIGGVTYKVKDHVLLHSSNNKLMPSKLQTMWEDTGTGSKWVMV  733

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            NRC+F  DLP +VG PC+ ES+E+Y SN  S+VMAGLI GPCEVLPP KF EE ER    
Sbjct  734  NRCFFPGDLPEAVGCPCAPESNELYESNNESSVMAGLIRGPCEVLPPGKFKEENERLNHL  793

Query  367  VTEKNDLR-PLYLCKWIFDEAKGLFRDVS  284
              E N  R P++LC+W +DE KG+FR VS
Sbjct  794  GNEANKGRHPVFLCQWFYDELKGVFRPVS  822



>ref|XP_007020692.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY12217.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
1 [Theobroma cacao]
Length=821

 Score =   179 bits (454),  Expect = 5e-48, Method: Composition-based stats.
 Identities = 84/143 (59%), Positives = 103/143 (72%), Gaps = 1/143 (1%)
 Frame = -3

Query  709  VGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTVNRCYFA  530
            V D + FY +C ING  Y ++D+AL+  G D+LIPSKLQ MWEDAKTG KWV V RCYF 
Sbjct  678  VADGRKFYQSCCINGITYKVQDHALVHSGQDKLIPSKLQAMWEDAKTGSKWVVVKRCYFP  737

Query  529  RDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCAVTEKND  350
             DLP +VG PC+ ESSEVY SN  S VMA  I+GPCEVLP +KF +E ERR+    E N+
Sbjct  738  SDLPEAVGHPCAPESSEVYESNNDSTVMATSIQGPCEVLPTAKFKDEIERRSQLGIEGNE  797

Query  349  -LRPLYLCKWIFDEAKGLFRDVS  284
             L  ++LCKW++DE KG F+ VS
Sbjct  798  GLTAIFLCKWLYDEFKGSFQPVS  820



>ref|XP_008227014.1| PREDICTED: uncharacterized protein LOC103326553 [Prunus mume]
Length=925

 Score =   180 bits (456),  Expect = 7e-48, Method: Composition-based stats.
 Identities = 86/149 (58%), Positives = 109/149 (73%), Gaps = 1/149 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G    V D+KLFY  C ++G +Y L+D+AL      +LIPSKLQ+MWED KTG KWV V
Sbjct  776  IGDAVQVNDEKLFYCTCCVDGVMYKLQDHALFHSSLGKLIPSKLQSMWEDRKTGSKWVIV  835

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            NRCYF  DLP +VGRP + ES+EVY SN  S VMAGLI+GPCEVL P+KF +E E+R+  
Sbjct  836  NRCYFPGDLPENVGRPSTPESNEVYESNHDSTVMAGLIQGPCEVLTPTKFSKECEKRSNL  895

Query  367  VTE-KNDLRPLYLCKWIFDEAKGLFRDVS  284
              E  N+L+P++LCKWI+DE KGL + VS
Sbjct  896  GPEANNELQPIFLCKWIYDEFKGLLQPVS  924



>gb|KDO62140.1| hypothetical protein CISIN_1g003406mg [Citrus sinensis]
Length=641

 Score =   177 bits (450),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 104/149 (70%), Gaps = 1/149 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G    + D K FY +CRI G  Y ++D+ L+   N++L+PSKLQTMWED  TG KWV V
Sbjct  492  IGDVLQIVDGKKFYQSCRIGGVTYKVKDHVLLHSSNNKLMPSKLQTMWEDTGTGSKWVMV  551

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            NRC+F  DLP +VG PC+ ES+E+Y SN  S+VMAGLI GPCEVLPP KF EE ER    
Sbjct  552  NRCFFPGDLPEAVGCPCAPESNELYESNNESSVMAGLIRGPCEVLPPGKFKEENERLNHL  611

Query  367  VTEKNDLR-PLYLCKWIFDEAKGLFRDVS  284
              E N  R P++LC+W +DE KG+FR VS
Sbjct  612  GNEANKGRHPVFLCQWFYDELKGVFRPVS  640



>ref|XP_010644503.1| PREDICTED: uncharacterized protein LOC104877603 isoform X3 [Vitis 
vinifera]
Length=808

 Score =   177 bits (448),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 84/146 (58%), Positives = 102/146 (70%), Gaps = 1/146 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G    V ++K FY +C ING  Y + D+AL    ND+LIP KLQ MWED+KT  KWV  
Sbjct  659  IGDVLRVVEEKTFYQSCCINGVSYKVLDHALFHSSNDKLIPFKLQGMWEDSKTRSKWVMA  718

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            N+CYF  DLP  VGRP + ES+EVY SN  SA+ AGLI+GPCEVLPP KF EE ERRT  
Sbjct  719  NQCYFPSDLPEVVGRPSAPESNEVYESNHDSAITAGLIQGPCEVLPPDKFKEESERRTLL  778

Query  367  VTEKND-LRPLYLCKWIFDEAKGLFR  293
             TE ND L P++LCKW +D+  GLF+
Sbjct  779  GTEANDGLWPIFLCKWFYDKFNGLFQ  804



>ref|XP_010644502.1| PREDICTED: uncharacterized protein LOC104877603 isoform X2 [Vitis 
vinifera]
Length=832

 Score =   177 bits (448),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 84/146 (58%), Positives = 102/146 (70%), Gaps = 1/146 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G    V ++K FY +C ING  Y + D+AL    ND+LIP KLQ MWED+KT  KWV  
Sbjct  683  IGDVLRVVEEKTFYQSCCINGVSYKVLDHALFHSSNDKLIPFKLQGMWEDSKTRSKWVMA  742

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            N+CYF  DLP  VGRP + ES+EVY SN  SA+ AGLI+GPCEVLPP KF EE ERRT  
Sbjct  743  NQCYFPSDLPEVVGRPSAPESNEVYESNHDSAITAGLIQGPCEVLPPDKFKEESERRTLL  802

Query  367  VTEKND-LRPLYLCKWIFDEAKGLFR  293
             TE ND L P++LCKW +D+  GLF+
Sbjct  803  GTEANDGLWPIFLCKWFYDKFNGLFQ  828



>ref|XP_010644501.1| PREDICTED: uncharacterized protein LOC104877603 isoform X1 [Vitis 
vinifera]
Length=833

 Score =   177 bits (448),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 84/146 (58%), Positives = 102/146 (70%), Gaps = 1/146 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G    V ++K FY +C ING  Y + D+AL    ND+LIP KLQ MWED+KT  KWV  
Sbjct  684  IGDVLRVVEEKTFYQSCCINGVSYKVLDHALFHSSNDKLIPFKLQGMWEDSKTRSKWVMA  743

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            N+CYF  DLP  VGRP + ES+EVY SN  SA+ AGLI+GPCEVLPP KF EE ERRT  
Sbjct  744  NQCYFPSDLPEVVGRPSAPESNEVYESNHDSAITAGLIQGPCEVLPPDKFKEESERRTLL  803

Query  367  VTEKND-LRPLYLCKWIFDEAKGLFR  293
             TE ND L P++LCKW +D+  GLF+
Sbjct  804  GTEANDGLWPIFLCKWFYDKFNGLFQ  829



>ref|XP_009334184.1| PREDICTED: uncharacterized protein LOC103927011 [Pyrus x bretschneideri]
Length=942

 Score =   175 bits (444),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 81/141 (57%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = -3

Query  706  GDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTVNRCYFAR  527
            GD+K++Y  C I+G  Y L+D+AL +  + +LIP KLQ+MWED KTG KW  VNRCYF  
Sbjct  800  GDEKIYYHTCCIDGVTYQLQDHALFQSSHGKLIPLKLQSMWEDRKTGSKWAIVNRCYFPG  859

Query  526  DLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCAVTE-KND  350
            DLP +VGRP + ES+EVY SN  S VMAGLI GPCEVL P+KF  E ER++    E  N+
Sbjct  860  DLPENVGRPSTPESNEVYQSNHDSTVMAGLIRGPCEVLSPAKFSGETERQSQLEQEANNE  919

Query  349  LRPLYLCKWIFDEAKGLFRDV  287
            LRP++LCKWI+DE KG+   V
Sbjct  920  LRPIFLCKWIYDEFKGVLEPV  940



>ref|XP_008385829.1| PREDICTED: uncharacterized protein LOC103448356 [Malus domestica]
Length=981

 Score =   175 bits (444),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 82/141 (58%), Positives = 101/141 (72%), Gaps = 1/141 (1%)
 Frame = -3

Query  706  GDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTVNRCYFAR  527
            GD+K++Y  C I+   Y L D+AL +  + +LIPSKLQ+MWED KTG KW  VNRCYF  
Sbjct  839  GDEKIYYHTCCIDEVTYQLRDHALFQSSHGKLIPSKLQSMWEDRKTGSKWAIVNRCYFPG  898

Query  526  DLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCAVTE-KND  350
            DLP +VGRP + ES+EVY SN  S VMAGLI GPCEVL P+KF  E ERR+    E  N+
Sbjct  899  DLPENVGRPSTPESNEVYESNHDSTVMAGLIRGPCEVLSPAKFSGETERRSQLEQEANNE  958

Query  349  LRPLYLCKWIFDEAKGLFRDV  287
            LRP++LCKWI+DE KG+   V
Sbjct  959  LRPIFLCKWIYDEFKGVLESV  979



>ref|XP_010274120.1| PREDICTED: uncharacterized protein LOC104609484 [Nelumbo nucifera]
Length=858

 Score =   174 bits (440),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 103/149 (69%), Gaps = 1/149 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            VG    V D+K FY +CRING VYNL D+AL    ++ L PSKLQ +WED +T  KW  V
Sbjct  709  VGDVQEVVDEKAFYQSCRINGVVYNLLDHALFCSNSNNLRPSKLQALWEDTRTRSKWAIV  768

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            NRCY   DLP  VGRPC  E +EVY SN  S VMAGLI+GPC+VLP +KF EE ERR   
Sbjct  769  NRCYSPSDLPEVVGRPCMPEDNEVYESNHESTVMAGLIQGPCDVLPSNKFKEEIERRMHL  828

Query  367  VTEKND-LRPLYLCKWIFDEAKGLFRDVS  284
               +ND LRP+++CKW +DE KG+FR V+
Sbjct  829  GDGENDGLRPVFICKWAYDEFKGVFRPVT  857



>ref|XP_009361058.1| PREDICTED: uncharacterized protein LOC103951422 [Pyrus x bretschneideri]
Length=989

 Score =   174 bits (442),  Expect = 7e-46, Method: Composition-based stats.
 Identities = 83/148 (56%), Positives = 104/148 (70%), Gaps = 1/148 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G     GD+K++Y  C I+G  Y L D+AL +  + +LIPSKLQ+MWED KTG KW  V
Sbjct  840  IGDAVQGGDEKIYYHTCCIDGVTYQLRDHALFQSSHGKLIPSKLQSMWEDRKTGSKWAIV  899

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            NRCYF  DLP +VGRP + ES+EVY SN  S VMAGLI GPCEVL P+KF  E ERR+  
Sbjct  900  NRCYFPGDLPENVGRPSTPESNEVYESNHDSNVMAGLIRGPCEVLSPAKFSVETERRSQL  959

Query  367  VTE-KNDLRPLYLCKWIFDEAKGLFRDV  287
              E  N+L+P++LCKWI+DE KG+   V
Sbjct  960  GHEADNELQPIFLCKWIYDEFKGVLEPV  987



>ref|XP_010270097.1| PREDICTED: uncharacterized protein LOC104606535 [Nelumbo nucifera]
Length=815

 Score =   171 bits (434),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 82/149 (55%), Positives = 102/149 (68%), Gaps = 1/149 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G+   V DDK FY +C ING VY L+D+AL    ND L PSKLQ++WED +T  KW  V
Sbjct  663  IGNILQVVDDKAFYQSCCINGIVYKLQDHALFLSSNDSLRPSKLQSLWEDTRTRSKWAAV  722

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            N CY   DLP  VG+PC+ E +EVY SN  S VMAGLI+GPC+VLP +KF EE ERR   
Sbjct  723  NLCYLPSDLPEVVGQPCTPEVNEVYESNHDSTVMAGLIQGPCDVLPSNKFKEEVERRKHL  782

Query  367  VTEKND-LRPLYLCKWIFDEAKGLFRDVS  284
                +D L+ ++LCKW +DE KGLFR V+
Sbjct  783  ENGAHDGLQRVFLCKWFYDEPKGLFRAVT  811



>ref|XP_011047530.1| PREDICTED: uncharacterized protein LOC105141853 isoform X3 [Populus 
euphratica]
Length=783

 Score =   170 bits (431),  Expect = 6e-45, Method: Composition-based stats.
 Identities = 79/148 (53%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G++  V D K FY +C I+G  Y ++D+AL    N +L PSKLQ MWE+ +TG KWV V
Sbjct  634  IGNEIKVADGKNFYKSCCIDGVSYKVQDHALFHSSNGKLTPSKLQAMWEEIETGSKWVLV  693

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            ++CYF  DLPA+VG PC+ ES+EVY SN  S+VMA LIEGPCEVLPP+KF E  ER+   
Sbjct  694  SQCYFPGDLPAAVGHPCAPESNEVYESNHESSVMASLIEGPCEVLPPNKFKEMSERQNQL  753

Query  367  VTEKND-LRPLYLCKWIFDEAKGLFRDV  287
             T+ N+   P+++CKW +DE KG F+ V
Sbjct  754  ATKANNGSAPVFICKWFYDELKGNFQPV  781



>ref|XP_011047529.1| PREDICTED: uncharacterized protein LOC105141853 isoform X2 [Populus 
euphratica]
Length=807

 Score =   170 bits (431),  Expect = 7e-45, Method: Composition-based stats.
 Identities = 79/148 (53%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G++  V D K FY +C I+G  Y ++D+AL    N +L PSKLQ MWE+ +TG KWV V
Sbjct  658  IGNEIKVADGKNFYKSCCIDGVSYKVQDHALFHSSNGKLTPSKLQAMWEEIETGSKWVLV  717

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            ++CYF  DLPA+VG PC+ ES+EVY SN  S+VMA LIEGPCEVLPP+KF E  ER+   
Sbjct  718  SQCYFPGDLPAAVGHPCAPESNEVYESNHESSVMASLIEGPCEVLPPNKFKEMSERQNQL  777

Query  367  VTEKND-LRPLYLCKWIFDEAKGLFRDV  287
             T+ N+   P+++CKW +DE KG F+ V
Sbjct  778  ATKANNGSAPVFICKWFYDELKGNFQPV  805



>ref|XP_011047528.1| PREDICTED: uncharacterized protein LOC105141853 isoform X1 [Populus 
euphratica]
Length=807

 Score =   170 bits (431),  Expect = 7e-45, Method: Composition-based stats.
 Identities = 79/148 (53%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G++  V D K FY +C I+G  Y ++D+AL    N +L PSKLQ MWE+ +TG KWV V
Sbjct  658  IGNEIKVADGKNFYKSCCIDGVSYKVQDHALFHSSNGKLTPSKLQAMWEEIETGSKWVLV  717

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            ++CYF  DLPA+VG PC+ ES+EVY SN  S+VMA LIEGPCEVLPP+KF E  ER+   
Sbjct  718  SQCYFPGDLPAAVGHPCAPESNEVYESNHESSVMASLIEGPCEVLPPNKFKEMSERQNQL  777

Query  367  VTEKND-LRPLYLCKWIFDEAKGLFRDV  287
             T+ N+   P+++CKW +DE KG F+ V
Sbjct  778  ATKANNGSAPVFICKWFYDELKGNFQPV  805



>ref|XP_011047531.1| PREDICTED: uncharacterized protein LOC105141853 isoform X4 [Populus 
euphratica]
Length=783

 Score =   170 bits (430),  Expect = 7e-45, Method: Composition-based stats.
 Identities = 79/148 (53%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G++  V D K FY +C I+G  Y ++D+AL    N +L PSKLQ MWE+ +TG KWV V
Sbjct  634  IGNEIKVADGKNFYKSCCIDGVSYKVQDHALFHSSNGKLTPSKLQAMWEEIETGSKWVLV  693

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            ++CYF  DLPA+VG PC+ ES+EVY SN  S+VMA LIEGPCEVLPP+KF E  ER+   
Sbjct  694  SQCYFPGDLPAAVGHPCAPESNEVYESNHESSVMASLIEGPCEVLPPNKFKEMSERQNQL  753

Query  367  VTEKND-LRPLYLCKWIFDEAKGLFRDV  287
             T+ N+   P+++CKW +DE KG F+ V
Sbjct  754  ATKANNGSAPVFICKWFYDELKGNFQPV  781



>ref|XP_004295852.1| PREDICTED: uncharacterized protein LOC101311365 [Fragaria vesca 
subsp. vesca]
Length=924

 Score =   171 bits (432),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 82/149 (55%), Positives = 105/149 (70%), Gaps = 1/149 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G    V  +K FY +C I+G  Y L+++AL +  + +LIPSKLQ+MWED K+G KWV V
Sbjct  775  IGDSIQVVSEKQFYGSCCIDGVTYELQEHALFQSSDGKLIPSKLQSMWEDMKSGSKWVIV  834

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRT-C  371
            N CYF  DLP +VGRP + ES+EVY SN  S VMAGLI+GPCEVLP +KF EE ERR+  
Sbjct  835  NTCYFPSDLPENVGRPSTPESNEVYESNHESTVMAGLIQGPCEVLPLAKFNEEIERRSQL  894

Query  370  AVTEKNDLRPLYLCKWIFDEAKGLFRDVS  284
                 N+L P++LCKW +DE KGL + VS
Sbjct  895  GADTNNELPPVFLCKWNYDEFKGLLQPVS  923



>ref|XP_012070920.1| PREDICTED: uncharacterized protein LOC105633025 [Jatropha curcas]
 gb|KDP39202.1| hypothetical protein JCGZ_00959 [Jatropha curcas]
Length=858

 Score =   167 bits (422),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 77/148 (52%), Positives = 102/148 (69%), Gaps = 1/148 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G    V D K FY +C I+G  Y ++D+AL R  +++L+PSKLQ MWED +TG KWV V
Sbjct  709  IGDAVKVSDGKTFYQSCFIDGVTYKVQDHALFRSSHEKLMPSKLQAMWEDIETGTKWVLV  768

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            NRCYF  DLP +VG PC+ ES+EVY SN  S++MAGLI+G C+VLP  KF    ER+   
Sbjct  769  NRCYFPGDLPKAVGHPCASESNEVYESNHESSLMAGLIQGQCKVLPSIKFQINSERQNQL  828

Query  367  VTEKN-DLRPLYLCKWIFDEAKGLFRDV  287
             TE N    P+++CKW +DE+KG F+ V
Sbjct  829  GTEANIGSDPVFICKWFYDESKGTFQPV  856



>gb|KJB22162.1| hypothetical protein B456_004G032700 [Gossypium raimondii]
Length=822

 Score =   165 bits (418),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 78/143 (55%), Positives = 95/143 (66%), Gaps = 1/143 (1%)
 Frame = -3

Query  709  VGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTVNRCYFA  530
            V D K FY  C I+G +Y + D+AL+  G D+LIPSKLQ MWEDAKTG KWV V RCYF 
Sbjct  679  VVDGKKFYQYCCIDGIIYKVHDHALVHSGQDKLIPSKLQAMWEDAKTGSKWVVVKRCYFP  738

Query  529  RDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCAVTEKND  350
             DLP  V  PC  E SEVY SN  S VMA  I+ PCEVLP  KF EE ERR+    E N+
Sbjct  739  SDLPEGVAHPCPPEISEVYESNNDSTVMASAIQCPCEVLPADKFKEESERRSQLGIEANE  798

Query  349  L-RPLYLCKWIFDEAKGLFRDVS  284
              + ++LC+W++DE  G F+ +S
Sbjct  799  RSKAIFLCRWLYDEFNGSFQSIS  821



>ref|XP_010252618.1| PREDICTED: uncharacterized protein LOC104594146 [Nelumbo nucifera]
Length=875

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 100/149 (67%), Gaps = 1/149 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            VG    V D+K FY +C +NG +Y L D+AL    ++ L PSKLQ +WED +T  KW  V
Sbjct  726  VGDVLQVVDEKAFYQSCCVNGVMYKLLDHALFCSNSNNLRPSKLQALWEDTRTRSKWAIV  785

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRT-C  371
            +RCY   DLP  VGRPC  E +EVY SN  S VMAGLI+GPC+VLP +KF EE ERRT  
Sbjct  786  SRCYSPSDLPEVVGRPCMPEDNEVYESNHESTVMAGLIQGPCDVLPSNKFKEEIERRTHL  845

Query  370  AVTEKNDLRPLYLCKWIFDEAKGLFRDVS  284
                 N LRP++LCKW +DE KGLFR V+
Sbjct  846  GDGANNGLRPVFLCKWSYDEFKGLFRPVT  874



>ref|XP_010063057.1| PREDICTED: uncharacterized protein LOC104450270 isoform X1 [Eucalyptus 
grandis]
 gb|KCW70245.1| hypothetical protein EUGRSUZ_F03507 [Eucalyptus grandis]
Length=858

 Score =   163 bits (413),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 75/149 (50%), Positives = 101/149 (68%), Gaps = 1/149 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G    V + K +Y +C + G  Y ++++AL R  ND+L P KLQ MWED++TG+KW  +
Sbjct  709  IGDALEVVNGKTYYSSCCVGGITYKVKEHALFRLSNDKLTPFKLQAMWEDSETGLKWFDI  768

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
             RCYF  DLP +V  P   +S+EV+ SN  S+VMA  I+GPCEVLPP+K+ EE ERR+  
Sbjct  769  TRCYFPGDLPNNVAHPFVPDSNEVFESNHNSSVMACSIQGPCEVLPPAKYKEETERRSHL  828

Query  367  VTEKN-DLRPLYLCKWIFDEAKGLFRDVS  284
             TE N  LRPL+LC W +DE KG F+ VS
Sbjct  829  GTEANVRLRPLFLCNWFYDELKGHFQAVS  857



>ref|XP_007142347.1| hypothetical protein PHAVU_008G272900g [Phaseolus vulgaris]
 gb|ESW14341.1| hypothetical protein PHAVU_008G272900g [Phaseolus vulgaris]
Length=824

 Score =   159 bits (402),  Expect = 9e-41, Method: Composition-based stats.
 Identities = 71/148 (48%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G    + D+K+FY +C ++G  Y L+ +AL    N +L PSKLQ+MWED KTG+KWV V
Sbjct  675  IGDVVQLADEKIFYQSCCVDGVSYRLQGHALFPTSNGKLAPSKLQSMWEDCKTGVKWVKV  734

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERR-TC  371
             +CYF  DLP ++G PC  E +EVY SN     MAG I+GPCEVLP  KF +E +RR   
Sbjct  735  TKCYFPDDLPGNIGHPCISEVNEVYESNSDRTEMAGSIQGPCEVLPSDKFKQENDRRCQL  794

Query  370  AVTEKNDLRPLYLCKWIFDEAKGLFRDV  287
             + E   ++P++LC+W +DE K LF+ V
Sbjct  795  GIEECTRIQPIFLCRWFYDEFKKLFQPV  822



>ref|XP_002298842.1| PHD finger family protein [Populus trichocarpa]
 gb|EEE83647.1| PHD finger family protein [Populus trichocarpa]
Length=798

 Score =   156 bits (394),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 73/139 (53%), Positives = 98/139 (71%), Gaps = 1/139 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G++  V D K FY +C I+G  Y ++D+AL    + +L PSKLQTMWE+ +TG KWV V
Sbjct  646  IGNEIKVADGKTFYKSCCIDGVSYKVQDHALFHSSDGKLTPSKLQTMWEEIETGSKWVLV  705

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRT-C  371
            ++CYF  DLPA+VG PC+ ES+EVY SN  S+VMA LIEGPCEVLPP+KF E  ER+   
Sbjct  706  SQCYFPGDLPAAVGHPCAPESNEVYESNHESSVMASLIEGPCEVLPPNKFKEMSERQNRL  765

Query  370  AVTEKNDLRPLYLCKWIFD  314
            A+   N   P+++CK + D
Sbjct  766  AIEANNGSAPVFICKELHD  784



>gb|EYU27390.1| hypothetical protein MIMGU_mgv1a001625mg [Erythranthe guttata]
Length=783

 Score =   155 bits (392),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 76/135 (56%), Positives = 92/135 (68%), Gaps = 1/135 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            VG    V DDK++Y +C IN ++Y   D+ LIR  + +LIP+K+Q MWED  T  KWVTV
Sbjct  649  VGEPIRVLDDKIYYSSCCINEHLYEAMDHVLIRIESGKLIPAKIQDMWEDKNTTTKWVTV  708

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            N+CYF  DLP +VGRPC LES EVY S  G AVMA  IE PCEVLPP KF EE E R  +
Sbjct  709  NQCYFPGDLPEAVGRPCGLESREVYESTCGKAVMAHSIESPCEVLPPRKFAEETESRNHS  768

Query  367  VTEKND-LRPLYLCK  326
              + ND L P+Y+CK
Sbjct  769  GEQLNDNLPPIYVCK  783



>ref|XP_010913211.1| PREDICTED: uncharacterized protein LOC105038965 isoform X1 [Elaeis 
guineensis]
Length=847

 Score =   155 bits (392),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 70/148 (47%), Positives = 98/148 (66%), Gaps = 0/148 (0%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            VG    V D+K++Y +C +NG +Y L+D+ LI F   + +PSKLQ++WED K+G KW TV
Sbjct  699  VGDVLQVVDEKMYYQSCCVNGILYKLQDHVLIDFNCQKFVPSKLQSLWEDNKSGSKWATV  758

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            +  YF  DL  +V +P + E+SEVY SN    +MAG I GPCEVL   KF EE +RR   
Sbjct  759  DLYYFPSDLAETVSQPSTTENSEVYASNNKKTIMAGSIHGPCEVLAIDKFREESDRRLQL  818

Query  367  VTEKNDLRPLYLCKWIFDEAKGLFRDVS  284
               K+ L P+++CKW++DE KG F+ V+
Sbjct  819  GDSKSSLHPVFVCKWMYDELKGSFQAVT  846



>ref|XP_010913214.1| PREDICTED: uncharacterized protein LOC105038965 isoform X4 [Elaeis 
guineensis]
Length=722

 Score =   153 bits (387),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 98/148 (66%), Gaps = 0/148 (0%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            VG    V D+K++Y +C +NG +Y L+D+ LI F   + +PSKLQ++WED K+G KW TV
Sbjct  574  VGDVLQVVDEKMYYQSCCVNGILYKLQDHVLIDFNCQKFVPSKLQSLWEDNKSGSKWATV  633

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            +  YF  DL  +V +P + E+SEVY SN    +MAG I GPCEVL   KF EE +RR   
Sbjct  634  DLYYFPSDLAETVSQPSTTENSEVYASNNKKTIMAGSIHGPCEVLAIDKFREESDRRLQL  693

Query  367  VTEKNDLRPLYLCKWIFDEAKGLFRDVS  284
               K+ L P+++CKW++DE KG F+ V+
Sbjct  694  GDSKSSLHPVFVCKWMYDELKGSFQAVT  721



>ref|XP_008364724.1| PREDICTED: uncharacterized protein LOC103428395, partial [Malus 
domestica]
Length=984

 Score =   154 bits (389),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 76/135 (56%), Positives = 93/135 (69%), Gaps = 1/135 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G     GD+K++Y  C I+G  Y L D+AL +  + +LIP KLQ+MWED KTG KW  V
Sbjct  850  IGDAVQGGDEKIYYHTCCIDGVTYQLRDHALFQSSHGKLIPXKLQSMWEDRKTGSKWAIV  909

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            NRCYF  DLP +VGRP + ES+EVY SN  S VMAGLI GPCEVL P+KF  E ERR+  
Sbjct  910  NRCYFPGDLPENVGRPSTPESNEVYESNXDSNVMAGLIRGPCEVLSPAKFSVETERRSQL  969

Query  367  VTE-KNDLRPLYLCK  326
              E  N+L PL+LCK
Sbjct  970  GHEANNELXPLFLCK  984



>ref|XP_010675809.1| PREDICTED: uncharacterized protein LOC104891755 [Beta vulgaris 
subsp. vulgaris]
Length=819

 Score =   152 bits (384),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 69/144 (48%), Positives = 95/144 (66%), Gaps = 0/144 (0%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G    V D K F+ +CRING VY ++DYAL+R  + +LIPSKLQ MWED++T +KW+ V
Sbjct  671  IGDLDRVVDKKNFFRSCRINGMVYEVQDYALLRLKSGKLIPSKLQAMWEDSETNLKWLIV  730

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            ++CYF  DLP  VGRP + +S+EVY S   S V+AG ++G CEVLP  KF EE E     
Sbjct  731  HKCYFPDDLPEEVGRPGAPQSNEVYESTHDSNVLAGFVQGRCEVLPFRKFGEESEGSDQG  790

Query  367  VTEKNDLRPLYLCKWIFDEAKGLF  296
              EK   +P+++  W +DE +  F
Sbjct  791  SLEKETRQPIFIRNWFYDETRRAF  814



>ref|XP_003519600.1| PREDICTED: uncharacterized protein LOC100807139 [Glycine max]
Length=830

 Score =   152 bits (383),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 69/141 (49%), Positives = 94/141 (67%), Gaps = 3/141 (2%)
 Frame = -3

Query  703  DDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTVNRCYFARD  524
            D+K +Y +C ++G  Y L+ +AL   G+ +L PSKLQ+MWED KTG+KWV V  CYF  D
Sbjct  689  DEKKYYQSCCVDGVTYRLQGHALFPTGHGKLTPSKLQSMWEDCKTGLKWVKVTNCYFPDD  748

Query  523  LPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCAV--TEKND  350
            LP ++G PC  E +EVY SN     MA  I GPCEVLP  KF +E +RR C +   E + 
Sbjct  749  LPGNIGHPCISEVNEVYESNSDRTEMASSIRGPCEVLPSDKFKQENDRR-CQLRNEESSR  807

Query  349  LRPLYLCKWIFDEAKGLFRDV  287
            ++P++LC+W +DE K LF+ V
Sbjct  808  VQPIFLCRWFYDEFKKLFQPV  828



>ref|XP_003545110.1| PREDICTED: uncharacterized protein LOC100783208 [Glycine max]
Length=830

 Score =   149 bits (377),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 68/148 (46%), Positives = 94/148 (64%), Gaps = 1/148 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G    + D+K +Y +C I+G  Y L+ +AL    + +L PSKLQ+MWED KTG+KWV V
Sbjct  681  IGDVVQLVDEKKYYQSCCIDGVTYRLQGHALFPTSHGKLTPSKLQSMWEDCKTGLKWVKV  740

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERR-TC  371
              CYF  DLP ++G PC  E +EVY SN     MA  I GPCEVLP  KF +E + R   
Sbjct  741  TNCYFPDDLPGNIGHPCISEVNEVYESNGDRTEMANSIRGPCEVLPSDKFKQENDMRCQL  800

Query  370  AVTEKNDLRPLYLCKWIFDEAKGLFRDV  287
             + E + ++P++LC+W +DE K LF+ V
Sbjct  801  GIEETSKVQPIFLCRWFYDEFKKLFQPV  828



>ref|XP_008798852.1| PREDICTED: uncharacterized protein LOC103713628 [Phoenix dactylifera]
Length=869

 Score =   149 bits (376),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 69/148 (47%), Positives = 96/148 (65%), Gaps = 0/148 (0%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            VG    V D+K +Y  CRING +Y L+D+ LI     + +PSKLQ++WED K+G KW TV
Sbjct  721  VGDILQVVDEKTYYQYCRINGILYKLQDHVLIASTCQKFVPSKLQSLWEDNKSGSKWATV  780

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            +  YF  DL  +V +P + E+SEVY SN    +MAG I GPCEVL   KF EE +RR   
Sbjct  781  DLYYFPNDLAGTVSQPSTTENSEVYASNNKKTIMAGSINGPCEVLAIDKFREECDRRLQL  840

Query  367  VTEKNDLRPLYLCKWIFDEAKGLFRDVS  284
               K+ L P+++C+W++D+ KG F+ V+
Sbjct  841  GDSKSGLHPVFVCEWMYDDLKGSFQPVT  868



>ref|XP_006452466.1| hypothetical protein CICLE_v10007504mg [Citrus clementina]
 gb|ESR65706.1| hypothetical protein CICLE_v10007504mg [Citrus clementina]
Length=793

 Score =   147 bits (370),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 74/149 (50%), Positives = 89/149 (60%), Gaps = 21/149 (14%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G    + D K FY +CRI G  Y                    +TMWED  TG KWV V
Sbjct  664  IGDVLQIVDGKKFYQSCRIGGVTY--------------------KTMWEDTGTGSKWVMV  703

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            NRC+F  DLP +VG PC+ ES+E+Y SN  S+VMAGLI GPCEVLPP KF EE ER    
Sbjct  704  NRCFFPGDLPEAVGCPCAPESNELYESNNESSVMAGLIRGPCEVLPPGKFKEENERLNHL  763

Query  367  VTEKNDLR-PLYLCKWIFDEAKGLFRDVS  284
              E N  R P++LC+W +DE KG+FR VS
Sbjct  764  GNEANKGRHPVFLCQWFYDELKGVFRPVS  792



>ref|XP_002531205.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31182.1| conserved hypothetical protein [Ricinus communis]
Length=892

 Score =   146 bits (368),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 70/153 (46%), Positives = 97/153 (63%), Gaps = 18/153 (12%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQT--------------  590
            +G+   V D K FY +C + G  Y ++D+AL R  +++LIPSKLQ               
Sbjct  707  IGNVLKVADGKTFYVSCSVGGATYKVQDHALFRSSHEKLIPSKLQASDMRVIPSYVYCSS  766

Query  589  ---MWEDAKTGMKWVTVNRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCE  419
               MWED +TG KWV V +CYF  DLP +VG PC+ ES+EVY SN  S+++A LI+GPC+
Sbjct  767  LLAMWEDVETGSKWVLVRQCYFPGDLPKAVGHPCAPESNEVYESNHESSILADLIQGPCQ  826

Query  418  VLPPSKFPEERERRT-CAVTEKNDLRPLYLCKW  323
            VLPP+KF E  ERR+   +  KN+  P++LCK+
Sbjct  827  VLPPTKFQENAERRSQLGIEGKNESWPVFLCKY  859



>ref|XP_010063058.1| PREDICTED: uncharacterized protein LOC104450270 isoform X2 [Eucalyptus 
grandis]
 gb|KCW70244.1| hypothetical protein EUGRSUZ_F03507 [Eucalyptus grandis]
Length=858

 Score =   144 bits (364),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 67/134 (50%), Positives = 91/134 (68%), Gaps = 1/134 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G    V + K +Y +C + G  Y ++++AL R  ND+L P KLQ MWED++TG+KW  +
Sbjct  709  IGDALEVVNGKTYYSSCCVGGITYKVKEHALFRLSNDKLTPFKLQAMWEDSETGLKWFDI  768

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
             RCYF  DLP +V  P   +S+EV+ SN  S+VMA  I+GPCEVLPP+K+ EE ERR+  
Sbjct  769  TRCYFPGDLPNNVAHPFVPDSNEVFESNHNSSVMACSIQGPCEVLPPAKYKEETERRSHL  828

Query  367  VTEKN-DLRPLYLC  329
             TE N  LRPL+LC
Sbjct  829  GTEANVRLRPLFLC  842



>ref|XP_004491434.1| PREDICTED: uncharacterized protein LOC101515729 isoform X2 [Cicer 
arietinum]
Length=796

 Score =   144 bits (362),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 66/147 (45%), Positives = 92/147 (63%), Gaps = 1/147 (1%)
 Frame = -3

Query  724  GSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTVN  545
            GS  +  D+K +Y +C I+G  Y L+ +A     + +L PSKLQ+MWED+KTG+KWV V 
Sbjct  648  GSGTNTEDEKKYYQSCCIDGVTYRLQGHAFFTSNHGKLTPSKLQSMWEDSKTGIKWVKVT  707

Query  544  RCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERR-TCA  368
            +CYF  DLP ++G PC  E +EVY SN     MA  I GPC VLP  KF +E +RR    
Sbjct  708  KCYFPDDLPGNIGHPCISEVNEVYESNSDRIEMASSIRGPCVVLPYDKFKQENDRRCQFG  767

Query  367  VTEKNDLRPLYLCKWIFDEAKGLFRDV  287
            +     ++P++LC+W +DE K  F+ V
Sbjct  768  IDASASVQPIFLCRWFYDEIKKSFQPV  794



>ref|XP_004491433.1| PREDICTED: uncharacterized protein LOC101515729 isoform X1 [Cicer 
arietinum]
Length=821

 Score =   142 bits (359),  Expect = 7e-35, Method: Composition-based stats.
 Identities = 65/148 (44%), Positives = 92/148 (62%), Gaps = 1/148 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G    + D+K +Y +C I+G  Y L+ +A     + +L PSKLQ+MWED+KTG+KWV V
Sbjct  672  IGDVVQLVDEKKYYQSCCIDGVTYRLQGHAFFTSNHGKLTPSKLQSMWEDSKTGIKWVKV  731

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERR-TC  371
             +CYF  DLP ++G PC  E +EVY SN     MA  I GPC VLP  KF +E +RR   
Sbjct  732  TKCYFPDDLPGNIGHPCISEVNEVYESNSDRIEMASSIRGPCVVLPYDKFKQENDRRCQF  791

Query  370  AVTEKNDLRPLYLCKWIFDEAKGLFRDV  287
             +     ++P++LC+W +DE K  F+ V
Sbjct  792  GIDASASVQPIFLCRWFYDEIKKSFQPV  819



>emb|CBI26703.3| unnamed protein product [Vitis vinifera]
Length=104

 Score =   130 bits (328),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 74/100 (74%), Gaps = 1/100 (1%)
 Frame = -3

Query  589  MWEDAKTGMKWVTVNRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLP  410
            MWED+KT  KWV  N+CYF  DLP  VGRP + ES+EVY SN  SA+ AGLI+GPCEVLP
Sbjct  1    MWEDSKTRSKWVMANQCYFPSDLPEVVGRPSAPESNEVYESNHDSAITAGLIQGPCEVLP  60

Query  409  PSKFPEERERRTCAVTEKND-LRPLYLCKWIFDEAKGLFR  293
            P KF EE ERRT   TE ND L P++LCKW +D+  GLF+
Sbjct  61   PDKFKEESERRTLLGTEANDGLWPIFLCKWFYDKFNGLFQ  100



>gb|KEH28438.1| PHD-finger protein [Medicago truncatula]
Length=846

 Score =   142 bits (357),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 66/148 (45%), Positives = 91/148 (61%), Gaps = 1/148 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G    + D+K  Y +C I+G  Y L+ +A     + +L PSKLQ+MWED+KTG+KWV V
Sbjct  697  IGDVVQLVDEKKHYQSCCIDGVTYRLQGHAFFTSSHGKLTPSKLQSMWEDSKTGVKWVKV  756

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERR-TC  371
             +CYF  DLP ++G PC  E +EVY SN     MA  I GPC VLP  KF +E +RR   
Sbjct  757  TKCYFPDDLPGNIGHPCISEVNEVYESNSDRVEMASSIRGPCVVLPYDKFKQENDRRCQF  816

Query  370  AVTEKNDLRPLYLCKWIFDEAKGLFRDV  287
             V     ++P++LC+W +DE K  F+ V
Sbjct  817  GVEASASVQPIFLCRWFYDEIKKSFQPV  844



>ref|XP_008775979.1| PREDICTED: uncharacterized protein LOC103696217 isoform X2 [Phoenix 
dactylifera]
Length=871

 Score =   142 bits (357),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 67/148 (45%), Positives = 92/148 (62%), Gaps = 0/148 (0%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            VG    V D+K +Y +CRING  Y L+D  LI     +  PSKLQ++WED  +  KW TV
Sbjct  723  VGDILQVVDEKTYYQSCRINGIQYKLQDQVLIASTCQKFAPSKLQSLWEDNNSRSKWATV  782

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            +  YF  DL   V +P + E+SEVY SN    +MAG I GPCEVL   +F EE +RR+  
Sbjct  783  DLYYFPNDLAEIVSQPSTTENSEVYASNNKETIMAGSIYGPCEVLDTDRFREESDRRSQI  842

Query  367  VTEKNDLRPLYLCKWIFDEAKGLFRDVS  284
               K+ L P+++CKW++DE+ G F+ V+
Sbjct  843  GDSKSGLHPIFVCKWMYDESNGSFQPVT  870



>gb|AET00610.2| PHD-finger protein [Medicago truncatula]
Length=829

 Score =   141 bits (356),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 66/148 (45%), Positives = 91/148 (61%), Gaps = 1/148 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G    + D+K  Y +C I+G  Y L+ +A     + +L PSKLQ+MWED+KTG+KWV V
Sbjct  680  IGDVVQLVDEKKHYQSCCIDGVTYRLQGHAFFTSSHGKLTPSKLQSMWEDSKTGVKWVKV  739

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERR-TC  371
             +CYF  DLP ++G PC  E +EVY SN     MA  I GPC VLP  KF +E +RR   
Sbjct  740  TKCYFPDDLPGNIGHPCISEVNEVYESNSDRVEMASSIRGPCVVLPYDKFKQENDRRCQF  799

Query  370  AVTEKNDLRPLYLCKWIFDEAKGLFRDV  287
             V     ++P++LC+W +DE K  F+ V
Sbjct  800  GVEASASVQPIFLCRWFYDEIKKSFQPV  827



>ref|XP_003617651.1| PHD finger protein [Medicago truncatula]
Length=874

 Score =   141 bits (356),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 66/148 (45%), Positives = 91/148 (61%), Gaps = 1/148 (1%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G    + D+K  Y +C I+G  Y L+ +A     + +L PSKLQ+MWED+KTG+KWV V
Sbjct  725  IGDVVQLVDEKKHYQSCCIDGVTYRLQGHAFFTSSHGKLTPSKLQSMWEDSKTGVKWVKV  784

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERR-TC  371
             +CYF  DLP ++G PC  E +EVY SN     MA  I GPC VLP  KF +E +RR   
Sbjct  785  TKCYFPDDLPGNIGHPCISEVNEVYESNSDRVEMASSIRGPCVVLPYDKFKQENDRRCQF  844

Query  370  AVTEKNDLRPLYLCKWIFDEAKGLFRDV  287
             V     ++P++LC+W +DE K  F+ V
Sbjct  845  GVEASASVQPIFLCRWFYDEIKKSFQPV  872



>ref|XP_011624940.1| PREDICTED: uncharacterized protein LOC18438183 [Amborella trichopoda]
 ref|XP_011624941.1| PREDICTED: uncharacterized protein LOC18438183 [Amborella trichopoda]
Length=729

 Score =   139 bits (351),  Expect = 5e-34, Method: Composition-based stats.
 Identities = 68/151 (45%), Positives = 95/151 (63%), Gaps = 3/151 (2%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIR--FGNDRLIPSKLQTMWEDAKTGMKWV  554
            VG K  V + + +Y +C ING +Y L+DYAL    + N     +K+QT+WED +TG KW 
Sbjct  579  VGEKVKVAEGRTYYQSCCINGVIYKLQDYALFHPDYPNFPSYVAKIQTLWEDNRTGAKWA  638

Query  553  TVNRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRT  374
             VN CY+  DL   VGRP +  + EVY SN+G+  + G I GPC VL   K+ +E ERR+
Sbjct  639  HVNWCYYPDDLSQLVGRPATPGTDEVYESNYGANKLVGTILGPCSVLSVEKYKKEIERRS  698

Query  373  CAVTEKN-DLRPLYLCKWIFDEAKGLFRDVS  284
            C   E+N +L P+++CKW +DE K LF+  S
Sbjct  699  CLADEENPELGPIFICKWFYDEPKELFQPFS  729



>ref|XP_010096087.1| PHD finger protein [Morus notabilis]
 gb|EXB63252.1| PHD finger protein [Morus notabilis]
Length=1213

 Score =   137 bits (346),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 65/152 (43%), Positives = 98/152 (64%), Gaps = 11/152 (7%)
 Frame = -3

Query  727   VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQ----------TMWED  578
             VG      D K FY +CRI G +Y L+D+ + R  + +L+P+KLQ          +M+E+
Sbjct  911   VGDATEADDWKAFYQSCRIGGLIYKLQDHVVYRSSSGKLLPAKLQASRHQLPGLLSMYEE  970

Query  577   AKTGMKWVTVNRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKF  398
              KT +KW  ++R YF  DLP +VGRPC+ + +EV+ ++    +MA  ++GPCEVLPPSK+
Sbjct  971   RKTKLKWFRLSRYYFPGDLPENVGRPCTTDCNEVFETDRRVIIMAQSVQGPCEVLPPSKY  1030

Query  397   PEERERRTCAVTEKND-LRPLYLCKWIFDEAK  305
              EE ERR  +  E +  L+P++LCKW++DE K
Sbjct  1031  KEETERRNQSSLEPSSGLQPVFLCKWLYDEFK  1062


 Score =   113 bits (283),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 53/122 (43%), Positives = 84/122 (69%), Gaps = 6/122 (5%)
 Frame = -3

Query  655  NLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTVNRCYFARDLPASVGRPCSLESSEV  476
            +++D  L+++  D     ++++M+ED+KT ++W  ++R YF  DLP + GRPC+ +S+EV
Sbjct  705  SIDDSHLVKWVGD-----EIESMYEDSKTKLRWFRLSRYYFPCDLPENAGRPCTTDSNEV  759

Query  475  YLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCAVTEKND-LRPLYLCKWIFDEAKGL  299
            + ++    V AG I+GPC+VLPPSKF EE ER   +  E N  L P++LCKW++DE KG 
Sbjct  760  FETDCCVTVTAGYIQGPCKVLPPSKFKEESERLNSSGLEPNHGLCPVFLCKWLYDEFKGS  819

Query  298  FR  293
            F+
Sbjct  820  FQ  821



>gb|KCW70246.1| hypothetical protein EUGRSUZ_F03507 [Eucalyptus grandis]
Length=836

 Score =   135 bits (340),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 84/125 (67%), Gaps = 0/125 (0%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G    V + K +Y +C + G  Y ++++AL R  ND+L P KLQ MWED++TG+KW  +
Sbjct  709  IGDALEVVNGKTYYSSCCVGGITYKVKEHALFRLSNDKLTPFKLQAMWEDSETGLKWFDI  768

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
             RCYF  DLP +V  P   +S+EV+ SN  S+VMA  I+GPCEVLPP+K+ EE ERR+  
Sbjct  769  TRCYFPGDLPNNVAHPFVPDSNEVFESNHNSSVMACSIQGPCEVLPPAKYKEETERRSHL  828

Query  367  VTEKN  353
             TE N
Sbjct  829  GTEAN  833



>ref|XP_010928147.1| PREDICTED: uncharacterized protein LOC105050005 [Elaeis guineensis]
Length=834

 Score =   128 bits (322),  Expect = 7e-30, Method: Composition-based stats.
 Identities = 62/135 (46%), Positives = 86/135 (64%), Gaps = 0/135 (0%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            VG+   V D+K +Y +CRING +Y L+D+ LI     +  PSKLQ++WED K+  KW +V
Sbjct  692  VGNIVQVVDEKTYYQSCRINGVLYKLQDHVLIASTCQKFAPSKLQSLWEDNKSRSKWASV  751

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            +  YF  DL   V +P + E++EVY SN    +MAG I GPCEVL   KF EE E R+  
Sbjct  752  DLYYFPNDLAEIVSQPSTPENNEVYASNNKKTIMAGSIYGPCEVLAIDKFREESEGRSQI  811

Query  367  VTEKNDLRPLYLCKW  323
               K+DL P+++CK+
Sbjct  812  GDSKSDLYPIFVCKY  826



>ref|XP_008449200.1| PREDICTED: uncharacterized protein LOC103491150, partial [Cucumis 
melo]
Length=920

 Score =   126 bits (316),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 57/147 (39%), Positives = 89/147 (61%), Gaps = 3/147 (2%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G ++ + D + +Y +CR++G  Y +E++AL +  N +L+P +L +   + ++G+KW  +
Sbjct  668  IGDQYQILDRRAYYKSCRVDGATYKVEEFALFQSSNGKLMPYRLHSFSHEYESGLKWAIL  727

Query  547  NRCYFARDLPASVGR--PCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERR-  377
             +CYF  DLP  V    PCS E  EVY S+    +  GLI GPCEVL  +K+ EE ERR 
Sbjct  728  KKCYFYEDLPKEVAHLCPCSPEEHEVYTSDGYICLDLGLIRGPCEVLSVAKYKEELERRK  787

Query  376  TCAVTEKNDLRPLYLCKWIFDEAKGLF  296
                 E N ++P++LCKW + EA   F
Sbjct  788  QLGPGEDNGIKPIFLCKWFYTEASKEF  814



>ref|XP_002967922.1| hypothetical protein SELMODRAFT_408842 [Selaginella moellendorffii]
 gb|EFJ31269.1| hypothetical protein SELMODRAFT_408842 [Selaginella moellendorffii]
Length=619

 Score =   124 bits (312),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 97/158 (61%), Gaps = 6/158 (4%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIP--SKLQTMWEDAKTGMKWV  554
            VG+   V D +++Y +C + G+ Y ++D AL R  +  + P  ++LQT+WED ++G KWV
Sbjct  464  VGAPTKVVDKRVYYSSCCVGGWTYKIKDCALFRPESPEIPPYIARLQTLWEDLESGAKWV  523

Query  553  TVNRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRT  374
             VN CY+  D+PA  GRP   E+ EVY SN     + G I+GPC+VL P K+ EE  RR 
Sbjct  524  RVNWCYYPNDMPAIAGRPDDAEAGEVYESNHCDNNLVGSIQGPCQVLVPQKYAEETARRQ  583

Query  373  C--AVTEKNDLRPLYLCKWIFDEAKGLFRDVSC*WAVK  266
                    ++L P++LC++ ++  KG+F+ V+  W V+
Sbjct  584  NLFPAGAADELPPIFLCRYTYNAQKGVFQKVN--WIVE  619



>ref|XP_004149357.2| PREDICTED: uncharacterized protein LOC101222588 isoform X1 [Cucumis 
sativus]
Length=874

 Score =   125 bits (314),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 57/147 (39%), Positives = 90/147 (61%), Gaps = 3/147 (2%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G ++ + D + +Y +CR++G  Y +E++AL +  N +L+P +L +   + ++G+KW  +
Sbjct  676  IGEQYQILDMRAYYKSCRVDGVTYKVEEFALFQSSNGKLMPYRLHSFSHEYESGLKWAIL  735

Query  547  NRCYFARDLPASVG--RPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERR-  377
             +CYF  DLP  V    PCS E  EVY S+    +  GLI GPCEVL  +K+ EE ERR 
Sbjct  736  KKCYFYEDLPKEVAHLHPCSPEEHEVYTSDGYICLDLGLIRGPCEVLSVAKYKEELERRK  795

Query  376  TCAVTEKNDLRPLYLCKWIFDEAKGLF  296
              +  E N ++P++LCKW + EA   F
Sbjct  796  QLSPGEDNGIKPIFLCKWFYTEASKEF  822



>ref|XP_011650515.1| PREDICTED: uncharacterized protein LOC101222588 isoform X2 [Cucumis 
sativus]
Length=847

 Score =   125 bits (314),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 57/147 (39%), Positives = 90/147 (61%), Gaps = 3/147 (2%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G ++ + D + +Y +CR++G  Y +E++AL +  N +L+P +L +   + ++G+KW  +
Sbjct  676  IGEQYQILDMRAYYKSCRVDGVTYKVEEFALFQSSNGKLMPYRLHSFSHEYESGLKWAIL  735

Query  547  NRCYFARDLPASVG--RPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERR-  377
             +CYF  DLP  V    PCS E  EVY S+    +  GLI GPCEVL  +K+ EE ERR 
Sbjct  736  KKCYFYEDLPKEVAHLHPCSPEEHEVYTSDGYICLDLGLIRGPCEVLSVAKYKEELERRK  795

Query  376  TCAVTEKNDLRPLYLCKWIFDEAKGLF  296
              +  E N ++P++LCKW + EA   F
Sbjct  796  QLSPGEDNGIKPIFLCKWFYTEASKEF  822



>ref|XP_002964003.1| hypothetical protein SELMODRAFT_405576 [Selaginella moellendorffii]
 gb|EFJ34336.1| hypothetical protein SELMODRAFT_405576 [Selaginella moellendorffii]
Length=652

 Score =   124 bits (312),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 97/158 (61%), Gaps = 6/158 (4%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIP--SKLQTMWEDAKTGMKWV  554
            VG+   V D +++Y +C + G+ Y ++D AL R  +  + P  ++LQT+WED ++G KWV
Sbjct  497  VGAPTKVVDKRVYYSSCCVGGWTYKIKDCALFRPESPEIPPYIARLQTLWEDLESGAKWV  556

Query  553  TVNRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRT  374
             VN CY+  D+PA  GRP   E+ EVY SN     + G I+GPC+VL P K+ EE  RR 
Sbjct  557  RVNWCYYPNDMPAIAGRPDDAEAGEVYESNHCDNNLVGSIQGPCQVLVPQKYAEETARRQ  616

Query  373  C--AVTEKNDLRPLYLCKWIFDEAKGLFRDVSC*WAVK  266
                    ++L P++LC++ ++  KG+F+ V+  W V+
Sbjct  617  NLFPAGAADELPPIFLCRYTYNAQKGVFQKVN--WIVE  652



>gb|KGN56088.1| hypothetical protein Csa_3G073800 [Cucumis sativus]
Length=976

 Score =   125 bits (314),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 57/147 (39%), Positives = 90/147 (61%), Gaps = 3/147 (2%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G ++ + D + +Y +CR++G  Y +E++AL +  N +L+P +L +   + ++G+KW  +
Sbjct  778  IGEQYQILDMRAYYKSCRVDGVTYKVEEFALFQSSNGKLMPYRLHSFSHEYESGLKWAIL  837

Query  547  NRCYFARDLPASVG--RPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERR-  377
             +CYF  DLP  V    PCS E  EVY S+    +  GLI GPCEVL  +K+ EE ERR 
Sbjct  838  KKCYFYEDLPKEVAHLHPCSPEEHEVYTSDGYICLDLGLIRGPCEVLSVAKYKEELERRK  897

Query  376  TCAVTEKNDLRPLYLCKWIFDEAKGLF  296
              +  E N ++P++LCKW + EA   F
Sbjct  898  QLSPGEDNGIKPIFLCKWFYTEASKEF  924



>gb|ERN10016.1| hypothetical protein AMTR_s00013p00237850 [Amborella trichopoda]
Length=742

 Score =   123 bits (308),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 61/141 (43%), Positives = 87/141 (62%), Gaps = 3/141 (2%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIR--FGNDRLIPSKLQTMWEDAKTGMKWV  554
            VG K  V + + +Y +C ING +Y L+DYAL    + N     +K+QT+WED +TG KW 
Sbjct  579  VGEKVKVAEGRTYYQSCCINGVIYKLQDYALFHPDYPNFPSYVAKIQTLWEDNRTGAKWA  638

Query  553  TVNRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRT  374
             VN CY+  DL   VGRP +  + EVY SN+G+  + G I GPC VL   K+ +E ERR+
Sbjct  639  HVNWCYYPDDLSQLVGRPATPGTDEVYESNYGANKLVGTILGPCSVLSVEKYKKEIERRS  698

Query  373  CAVTEKN-DLRPLYLCKWIFD  314
            C   E+N +L P+++C  + D
Sbjct  699  CLADEENPELGPIFICNTMKD  719



>gb|EMT32178.1| PHD finger protein [Aegilops tauschii]
Length=788

 Score =   119 bits (299),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 59/147 (40%), Positives = 85/147 (58%), Gaps = 0/147 (0%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            VG    V  +  +Y++C ++G  YNL+D+ LI   + +  PSKLQ++WE+  +  K   V
Sbjct  636  VGDALKVVGNITYYNSCIVDGITYNLQDHILIGSKDGKSAPSKLQSLWEEHGSQSKLAMV  695

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            N  +FA D+P S  +PCS E +EVY SN    VM   I GPC+VL   KF EE  RR   
Sbjct  696  NTYFFASDIPESATKPCSPEENEVYASNDQRTVMISSICGPCDVLHVDKFREETNRRNQV  755

Query  367  VTEKNDLRPLYLCKWIFDEAKGLFRDV  287
            V+  ++L P++  +W +DE  G F  V
Sbjct  756  VSSDSELHPIFFGRWKYDECTGSFVSV  782



>ref|XP_008775980.1| PREDICTED: uncharacterized protein LOC103696217 isoform X3 [Phoenix 
dactylifera]
Length=853

 Score =   117 bits (292),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 61/141 (43%), Positives = 81/141 (57%), Gaps = 6/141 (4%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            VG    V D+K +Y +CRING  Y L+D  LI     +  PSKLQ++WED  +  KW TV
Sbjct  698  VGDILQVVDEKTYYQSCRINGIQYKLQDQVLIASTCQKFAPSKLQSLWEDNNSRSKWATV  757

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRT--  374
            +  YF  DL   V +P + E+SEVY SN    +MAG I GPCEVL   +F EE +RR+  
Sbjct  758  DLYYFPNDLAEIVSQPSTTENSEVYASNNKETIMAGSIYGPCEVLDTDRFREESDRRSQI  817

Query  373  --CAVTEKN--DLRPLYLCKW  323
              C + +     L P+ + KW
Sbjct  818  DGCMMNQMAAFSLSPINVSKW  838



>ref|XP_008775981.1| PREDICTED: uncharacterized protein LOC103696217 isoform X4 [Phoenix 
dactylifera]
Length=836

 Score =   117 bits (292),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 61/141 (43%), Positives = 81/141 (57%), Gaps = 6/141 (4%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            VG    V D+K +Y +CRING  Y L+D  LI     +  PSKLQ++WED  +  KW TV
Sbjct  681  VGDILQVVDEKTYYQSCRINGIQYKLQDQVLIASTCQKFAPSKLQSLWEDNNSRSKWATV  740

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRT--  374
            +  YF  DL   V +P + E+SEVY SN    +MAG I GPCEVL   +F EE +RR+  
Sbjct  741  DLYYFPNDLAEIVSQPSTTENSEVYASNNKETIMAGSIYGPCEVLDTDRFREESDRRSQI  800

Query  373  --CAVTEKN--DLRPLYLCKW  323
              C + +     L P+ + KW
Sbjct  801  DGCMMNQMAAFSLSPINVSKW  821



>ref|XP_004965320.1| PREDICTED: uncharacterized protein LOC101774055 isoform X2 [Setaria 
italica]
Length=770

 Score =   116 bits (290),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 53/136 (39%), Positives = 78/136 (57%), Gaps = 0/136 (0%)
 Frame = -3

Query  703  DDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTVNRCYFARD  524
            D+K +Y++C I+G +YNL D+ LI     +  P KLQ++WE+  +G +   VN   F  D
Sbjct  627  DNKTYYNSCNIDGVIYNLHDHMLIASEGGKFGPCKLQSLWEEHDSGSRLAMVNPYIFGSD  686

Query  523  LPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCAVTEKNDLR  344
            +P S+ +PC  E  EVY SN    V+   I GPCEVL   KF EE +RR    +    L 
Sbjct  687  IPGSISKPCIDEEDEVYGSNNDRIVLVSAIHGPCEVLHVDKFREETKRRCQLDSSGCVLH  746

Query  343  PLYLCKWIFDEAKGLF  296
            P++ C+W +D++   F
Sbjct  747  PIFFCRWNYDDSTSSF  762



>ref|XP_008775977.1| PREDICTED: uncharacterized protein LOC103696217 isoform X1 [Phoenix 
dactylifera]
Length=875

 Score =   112 bits (281),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 72/118 (61%), Gaps = 0/118 (0%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            VG    V D+K +Y +CRING  Y L+D  LI     +  PSKLQ++WED  +  KW TV
Sbjct  723  VGDILQVVDEKTYYQSCRINGIQYKLQDQVLIASTCQKFAPSKLQSLWEDNNSRSKWATV  782

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRT  374
            +  YF  DL   V +P + E+SEVY SN    +MAG I GPCEVL   +F EE +RR+
Sbjct  783  DLYYFPNDLAEIVSQPSTTENSEVYASNNKETIMAGSIYGPCEVLDTDRFREESDRRS  840



>ref|XP_007020693.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY12218.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
2 [Theobroma cacao]
Length=755

 Score =   111 bits (278),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 49/78 (63%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -3

Query  709  VGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTVNRCYFA  530
            V D + FY +C ING  Y ++D+AL+  G D+LIPSKLQ MWEDAKTG KWV V RCYF 
Sbjct  678  VADGRKFYQSCCINGITYKVQDHALVHSGQDKLIPSKLQAMWEDAKTGSKWVVVKRCYFP  737

Query  529  RDLPASVGRPCSLESSEV  476
             DLP +VG PC+ ESSEV
Sbjct  738  SDLPEAVGHPCAPESSEV  755



>ref|XP_004965321.1| PREDICTED: uncharacterized protein LOC101774055 isoform X3 [Setaria 
italica]
Length=764

 Score =   106 bits (265),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 52/134 (39%), Positives = 74/134 (55%), Gaps = 5/134 (4%)
 Frame = -3

Query  703  DDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTVNRCYFARD  524
            D+K +Y++C I+G +YNL D+ LI     +  P KLQ++WE+  +G +   VN   F  D
Sbjct  627  DNKTYYNSCNIDGVIYNLHDHMLIASEGGKFGPCKLQSLWEEHDSGSRLAMVNPYIFGSD  686

Query  523  LPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCAVTEKNDLR  344
            +P S+ +PC  E  EVY SN    V+   I GPCEVL   KF EE +RR    +    L 
Sbjct  687  IPGSISKPCIDEEDEVYGSNNDRIVLVSAIHGPCEVLHVDKFREETKRRCQLDSSGCVLH  746

Query  343  PLYL-----CKWIF  317
            P++      C+W F
Sbjct  747  PIFFCSIGSCQWYF  760



>ref|XP_004965319.1| PREDICTED: uncharacterized protein LOC101774055 isoform X1 [Setaria 
italica]
Length=792

 Score =   106 bits (264),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 50/126 (40%), Positives = 72/126 (57%), Gaps = 0/126 (0%)
 Frame = -3

Query  703  DDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTVNRCYFARD  524
            D+K +Y++C I+G +YNL D+ LI     +  P KLQ++WE+  +G +   VN   F  D
Sbjct  627  DNKTYYNSCNIDGVIYNLHDHMLIASEGGKFGPCKLQSLWEEHDSGSRLAMVNPYIFGSD  686

Query  523  LPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCAVTEKNDLR  344
            +P S+ +PC  E  EVY SN    V+   I GPCEVL   KF EE +RR    +    L 
Sbjct  687  IPGSISKPCIDEEDEVYGSNNDRIVLVSAIHGPCEVLHVDKFREETKRRCQLDSSGCVLH  746

Query  343  PLYLCK  326
            P++ C+
Sbjct  747  PIFFCR  752



>gb|EEE65588.1| hypothetical protein OsJ_21107 [Oryza sativa Japonica Group]
Length=648

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 81/148 (55%), Gaps = 3/148 (2%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            VG    V ++K +Y +C I+G  YNL+D+ L+   +    PSKLQ++WE+  +  K   V
Sbjct  503  VGDPLRVVENKTYYYSCNIDGIAYNLDDHILVASKDKESAPSKLQSLWEEHDSRSKMALV  562

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            +  +FA D+P  + +PC+ E +EV+ S     V    I G CEVL   KF   RE    +
Sbjct  563  SPYFFASDIPELISKPCTAEENEVFASCNQRTVTVSAICGQCEVLHVDKF---REETKGS  619

Query  367  VTEKNDLRPLYLCKWIFDEAKGLFRDVS  284
                + L P++LC+W +DE+   F  V+
Sbjct  620  QVVSSRLHPIFLCRWKYDESTSSFSSVN  647



>ref|NP_001057478.1| Os06g0309000 [Oryza sativa Japonica Group]
 dbj|BAD62199.1| bactericidal permeability-increasing protein-like [Oryza sativa 
Japonica Group]
 dbj|BAF19392.1| Os06g0309000 [Oryza sativa Japonica Group]
 dbj|BAH00280.1| unnamed protein product [Oryza sativa Japonica Group]
Length=662

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 81/148 (55%), Gaps = 3/148 (2%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            VG    V ++K +Y +C I+G  YNL+D+ L+   +    PSKLQ++WE+  +  K   V
Sbjct  517  VGDPLRVVENKTYYYSCNIDGIAYNLDDHILVASKDKESAPSKLQSLWEEHDSRSKMALV  576

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
            +  +FA D+P  + +PC+ E +EV+ S     V    I G CEVL   KF   RE    +
Sbjct  577  SPYFFASDIPELISKPCTAEENEVFASCNQRTVTVSAICGQCEVLHVDKF---REETKGS  633

Query  367  VTEKNDLRPLYLCKWIFDEAKGLFRDVS  284
                + L P++LC+W +DE+   F  V+
Sbjct  634  QVVSSRLHPIFLCRWKYDESTSSFSSVN  661



>gb|KHN23886.1| PHD finger protein [Glycine soja]
Length=895

 Score =   100 bits (250),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 51/135 (38%), Positives = 71/135 (53%), Gaps = 25/135 (19%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G    + D+K +Y +C I+G                        +MWED KTG+KWV V
Sbjct  683  IGDVVQLVDEKKYYQSCCIDG------------------------SMWEDCKTGLKWVKV  718

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERR-TC  371
              CYF  DLP ++G PC  E +EVY SN     MA  I GPCEVLP  KF +E + R   
Sbjct  719  TNCYFPDDLPGNIGHPCISEVNEVYESNGDRTEMANSIRGPCEVLPSDKFKQENDMRCQL  778

Query  370  AVTEKNDLRPLYLCK  326
             + E + ++P++LC+
Sbjct  779  GIEETSKVQPIFLCR  793



>gb|KHN38237.1| PHD finger protein [Glycine soja]
Length=937

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 69/127 (54%), Gaps = 27/127 (21%)
 Frame = -3

Query  703  DDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTVNRCYFARD  524
            D+K +Y +C ++G                        +MWED KTG+KWV V  CYF  D
Sbjct  689  DEKKYYQSCCVDG------------------------SMWEDCKTGLKWVKVTNCYFPDD  724

Query  523  LPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCAV--TEKND  350
            LP ++G PC  E +EVY SN     MA  I GPCEVLP  KF +E +RR C +   E + 
Sbjct  725  LPGNIGHPCISEVNEVYESNSDRTEMASSIRGPCEVLPSDKFKQENDRR-CQLRNEESSR  783

Query  349  LRPLYLC  329
            ++P++LC
Sbjct  784  VQPIFLC  790



>ref|XP_010913212.1| PREDICTED: uncharacterized protein LOC105038965 isoform X2 [Elaeis 
guineensis]
Length=809

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 52/148 (35%), Positives = 72/148 (49%), Gaps = 38/148 (26%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            VG    V D+K++Y +C +NG +Y L+D+ LI F   + +PSKLQ               
Sbjct  699  VGDVLQVVDEKMYYQSCCVNGILYKLQDHVLIDFNCQKFVPSKLQ---------------  743

Query  547  NRCYFARDLPASVGRPCSLESSEVYLSNFGSAVMAGLIEGPCEVLPPSKFPEERERRTCA  368
                                   VY SN    +MAG I GPCEVL   KF EE +RR   
Sbjct  744  -----------------------VYASNNKKTIMAGSIHGPCEVLAIDKFREESDRRLQL  780

Query  367  VTEKNDLRPLYLCKWIFDEAKGLFRDVS  284
               K+ L P+++CKW++DE KG F+ V+
Sbjct  781  GDSKSSLHPVFVCKWMYDELKGSFQAVT  808



>ref|XP_010913213.1| PREDICTED: uncharacterized protein LOC105038965 isoform X3 [Elaeis 
guineensis]
Length=792

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 39/84 (46%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            VG    V D+K++Y +C +NG +Y L+D+ LI F   + +PSKLQ++WED K+G KW TV
Sbjct  699  VGDVLQVVDEKMYYQSCCVNGILYKLQDHVLIDFNCQKFVPSKLQSLWEDNKSGSKWATV  758

Query  547  NRCYFARDLPASVGRPCSLESSEV  476
            +  YF  DL  +V +P + E+SEV
Sbjct  759  DLYYFPSDLAETVSQPSTTENSEV  782



>gb|KCW70247.1| hypothetical protein EUGRSUZ_F03507 [Eucalyptus grandis]
Length=814

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            +G    V + K +Y +C + G  Y ++++AL R  ND+L P KLQ MWED++TG+KW  +
Sbjct  709  IGDALEVVNGKTYYSSCCVGGITYKVKEHALFRLSNDKLTPFKLQAMWEDSETGLKWFDI  768

Query  547  NRCYFARDLPASVGRPCSLESSEV  476
             RCYF  DLP +V  P   +S+EV
Sbjct  769  TRCYFPGDLPNNVAHPFVPDSNEV  792



>ref|XP_008775982.1| PREDICTED: uncharacterized protein LOC103696217 isoform X5 [Phoenix 
dactylifera]
Length=808

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 37/84 (44%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            VG    V D+K +Y +CRING  Y L+D  LI     +  PSKLQ++WED  +  KW TV
Sbjct  723  VGDILQVVDEKTYYQSCRINGIQYKLQDQVLIASTCQKFAPSKLQSLWEDNNSRSKWATV  782

Query  547  NRCYFARDLPASVGRPCSLESSEV  476
            +  YF  DL   V +P + E+SE+
Sbjct  783  DLYYFPNDLAEIVSQPSTTENSEM  806



>gb|EEC80475.1| hypothetical protein OsI_22699 [Oryza sativa Indica Group]
Length=537

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 53/87 (61%), Gaps = 0/87 (0%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKLQTMWEDAKTGMKWVTV  548
            VG    V ++K +Y +C I+G  YNL+D+ L+   +    PSKLQ++WE+  +  K   V
Sbjct  429  VGDPLRVVENKTYYYSCNIDGIAYNLDDHILVASKDKESAPSKLQSLWEEHDSRSKMALV  488

Query  547  NRCYFARDLPASVGRPCSLESSEVYLS  467
            +  +FA D+P  + +PC+ E +EV+ S
Sbjct  489  SPYFFASDIPELISKPCTAEENEVFAS  515



>ref|XP_009757734.1| PREDICTED: uncharacterized protein LOC104210518 isoform X2 [Nicotiana 
sylvestris]
Length=730

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  727  VGSKHSVGDDKLFYDACRINGYVYNLEDYALIRFGNDRLIPSKL  596
            +G+   V DDK +Y +CR+NG++YN++DYAL+RF N+RLIPSKL
Sbjct  683  IGNVLQVADDKYYYHSCRVNGFIYNVQDYALVRFENERLIPSKL  726



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1344627596975