BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13768

Length=807
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004248074.1|  PREDICTED: mitochondrial adenine nucleotide ...    313   8e-102   Solanum lycopersicum
ref|XP_006358640.1|  PREDICTED: mitochondrial adenine nucleotide ...    313   1e-101   Solanum tuberosum [potatoes]
emb|CDP08711.1|  unnamed protein product                                311   3e-101   Coffea canephora [robusta coffee]
ref|XP_007040459.1|  Adenine nucleotide transporter 1 isoform 2         308   3e-101   
ref|XP_010104983.1|  Mitochondrial substrate carrier family prote...    311   4e-101   Morus notabilis
ref|XP_010661886.1|  PREDICTED: mitochondrial adenine nucleotide ...    311   5e-101   Vitis vinifera
ref|XP_002280675.1|  PREDICTED: mitochondrial adenine nucleotide ...    311   5e-101   Vitis vinifera
ref|XP_011023215.1|  PREDICTED: mitochondrial adenine nucleotide ...    310   8e-101   Populus euphratica
ref|XP_012083252.1|  PREDICTED: mitochondrial adenine nucleotide ...    310   1e-100   Jatropha curcas
ref|XP_002302618.1|  mitochondrial substrate carrier family protein     310   1e-100   Populus trichocarpa [western balsam poplar]
ref|XP_008437971.1|  PREDICTED: mitochondrial adenine nucleotide ...    310   1e-100   Cucumis melo [Oriental melon]
ref|XP_011037758.1|  PREDICTED: mitochondrial adenine nucleotide ...    309   2e-100   Populus euphratica
gb|KJB41483.1|  hypothetical protein B456_007G106400                    305   3e-100   Gossypium raimondii
ref|XP_010266452.1|  PREDICTED: mitochondrial adenine nucleotide ...    309   3e-100   Nelumbo nucifera [Indian lotus]
ref|XP_007040458.1|  Adenine nucleotide transporter 1 isoform 1         309   4e-100   
ref|XP_002320851.2|  mitochondrial substrate carrier family protein     308   4e-100   Populus trichocarpa [western balsam poplar]
ref|XP_004133837.1|  PREDICTED: mitochondrial adenine nucleotide ...    308   6e-100   Cucumis sativus [cucumbers]
ref|XP_007218199.1|  hypothetical protein PRUPE_ppa007790mg             308   7e-100   Prunus persica
ref|XP_008233213.1|  PREDICTED: mitochondrial adenine nucleotide ...    307   1e-99    Prunus mume [ume]
gb|KJB21314.1|  hypothetical protein B456_004G043200                    302   2e-99    Gossypium raimondii
gb|KHN35367.1|  Mitochondrial substrate carrier family protein B        306   2e-99    Glycine soja [wild soybean]
ref|XP_003521800.1|  PREDICTED: mitochondrial adenine nucleotide ...    306   2e-99    Glycine max [soybeans]
ref|XP_010261496.1|  PREDICTED: mitochondrial adenine nucleotide ...    306   2e-99    Nelumbo nucifera [Indian lotus]
gb|KJB41485.1|  hypothetical protein B456_007G106400                    306   2e-99    Gossypium raimondii
ref|XP_003521801.1|  PREDICTED: mitochondrial adenine nucleotide ...    306   2e-99    
ref|XP_004516398.1|  PREDICTED: mitochondrial adenine nucleotide ...    306   2e-99    Cicer arietinum [garbanzo]
gb|KHG26522.1|  Mitochondrial substrate carrier family protein B        306   2e-99    Gossypium arboreum [tree cotton]
ref|XP_011093457.1|  PREDICTED: mitochondrial adenine nucleotide ...    306   3e-99    Sesamum indicum [beniseed]
ref|XP_004306695.1|  PREDICTED: mitochondrial adenine nucleotide ...    306   3e-99    Fragaria vesca subsp. vesca
gb|KJB41484.1|  hypothetical protein B456_007G106400                    306   3e-99    Gossypium raimondii
ref|XP_007051615.1|  Adenine nucleotide transporter 1                   305   7e-99    Theobroma cacao [chocolate]
emb|CAN60251.1|  hypothetical protein VITISV_039402                     305   7e-99    Vitis vinifera
gb|KJB24253.1|  hypothetical protein B456_004G135200                    301   1e-98    Gossypium raimondii
gb|KJB21315.1|  hypothetical protein B456_004G043200                    302   1e-98    Gossypium raimondii
gb|KJB21318.1|  hypothetical protein B456_004G043200                    305   2e-98    Gossypium raimondii
gb|KJB21316.1|  hypothetical protein B456_004G043200                    304   2e-98    Gossypium raimondii
gb|KJB21317.1|  hypothetical protein B456_004G043200                    303   2e-98    Gossypium raimondii
gb|KHN43116.1|  Mitochondrial substrate carrier family protein B        304   2e-98    Glycine soja [wild soybean]
ref|XP_009377268.1|  PREDICTED: mitochondrial adenine nucleotide ...    303   3e-98    Pyrus x bretschneideri [bai li]
ref|XP_009626771.1|  PREDICTED: mitochondrial adenine nucleotide ...    303   4e-98    Nicotiana tomentosiformis
ref|XP_009779970.1|  PREDICTED: mitochondrial adenine nucleotide ...    303   5e-98    Nicotiana sylvestris
gb|KJB24246.1|  hypothetical protein B456_004G135200                    303   5e-98    Gossypium raimondii
ref|XP_009779971.1|  PREDICTED: mitochondrial adenine nucleotide ...    301   5e-98    Nicotiana sylvestris
ref|XP_008343426.1|  PREDICTED: mitochondrial adenine nucleotide ...    303   6e-98    
ref|XP_009377876.1|  PREDICTED: mitochondrial adenine nucleotide ...    303   6e-98    Pyrus x bretschneideri [bai li]
ref|XP_003554758.1|  PREDICTED: mitochondrial adenine nucleotide ...    303   7e-98    Glycine max [soybeans]
gb|KCW78146.1|  hypothetical protein EUGRSUZ_D02348                     303   8e-98    Eucalyptus grandis [rose gum]
ref|XP_010053790.1|  PREDICTED: mitochondrial adenine nucleotide ...    302   9e-98    Eucalyptus grandis [rose gum]
ref|XP_006583253.1|  PREDICTED: mitochondrial adenine nucleotide ...    296   1e-97    
gb|EYU38910.1|  hypothetical protein MIMGU_mgv1a009053mg                302   1e-97    Erythranthe guttata [common monkey flower]
gb|EYU32214.1|  hypothetical protein MIMGU_mgv1a009069mg                302   1e-97    Erythranthe guttata [common monkey flower]
ref|XP_010326870.1|  PREDICTED: mitochondrial adenine nucleotide ...    302   2e-97    Solanum lycopersicum
ref|XP_010326872.1|  PREDICTED: mitochondrial adenine nucleotide ...    302   2e-97    Solanum lycopersicum
ref|XP_002532663.1|  Grave disease carrier protein, putative            301   2e-97    Ricinus communis
ref|XP_011093053.1|  PREDICTED: mitochondrial adenine nucleotide ...    301   2e-97    Sesamum indicum [beniseed]
ref|XP_009610019.1|  PREDICTED: mitochondrial adenine nucleotide ...    299   4e-97    Nicotiana tomentosiformis
ref|XP_003528803.1|  PREDICTED: mitochondrial adenine nucleotide ...    300   1e-96    Glycine max [soybeans]
ref|XP_009410854.1|  PREDICTED: mitochondrial adenine nucleotide ...    299   2e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002273414.1|  PREDICTED: mitochondrial adenine nucleotide ...    299   2e-96    Vitis vinifera
ref|NP_001275102.1|  mitochondrial carrier-like protein                 299   3e-96    Solanum tuberosum [potatoes]
ref|XP_007147281.1|  hypothetical protein PHAVU_006G110800g             298   3e-96    Phaseolus vulgaris [French bean]
gb|AFV46218.1|  hypothetical protein                                    296   4e-96    Scutellaria baicalensis [Baikal skullcap]
ref|XP_010924827.1|  PREDICTED: mitochondrial adenine nucleotide ...    298   5e-96    Elaeis guineensis
ref|XP_007209295.1|  hypothetical protein PRUPE_ppa007764mg             298   5e-96    Prunus persica
ref|XP_008239064.1|  PREDICTED: mitochondrial adenine nucleotide ...    298   5e-96    Prunus mume [ume]
gb|KEH18704.1|  grave disease carrier protein                           298   6e-96    Medicago truncatula
ref|XP_012086759.1|  PREDICTED: mitochondrial adenine nucleotide ...    298   7e-96    Jatropha curcas
ref|XP_002509930.1|  Grave disease carrier protein, putative            298   8e-96    Ricinus communis
ref|XP_010522928.1|  PREDICTED: mitochondrial adenine nucleotide ...    298   8e-96    Tarenaya hassleriana [spider flower]
ref|XP_006288044.1|  hypothetical protein CARUB_v10001278mg             298   8e-96    Capsella rubella
ref|XP_010427766.1|  PREDICTED: mitochondrial adenine nucleotide ...    297   9e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010914053.1|  PREDICTED: mitochondrial adenine nucleotide ...    297   1e-95    Elaeis guineensis
ref|XP_010422770.1|  PREDICTED: mitochondrial adenine nucleotide ...    297   1e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010523787.1|  PREDICTED: mitochondrial adenine nucleotide ...    297   1e-95    Tarenaya hassleriana [spider flower]
ref|XP_004298882.1|  PREDICTED: mitochondrial adenine nucleotide ...    297   1e-95    Fragaria vesca subsp. vesca
ref|XP_007135224.1|  hypothetical protein PHAVU_010G111300g             296   3e-95    Phaseolus vulgaris [French bean]
gb|KJB49523.1|  hypothetical protein B456_008G123800                    296   3e-95    Gossypium raimondii
gb|KHG06223.1|  Mitochondrial substrate carrier family protein B        296   4e-95    Gossypium arboreum [tree cotton]
gb|KJB49521.1|  hypothetical protein B456_008G123800                    296   4e-95    Gossypium raimondii
gb|KJB49522.1|  hypothetical protein B456_008G123800                    294   5e-95    Gossypium raimondii
ref|XP_009415476.1|  PREDICTED: mitochondrial adenine nucleotide ...    295   6e-95    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009386307.1|  PREDICTED: mitochondrial adenine nucleotide ...    295   8e-95    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY01954.1|  BnaC02g27730D                                          289   1e-94    
ref|XP_009386297.1|  PREDICTED: mitochondrial adenine nucleotide ...    295   1e-94    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010549230.1|  PREDICTED: mitochondrial adenine nucleotide ...    288   1e-94    Tarenaya hassleriana [spider flower]
ref|XP_008798636.1|  PREDICTED: mitochondrial adenine nucleotide ...    294   2e-94    Phoenix dactylifera
ref|XP_010669340.1|  PREDICTED: mitochondrial adenine nucleotide ...    294   2e-94    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003548513.1|  PREDICTED: mitochondrial adenine nucleotide ...    294   2e-94    Glycine max [soybeans]
ref|XP_008791452.1|  PREDICTED: mitochondrial adenine nucleotide ...    294   3e-94    Phoenix dactylifera
gb|KDO76472.1|  hypothetical protein CISIN_1g018449mg                   290   3e-94    Citrus sinensis [apfelsine]
emb|CAN60283.1|  hypothetical protein VITISV_011983                     293   3e-94    Vitis vinifera
ref|XP_006444883.1|  hypothetical protein CICLE_v10020846mg             293   4e-94    Citrus clementina [clementine]
ref|XP_009394146.1|  PREDICTED: mitochondrial adenine nucleotide ...    293   4e-94    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010055845.1|  PREDICTED: mitochondrial adenine nucleotide ...    293   4e-94    Eucalyptus grandis [rose gum]
ref|XP_010544425.1|  PREDICTED: mitochondrial adenine nucleotide ...    293   4e-94    Tarenaya hassleriana [spider flower]
ref|XP_009352376.1|  PREDICTED: mitochondrial adenine nucleotide ...    293   5e-94    Pyrus x bretschneideri [bai li]
gb|ADE77740.1|  unknown                                                 293   5e-94    Picea sitchensis
ref|XP_010055846.1|  PREDICTED: mitochondrial adenine nucleotide ...    293   6e-94    
ref|XP_009336243.1|  PREDICTED: mitochondrial adenine nucleotide ...    293   7e-94    Pyrus x bretschneideri [bai li]
ref|XP_009336244.1|  PREDICTED: mitochondrial adenine nucleotide ...    292   9e-94    Pyrus x bretschneideri [bai li]
ref|NP_192019.1|  adenine nucleotide transporter 1                      292   1e-93    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190650.1|  adenine nucleotide transporter 1                   292   1e-93    Arabidopsis thaliana [mouse-ear cress]
gb|ACU20385.1|  unknown                                                 286   1e-93    Glycine max [soybeans]
ref|XP_010544796.1|  PREDICTED: mitochondrial adenine nucleotide ...    291   2e-93    Tarenaya hassleriana [spider flower]
gb|KFK42532.1|  hypothetical protein AALP_AA1G006600                    291   2e-93    Arabis alpina [alpine rockcress]
emb|CDX74363.1|  BnaA03g26840D                                          291   3e-93    
emb|CDX71722.1|  BnaC08g31520D                                          290   4e-93    
ref|XP_009134513.1|  PREDICTED: mitochondrial adenine nucleotide ...    291   4e-93    Brassica rapa
ref|XP_009116833.1|  PREDICTED: mitochondrial adenine nucleotide ...    290   4e-93    Brassica rapa
emb|CDY11371.1|  BnaA09g39370D                                          290   4e-93    Brassica napus [oilseed rape]
gb|KJB52266.1|  hypothetical protein B456_008G252700                    290   6e-93    Gossypium raimondii
gb|KJB49524.1|  hypothetical protein B456_008G123800                    290   7e-93    Gossypium raimondii
ref|XP_006439392.1|  hypothetical protein CICLE_v10020845mg             290   1e-92    
ref|XP_006439393.1|  hypothetical protein CICLE_v10020845mg             290   1e-92    Citrus clementina [clementine]
gb|KFK30686.1|  hypothetical protein AALP_AA6G014800                    290   1e-92    Arabis alpina [alpine rockcress]
gb|ABK96372.1|  unknown                                                 289   1e-92    Populus trichocarpa x Populus deltoides
ref|XP_006476410.1|  PREDICTED: mitochondrial adenine nucleotide ...    289   1e-92    Citrus sinensis [apfelsine]
ref|XP_002297985.1|  hypothetical protein POPTR_0001s10370g             289   1e-92    Populus trichocarpa [western balsam poplar]
ref|XP_008360687.1|  PREDICTED: mitochondrial adenine nucleotide ...    289   1e-92    Malus domestica [apple tree]
gb|KDO76471.1|  hypothetical protein CISIN_1g018449mg                   287   1e-92    Citrus sinensis [apfelsine]
emb|CDX91877.1|  BnaC03g31790D                                          289   2e-92    
ref|XP_002874996.1|  mitochondrial substrate carrier family protein     289   2e-92    
emb|CDP12129.1|  unnamed protein product                                289   2e-92    Coffea canephora [robusta coffee]
ref|XP_006343883.1|  PREDICTED: mitochondrial adenine nucleotide ...    288   3e-92    Solanum tuberosum [potatoes]
ref|XP_006396301.1|  hypothetical protein EUTSA_v10028766mg             288   4e-92    Eutrema salsugineum [saltwater cress]
ref|XP_004511523.1|  PREDICTED: mitochondrial adenine nucleotide ...    286   9e-92    Cicer arietinum [garbanzo]
gb|AES93971.2|  substrate carrier family protein                        286   1e-91    Medicago truncatula
ref|XP_009111419.1|  PREDICTED: mitochondrial adenine nucleotide ...    286   1e-91    Brassica rapa
ref|XP_011026923.1|  PREDICTED: mitochondrial adenine nucleotide ...    286   2e-91    Populus euphratica
ref|XP_002304548.1|  hypothetical protein POPTR_0003s13730g             285   4e-91    Populus trichocarpa [western balsam poplar]
ref|XP_009763306.1|  PREDICTED: mitochondrial adenine nucleotide ...    285   6e-91    Nicotiana sylvestris
ref|XP_004245537.1|  PREDICTED: mitochondrial adenine nucleotide ...    285   6e-91    Solanum lycopersicum
ref|XP_003516718.1|  PREDICTED: mitochondrial adenine nucleotide ...    284   6e-91    Glycine max [soybeans]
ref|XP_006590494.1|  PREDICTED: mitochondrial adenine nucleotide ...    284   7e-91    
ref|XP_011073667.1|  PREDICTED: mitochondrial adenine nucleotide ...    285   8e-91    Sesamum indicum [beniseed]
ref|XP_003538203.1|  PREDICTED: mitochondrial adenine nucleotide ...    284   8e-91    Glycine max [soybeans]
ref|XP_006847299.1|  PREDICTED: mitochondrial adenine nucleotide ...    285   9e-91    Amborella trichopoda
ref|XP_009617594.1|  PREDICTED: mitochondrial adenine nucleotide ...    284   1e-90    Nicotiana tomentosiformis
ref|XP_011022540.1|  PREDICTED: mitochondrial adenine nucleotide ...    284   1e-90    Populus euphratica
gb|AFK35995.1|  unknown                                                 275   9e-90    Lotus japonicus
ref|XP_006654848.1|  PREDICTED: mitochondrial adenine nucleotide ...    280   4e-89    Oryza brachyantha
ref|XP_003611013.1|  Calcium-binding mitochondrial carrier protei...    280   2e-88    
ref|XP_010676334.1|  PREDICTED: mitochondrial adenine nucleotide ...    278   3e-88    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007158565.1|  hypothetical protein PHAVU_002G163100g             277   5e-88    Phaseolus vulgaris [French bean]
ref|NP_001130208.1|  uncharacterized protein LOC100191302               275   4e-87    Zea mays [maize]
ref|XP_003567810.1|  PREDICTED: mitochondrial adenine nucleotide ...    275   5e-87    Brachypodium distachyon [annual false brome]
ref|XP_002441594.1|  hypothetical protein SORBIDRAFT_09g030000          274   9e-87    Sorghum bicolor [broomcorn]
ref|XP_004961067.1|  PREDICTED: mitochondrial adenine nucleotide ...    273   2e-86    Setaria italica
ref|NP_001056459.1|  Os05g0585900                                       273   3e-86    
gb|EPS68599.1|  hypothetical protein M569_06168                         273   3e-86    Genlisea aurea
gb|EMT21891.1|  Mitochondrial substrate carrier family protein B        270   5e-86    
gb|EAY99214.1|  hypothetical protein OsI_21172                          272   9e-86    Oryza sativa Indica Group [Indian rice]
dbj|BAJ94251.1|  predicted protein                                      270   3e-85    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ85614.1|  predicted protein                                      268   3e-84    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB41486.1|  hypothetical protein B456_007G106400                    261   6e-82    Gossypium raimondii
gb|KJB24251.1|  hypothetical protein B456_004G135200                    260   2e-81    Gossypium raimondii
gb|KJB24248.1|  hypothetical protein B456_004G135200                    258   1e-80    Gossypium raimondii
ref|XP_001766394.1|  predicted protein                                  254   8e-79    
ref|XP_001756133.1|  predicted protein                                  250   4e-77    
gb|KDO76473.1|  hypothetical protein CISIN_1g018449mg                   243   8e-75    Citrus sinensis [apfelsine]
ref|XP_008355175.1|  PREDICTED: mitochondrial adenine nucleotide ...    221   1e-68    
gb|KCW78145.1|  hypothetical protein EUGRSUZ_D02348                     223   3e-67    Eucalyptus grandis [rose gum]
ref|XP_010095712.1|  Pentatricopeptide repeat-containing protein        226   3e-64    
ref|XP_002979197.1|  hypothetical protein SELMODRAFT_233298             211   4e-62    Selaginella moellendorffii
ref|XP_011399125.1|  Calcium-binding mitochondrial carrier protei...    207   3e-61    Auxenochlorella protothecoides
ref|XP_005849239.1|  hypothetical protein CHLNCDRAFT_34838              204   6e-60    Chlorella variabilis
gb|KDD76091.1|  hypothetical protein H632_c360p1                        201   3e-59    Helicosporidium sp. ATCC 50920
ref|XP_001693350.1|  mitochondrial carrier protein                      199   1e-57    Chlamydomonas reinhardtii
ref|XP_002957829.1|  mitochondrial substrate carrier                    193   7e-56    Volvox carteri f. nagariensis
gb|KIZ03643.1|  putative calcium-binding carrier                        187   2e-53    Monoraphidium neglectum
ref|XP_005643443.1|  mitochondrial carrier protein                      187   2e-53    Coccomyxa subellipsoidea C-169
ref|XP_003055917.1|  predicted protein                                  185   8e-52    Micromonas pusilla CCMP1545
ref|XP_002500487.1|  predicted protein                                  180   1e-50    Micromonas commoda
emb|CEF97253.1|  Mitochondrial substrate/solute carrier                 168   4e-46    Ostreococcus tauri
ref|XP_007511830.1|  predicted protein                                  170   8e-46    Bathycoccus prasinos
ref|XP_003078331.1|  putative carrier protein (ISS)                     168   3e-45    
ref|XP_001416737.1|  MC family transporter: aspartate/glutamate (...    163   5e-44    Ostreococcus lucimarinus CCE9901
gb|KJE90615.1|  EF-hand domain-containing protein, variant              141   1e-35    Capsaspora owczarzaki ATCC 30864
ref|XP_002862152.1|  hypothetical protein ARALYDRAFT_920176             133   2e-35    
ref|XP_004364767.1|  EF-hand domain-containing protein                  140   2e-35    Capsaspora owczarzaki ATCC 30864
gb|ETO75235.1|  hypothetical protein F444_09145                         126   1e-30    Phytophthora parasitica P1976
gb|ETI46538.1|  hypothetical protein F443_09091                         126   2e-30    Phytophthora parasitica P1569
gb|ETL93014.1|  hypothetical protein L917_08748                         126   2e-30    Phytophthora parasitica
gb|ETM46311.1|  hypothetical protein L914_08781                         126   2e-30    Phytophthora parasitica
ref|XP_008905983.1|  hypothetical protein PPTG_11619                    125   4e-30    Phytophthora parasitica INRA-310
gb|ETK86468.1|  hypothetical protein L915_08908                         125   4e-30    Phytophthora parasitica
gb|AFW83145.1|  hypothetical protein ZEAMMB73_772585                    125   5e-30    
gb|ETP44384.1|  hypothetical protein F442_09023                         124   7e-30    Phytophthora parasitica P10297
gb|ETL39886.1|  hypothetical protein L916_08827                         124   2e-29    Phytophthora parasitica
gb|ETP16331.1|  hypothetical protein F441_09055                         124   2e-29    Phytophthora parasitica CJ01A1
ref|XP_009527785.1|  hypothetical protein PHYSODRAFT_559383             123   2e-29    Phytophthora sojae
ref|XP_008866918.1|  hypothetical protein H310_04369                    121   1e-28    Aphanomyces invadans
ref|XP_001626526.1|  predicted protein                                  122   1e-28    Nematostella vectensis
gb|KDO25589.1|  hypothetical protein SPRG_08888                         121   1e-28    Saprolegnia parasitica CBS 223.65
ref|XP_008608708.1|  hypothetical protein SDRG_04802                    120   2e-28    Saprolegnia diclina VS20
gb|EFA84007.1|  EF-hand domain-containing protein                       122   2e-28    Heterostelium album PN500
dbj|BAC11071.1|  unnamed protein product                                116   1e-27    Homo sapiens [man]
ref|XP_012087988.1|  PREDICTED: mitochondrial substrate carrier f...    117   4e-27    Jatropha curcas
emb|CDP06562.1|  unnamed protein product                                117   7e-27    Coffea canephora [robusta coffee]
ref|XP_002945883.1|  mitochondrial substrate carrier                    116   8e-27    Volvox carteri f. nagariensis
ref|XP_011526580.1|  PREDICTED: calcium-binding mitochondrial car...    118   9e-27    Homo sapiens [man]
ref|XP_004344612.1|  carrier superfamily protein                        118   9e-27    Acanthamoeba castellanii str. Neff
ref|XP_011526579.1|  PREDICTED: calcium-binding mitochondrial car...    118   1e-26    Homo sapiens [man]
ref|XP_010262655.1|  PREDICTED: mitochondrial substrate carrier f...    115   1e-26    
ref|XP_008049193.1|  PREDICTED: calcium-binding mitochondrial car...    116   1e-26    Carlito syrichta
gb|EAW69088.1|  solute carrier family 25 (mitochondrial carrier; ...    117   2e-26    Homo sapiens [man]
ref|XP_002901049.1|  Mitochondrial Carrier (MC) Family                  115   2e-26    Phytophthora infestans T30-4
ref|XP_004358737.1|  EF-hand domain-containing protein                  116   2e-26    Cavenderia fasciculata
ref|XP_009802224.1|  PREDICTED: mitochondrial substrate carrier f...    115   2e-26    Nicotiana sylvestris
ref|XP_010262654.1|  PREDICTED: mitochondrial substrate carrier f...    116   2e-26    Nelumbo nucifera [Indian lotus]
ref|XP_009843699.1|  hypothetical protein H257_16824                    115   2e-26    Aphanomyces astaci
ref|XP_006045177.1|  PREDICTED: calcium-binding mitochondrial car...    117   2e-26    Bubalus bubalis [domestic water buffalo]
ref|XP_011798923.1|  PREDICTED: calcium-binding mitochondrial car...    116   2e-26    Colobus angolensis palliatus
dbj|BAB70825.1|  unnamed protein product                                116   2e-26    Homo sapiens [man]
ref|XP_009615663.1|  PREDICTED: mitochondrial substrate carrier f...    115   2e-26    Nicotiana tomentosiformis
ref|XP_002131752.1|  PREDICTED: calcium-binding mitochondrial car...    116   2e-26    
ref|XP_010347829.1|  PREDICTED: calcium-binding mitochondrial car...    115   3e-26    Saimiri boliviensis boliviensis
ref|XP_011019212.1|  PREDICTED: mitochondrial substrate carrier f...    115   3e-26    Populus euphratica
ref|XP_010782176.1|  PREDICTED: calcium-binding mitochondrial car...    113   3e-26    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_008240217.1|  PREDICTED: mitochondrial substrate carrier f...    115   4e-26    
ref|XP_011405585.1|  PREDICTED: mitochondrial adenine nucleotide ...    115   4e-26    
ref|XP_007205473.1|  hypothetical protein PRUPE_ppa008053mg             115   4e-26    Prunus persica
ref|XP_001696228.1|  mitochondrial substrate carrier protein            114   4e-26    Chlamydomonas reinhardtii
ref|XP_010658512.1|  PREDICTED: mitochondrial substrate carrier f...    114   5e-26    Vitis vinifera
ref|XP_002674890.1|  predicted protein                                  114   5e-26    Naegleria gruberi strain NEG-M
ref|XP_008970918.1|  PREDICTED: calcium-binding mitochondrial car...    115   5e-26    Pan paniscus [bonobo]
ref|XP_003798042.1|  PREDICTED: calcium-binding mitochondrial car...    115   5e-26    Otolemur garnettii
ref|XP_002761674.1|  PREDICTED: calcium-binding mitochondrial car...    115   5e-26    Callithrix jacchus [common marmoset]
ref|XP_003819385.1|  PREDICTED: calcium-binding mitochondrial car...    115   5e-26    Pan paniscus [bonobo]
ref|XP_007993182.1|  PREDICTED: calcium-binding mitochondrial car...    115   5e-26    Chlorocebus sabaeus
ref|XP_007489085.1|  PREDICTED: calcium-binding mitochondrial car...    115   5e-26    
ref|XP_007409754.1|  hypothetical protein MELLADRAFT_48294              114   6e-26    Melampsora larici-populina 98AG31
ref|XP_007993181.1|  PREDICTED: calcium-binding mitochondrial car...    115   6e-26    Chlorocebus sabaeus
ref|XP_011744787.1|  PREDICTED: calcium-binding mitochondrial car...    115   6e-26    Macaca nemestrina [pigtail macaque]
ref|XP_012067384.1|  PREDICTED: calcium-binding mitochondrial car...    115   6e-26    Jatropha curcas
ref|XP_005587761.1|  PREDICTED: calcium-binding mitochondrial car...    115   6e-26    
ref|XP_011928654.1|  PREDICTED: calcium-binding mitochondrial car...    115   6e-26    Cercocebus atys
ref|XP_007489084.1|  PREDICTED: calcium-binding mitochondrial car...    115   6e-26    
ref|XP_005587762.1|  PREDICTED: calcium-binding mitochondrial car...    115   6e-26    Macaca fascicularis [crab eating macaque]
ref|XP_002529856.1|  Mitochondrial deoxynucleotide carrier, putative    114   6e-26    
ref|XP_010365471.1|  PREDICTED: calcium-binding mitochondrial car...    115   6e-26    Rhinopithecus roxellana
ref|NP_001244844.1|  calcium-binding mitochondrial carrier protei...    115   7e-26    Macaca mulatta [rhesus macaque]
ref|XP_004059894.1|  PREDICTED: calcium-binding mitochondrial car...    115   7e-26    Gorilla gorilla gorilla [lowland gorilla]
ref|XP_011744807.1|  PREDICTED: calcium-binding mitochondrial car...    115   7e-26    Macaca nemestrina [pigtail macaque]
ref|XP_009432750.1|  PREDICTED: calcium-binding mitochondrial car...    115   7e-26    
ref|XP_011526577.1|  PREDICTED: calcium-binding mitochondrial car...    116   7e-26    Homo sapiens [man]
gb|ACG46518.1|  protein brittle-1                                       114   7e-26    Zea mays [maize]
ref|NP_077008.2|  calcium-binding mitochondrial carrier protein S...    115   7e-26    Homo sapiens [man]
ref|XP_007489083.1|  PREDICTED: calcium-binding mitochondrial car...    115   7e-26    
ref|XP_007026884.1|  Mitochondrial substrate carrier family protein     114   8e-26    
gb|EPS61182.1|  hypothetical protein M569_13615                         114   8e-26    Genlisea aurea
gb|KIY69538.1|  mitochondrial carrier                                   114   8e-26    Cylindrobasidium torrendii FP15055 ss-10
ref|XP_010826530.1|  PREDICTED: calcium-binding mitochondrial car...    115   9e-26    Bison bison bison
ref|XP_011526583.1|  PREDICTED: calcium-binding mitochondrial car...    115   9e-26    Homo sapiens [man]
ref|XP_007397036.1|  hypothetical protein PHACADRAFT_258126             114   1e-25    Phanerochaete carnosa HHB-10118-sp
dbj|BAD61073.1|  putative peroxisomal Ca-dependent solute carrier       113   1e-25    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009859579.1|  PREDICTED: calcium-binding mitochondrial car...    116   1e-25    
ref|XP_011526576.1|  PREDICTED: calcium-binding mitochondrial car...    116   1e-25    Homo sapiens [man]
ref|NP_001041995.1|  Os01g0143100                                       113   1e-25    
ref|XP_006206413.1|  PREDICTED: calcium-binding mitochondrial car...    113   1e-25    
ref|XP_003287896.1|  hypothetical protein DICPUDRAFT_152069             114   1e-25    Dictyostelium purpureum
ref|XP_006177609.1|  PREDICTED: calcium-binding mitochondrial car...    113   1e-25    
ref|XP_010553275.1|  PREDICTED: mitochondrial substrate carrier f...    114   1e-25    Tarenaya hassleriana [spider flower]
ref|XP_007151708.1|  hypothetical protein PHAVU_004G069200g             114   1e-25    Phaseolus vulgaris [French bean]
ref|XP_008985314.1|  PREDICTED: calcium-binding mitochondrial car...    115   1e-25    Callithrix jacchus [common marmoset]
ref|XP_005650282.1|  mitochondrial substrate carrier                    112   1e-25    Coccomyxa subellipsoidea C-169
dbj|BAJ85193.1|  predicted protein                                      113   1e-25    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011006631.1|  PREDICTED: mitochondrial substrate carrier f...    113   1e-25    Populus euphratica
ref|XP_004441303.1|  PREDICTED: calcium-binding mitochondrial car...    114   1e-25    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_006643743.1|  PREDICTED: mitochondrial substrate carrier f...    112   1e-25    Oryza brachyantha
ref|XP_010658511.1|  PREDICTED: mitochondrial substrate carrier f...    113   1e-25    Vitis vinifera
ref|XP_005682594.1|  PREDICTED: calcium-binding mitochondrial car...    113   1e-25    
ref|XP_002455216.1|  hypothetical protein SORBIDRAFT_03g006370          113   2e-25    Sorghum bicolor [broomcorn]
ref|XP_009358788.1|  PREDICTED: mitochondrial substrate carrier f...    113   2e-25    Pyrus x bretschneideri [bai li]
ref|XP_009358789.1|  PREDICTED: mitochondrial substrate carrier f...    112   2e-25    
ref|XP_638149.1|  EF-hand domain-containing protein                     113   2e-25    Dictyostelium discoideum AX4
gb|KIP06606.1|  hypothetical protein PHLGIDRAFT_72460                   112   2e-25    Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_002323527.1|  mitochondrial substrate carrier family protein     112   2e-25    
ref|XP_005738159.1|  PREDICTED: calcium-binding mitochondrial car...    111   2e-25    Pundamilia nyererei
gb|EPY86301.1|  calcium-binding mitochondrial carrier protein SCa...    115   2e-25    
ref|XP_006381219.1|  hypothetical protein POPTR_0006s09300g             112   3e-25    
ref|XP_010826531.1|  PREDICTED: calcium-binding mitochondrial car...    114   3e-25    
ref|XP_008574047.1|  PREDICTED: calcium-binding mitochondrial car...    112   3e-25    
ref|XP_006896421.1|  PREDICTED: calcium-binding mitochondrial car...    113   3e-25    
ref|XP_006850446.1|  PREDICTED: mitochondrial substrate carrier f...    112   3e-25    
gb|EMS62487.1|  Mitochondrial substrate carrier family protein B        113   3e-25    
ref|XP_003558266.1|  PREDICTED: mitochondrial substrate carrier f...    112   4e-25    
ref|XP_011036560.1|  PREDICTED: mitochondrial substrate carrier f...    112   4e-25    
ref|XP_011036718.1|  PREDICTED: mitochondrial substrate carrier f...    112   4e-25    
ref|XP_003760690.1|  PREDICTED: calcium-binding mitochondrial car...    114   4e-25    
ref|XP_008811361.1|  PREDICTED: mitochondrial substrate carrier f...    112   4e-25    
ref|XP_010663818.1|  PREDICTED: calcium-binding mitochondrial car...    112   4e-25    
gb|KHN46834.1|  Calcium-binding mitochondrial carrier protein SCa...    110   4e-25    
ref|XP_005793477.1|  mitochondrial solute carrier protein               112   4e-25    
ref|XP_002946584.1|  mitochondrial substrate carrier                    110   4e-25    
ref|XP_004619533.1|  PREDICTED: calcium-binding mitochondrial car...    112   5e-25    
ref|XP_008574048.1|  PREDICTED: calcium-binding mitochondrial car...    112   5e-25    
ref|XP_004655065.1|  PREDICTED: calcium-binding mitochondrial car...    112   5e-25    
ref|XP_010981654.1|  PREDICTED: calcium-binding mitochondrial car...    112   5e-25    
ref|XP_007009174.1|  Mitochondrial substrate carrier family prote...    112   5e-25    
ref|XP_008574046.1|  PREDICTED: calcium-binding mitochondrial car...    112   6e-25    
ref|XP_006868947.1|  PREDICTED: calcium-binding mitochondrial car...    112   6e-25    
gb|KDQ57586.1|  hypothetical protein JAAARDRAFT_35278                   111   6e-25    
ref|XP_003520959.1|  PREDICTED: mitochondrial substrate carrier f...    111   6e-25    
gb|ELR52063.1|  Calcium-binding mitochondrial carrier protein SCa...    112   7e-25    
ref|XP_010826532.1|  PREDICTED: calcium-binding mitochondrial car...    112   7e-25    
ref|XP_005901808.1|  PREDICTED: calcium-binding mitochondrial car...    112   7e-25    
gb|EQK99301.1|  Mitochondrial carrier domain protein                    111   7e-25    
ref|XP_009077057.1|  PREDICTED: calcium-binding mitochondrial car...    112   7e-25    
ref|XP_004714296.1|  PREDICTED: calcium-binding mitochondrial car...    112   8e-25    
ref|XP_003421696.1|  PREDICTED: calcium-binding mitochondrial car...    112   8e-25    
ref|XP_009506117.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-bind...    108   8e-25    
ref|XP_004343599.2|  substrate carrier family protein                   112   8e-25    
gb|KFP84445.1|  Calcium-binding mitochondrial carrier protein SCa...    112   8e-25    
ref|XP_002992848.1|  hypothetical protein SELMODRAFT_431005             111   8e-25    
ref|XP_008461713.1|  PREDICTED: mitochondrial substrate carrier f...    111   8e-25    
ref|XP_010080118.1|  PREDICTED: LOW QUALITY PROTEIN: calcium-bind...    108   8e-25    
ref|XP_004329529.1|  PREDICTED: calcium-binding mitochondrial car...    112   8e-25    
ref|NP_001233175.1|  calcium-binding mitochondrial carrier protei...    112   9e-25    
ref|XP_004689356.1|  PREDICTED: calcium-binding mitochondrial car...    112   9e-25    
gb|KJB36662.1|  hypothetical protein B456_006G169600                    111   9e-25    
gb|EYU41786.1|  hypothetical protein MIMGU_mgv1a009733mg                110   1e-24    
ref|XP_004277317.1|  PREDICTED: calcium-binding mitochondrial car...    112   1e-24    
ref|XP_001777279.1|  predicted protein                                  112   1e-24    
ref|XP_004595650.1|  PREDICTED: calcium-binding mitochondrial car...    112   1e-24    
ref|XP_007525025.1|  PREDICTED: calcium-binding mitochondrial car...    112   1e-24    
ref|XP_009373668.1|  PREDICTED: calcium-binding mitochondrial car...    111   1e-24    
ref|XP_004149948.1|  PREDICTED: mitochondrial substrate carrier f...    111   1e-24    
gb|KDN42528.1|  hypothetical protein RSAG8_06671                        111   1e-24    
ref|XP_009412566.1|  PREDICTED: mitochondrial substrate carrier f...    111   1e-24    
emb|CAN83157.1|  hypothetical protein VITISV_022552                     112   1e-24    
ref|XP_010965077.1|  PREDICTED: calcium-binding mitochondrial car...    113   1e-24    
ref|XP_012033402.1|  PREDICTED: calcium-binding mitochondrial car...    112   1e-24    
ref|XP_009133214.1|  PREDICTED: mitochondrial substrate carrier f...    110   1e-24    
ref|XP_010663817.1|  PREDICTED: calcium-binding mitochondrial car...    112   1e-24    
ref|XP_010743129.1|  PREDICTED: calcium-binding mitochondrial car...    112   1e-24    
ref|XP_003081597.1|  Mitochondrial ADP/ATP carrier proteins (ISS)       110   1e-24    
ref|XP_010322634.1|  PREDICTED: calcium-binding mitochondrial car...    111   1e-24    
ref|XP_004984913.1|  PREDICTED: mitochondrial substrate carrier f...    109   1e-24    
ref|XP_004503037.1|  PREDICTED: calcium-binding mitochondrial car...    111   1e-24    
ref|XP_012033403.1|  PREDICTED: calcium-binding mitochondrial car...    112   1e-24    
emb|CEF99361.1|  Mitochondrial substrate/solute carrier                 110   1e-24    
ref|XP_002272651.1|  PREDICTED: mitochondrial substrate carrier f...    110   1e-24    
ref|XP_002512812.1|  ADP,ATP carrier protein, putative                  111   1e-24    
ref|XP_003321187.2|  hypothetical protein PGTG_02229                    110   1e-24    
ref|XP_011094922.1|  PREDICTED: mitochondrial substrate carrier f...    110   1e-24    
ref|XP_009378862.1|  PREDICTED: mitochondrial substrate carrier f...    110   1e-24    
ref|XP_003460309.1|  PREDICTED: calcium-binding mitochondrial car...    109   1e-24    
ref|XP_005847872.1|  hypothetical protein CHLNCDRAFT_23011              109   1e-24    
ref|XP_005520980.1|  PREDICTED: calcium-binding mitochondrial car...    111   1e-24    
ref|XP_006170310.1|  PREDICTED: calcium-binding mitochondrial car...    111   2e-24    
emb|CBI15774.3|  unnamed protein product                                112   2e-24    
ref|XP_004906054.1|  PREDICTED: calcium-binding mitochondrial car...    111   2e-24    
ref|XP_009378868.1|  PREDICTED: mitochondrial substrate carrier f...    110   2e-24    
gb|EMS49732.1|  Calcium-binding mitochondrial carrier protein SCa...    110   2e-24    
dbj|GAM17017.1|  hypothetical protein SAMD00019534_001920               110   2e-24    
ref|XP_002877948.1|  mitochondrial substrate carrier family protein     110   2e-24    
ref|XP_010663816.1|  PREDICTED: calcium-binding mitochondrial car...    112   2e-24    
emb|CAN73411.1|  hypothetical protein VITISV_024376                     110   2e-24    
ref|XP_008835129.1|  PREDICTED: calcium-binding mitochondrial car...    110   2e-24    
emb|CCO31635.1|  putative mitochondrial carrier YPR011C                 107   2e-24    
ref|XP_010826529.1|  PREDICTED: calcium-binding mitochondrial car...    111   2e-24    
ref|NP_190962.2|  mitochondrial substrate carrier family protein        110   2e-24    
ref|XP_005611836.1|  PREDICTED: calcium-binding mitochondrial car...    111   2e-24    
ref|XP_007339346.1|  mitochondrial carrier                              110   2e-24    
gb|EYU19953.1|  hypothetical protein MIMGU_mgv1a009862mg                110   2e-24    
ref|XP_011865269.1|  PREDICTED: mitochondrial thiamine pyrophosph...    110   2e-24    
ref|XP_006366294.1|  PREDICTED: calcium-binding mitochondrial car...    110   2e-24    
ref|XP_006457336.1|  hypothetical protein AGABI2DRAFT_196090            109   2e-24    
ref|XP_010256767.1|  PREDICTED: mitochondrial substrate carrier f...    110   2e-24    
ref|XP_007952638.1|  PREDICTED: calcium-binding mitochondrial car...    111   2e-24    
gb|EMS64325.1|  Mitochondrial substrate carrier family protein B        108   2e-24    
ref|XP_011077623.1|  PREDICTED: mitochondrial substrate carrier f...    110   2e-24    
ref|XP_007032054.1|  Mitochondrial substrate carrier family prote...    111   2e-24    
ref|XP_006868948.1|  PREDICTED: calcium-binding mitochondrial car...    110   2e-24    
ref|XP_007134012.1|  hypothetical protein PHAVU_010G011800g             110   2e-24    
ref|XP_006346817.1|  PREDICTED: mitochondrial substrate carrier f...    110   2e-24    
emb|CDY59491.1|  BnaC03g72120D                                          110   2e-24    
ref|XP_007510410.1|  predicted protein                                  109   2e-24    
ref|XP_007864537.1|  mitochondrial carrier                              110   2e-24    
ref|XP_010691623.1|  PREDICTED: mitochondrial substrate carrier f...    110   2e-24    
ref|XP_011995084.1|  PREDICTED: calcium-binding mitochondrial car...    111   2e-24    
gb|KIO19166.1|  hypothetical protein M407DRAFT_150116                   110   2e-24    
ref|XP_004771646.1|  PREDICTED: calcium-binding mitochondrial car...    110   2e-24    
gb|EMD37486.1|  hypothetical protein CERSUDRAFT_114129                  110   2e-24    
ref|XP_011995081.1|  PREDICTED: calcium-binding mitochondrial car...    111   2e-24    
ref|XP_007169161.1|  PREDICTED: calcium-binding mitochondrial car...    110   2e-24    
ref|XP_010905843.1|  PREDICTED: mitochondrial substrate carrier f...    110   3e-24    
ref|XP_007627394.1|  PREDICTED: calcium-binding mitochondrial car...    110   3e-24    
gb|EGV93748.1|  Calcium-binding mitochondrial carrier protein SCa...    113   3e-24    
ref|XP_011995082.1|  PREDICTED: calcium-binding mitochondrial car...    111   3e-24    
ref|XP_004302699.1|  PREDICTED: mitochondrial substrate carrier f...    109   3e-24    
ref|XP_007169160.1|  PREDICTED: calcium-binding mitochondrial car...    110   3e-24    
ref|XP_007169159.1|  PREDICTED: calcium-binding mitochondrial car...    110   3e-24    
ref|XP_008508979.1|  PREDICTED: calcium-binding mitochondrial car...    110   3e-24    
ref|XP_010633064.1|  PREDICTED: calcium-binding mitochondrial car...    110   3e-24    
ref|XP_006045178.1|  PREDICTED: calcium-binding mitochondrial car...    110   3e-24    
ref|XP_006446898.1|  hypothetical protein CICLE_v10015032mg             109   3e-24    
ref|NP_001132148.2|  uncharacterized protein LOC100193567               108   3e-24    
ref|XP_010633063.1|  PREDICTED: calcium-binding mitochondrial car...    111   3e-24    
ref|XP_005884468.1|  PREDICTED: calcium-binding mitochondrial car...    110   3e-24    
ref|XP_008448407.1|  PREDICTED: mitochondrial substrate carrier f...    109   3e-24    
ref|XP_006764286.1|  PREDICTED: calcium-binding mitochondrial car...    110   3e-24    
ref|XP_004378474.1|  PREDICTED: calcium-binding mitochondrial car...    110   3e-24    
ref|NP_001100343.1|  calcium-binding mitochondrial carrier protei...    110   3e-24    
ref|NP_001038417.1|  solute carrier family 25, member 23                110   3e-24    
ref|XP_007460633.1|  PREDICTED: calcium-binding mitochondrial car...    110   3e-24    
ref|XP_007640644.1|  PREDICTED: calcium-binding mitochondrial car...    110   3e-24    
ref|XP_005332294.1|  PREDICTED: calcium-binding mitochondrial car...    110   4e-24    
gb|EMT02893.1|  Calcium-binding mitochondrial carrier protein SCa...    110   4e-24    
gb|EYU26616.1|  hypothetical protein MIMGU_mgv1a009595mg                109   4e-24    
ref|XP_009373667.1|  PREDICTED: calcium-binding mitochondrial car...    110   4e-24    
ref|XP_002969080.1|  hypothetical protein SELMODRAFT_409897             109   4e-24    
ref|XP_004241649.1|  PREDICTED: calcium-binding mitochondrial car...    110   4e-24    
ref|XP_008811512.1|  PREDICTED: mitochondrial substrate carrier f...    109   4e-24    
gb|ERN06329.1|  hypothetical protein AMTR_s00016p00237360               110   4e-24    
emb|CDI56480.1|  related to mitochondrial carrier protein               110   4e-24    
ref|XP_004809592.1|  PREDICTED: calcium-binding mitochondrial car...    110   4e-24    
ref|XP_010528569.1|  PREDICTED: mitochondrial substrate carrier f...    109   4e-24    
ref|XP_004906053.1|  PREDICTED: calcium-binding mitochondrial car...    112   4e-24    
ref|XP_006602613.1|  PREDICTED: mitochondrial substrate carrier f...    108   4e-24    
ref|XP_006844654.2|  PREDICTED: calcium-binding mitochondrial car...    110   4e-24    
ref|XP_002277297.1|  PREDICTED: calcium-binding mitochondrial car...    110   5e-24    
ref|NP_998422.1|  calcium-binding mitochondrial carrier protein S...    110   5e-24    
ref|XP_003551509.1|  PREDICTED: mitochondrial substrate carrier f...    108   5e-24    
ref|XP_002309090.2|  hypothetical protein POPTR_0006s09300g             109   5e-24    
ref|NP_080153.2|  calcium-binding mitochondrial carrier protein S...    110   5e-24    
gb|KDR75001.1|  hypothetical protein GALMADRAFT_248838                  109   5e-24    
ref|XP_011076771.1|  PREDICTED: mitochondrial substrate carrier f...    108   5e-24    
ref|XP_007317922.1|  hypothetical protein SERLADRAFT_466441             109   5e-24    
ref|XP_008709509.1|  PREDICTED: calcium-binding mitochondrial car...    110   5e-24    
ref|XP_008835127.1|  PREDICTED: calcium-binding mitochondrial car...    109   5e-24    
ref|XP_008658114.1|  PREDICTED: uncharacterized protein LOC100193...    108   5e-24    
ref|XP_011244878.1|  PREDICTED: calcium-binding mitochondrial car...    109   5e-24    
ref|XP_003602734.1|  Calcium-binding mitochondrial carrier protei...    110   5e-24    
dbj|BAJ91546.1|  predicted protein                                      107   5e-24    
gb|KHN28603.1|  Calcium-binding mitochondrial carrier protein SCa...    112   5e-24    
ref|XP_003548488.1|  PREDICTED: calcium-binding mitochondrial car...    110   5e-24    
dbj|BAJ86657.1|  predicted protein                                      110   6e-24    
ref|XP_011244877.1|  PREDICTED: calcium-binding mitochondrial car...    110   6e-24    
gb|KFO28794.1|  Calcium-binding mitochondrial carrier protein SCa...    110   6e-24    
ref|XP_006749183.1|  PREDICTED: calcium-binding mitochondrial car...    109   6e-24    
ref|XP_003344880.1|  hypothetical protein SMAC_06166                    105   6e-24    
ref|XP_007058269.1|  PREDICTED: calcium-binding mitochondrial car...    109   6e-24    
gb|EMF12919.1|  mitochondrial carrier protein                           108   6e-24    
gb|ELU42989.1|  Lpz11p                                                  110   6e-24    
ref|XP_004493102.1|  PREDICTED: calcium-binding mitochondrial car...    109   6e-24    
ref|XP_008291509.1|  PREDICTED: calcium-binding mitochondrial car...    109   6e-24    
gb|KIK67484.1|  hypothetical protein GYMLUDRAFT_37615                   108   6e-24    
ref|XP_006805080.1|  PREDICTED: calcium-binding mitochondrial car...    109   7e-24    
ref|XP_005371175.1|  PREDICTED: calcium-binding mitochondrial car...    109   7e-24    
emb|CCF51827.1|  related to mitochondrial carrier protein               109   7e-24    
ref|XP_003553987.1|  PREDICTED: calcium-binding mitochondrial car...    109   7e-24    
ref|XP_006982346.1|  PREDICTED: calcium-binding mitochondrial car...    109   7e-24    
ref|XP_002312122.1|  mitochondrial substrate carrier family protein     108   7e-24    
ref|XP_004515948.1|  PREDICTED: mitochondrial substrate carrier f...    108   7e-24    
ref|XP_006446899.1|  hypothetical protein CICLE_v10015032mg             108   7e-24    
ref|XP_001769325.1|  predicted protein                                  109   8e-24    
ref|XP_004339053.1|  mitochondrial adp/atp carrier proteins (iss)...    108   8e-24    
ref|XP_004562931.1|  PREDICTED: calcium-binding mitochondrial car...    109   8e-24    
emb|CDM81098.1|  unnamed protein product                                107   8e-24    
gb|EDL38228.1|  solute carrier family 25 (mitochondrial carrier; ...    109   8e-24    
ref|XP_006291362.1|  hypothetical protein CARUB_v10017501mg             108   8e-24    
ref|XP_008375425.1|  PREDICTED: calcium-binding mitochondrial car...    108   8e-24    
ref|XP_007109423.1|  PREDICTED: calcium-binding mitochondrial car...    109   8e-24    
ref|XP_006170309.1|  PREDICTED: calcium-binding mitochondrial car...    110   8e-24    
ref|XP_006270480.1|  PREDICTED: calcium-binding mitochondrial car...    109   9e-24    
ref|XP_010108384.1|  Mitochondrial substrate carrier family prote...    108   9e-24    
dbj|GAC98700.1|  hypothetical protein PHSY_006294                       109   9e-24    
ref|XP_007169158.1|  PREDICTED: calcium-binding mitochondrial car...    109   9e-24    
ref|XP_004699609.1|  PREDICTED: calcium-binding mitochondrial car...    109   9e-24    
ref|XP_007361771.1|  mitochondrial carrier                              108   9e-24    
gb|KJB74085.1|  hypothetical protein B456_011G271000                    108   9e-24    
ref|XP_011468225.1|  PREDICTED: calcium-binding mitochondrial car...    108   1e-23    
ref|XP_008388081.1|  PREDICTED: mitochondrial substrate carrier f...    108   1e-23    
ref|XP_008423002.1|  PREDICTED: calcium-binding mitochondrial car...    108   1e-23    
gb|KFO56519.1|  Calcium-binding mitochondrial carrier protein SCa...    108   1e-23    
ref|XP_003461143.1|  PREDICTED: calcium-binding mitochondrial car...    108   1e-23    
ref|XP_004999408.1|  PREDICTED: calcium-binding mitochondrial car...    108   1e-23    
ref|XP_006045176.1|  PREDICTED: calcium-binding mitochondrial car...    109   1e-23    
ref|XP_002927818.1|  PREDICTED: calcium-binding mitochondrial car...    108   1e-23    
ref|XP_006341461.1|  PREDICTED: calcium-binding mitochondrial car...    109   1e-23    
gb|EWY91225.1|  hypothetical protein FOYG_08401                         106   1e-23    
gb|EMT20308.1|  Mitochondrial substrate carrier family protein B        107   1e-23    
emb|CEL54090.1|  putative mitochondrial carrier YPR011C OS=Saccha...    108   1e-23    
ref|XP_006468929.1|  PREDICTED: calcium-binding mitochondrial car...    109   1e-23    
emb|CDO98290.1|  unnamed protein product                                109   1e-23    
gb|AAP06887.1|  putative peroxisomal Ca-dependent solute carrier ...    107   1e-23    
ref|XP_003981818.2|  PREDICTED: calcium-binding mitochondrial car...    110   1e-23    
ref|NP_001049667.1|  Os03g0267700                                       107   1e-23    
ref|XP_008600269.1|  solute carrier family 25 member 42                 109   1e-23    
ref|XP_010407803.1|  PREDICTED: calcium-binding mitochondrial car...    108   1e-23    
ref|XP_003964423.1|  PREDICTED: calcium-binding mitochondrial car...    108   1e-23    
ref|XP_003460361.1|  PREDICTED: calcium-binding mitochondrial car...    107   1e-23    
gb|KFH46822.1|  putative mitochondrial carrier-like protein             107   1e-23    
ref|XP_008628690.1|  PREDICTED: calcium-binding mitochondrial car...    108   1e-23    
ref|XP_008034413.1|  mitochondrial carrier                              107   1e-23    
ref|XP_007075244.1|  PREDICTED: calcium-binding mitochondrial car...    109   1e-23    
ref|XP_006446893.1|  hypothetical protein CICLE_v10015524mg             107   1e-23    
ref|XP_010427055.1|  PREDICTED: mitochondrial substrate carrier f...    107   1e-23    



>ref|XP_004248074.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Solanum lycopersicum]
 ref|XP_010327001.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Solanum lycopersicum]
Length=355

 Score =   313 bits (801),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  ENSPYQYRGMFHALSTVLR EGPRALYKGW PSVIGV+PYVGLNFAVYESLKDW
Sbjct  171  RLTVQTENSPYQYRGMFHALSTVLREEGPRALYKGWTPSVIGVIPYVGLNFAVYESLKDW  230

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K+KP GLV++SEL +VTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGW  AASIVTG+
Sbjct  231  LVKTKPFGLVDNSELGVVTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWSHAASIVTGD  290

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+APLEYTGMIDAFRKTV+YEGVRALYKGLVPNSVKVVPSI+IAFV YEQVKD+LGVE
Sbjct  291  GRSKAPLEYTGMIDAFRKTVKYEGVRALYKGLVPNSVKVVPSISIAFVAYEQVKDLLGVE  350

Query  265  IRISD  251
            IRISD
Sbjct  351  IRISD  355


 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 82/167 (49%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG + L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  78   KYNGTIQGLKYIWRTEGFKGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYLYRQQTGN  137

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +Y 
Sbjct  138  EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTV-------------QTENSPYQYR  184

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A    +R EG RALYKG  P+ + V+P + + F  YE +KD L
Sbjct  185  GMFHALSTVLREEGPRALYKGWTPSVIGVIPYVGLNFAVYESLKDWL  231



>ref|XP_006358640.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Solanum tuberosum]
Length=355

 Score =   313 bits (801),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  ENSPYQYRGMFHALSTVLR EGPRALYKGW PSVIGV+PYVGLNFAVYESLKDW
Sbjct  171  RLTVQTENSPYQYRGMFHALSTVLREEGPRALYKGWTPSVIGVIPYVGLNFAVYESLKDW  230

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K+KP GLV++SEL +VTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGW  AASIVTG+
Sbjct  231  LVKTKPFGLVDNSELGVVTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWSHAASIVTGD  290

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+APLEYTGMIDAFRKTV+YEGVRALYKGLVPNSVKVVPSI+IAFV YEQVKD+LGVE
Sbjct  291  GRSKAPLEYTGMIDAFRKTVKYEGVRALYKGLVPNSVKVVPSISIAFVAYEQVKDLLGVE  350

Query  265  IRISD  251
            IRISD
Sbjct  351  IRISD  355


 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 83/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG + L+KG   +   +VP   + F  YE + K  L   +    +
Sbjct  78   KYNGTIQGLKYIWRTEGFKGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYLYRQQTGI  137

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +Y 
Sbjct  138  EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTV-------------QTENSPYQYR  184

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A    +R EG RALYKG  P+ + V+P + + F  YE +KD L
Sbjct  185  GMFHALSTVLREEGPRALYKGWTPSVIGVIPYVGLNFAVYESLKDWL  231



>emb|CDP08711.1| unnamed protein product [Coffea canephora]
Length=354

 Score =   311 bits (798),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SPYQYRGMFHAL+TVLR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  170  RLTVQTEKSPYQYRGMFHALATVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K+KP GLVEDSEL ++TRLACGAAAGTVGQTVAYP DV+RRRMQMVGWK AAS+VTG+
Sbjct  230  LVKAKPFGLVEDSELGVITRLACGAAAGTVGQTVAYPFDVMRRRMQMVGWKDAASVVTGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+APLEYTGMIDAFRKTVR+EG +ALYKGLVPNSVKVVPSIAIAFVTYEQVKD+LGVE
Sbjct  290  GRSKAPLEYTGMIDAFRKTVRHEGFKALYKGLVPNSVKVVPSIAIAFVTYEQVKDLLGVE  349

Query  265  IRISD  251
            IRISD
Sbjct  350  IRISD  354


 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 84/169 (50%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE       WL + K   
Sbjct  77   KYSGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYREKTGN  136

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              ED+EL+ V RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  137  --EDAELTPVLRLGAGACAGIIAMSATYPMDMVRGRLTV-------------QTEKSPYQ  181

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y GM  A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  182  YRGMFHALATVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  230



>ref|XP_007040459.1| Adenine nucleotide transporter 1 isoform 2 [Theobroma cacao]
 gb|EOY24960.1| Adenine nucleotide transporter 1 isoform 2 [Theobroma cacao]
Length=258

 Score =   308 bits (788),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP QYRG+FHALSTVLR EGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  74   RLTVQTEKSPRQYRGIFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  133

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKSKP GLVEDSEL ++TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+VTG+
Sbjct  134  LIKSKPFGLVEDSELGVMTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASVVTGD  193

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GKS+APLEYTGM+DAFRKTVRYEG+ ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  194  GKSKAPLEYTGMVDAFRKTVRYEGIGALYKGLVPNSVKVVPSIAIAFVTYELVKDVLGVE  253

Query  265  IRISD  251
            +RISD
Sbjct  254  LRISD  258


 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 75/147 (51%), Gaps = 14/147 (10%)
 Frame = -3

Query  712  LYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLVEDSELSIVTRLacgaaagtv  536
            ++KG   +   ++P   + F  YE + K  L   +     ED++L+ V RL  GA AG +
Sbjct  1    MFKGNGTNCARIIPNSAVKFFSYEEASKQILYLYRQHSGNEDAQLTPVLRLGAGACAGII  60

Query  535  gqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTGMIDAFRKTVRYEGVRALYK  356
              +  YP+D++R R+ +                ++P +Y G+  A    +R EG RALYK
Sbjct  61   AMSATYPMDMVRGRLTV-------------QTEKSPRQYRGIFHALSTVLREEGPRALYK  107

Query  355  GLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            G +P+ + VVP + + F  YE +KD L
Sbjct  108  GWLPSVIGVVPYVGLNFAVYESLKDWL  134



>ref|XP_010104983.1| Mitochondrial substrate carrier family protein B [Morus notabilis]
 gb|EXC02940.1| Mitochondrial substrate carrier family protein B [Morus notabilis]
Length=357

 Score =   311 bits (797),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 165/185 (89%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP QYRG+FHAL+TVLR EGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  173  RLTVQTEKSPRQYRGIFHALTTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  232

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK++P GLVEDSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AASIVTG+
Sbjct  233  LIKARPFGLVEDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASIVTGD  292

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GKS+APLEYTGMIDAFRKTVR+EG RALYKGLVPNSVKVVPSIAIAFVTYE VKDILGVE
Sbjct  293  GKSKAPLEYTGMIDAFRKTVRHEGARALYKGLVPNSVKVVPSIAIAFVTYEVVKDILGVE  352

Query  265  IRISD  251
            +RISD
Sbjct  353  MRISD  357


 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 51/167 (31%), Positives = 84/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + + EG R ++KG   +   +VP   + F  YE + K  L   +     
Sbjct  80   RYSGTIQGLKYIWKTEGVRGMFKGNGTNCARIVPNSAVKFYSYEQASKGILCLYRQQTGE  139

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            E+++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +Y 
Sbjct  140  EEAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTV-------------QTEKSPRQYR  186

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            G+  A    +R EG RALYKG +P+ + VVP + + F  YE +KD L
Sbjct  187  GIFHALTTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  233



>ref|XP_010661886.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
isoform X2 [Vitis vinifera]
Length=353

 Score =   311 bits (796),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  ENSPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  169  RLTVQTENSPYQYRGMFHALSTVLRQEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  228

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKSK  GLV D+EL + TRLACGAAAGT+GQTVAYPLDVIRRRMQM+GWK AASIVTGE
Sbjct  229  LIKSKAFGLVHDNELGVTTRLACGAAAGTIGQTVAYPLDVIRRRMQMIGWKDAASIVTGE  288

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+AP+EYTGM+DAFRKTVR+EG+ ALYKGLVPNSVKVVPSIA+AFVTYE VKDILGVE
Sbjct  289  GRSKAPIEYTGMVDAFRKTVRHEGIGALYKGLVPNSVKVVPSIALAFVTYEMVKDILGVE  348

Query  265  IRISD  251
            IRISD
Sbjct  349  IRISD  353


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 80/166 (48%), Gaps = 13/166 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            +Y G    L  + + EG R L+KG   +   ++P   + F  YE     ++         
Sbjct  77   KYNGTIQGLKYIWKTEGFRGLFKGNGTNCARIIPNSAVKFFSYEQASKGILYLYQQQTGN  136

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
            D++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +Y G
Sbjct  137  DAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TENSPYQYRG  183

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            M  A    +R EG RALYKG +P+ + VVP + + F  YE +KD L
Sbjct  184  MFHALSTVLRQEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  229



>ref|XP_002280675.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
isoform X1 [Vitis vinifera]
 emb|CBI40481.3| unnamed protein product [Vitis vinifera]
Length=354

 Score =   311 bits (796),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  ENSPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  170  RLTVQTENSPYQYRGMFHALSTVLRQEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKSK  GLV D+EL + TRLACGAAAGT+GQTVAYPLDVIRRRMQM+GWK AASIVTGE
Sbjct  230  LIKSKAFGLVHDNELGVTTRLACGAAAGTIGQTVAYPLDVIRRRMQMIGWKDAASIVTGE  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+AP+EYTGM+DAFRKTVR+EG+ ALYKGLVPNSVKVVPSIA+AFVTYE VKDILGVE
Sbjct  290  GRSKAPIEYTGMVDAFRKTVRHEGIGALYKGLVPNSVKVVPSIALAFVTYEMVKDILGVE  349

Query  265  IRISD  251
            IRISD
Sbjct  350  IRISD  354


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 83/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + + EG R L+KG   +   ++P   + F  YE + K  L   +     
Sbjct  77   KYNGTIQGLKYIWKTEGFRGLFKGNGTNCARIIPNSAVKFFSYEQASKGILYLYQQQTGN  136

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +Y 
Sbjct  137  EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TENSPYQYR  183

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A    +R EG RALYKG +P+ + VVP + + F  YE +KD L
Sbjct  184  GMFHALSTVLRQEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  230



>ref|XP_011023215.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Populus euphratica]
Length=354

 Score =   310 bits (795),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SPYQYRGMFHAL+TVLR EGPRALYKGWLPSVIGV+PYVGLNF+VYESLKDW
Sbjct  170  RLTVQTEKSPYQYRGMFHALATVLRQEGPRALYKGWLPSVIGVIPYVGLNFSVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K++P GLVEDSEL++ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKGAASIVTG+
Sbjct  230  LVKARPSGLVEDSELNVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKGAASIVTGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+APLEYTGMIDAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGV+
Sbjct  290  GRSKAPLEYTGMIDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDILGVQ  349

Query  265  IRISD  251
            IRISD
Sbjct  350  IRISD  354


 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 83/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG   L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  77   KYNGTIQGLKYIWRTEGFHGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYLYQQQTGN  136

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +Y 
Sbjct  137  EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TEKSPYQYR  183

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  184  GMFHALATVLRQEGPRALYKGWLPSVIGVIPYVGLNFSVYESLKDWL  230



>ref|XP_012083252.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Jatropha curcas]
 gb|KDP28516.1| hypothetical protein JCGZ_14287 [Jatropha curcas]
Length=354

 Score =   310 bits (794),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  170  RLTVQTEKSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK+KP GLVEDS+LS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AASI+TG+
Sbjct  230  LIKAKPFGLVEDSDLSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASIITGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+APLEY+GMIDAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGVE
Sbjct  290  GRSKAPLEYSGMIDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDILGVE  349

Query  265  IRISD  251
            +RISD
Sbjct  350  VRISD  354


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 84/169 (50%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE       WL + +   
Sbjct  77   KYNGTIQGLRYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEEASKGILWLYQKQTGN  136

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              ED++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  137  --EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TEKSPYQ  181

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y GM  A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  182  YRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  230



>ref|XP_002302618.1| mitochondrial substrate carrier family protein [Populus trichocarpa]
 gb|EEE81891.1| mitochondrial substrate carrier family protein [Populus trichocarpa]
Length=354

 Score =   310 bits (794),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 176/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP+QYRGMFHALSTVLR EGPRALYKGWLPSVIGV+PYVGLNF+VYESLKDW
Sbjct  170  RLTVQTEKSPHQYRGMFHALSTVLRQEGPRALYKGWLPSVIGVIPYVGLNFSVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K++P GLVEDSEL++ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKGAASIVTG+
Sbjct  230  LVKARPSGLVEDSELNVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKGAASIVTGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+APLEYTGMIDAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGV+
Sbjct  290  GRSKAPLEYTGMIDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDILGVQ  349

Query  265  IRISD  251
            IRISD
Sbjct  350  IRISD  354


 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 83/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG   L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  77   KYNGTIQGLKYIWRTEGFHGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYLYQQQTGN  136

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+ + RL  GA AG +  +  YPLD++R R+ +                ++P +Y 
Sbjct  137  EDAQLTPLLRLGAGACAGIIAMSATYPLDMVRGRLTVQ-------------TEKSPHQYR  183

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  184  GMFHALSTVLRQEGPRALYKGWLPSVIGVIPYVGLNFSVYESLKDWL  230



>ref|XP_008437971.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Cucumis melo]
Length=354

 Score =   310 bits (793),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  + SPYQYRG+FHALSTVLR EGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  170  RLTVQTDKSPYQYRGIFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK+KP GLVEDSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGW  AAS+VTG+
Sbjct  230  LIKNKPFGLVEDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWNNAASVVTGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+APLEYTGM+DAFRKTVRYEG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  290  GRSKAPLEYTGMVDAFRKTVRYEGFSALYKGLVPNSVKVVPSIAIAFVTYEMVKDVLGVE  349

Query  265  IRISD  251
            IRISD
Sbjct  350  IRISD  354


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 83/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + +  L   +     
Sbjct  77   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASRGILYFYREQTGD  136

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
             D++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +Y 
Sbjct  137  HDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTV-------------QTDKSPYQYR  183

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            G+  A    +R EG RALYKG +P+ + VVP + + F  YE +KD L
Sbjct  184  GIFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  230



>ref|XP_011037758.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Populus euphratica]
Length=354

 Score =   309 bits (792),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  + SPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  170  RLTVQTDKSPYQYRGMFHALSTVLRQEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K++P GLVEDSELS+ TRLACGAAAGT+GQTVAYPLDVIRRRMQMVGWK AASIVTG+
Sbjct  230  LVKARPFGLVEDSELSVTTRLACGAAAGTIGQTVAYPLDVIRRRMQMVGWKDAASIVTGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+APLEY GMID FRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGVE
Sbjct  290  GRSKAPLEYNGMIDTFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDILGVE  349

Query  265  IRISD  251
            IRISD
Sbjct  350  IRISD  354


 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 84/168 (50%), Gaps = 16/168 (10%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIK--SKPLGL  599
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE     ++    +  G 
Sbjct  77   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKAILSLYQQQTG-  135

Query  598  VEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEY  419
             ED++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +Y
Sbjct  136  NEDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTV-------------QTDKSPYQY  182

Query  418  TGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
             GM  A    +R EG RALYKG +P+ + VVP + + F  YE +KD L
Sbjct  183  RGMFHALSTVLRQEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  230



>gb|KJB41483.1| hypothetical protein B456_007G106400 [Gossypium raimondii]
Length=241

 Score =   305 bits (781),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E+SPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGV+PYVGLNF+VYESLKDW
Sbjct  57   RITVQTESSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFSVYESLKDW  116

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKS+P GLVEDSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+V+G+
Sbjct  117  LIKSRPFGLVEDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASVVSGD  176

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+++A LEYTGMIDAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFV+YE VKDILGVE
Sbjct  177  GRNKASLEYTGMIDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVSYEVVKDILGVE  236

Query  265  IRISD  251
            IRISD
Sbjct  237  IRISD  241



>ref|XP_010266452.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Nelumbo nucifera]
Length=356

 Score =   309 bits (791),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  172  RLTVQTEKSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  231

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK++P GLVEDSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGW  AASIVTG+
Sbjct  232  LIKTRPFGLVEDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWSHAASIVTGD  291

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+APLEYTGM+DAFRKT+R+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  292  GRSKAPLEYTGMVDAFRKTIRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDVLGVE  351

Query  265  IRISD  251
            +RISD
Sbjct  352  MRISD  356


 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 84/169 (50%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + + EG R L+KG   +   +VP   + F  YE       W+ + +   
Sbjct  79   KYNGTIQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWIYQQQTGN  138

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              ED++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  139  --EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TEKSPYQ  183

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y GM  A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  184  YRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  232



>ref|XP_007040458.1| Adenine nucleotide transporter 1 isoform 1 [Theobroma cacao]
 gb|EOY24959.1| Adenine nucleotide transporter 1 isoform 1 [Theobroma cacao]
Length=368

 Score =   309 bits (792),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 164/185 (89%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP QYRG+FHALSTVLR EGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  184  RLTVQTEKSPRQYRGIFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  243

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKSKP GLVEDSEL ++TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+VTG+
Sbjct  244  LIKSKPFGLVEDSELGVMTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASVVTGD  303

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GKS+APLEYTGM+DAFRKTVRYEG+ ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  304  GKSKAPLEYTGMVDAFRKTVRYEGIGALYKGLVPNSVKVVPSIAIAFVTYELVKDVLGVE  363

Query  265  IRISD  251
            +RISD
Sbjct  364  LRISD  368


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 85/179 (47%), Gaps = 24/179 (13%)
 Frame = -3

Query  778  PYQYRGMFHA----------LSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLK  632
            PY  R  F            L  + + EG R ++KG   +   ++P   + F  YE + K
Sbjct  79   PYSLRSHFICMLLGYIPILGLKYIWKTEGFRGMFKGNGTNCARIIPNSAVKFFSYEEASK  138

Query  631  DWLIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVT  452
              L   +     ED++L+ V RL  GA AG +  +  YP+D++R R+ +           
Sbjct  139  QILYLYRQHSGNEDAQLTPVLRLGAGACAGIIAMSATYPMDMVRGRLTV-----------  187

Query  451  GEGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
                 ++P +Y G+  A    +R EG RALYKG +P+ + VVP + + F  YE +KD L
Sbjct  188  --QTEKSPRQYRGIFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  244



>ref|XP_002320851.2| mitochondrial substrate carrier family protein [Populus trichocarpa]
 gb|EEE99166.2| mitochondrial substrate carrier family protein [Populus trichocarpa]
Length=354

 Score =   308 bits (790),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  + SPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  170  RLTVQTDKSPYQYRGMFHALSTVLRQEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K++P GLVEDSELS+ TRLACGAAAGT+GQTVAYPLDVIRRRMQMVGWK AASIVTG+
Sbjct  230  LVKARPFGLVEDSELSVTTRLACGAAAGTIGQTVAYPLDVIRRRMQMVGWKDAASIVTGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+APLEY GMID FRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  290  GRSKAPLEYNGMIDTFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDVLGVE  349

Query  265  IRISD  251
            IRISD
Sbjct  350  IRISD  354


 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 84/168 (50%), Gaps = 16/168 (10%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIK--SKPLGL  599
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE     ++    +  G 
Sbjct  77   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILSLYQQQTG-  135

Query  598  VEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEY  419
             ED++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +Y
Sbjct  136  NEDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TDKSPYQY  182

Query  418  TGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
             GM  A    +R EG RALYKG +P+ + VVP + + F  YE +KD L
Sbjct  183  RGMFHALSTVLRQEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  230



>ref|XP_004133837.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Cucumis sativus]
 gb|KGN56467.1| hypothetical protein Csa_3G120460 [Cucumis sativus]
Length=354

 Score =   308 bits (789),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  + SPYQYRG+FHALSTVLR EGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  170  RLTVQTDKSPYQYRGIFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK+KP GLV+DSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGW  AAS+VTG+
Sbjct  230  LIKNKPFGLVDDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWNNAASVVTGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+A LEYTGM+DAFRKTVRYEG RALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  290  GRSKASLEYTGMVDAFRKTVRYEGFRALYKGLVPNSVKVVPSIAIAFVTYEMVKDVLGVE  349

Query  265  IRISD  251
            IRISD
Sbjct  350  IRISD  354


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 84/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + +  L   +     
Sbjct  77   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASRGILYFYREQTGD  136

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            +D++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +Y 
Sbjct  137  QDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTV-------------QTDKSPYQYR  183

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            G+  A    +R EG RALYKG +P+ + VVP + + F  YE +KD L
Sbjct  184  GIFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  230



>ref|XP_007218199.1| hypothetical protein PRUPE_ppa007790mg [Prunus persica]
 gb|EMJ19398.1| hypothetical protein PRUPE_ppa007790mg [Prunus persica]
Length=355

 Score =   308 bits (789),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 161/185 (87%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  ENSP+QYRGMFHALSTVLR EGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  171  RLTVQTENSPFQYRGMFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  230

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKS+P GLVED++LS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQM GW  AAS++TG+
Sbjct  231  LIKSRPFGLVEDTDLSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMGGWSNAASVITGD  290

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+APLEYTGMIDAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  291  GRSKAPLEYTGMIDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDVLGVE  350

Query  265  IRISD  251
            IRISD
Sbjct  351  IRISD  355


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 85/167 (51%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R+EG R L+KG   +   +VP   + F  YE + K  L+  +     
Sbjct  78   KYNGTIQGLKYIWRSEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILLLYRDQTGN  137

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +Y 
Sbjct  138  EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TENSPFQYR  184

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A    +R EG RALYKG +P+ + VVP + + F  YE +KD L
Sbjct  185  GMFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  231



>ref|XP_008233213.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Prunus mume]
Length=355

 Score =   307 bits (787),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  ENSP+QYRGMFHAL+TVLR EGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  171  RLTVQTENSPFQYRGMFHALTTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  230

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKS+P GLVED++LS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQM GW  AAS++TG+
Sbjct  231  LIKSRPFGLVEDTDLSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMGGWSNAASVITGD  290

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+APLEYTGMIDAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  291  GRSKAPLEYTGMIDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDVLGVE  350

Query  265  IRISD  251
            IRISD
Sbjct  351  IRISD  355


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 84/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L+  +     
Sbjct  78   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILLLYRDQTGN  137

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +Y 
Sbjct  138  EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TENSPFQYR  184

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A    +R EG RALYKG +P+ + VVP + + F  YE +KD L
Sbjct  185  GMFHALTTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  231



>gb|KJB21314.1| hypothetical protein B456_004G043200 [Gossypium raimondii]
Length=228

 Score =   302 bits (774),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  ++SP+QYRGMFHALSTVLR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  44   RLTVQTDSSPFQYRGMFHALSTVLRQEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  103

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK+K  G  EDSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+VTG+
Sbjct  104  LIKNKQFGFAEDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASVVTGD  163

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+++APLEYTGMIDAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGVE
Sbjct  164  GRNKAPLEYTGMIDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDILGVE  223

Query  265  IRISD  251
            IRISD
Sbjct  224  IRISD  228


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 58/107 (54%), Gaps = 13/107 (12%)
 Frame = -3

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +Y 
Sbjct  11   EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTV-------------QTDSSPFQYR  57

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  58   GMFHALSTVLRQEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  104



>gb|KHN35367.1| Mitochondrial substrate carrier family protein B [Glycine soja]
Length=345

 Score =   306 bits (785),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  161  RITVQTEKSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  220

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKS PLGLV+DSELS+ TRLACGAAAGT+GQTVAYPLDVIRRRMQMVGW  AAS+V G+
Sbjct  221  LIKSNPLGLVQDSELSVTTRLACGAAAGTIGQTVAYPLDVIRRRMQMVGWNHAASVVAGD  280

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+ + PLEYTGM+DAFRKTVRYEG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGVE
Sbjct  281  GRGKVPLEYTGMVDAFRKTVRYEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDILGVE  340

Query  265  IRISD  251
            IRISD
Sbjct  341  IRISD  345


 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 84/168 (50%), Gaps = 16/168 (10%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIK--SKPLGL  599
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE     ++    K  G 
Sbjct  68   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILHLYRKQTG-  126

Query  598  VEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEY  419
             ED++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +Y
Sbjct  127  NEDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TEKSPYQY  173

Query  418  TGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
             GM  A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  174  RGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  221



>ref|XP_003521800.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
isoform 1 [Glycine max]
Length=345

 Score =   306 bits (785),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  161  RITVQTEKSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  220

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKS PLGLV+DSELS+ TRLACGAAAGT+GQTVAYPLDVIRRRMQMVGW  AAS+V G+
Sbjct  221  LIKSNPLGLVQDSELSVTTRLACGAAAGTIGQTVAYPLDVIRRRMQMVGWNHAASVVAGD  280

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+ + PLEYTGM+DAFRKTVRYEG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGVE
Sbjct  281  GRGKVPLEYTGMVDAFRKTVRYEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDILGVE  340

Query  265  IRISD  251
            IRISD
Sbjct  341  IRISD  345


 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 84/168 (50%), Gaps = 16/168 (10%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIK--SKPLGL  599
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE     ++    K  G 
Sbjct  68   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILHLYRKQTG-  126

Query  598  VEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEY  419
             ED++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +Y
Sbjct  127  NEDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TEKSPYQY  173

Query  418  TGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
             GM  A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  174  RGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  221



>ref|XP_010261496.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Nelumbo nucifera]
Length=356

 Score =   306 bits (785),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  172  RLTVQTEKSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  231

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K+KP GLVEDSELS+ TRLACGA AGTVGQTVAYPLDVIRRRMQMVGW  AASIVTG+
Sbjct  232  LVKAKPFGLVEDSELSVTTRLACGAVAGTVGQTVAYPLDVIRRRMQMVGWNNAASIVTGD  291

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+A LEYTGM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  292  GRSKATLEYTGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDVLGVE  351

Query  265  IRISD  251
            +RISD
Sbjct  352  MRISD  356


 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 83/169 (49%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + + EG R L+KG   +   +VP   + F  YE   +   W  + +   
Sbjct  79   KYNGTIQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASNGILWFYRQQTGN  138

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              ED+ L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  139  --EDAGLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TEKSPYQ  183

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y GM  A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  184  YRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  232



>gb|KJB41485.1| hypothetical protein B456_007G106400 [Gossypium raimondii]
Length=354

 Score =   306 bits (785),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E+SPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGV+PYVGLNF+VYESLKDW
Sbjct  170  RITVQTESSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFSVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKS+P GLVEDSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+V+G+
Sbjct  230  LIKSRPFGLVEDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASVVSGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+++A LEYTGMIDAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFV+YE VKDILGVE
Sbjct  290  GRNKASLEYTGMIDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVSYEVVKDILGVE  349

Query  265  IRISD  251
            IRISD
Sbjct  350  IRISD  354


 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 83/168 (49%), Gaps = 16/168 (10%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL--IKSKPLGL  599
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE     +  +  +  G 
Sbjct  77   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYLYQRQTG-  135

Query  598  VEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEY  419
             ED++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +Y
Sbjct  136  NEDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TESSPYQY  182

Query  418  TGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
             GM  A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  183  RGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFSVYESLKDWL  230



>ref|XP_003521801.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
isoform 2 [Glycine max]
Length=359

 Score =   306 bits (785),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  175  RITVQTEKSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  234

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKS PLGLV+DSELS+ TRLACGAAAGT+GQTVAYPLDVIRRRMQMVGW  AAS+V G+
Sbjct  235  LIKSNPLGLVQDSELSVTTRLACGAAAGTIGQTVAYPLDVIRRRMQMVGWNHAASVVAGD  294

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+ + PLEYTGM+DAFRKTVRYEG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGVE
Sbjct  295  GRGKVPLEYTGMVDAFRKTVRYEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDILGVE  354

Query  265  IRISD  251
            IRISD
Sbjct  355  IRISD  359


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 86/184 (47%), Gaps = 34/184 (18%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPL----  605
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE     L    PL    
Sbjct  68   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKSL---SPLFTDC  124

Query  604  -----GLV---------EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGA  467
                 G++         ED++L+ + RL  GA AG +  +  YP+D++R R+ +      
Sbjct  125  SFSGRGILHLYRKQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRITVQ-----  179

Query  466  ASIVTGEGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQV  287
                      ++P +Y GM  A    +R EG RALYKG +P+ + V+P + + F  YE +
Sbjct  180  --------TEKSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESL  231

Query  286  KDIL  275
            KD L
Sbjct  232  KDWL  235



>ref|XP_004516398.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Cicer arietinum]
Length=354

 Score =   306 bits (785),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  170  RITVQTEKSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKS+P GLV+DSELS+ TRLACGAAAGT+GQTVAYPLDVIRRRMQM GW  AAS++TG+
Sbjct  230  LIKSRPFGLVQDSELSVTTRLACGAAAGTIGQTVAYPLDVIRRRMQMTGWNNAASVITGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+ +APLEYTGM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIA+AFV+YE VKDILGVE
Sbjct  290  GRGKAPLEYTGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIALAFVSYEMVKDILGVE  349

Query  265  IRISD  251
            IRISD
Sbjct  350  IRISD  354


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 84/168 (50%), Gaps = 16/168 (10%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIK--SKPLGL  599
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE     ++    +  G 
Sbjct  77   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILHLYQQQTG-  135

Query  598  VEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEY  419
             E+++L+ V RL  GA AG +  +  YP+D++R R+ +                ++P +Y
Sbjct  136  NENAQLTPVLRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TEKSPYQY  182

Query  418  TGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
             GM  A    +R EG RALYKG +P+ + VVP + + F  YE +KD L
Sbjct  183  RGMFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  230



>gb|KHG26522.1| Mitochondrial substrate carrier family protein B [Gossypium arboreum]
Length=354

 Score =   306 bits (785),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E+SPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGV+PYVGLNF+VYESLKDW
Sbjct  170  RITVQTESSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFSVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKS+P GLVEDSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+V+G+
Sbjct  230  LIKSRPFGLVEDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASVVSGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+++A LEYTGMIDAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFV+YE VKDILGVE
Sbjct  290  GRNKASLEYTGMIDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVSYEVVKDILGVE  349

Query  265  IRISD  251
            IRISD
Sbjct  350  IRISD  354


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 83/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  77   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYLYQQQTGN  136

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +Y 
Sbjct  137  EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TESSPYQYR  183

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  184  GMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFSVYESLKDWL  230



>ref|XP_011093457.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Sesamum indicum]
Length=354

 Score =   306 bits (785),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SPYQYRGMFHALSTVLR EG RALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  170  RLTVQTEKSPYQYRGMFHALSTVLREEGFRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKSKP GLVED++L +VTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGW  A+SIVTG+
Sbjct  230  LIKSKPFGLVEDNDLGVVTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWNNASSIVTGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+A LEYTGMIDAFRKTVR+EG RALYKGLVPNSVKVVPSIAIAFVTYEQVK++LGVE
Sbjct  290  GRSKASLEYTGMIDAFRKTVRHEGFRALYKGLVPNSVKVVPSIAIAFVTYEQVKELLGVE  349

Query  265  IRISD  251
            IRISD
Sbjct  350  IRISD  354


 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 84/168 (50%), Gaps = 16/168 (10%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIK--SKPLGL  599
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE     ++    +  G 
Sbjct  77   KYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILHLYQQQTG-  135

Query  598  VEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEY  419
             ED++L+ + RL  GA AG +  +  YP+D++R R+ +   K             +P +Y
Sbjct  136  NEDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQTEK-------------SPYQY  182

Query  418  TGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
             GM  A    +R EG RALYKG +P+ + VVP + + F  YE +KD L
Sbjct  183  RGMFHALSTVLREEGFRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  230



>ref|XP_004306695.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Fragaria vesca subsp. vesca]
Length=355

 Score =   306 bits (784),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  171  RITVQTEASPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  230

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKS+P GLV+D++LS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGW  AAS+V GE
Sbjct  231  LIKSRPFGLVQDTDLSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWSHAASVVAGE  290

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+APLEYTGMIDAFRKTVR+EG  ALYKGLVPNSVKVVPSIA+AFV+YE VKDILGVE
Sbjct  291  GRSKAPLEYTGMIDAFRKTVRHEGFGALYKGLVPNSVKVVPSIALAFVSYEMVKDILGVE  350

Query  265  IRISD  251
            IRISD
Sbjct  351  IRISD  355


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 82/169 (49%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R EG R L+ G   +   +VP   + F  YE       W+ + K   
Sbjct  78   KYSGTVQGLKYIWRTEGFRGLFIGNGTNCARIVPNSAVKFFSYEQASKGILWMYREKTGN  137

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              ED++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +
Sbjct  138  --EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRITV-------------QTEASPYQ  182

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y GM  A    +R EG RALYKG +P+ + VVP + + F  YE +KD L
Sbjct  183  YRGMFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  231



>gb|KJB41484.1| hypothetical protein B456_007G106400 [Gossypium raimondii]
Length=353

 Score =   306 bits (784),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 175/185 (95%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E+SPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGV+PYVGLNF+VYESLKDW
Sbjct  169  RITVQTESSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFSVYESLKDW  228

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKS+P GLVEDSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+V+G+
Sbjct  229  LIKSRPFGLVEDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASVVSGD  288

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+++A LEYTGMIDAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFV+YE VKDILGVE
Sbjct  289  GRNKASLEYTGMIDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVSYEVVKDILGVE  348

Query  265  IRISD  251
            IRISD
Sbjct  349  IRISD  353


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/166 (31%), Positives = 80/166 (48%), Gaps = 13/166 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE     ++         
Sbjct  77   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYLYQRQTGN  136

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
            D++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +Y G
Sbjct  137  DAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TESSPYQYRG  183

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            M  A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  184  MFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFSVYESLKDWL  229



>ref|XP_007051615.1| Adenine nucleotide transporter 1 [Theobroma cacao]
 gb|EOX95772.1| Adenine nucleotide transporter 1 [Theobroma cacao]
Length=354

 Score =   305 bits (782),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SPYQYRGM HALSTVLR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  170  RLTVQTERSPYQYRGMIHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKSKP GLVEDSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+VTG+
Sbjct  230  LIKSKPFGLVEDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASVVTGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+++ PLEYTGMIDAFRKTVR+EG  ALYKGLVPN VKVVPSIAIAFVTYE VKDILGVE
Sbjct  290  GRNKGPLEYTGMIDAFRKTVRHEGFGALYKGLVPNFVKVVPSIAIAFVTYEVVKDILGVE  349

Query  265  IRISD  251
            IRISD
Sbjct  350  IRISD  354


 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 85/167 (51%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  77   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYLYQQQTGN  136

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +Y 
Sbjct  137  EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TERSPYQYR  183

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GMI A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  184  GMIHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  230



>emb|CAN60251.1| hypothetical protein VITISV_039402 [Vitis vinifera]
Length=350

 Score =   305 bits (781),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -3

Query  799  TVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLI  620
            T   ENSPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLI
Sbjct  168  TGQTENSPYQYRGMFHALSTVLRQEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLI  227

Query  619  KSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGK  440
            KSK  GLV D+EL + TRLACGAAAGT+GQTVAYPLDVIRRRMQM+GWK AASIVTGEG+
Sbjct  228  KSKAFGLVHDNELGVTTRLACGAAAGTIGQTVAYPLDVIRRRMQMIGWKDAASIVTGEGR  287

Query  439  SQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIR  260
            S+AP+EYTGM+DAFRKTVR+EG+ ALYKGLVPNSVKVVPSIA+AFVTYE VKDILGVEIR
Sbjct  288  SKAPIEYTGMVDAFRKTVRHEGIGALYKGLVPNSVKVVPSIALAFVTYEMVKDILGVEIR  347

Query  259  ISD  251
            ISD
Sbjct  348  ISD  350


 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 83/168 (49%), Gaps = 20/168 (12%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + + EG R L+KG   +   ++P   + F  YE + K  L   +     
Sbjct  77   KYNGTIQGLKYIWKTEGFRGLFKGNGTNCARIIPNSAVKFFSYEQASKGILYLYQQQTGN  136

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQ-APLEY  419
            ED++L+ + RL  GA AG +  +  YP+D+                  G G+++ +P +Y
Sbjct  137  EDAQLTPLLRLGAGACAGIIAMSATYPMDI------------------GTGQTENSPYQY  178

Query  418  TGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
             GM  A    +R EG RALYKG +P+ + VVP + + F  YE +KD L
Sbjct  179  RGMFHALSTVLRQEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  226



>gb|KJB24253.1| hypothetical protein B456_004G135200 [Gossypium raimondii]
Length=258

 Score =   301 bits (771),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP+QYRG+FHALSTVLR EGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  74   RLTVQTEKSPHQYRGIFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  133

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK KPLGLVEDSEL + TRLACGAAAGT+GQTVAYPLDVIRRRMQMVGWK AAS+VTG+
Sbjct  134  LIKRKPLGLVEDSELGVTTRLACGAAAGTIGQTVAYPLDVIRRRMQMVGWKDAASVVTGD  193

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GK++AP+EY GM+D FRKTVRYEG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  194  GKNKAPIEYNGMVDTFRKTVRYEGFGALYKGLVPNSVKVVPSIAIAFVTYELVKDVLGVE  253

Query  265  IRISD  251
            +RISD
Sbjct  254  LRISD  258


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 75/147 (51%), Gaps = 14/147 (10%)
 Frame = -3

Query  712  LYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLVEDSELSIVTRLacgaaagtv  536
            ++KG   +   ++P   + F  YE + K  L   +     ED++L+ + RL  GA AG +
Sbjct  1    MFKGNGTNCARIIPNSAVKFFSYEEASKGILYLYRQQSGNEDAQLTPLLRLGAGACAGII  60

Query  535  gqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTGMIDAFRKTVRYEGVRALYK  356
              +  YP+D++R R+ +                ++P +Y G+  A    +R EG RALYK
Sbjct  61   AMSATYPMDMVRGRLTVQ-------------TEKSPHQYRGIFHALSTVLREEGPRALYK  107

Query  355  GLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            G +P+ + VVP + + F  YE +KD L
Sbjct  108  GWLPSVIGVVPYVGLNFAVYESLKDWL  134



>gb|KJB21315.1| hypothetical protein B456_004G043200 [Gossypium raimondii]
Length=287

 Score =   302 bits (774),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  ++SP+QYRGMFHALSTVLR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  103  RLTVQTDSSPFQYRGMFHALSTVLRQEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  162

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK+K  G  EDSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+VTG+
Sbjct  163  LIKNKQFGFAEDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASVVTGD  222

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+++APLEYTGMIDAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGVE
Sbjct  223  GRNKAPLEYTGMIDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDILGVE  282

Query  265  IRISD  251
            IRISD
Sbjct  283  IRISD  287


 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 83/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  10   KYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYLYQQQTGN  69

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +Y 
Sbjct  70   EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TDSSPFQYR  116

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  117  GMFHALSTVLRQEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  163



>gb|KJB21318.1| hypothetical protein B456_004G043200 [Gossypium raimondii]
Length=354

 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  ++SP+QYRGMFHALSTVLR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  170  RLTVQTDSSPFQYRGMFHALSTVLRQEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK+K  G  EDSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+VTG+
Sbjct  230  LIKNKQFGFAEDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASVVTGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+++APLEYTGMIDAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGVE
Sbjct  290  GRNKAPLEYTGMIDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDILGVE  349

Query  265  IRISD  251
            IRISD
Sbjct  350  IRISD  354


 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 83/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  77   KYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYLYQQQTGN  136

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +Y 
Sbjct  137  EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TDSSPFQYR  183

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  184  GMFHALSTVLRQEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  230



>gb|KJB21316.1| hypothetical protein B456_004G043200 [Gossypium raimondii]
Length=353

 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  ++SP+QYRGMFHALSTVLR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  169  RLTVQTDSSPFQYRGMFHALSTVLRQEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  228

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK+K  G  EDSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+VTG+
Sbjct  229  LIKNKQFGFAEDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASVVTGD  288

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+++APLEYTGMIDAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGVE
Sbjct  289  GRNKAPLEYTGMIDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDILGVE  348

Query  265  IRISD  251
            IRISD
Sbjct  349  IRISD  353


 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/166 (31%), Positives = 80/166 (48%), Gaps = 13/166 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE     ++         
Sbjct  77   KYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYLYQQQTGN  136

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
            D++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +Y G
Sbjct  137  DAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TDSSPFQYRG  183

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            M  A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  184  MFHALSTVLRQEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  229



>gb|KJB21317.1| hypothetical protein B456_004G043200 [Gossypium raimondii]
Length=310

 Score =   303 bits (775),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  ++SP+QYRGMFHALSTVLR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  126  RLTVQTDSSPFQYRGMFHALSTVLRQEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  185

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK+K  G  EDSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+VTG+
Sbjct  186  LIKNKQFGFAEDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASVVTGD  245

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+++APLEYTGMIDAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGVE
Sbjct  246  GRNKAPLEYTGMIDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDILGVE  305

Query  265  IRISD  251
            IRISD
Sbjct  306  IRISD  310


 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 83/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  33   KYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYLYQQQTGN  92

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +Y 
Sbjct  93   EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TDSSPFQYR  139

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  140  GMFHALSTVLRQEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  186



>gb|KHN43116.1| Mitochondrial substrate carrier family protein B [Glycine soja]
Length=345

 Score =   304 bits (778),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  161  RITVQTEKSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  220

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+KS PLGLV+DSELS+ TRLACGAAAGT+GQTVAYPLDVIRRRMQMVGW  AAS+V G+
Sbjct  221  LVKSNPLGLVQDSELSVTTRLACGAAAGTIGQTVAYPLDVIRRRMQMVGWNHAASVVAGD  280

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+ + PL YTGM+DAFRKTVRYEG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGVE
Sbjct  281  GRGKVPLAYTGMVDAFRKTVRYEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDILGVE  340

Query  265  IRISD  251
            IRISD
Sbjct  341  IRISD  345


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 84/168 (50%), Gaps = 16/168 (10%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIK--SKPLGL  599
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE     ++    K  G 
Sbjct  68   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILHLYQKQTG-  126

Query  598  VEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEY  419
             ED++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +Y
Sbjct  127  NEDAQLTPLFRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TEKSPYQY  173

Query  418  TGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
             GM  A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  174  RGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  221



>ref|XP_009377268.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Pyrus x bretschneideri]
Length=355

 Score =   303 bits (777),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  ENSP+QYRGMFHALSTVLR EGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  171  RITVQTENSPFQYRGMFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  230

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKS+P GLV+D++LS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGW  AAS+V+G+
Sbjct  231  LIKSRPFGLVQDTDLSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWSHAASVVSGD  290

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G S+ PLEYTGM+DAFRKTVR+EG  ALYKGLVPN VKVVPSIAIAFVTYE VKD+LGVE
Sbjct  291  GISKTPLEYTGMVDAFRKTVRHEGFGALYKGLVPNCVKVVPSIAIAFVTYEMVKDVLGVE  350

Query  265  IRISD  251
            IRISD
Sbjct  351  IRISD  355


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 83/169 (49%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE       WL + +   
Sbjct  78   KYNGTIQGLKHIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYRDQTGN  137

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              +D++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +
Sbjct  138  --DDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRITV-------------QTENSPFQ  182

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y GM  A    +R EG RALYKG +P+ + VVP + + F  YE +KD L
Sbjct  183  YRGMFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  231



>ref|XP_009626771.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Nicotiana tomentosiformis]
 ref|XP_009763324.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Nicotiana sylvestris]
Length=354

 Score =   303 bits (777),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 172/185 (93%), Gaps = 1/185 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHALSTVLR EGPRALYKGW PSVIGVVPYVGLNFAVYESLKDW
Sbjct  171  RITVQTEKSPYQYRGMFHALSTVLREEGPRALYKGWTPSVIGVVPYVGLNFAVYESLKDW  230

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK+KP GLV+D EL +VTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGW  AASIV G+
Sbjct  231  LIKTKPFGLVDD-ELGVVTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWNHAASIVAGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+ PLEYTGMIDAFRKTV+YEGVRALYKGLVPNSVKVVPSI+IAFV YEQVKD+LGVE
Sbjct  290  GRSKVPLEYTGMIDAFRKTVKYEGVRALYKGLVPNSVKVVPSISIAFVAYEQVKDLLGVE  349

Query  265  IRISD  251
            IRISD
Sbjct  350  IRISD  354


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 83/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG + L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  78   KYNGTIQGLKYIWRTEGFKGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYLYRQQTGN  137

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED+EL+ + RL  GA AG +  +  YP+D++R R+ +                ++P +Y 
Sbjct  138  EDAELTPLLRLGAGACAGIIAMSATYPMDMVRGRITV-------------QTEKSPYQYR  184

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A    +R EG RALYKG  P+ + VVP + + F  YE +KD L
Sbjct  185  GMFHALSTVLREEGPRALYKGWTPSVIGVVPYVGLNFAVYESLKDWL  231



>ref|XP_009779970.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
isoform X1 [Nicotiana sylvestris]
Length=355

 Score =   303 bits (777),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 175/186 (94%), Gaps = 1/186 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGM HALST+LR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  170  RITVQTEKSPYQYRGMVHALSTILREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVEDS-ELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTG  449
            L+K+KPLGLV+DS EL +VTRLACGA AGTVGQTVAYPLDV+RRRMQMVGWK A+SI+TG
Sbjct  230  LVKTKPLGLVDDSAELGVVTRLACGAVAGTVGQTVAYPLDVVRRRMQMVGWKDASSILTG  289

Query  448  EGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGV  269
            +G+S+APLEY+GMID FRKTV+YEG RALYKGLVPNSVKVVPSIAIAFVTYEQVK++LGV
Sbjct  290  DGRSKAPLEYSGMIDTFRKTVKYEGFRALYKGLVPNSVKVVPSIAIAFVTYEQVKELLGV  349

Query  268  EIRISD  251
            EIRISD
Sbjct  350  EIRISD  355


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 85/167 (51%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG + L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  77   KYNGTISGLKYIWRTEGFKGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYLYQQQTGN  136

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +Y 
Sbjct  137  EDAQLTPILRLGAGACAGIIAMSATYPMDMVRGRITV-------------QTEKSPYQYR  183

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM+ A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  184  GMVHALSTILREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  230



>gb|KJB24246.1| hypothetical protein B456_004G135200 [Gossypium raimondii]
 gb|KJB24247.1| hypothetical protein B456_004G135200 [Gossypium raimondii]
 gb|KJB24252.1| hypothetical protein B456_004G135200 [Gossypium raimondii]
Length=354

 Score =   303 bits (776),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP+QYRG+FHALSTVLR EGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  170  RLTVQTEKSPHQYRGIFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK KPLGLVEDSEL + TRLACGAAAGT+GQTVAYPLDVIRRRMQMVGWK AAS+VTG+
Sbjct  230  LIKRKPLGLVEDSELGVTTRLACGAAAGTIGQTVAYPLDVIRRRMQMVGWKDAASVVTGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GK++AP+EY GM+D FRKTVRYEG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  290  GKNKAPIEYNGMVDTFRKTVRYEGFGALYKGLVPNSVKVVPSIAIAFVTYELVKDVLGVE  349

Query  265  IRISD  251
            +RISD
Sbjct  350  LRISD  354


 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 84/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVY-ESLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R ++KG   +   ++P   + F  Y E+ K  L   +     
Sbjct  77   KYNGTIQGLKYIWRTEGFRGMFKGNGTNCARIIPNSAVKFFSYEEASKGILYLYRQQSGN  136

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +Y 
Sbjct  137  EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TEKSPHQYR  183

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            G+  A    +R EG RALYKG +P+ + VVP + + F  YE +KD L
Sbjct  184  GIFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  230



>ref|XP_009779971.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
isoform X2 [Nicotiana sylvestris]
Length=306

 Score =   301 bits (772),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 159/186 (85%), Positives = 175/186 (94%), Gaps = 1/186 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGM HALST+LR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  121  RITVQTEKSPYQYRGMVHALSTILREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  180

Query  625  LIKSKPLGLVEDS-ELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTG  449
            L+K+KPLGLV+DS EL +VTRLACGA AGTVGQTVAYPLDV+RRRMQMVGWK A+SI+TG
Sbjct  181  LVKTKPLGLVDDSAELGVVTRLACGAVAGTVGQTVAYPLDVVRRRMQMVGWKDASSILTG  240

Query  448  EGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGV  269
            +G+S+APLEY+GMID FRKTV+YEG RALYKGLVPNSVKVVPSIAIAFVTYEQVK++LGV
Sbjct  241  DGRSKAPLEYSGMIDTFRKTVKYEGFRALYKGLVPNSVKVVPSIAIAFVTYEQVKELLGV  300

Query  268  EIRISD  251
            EIRISD
Sbjct  301  EIRISD  306


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 61/108 (56%), Gaps = 13/108 (12%)
 Frame = -3

Query  598  VEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEY  419
            +ED++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +Y
Sbjct  87   LEDAQLTPILRLGAGACAGIIAMSATYPMDMVRGRITV-------------QTEKSPYQY  133

Query  418  TGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
             GM+ A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  134  RGMVHALSTILREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  181



>ref|XP_008343426.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Malus domestica]
Length=355

 Score =   303 bits (776),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  ENSP+QYRGMFHALSTVLR EGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  171  RITVQTENSPFQYRGMFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  230

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKS+P GLV+D++LS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGW  AAS+V+G+
Sbjct  231  LIKSRPFGLVQDTDLSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWSHAASVVSGD  290

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G S+ PLEYTGM+DAFRKTVR+EG  ALYKGLVPN VKVVPSIAIAFVTYE VKD+LGVE
Sbjct  291  GISKTPLEYTGMVDAFRKTVRHEGFGALYKGLVPNCVKVVPSIAIAFVTYEMVKDVLGVE  350

Query  265  IRISD  251
            IRISD
Sbjct  351  IRISD  355


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 83/169 (49%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE       WL + +   
Sbjct  78   KYNGTIQGLKHIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYRDQTGN  137

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              +D++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +
Sbjct  138  --DDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRITV-------------QTENSPFQ  182

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y GM  A    +R EG RALYKG +P+ + VVP + + F  YE +KD L
Sbjct  183  YRGMFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  231



>ref|XP_009377876.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Pyrus x bretschneideri]
Length=355

 Score =   303 bits (776),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  ENSP+QYRGMFHALSTVLR EGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  171  RITVQTENSPFQYRGMFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  230

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKS+P GLV+D++LS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQM GW  AAS+V+G+
Sbjct  231  LIKSRPFGLVQDTDLSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMGGWSHAASVVSGD  290

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G S+APLEYTGMIDAFRKTVR+EG  ALYKGLVPNSVKVVPSIA+AFVTYE VKD+LGVE
Sbjct  291  GISKAPLEYTGMIDAFRKTVRHEGFGALYKGLVPNSVKVVPSIALAFVTYEMVKDVLGVE  350

Query  265  IRISD  251
            IRISD
Sbjct  351  IRISD  355


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 84/169 (50%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R+EG R L+KG   +   +VP   + F  YE       WL + +   
Sbjct  78   KYNGTIQGLKYIWRSEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYRDQTGN  137

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              ED++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +
Sbjct  138  --EDAQLTPILRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TENSPFQ  182

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y GM  A    +R EG RALYKG +P+ + VVP + + F  YE +KD L
Sbjct  183  YRGMFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  231



>ref|XP_003554758.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Glycine max]
Length=345

 Score =   303 bits (775),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  161  RITVQTEKSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  220

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+KS PLGLV+DSELS+ TRLACGAAAGT+GQTVAYPLDVIRRRMQMVGW  AAS+V G+
Sbjct  221  LVKSNPLGLVQDSELSVTTRLACGAAAGTIGQTVAYPLDVIRRRMQMVGWNHAASVVAGD  280

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+ + PL YTGM+DAFRKTVRYEG  ALY+GLVPNSVKVVPSIAIAFVTYE VKDILGVE
Sbjct  281  GRGKVPLAYTGMVDAFRKTVRYEGFGALYRGLVPNSVKVVPSIAIAFVTYEVVKDILGVE  340

Query  265  IRISD  251
            IRISD
Sbjct  341  IRISD  345


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 84/168 (50%), Gaps = 16/168 (10%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIK--SKPLGL  599
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE     ++    K  G 
Sbjct  68   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILHLYQKQTG-  126

Query  598  VEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEY  419
             ED++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +Y
Sbjct  127  NEDAQLTPLFRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TEKSPYQY  173

Query  418  TGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
             GM  A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  174  RGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  221



>gb|KCW78146.1| hypothetical protein EUGRSUZ_D02348 [Eucalyptus grandis]
Length=353

 Score =   303 bits (775),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  ENSPYQYRGMFHALS+VLR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLK+W
Sbjct  169  RLTVQTENSPYQYRGMFHALSSVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKEW  228

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK++P GL+EDSELS+ TRLACGA AGTVGQTVAYPLDVIRRRMQMVGW  A+SIVTG+
Sbjct  229  LIKNRPFGLMEDSELSVTTRLACGAVAGTVGQTVAYPLDVIRRRMQMVGWNNASSIVTGD  288

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+++A LEY GM+DAFRKTV+YEG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGVE
Sbjct  289  GRAKAALEYNGMVDAFRKTVKYEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDILGVE  348

Query  265  IRISD  251
            IRISD
Sbjct  349  IRISD  353


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/166 (30%), Positives = 79/166 (48%), Gaps = 13/166 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE     ++         
Sbjct  77   KYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILLLYQQQTGN  136

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
            D++L+   RL  GA AG +  +  YP+D++R R+ +                 +P +Y G
Sbjct  137  DAQLTPPLRLGAGACAGIIAMSATYPMDLVRGRLTVQ-------------TENSPYQYRG  183

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            M  A    +R EG RALYKG +P+ + V+P + + F  YE +K+ L
Sbjct  184  MFHALSSVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKEWL  229



>ref|XP_010053790.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Eucalyptus grandis]
 gb|KCW78147.1| hypothetical protein EUGRSUZ_D02348 [Eucalyptus grandis]
Length=354

 Score =   302 bits (774),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  ENSPYQYRGMFHALS+VLR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLK+W
Sbjct  170  RLTVQTENSPYQYRGMFHALSSVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKEW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK++P GL+EDSELS+ TRLACGA AGTVGQTVAYPLDVIRRRMQMVGW  A+SIVTG+
Sbjct  230  LIKNRPFGLMEDSELSVTTRLACGAVAGTVGQTVAYPLDVIRRRMQMVGWNNASSIVTGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+++A LEY GM+DAFRKTV+YEG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGVE
Sbjct  290  GRAKAALEYNGMVDAFRKTVKYEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDILGVE  349

Query  265  IRISD  251
            IRISD
Sbjct  350  IRISD  354


 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 83/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L+  +     
Sbjct  77   KYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILLLYQQQTGN  136

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+   RL  GA AG +  +  YP+D++R R+ +                 +P +Y 
Sbjct  137  EDAQLTPPLRLGAGACAGIIAMSATYPMDLVRGRLTVQ-------------TENSPYQYR  183

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A    +R EG RALYKG +P+ + V+P + + F  YE +K+ L
Sbjct  184  GMFHALSSVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKEWL  230



>ref|XP_006583253.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
isoform X2 [Glycine max]
Length=197

 Score =   296 bits (759),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKD+
Sbjct  13   RITVQTEASPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDY  72

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKS P GLVE+SELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGW  AAS++TG+
Sbjct  73   LIKSNPFGLVENSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWNHAASVLTGD  132

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+ + PLEYTGM+DAFRKTV++EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGVE
Sbjct  133  GRGKVPLEYTGMVDAFRKTVQHEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDILGVE  192

Query  265  IRISD  251
            IRISD
Sbjct  193  IRISD  197



>gb|EYU38910.1| hypothetical protein MIMGU_mgv1a009053mg [Erythranthe guttata]
Length=354

 Score =   302 bits (774),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  + SPYQYRGMFHALSTVLR EG RALYKGWLPSVIGVVPYVGLNFAVYESLKD+
Sbjct  170  RLTVQTDKSPYQYRGMFHALSTVLREEGFRALYKGWLPSVIGVVPYVGLNFAVYESLKDY  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKSKP G+VED+EL +VTRL CGAAAGTVGQT+AYPLDVIRRRMQMVGW  A+SI+TG+
Sbjct  230  LIKSKPYGIVEDNELGVVTRLGCGAAAGTVGQTIAYPLDVIRRRMQMVGWNNASSIITGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+APLEYTGM+DAFRKTVR+EG RALYKG+VPNSVKVVPSIAIAFVTYEQVK++LGVE
Sbjct  290  GRSKAPLEYTGMVDAFRKTVRHEGFRALYKGIVPNSVKVVPSIAIAFVTYEQVKELLGVE  349

Query  265  IRISD  251
            IRISD
Sbjct  350  IRISD  354


 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 84/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  77   KYNGTVQGLKYIYRTEGLRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYMYRQQTGN  136

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +Y 
Sbjct  137  EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TDKSPYQYR  183

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A    +R EG RALYKG +P+ + VVP + + F  YE +KD L
Sbjct  184  GMFHALSTVLREEGFRALYKGWLPSVIGVVPYVGLNFAVYESLKDYL  230



>gb|EYU32214.1| hypothetical protein MIMGU_mgv1a009069mg [Erythranthe guttata]
Length=354

 Score =   302 bits (773),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  + SPYQYRGMFHALSTVLR EG RALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  170  RLTVQTDKSPYQYRGMFHALSTVLREEGFRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKSK  GLVED+EL ++TRLACGAAAGTVGQT+AYPLDVIRRRMQMVGW  A+SI+TG+
Sbjct  230  LIKSKQFGLVEDNELGVITRLACGAAAGTVGQTIAYPLDVIRRRMQMVGWSHASSILTGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S APL+YTGM+DAFRKTVR+EG RALYKGLVPNSVKVVPSIAIAFVTYEQVK++LGVE
Sbjct  290  GRSNAPLQYTGMVDAFRKTVRHEGFRALYKGLVPNSVKVVPSIAIAFVTYEQVKELLGVE  349

Query  265  IRISD  251
            IRISD
Sbjct  350  IRISD  354


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 84/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG + L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  77   KYSGTVQGLKYIYRTEGFKGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYLYRQQTGD  136

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +Y 
Sbjct  137  EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TDKSPYQYR  183

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A    +R EG RALYKG +P+ + VVP + + F  YE +KD L
Sbjct  184  GMFHALSTVLREEGFRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  230



>ref|XP_010326870.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
isoform X1 [Solanum lycopersicum]
Length=355

 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 173/186 (93%), Gaps = 1/186 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGM HALST+LR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLK+W
Sbjct  170  RITVQTEKSPYQYRGMVHALSTILREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKEW  229

Query  625  LIKSKPLGLVEDS-ELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTG  449
            L+K+KPLGLV+DS EL +VTRLACGA AGT+GQTVAYPLDV+RRRMQMVGWK AASI+TG
Sbjct  230  LVKTKPLGLVDDSTELGVVTRLACGAVAGTMGQTVAYPLDVVRRRMQMVGWKDAASIITG  289

Query  448  EGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGV  269
            +G+S+A LEY+GMID FRKTVRYEG  ALYKGLVPNSVKVVPSIAIAFVTYEQVKD+LGV
Sbjct  290  DGRSKASLEYSGMIDTFRKTVRYEGFSALYKGLVPNSVKVVPSIAIAFVTYEQVKDLLGV  349

Query  268  EIRISD  251
            EIRISD
Sbjct  350  EIRISD  355


 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 91/179 (51%), Gaps = 15/179 (8%)
 Frame = -3

Query  805  RITVXXENS-PYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLK  632
            +I +  +NS   +Y G    L  + R EG + L+KG   +   +VP   + F  YE + K
Sbjct  65   KILLQVQNSHSIKYNGTISGLKYIWRTEGFKGLFKGNGTNCARIVPNSAVKFFSYEQASK  124

Query  631  DWLIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVT  452
              L   +     ED++L+ + RL  GA AG +  +  YP+D++R R+ +   K       
Sbjct  125  GILYLYQQQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRITVQTEK-------  177

Query  451  GEGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
                  +P +Y GM+ A    +R EG RALYKG +P+ + V+P + + F  YE +K+ L
Sbjct  178  ------SPYQYRGMVHALSTILREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKEWL  230



>ref|XP_010326872.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
isoform X2 [Solanum lycopersicum]
Length=354

 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 173/186 (93%), Gaps = 1/186 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGM HALST+LR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLK+W
Sbjct  169  RITVQTEKSPYQYRGMVHALSTILREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKEW  228

Query  625  LIKSKPLGLVEDS-ELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTG  449
            L+K+KPLGLV+DS EL +VTRLACGA AGT+GQTVAYPLDV+RRRMQMVGWK AASI+TG
Sbjct  229  LVKTKPLGLVDDSTELGVVTRLACGAVAGTMGQTVAYPLDVVRRRMQMVGWKDAASIITG  288

Query  448  EGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGV  269
            +G+S+A LEY+GMID FRKTVRYEG  ALYKGLVPNSVKVVPSIAIAFVTYEQVKD+LGV
Sbjct  289  DGRSKASLEYSGMIDTFRKTVRYEGFSALYKGLVPNSVKVVPSIAIAFVTYEQVKDLLGV  348

Query  268  EIRISD  251
            EIRISD
Sbjct  349  EIRISD  354


 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 88/178 (49%), Gaps = 14/178 (8%)
 Frame = -3

Query  805  RITVXXENS-PYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD  629
            +I +  +NS   +Y G    L  + R EG + L+KG   +   +VP   + F  YE    
Sbjct  65   KILLQVQNSHSIKYNGTISGLKYIWRTEGFKGLFKGNGTNCARIVPNSAVKFFSYEQASK  124

Query  628  WLIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTG  449
             ++         D++L+ + RL  GA AG +  +  YP+D++R R+ +   K        
Sbjct  125  GILYLYQQQTGNDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRITVQTEK--------  176

Query  448  EGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
                 +P +Y GM+ A    +R EG RALYKG +P+ + V+P + + F  YE +K+ L
Sbjct  177  -----SPYQYRGMVHALSTILREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKEWL  229



>ref|XP_002532663.1| Grave disease carrier protein, putative [Ricinus communis]
 gb|EEF29736.1| Grave disease carrier protein, putative [Ricinus communis]
Length=354

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  + SPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLK+W
Sbjct  170  RLTVQTDKSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKEW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK+KP GLV+DS+LS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK A+SIV G+
Sbjct  230  LIKAKPFGLVQDSDLSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDASSIVIGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S++ LEYTGMIDAFRKTVRYEG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGVE
Sbjct  290  GRSKSSLEYTGMIDAFRKTVRYEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDILGVE  349

Query  265  IRISD  251
            IRISD
Sbjct  350  IRISD  354


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 84/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVY-ESLKDWLIKSKPLGLV  596
            +Y G    L  + + EG R L+KG   +   +VP   + F  Y E+ K  L   +     
Sbjct  77   KYNGTIQGLRYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEEASKGILYLYRQQTGN  136

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +Y 
Sbjct  137  EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTV-------------QTDKSPYQYR  183

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A    +R EG RALYKG +P+ + V+P + + F  YE +K+ L
Sbjct  184  GMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKEWL  230



>ref|XP_011093053.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Sesamum indicum]
Length=354

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SPYQYRGMFHALSTVLR EG RALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  170  RLTVQTEKSPYQYRGMFHALSTVLREEGFRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+KS P GLVED+EL +VTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGW  A+SIV G+
Sbjct  230  LLKSNPYGLVEDNELGVVTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWSNASSIVAGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+++ PLEYTGMIDAFRKTVR+EG RALYKGLVPNSVKVVPSIAIAFVTYEQVK++LGVE
Sbjct  290  GRTKGPLEYTGMIDAFRKTVRHEGFRALYKGLVPNSVKVVPSIAIAFVTYEQVKELLGVE  349

Query  265  IRISD  251
            IRISD
Sbjct  350  IRISD  354


 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 85/167 (51%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  77   KYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYMYQQQTGN  136

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+ V RLA GA AG +  +  YP+D++R R+ +                ++P +Y 
Sbjct  137  EDAQLTPVLRLAAGACAGIIAMSATYPMDMVRGRLTV-------------QTEKSPYQYR  183

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A    +R EG RALYKG +P+ + VVP + + F  YE +KD L
Sbjct  184  GMFHALSTVLREEGFRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  230



>ref|XP_009610019.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Nicotiana tomentosiformis]
Length=306

 Score =   299 bits (766),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 174/186 (94%), Gaps = 1/186 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGM HALST+LR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  121  RITVQTEKSPYQYRGMVHALSTILREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  180

Query  625  LIKSKPLGLVEDS-ELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTG  449
            L+ +KPLGLV+DS EL +VTRLACGA AGTVGQTVAYPLDV+RRRMQMVGWK A+SI+TG
Sbjct  181  LVTTKPLGLVDDSTELGVVTRLACGAVAGTVGQTVAYPLDVVRRRMQMVGWKDASSILTG  240

Query  448  EGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGV  269
            +G+S+APLEY+GMID FRKTV+YEG RALYKGLVPNSVKVVPSIAIAFVTYEQVK++LGV
Sbjct  241  DGRSKAPLEYSGMIDTFRKTVKYEGFRALYKGLVPNSVKVVPSIAIAFVTYEQVKELLGV  300

Query  268  EIRISD  251
            EIRISD
Sbjct  301  EIRISD  306



>ref|XP_003528803.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
isoform X1 [Glycine max]
 gb|KHN06287.1| Mitochondrial substrate carrier family protein B [Glycine soja]
Length=355

 Score =   300 bits (767),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKD+
Sbjct  171  RITVQTEASPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDY  230

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKS P GLVE+SELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGW  AAS++TG+
Sbjct  231  LIKSNPFGLVENSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWNHAASVLTGD  290

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+ + PLEYTGM+DAFRKTV++EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGVE
Sbjct  291  GRGKVPLEYTGMVDAFRKTVQHEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDILGVE  350

Query  265  IRISD  251
            IRISD
Sbjct  351  IRISD  355


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 83/168 (49%), Gaps = 16/168 (10%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIK--SKPLGL  599
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE     ++    +  G 
Sbjct  78   KYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILHLYQQQTG-  136

Query  598  VEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEY  419
             ED++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +Y
Sbjct  137  NEDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TEASPYQY  183

Query  418  TGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
             GM  A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  184  RGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDYL  231



>ref|XP_009410854.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Musa acuminata subsp. malaccensis]
Length=357

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 160/185 (86%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMF+AL TV R EG RALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  173  RITVQTEKSPYQYRGMFNALGTVYREEGFRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  232

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+KSKP GLVEDSELS+VTRLACGA AGT+GQTVAYPLDVIRRRMQMVGWK AAS+VTGE
Sbjct  233  LVKSKPYGLVEDSELSVVTRLACGAVAGTIGQTVAYPLDVIRRRMQMVGWKDAASVVTGE  292

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+APLEY GMIDAFRKTV +EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGVE
Sbjct  293  GRSKAPLEYAGMIDAFRKTVHHEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDILGVE  352

Query  265  IRISD  251
            +RISD
Sbjct  353  MRISD  357


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 85/169 (50%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            QY G    L  + ++EG R L++G   +   +VP   + F  YE       WL + +   
Sbjct  80   QYNGTIQGLKYIWKSEGFRGLFRGNGTNCARIVPNSAVKFFSYEQASSGILWLYRRQSGN  139

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              ED++++ V RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  140  --EDAQITPVLRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TEKSPYQ  184

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y GM +A     R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  185  YRGMFNALGTVYREEGFRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  233



>ref|XP_002273414.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Vitis vinifera]
 emb|CBI34457.3| unnamed protein product [Vitis vinifera]
Length=354

 Score =   299 bits (765),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP QYRG+FHALSTVLR EG RALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  170  RLTVQTEKSPRQYRGIFHALSTVLREEGARALYKGWLPSVIGVIPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K+KP GLVEDSEL + TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+VTG+
Sbjct  230  LMKAKPFGLVEDSELGVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASVVTGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+ +APLEYTGM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGVE
Sbjct  290  GRGKAPLEYTGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDILGVE  349

Query  265  IRISD  251
            +RISD
Sbjct  350  MRISD  354


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 86/169 (51%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + ++EG R L+KG   +   +VP   + F  YE       WL + +P  
Sbjct  77   KYNGTIQGLKYIWKSEGFRGLFKGNGTNCARIVPNSAVKFYSYEQASKGILWLYRQQPGN  136

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              E++EL+ + RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  137  --ENAELTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TEKSPRQ  181

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  182  YRGIFHALSTVLREEGARALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  230



>ref|NP_001275102.1| mitochondrial carrier-like protein [Solanum tuberosum]
 gb|ABC01898.1| mitochondrial carrier-like protein [Solanum tuberosum]
Length=355

 Score =   299 bits (765),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 172/186 (92%), Gaps = 1/186 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGM HALST+LR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLK+W
Sbjct  170  RITVQTEKSPYQYRGMVHALSTILREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKEW  229

Query  625  LIKSKPLGLVEDS-ELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTG  449
            L+K+KPLGLV+DS E  +VTRLACGA AGT+GQTVAYPLDV+RRRMQMVGWK AASIVTG
Sbjct  230  LVKTKPLGLVDDSTEPGVVTRLACGAVAGTLGQTVAYPLDVVRRRMQMVGWKDAASIVTG  289

Query  448  EGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGV  269
            +G+S+A LEY+GMID FRKTVRYEG  ALYKGLVPNSVKVVPSIAIAFVTYEQVKD+LGV
Sbjct  290  DGRSKASLEYSGMIDTFRKTVRYEGFSALYKGLVPNSVKVVPSIAIAFVTYEQVKDLLGV  349

Query  268  EIRISD  251
            EIRISD
Sbjct  350  EIRISD  355


 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 91/179 (51%), Gaps = 15/179 (8%)
 Frame = -3

Query  805  RITVXXENS-PYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLK  632
            +I +  +NS   +Y G    L  + R EG + L+KG   +   +VP   + F  YE + K
Sbjct  65   KILLQVQNSHSIKYNGTISGLKYIWRTEGFKGLFKGNGTNCARIVPNSAVKFFSYEQASK  124

Query  631  DWLIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVT  452
              L   +     ED++L+ + RL  GA AG +  +  YP+D++R R+ +   K       
Sbjct  125  GILYLYQQQTGNEDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRITVQTEK-------  177

Query  451  GEGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
                  +P +Y GM+ A    +R EG RALYKG +P+ + V+P + + F  YE +K+ L
Sbjct  178  ------SPYQYRGMVHALSTILREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKEWL  230



>ref|XP_007147281.1| hypothetical protein PHAVU_006G110800g [Phaseolus vulgaris]
 gb|ESW19275.1| hypothetical protein PHAVU_006G110800g [Phaseolus vulgaris]
Length=345

 Score =   298 bits (763),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHALSTVL+ EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  161  RITVQTEKSPYQYRGMFHALSTVLKEEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  220

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+KS P G+V+DSELS+ TRLACGAAAGT+GQTVAYPLDVIRRRMQMVGW  AAS++ G+
Sbjct  221  LVKSNPFGIVQDSELSVTTRLACGAAAGTMGQTVAYPLDVIRRRMQMVGWNHAASVIAGD  280

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+ + PLEY+GMIDAF KTVRYEG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGVE
Sbjct  281  GRGKVPLEYSGMIDAFSKTVRYEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDILGVE  340

Query  265  IRISD  251
            IRISD
Sbjct  341  IRISD  345


 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 85/168 (51%), Gaps = 16/168 (10%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIK--SKPLGL  599
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE     +++   K  G 
Sbjct  68   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILQLYQKQTG-  126

Query  598  VEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEY  419
             ED++L+ V RL  GA AG +  +  YP+D++R R+ +                ++P +Y
Sbjct  127  NEDAQLTPVLRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TEKSPYQY  173

Query  418  TGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
             GM  A    ++ EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  174  RGMFHALSTVLKEEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  221



>gb|AFV46218.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=305

 Score =   296 bits (759),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  + SPYQYRGM HALSTVLR EG R LYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  121  RLTVQTDKSPYQYRGMLHALSTVLREEGFRGLYKGWLPSVIGVVPYVGLNFAVYESLKDW  180

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKSK LGLVED+EL + TRL CGAAAGTVGQTVAYPLDVIRRRMQMVGW  AASIVTG+
Sbjct  181  LIKSKALGLVEDNELGVATRLMCGAAAGTVGQTVAYPLDVIRRRMQMVGWSNAASIVTGD  240

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+ +APLEYTGMIDAFRKTVR+EG RALYKGLVPNSVKVVPSIA+AFVTYEQVK++LGVE
Sbjct  241  GRIKAPLEYTGMIDAFRKTVRHEGFRALYKGLVPNSVKVVPSIALAFVTYEQVKELLGVE  300

Query  265  IRISD  251
             RISD
Sbjct  301  FRISD  305


 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 82/162 (51%), Gaps = 14/162 (9%)
 Frame = -3

Query  757  FHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLVEDSEL  581
            +  L  + R EG R L+KG   +   +VP   + F  YE + K  L   +     E+++L
Sbjct  33   YSGLKYIYRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILFLYQQQTGDENAKL  92

Query  580  SIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTGMIDA  401
            + + RL  GA AG V  +  YP+D++R R+ +                ++P +Y GM+ A
Sbjct  93   TPLLRLGAGACAGIVAMSATYPMDMVRGRLTVQ-------------TDKSPYQYRGMLHA  139

Query  400  FRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
                +R EG R LYKG +P+ + VVP + + F  YE +KD L
Sbjct  140  LSTVLREEGFRGLYKGWLPSVIGVVPYVGLNFAVYESLKDWL  181



>ref|XP_010924827.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Elaeis guineensis]
Length=357

 Score =   298 bits (763),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHAL TV R EG RALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  173  RITVQTEKSPYQYRGMFHALGTVYREEGFRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  232

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+KS PLGLVEDSELS+VTRLACGA AGT+GQTVAYPLDVIRRRMQMVGW  AASIV G+
Sbjct  233  LVKSNPLGLVEDSELSVVTRLACGAVAGTIGQTVAYPLDVIRRRMQMVGWNHAASIVAGQ  292

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G S+APLEYTGM+DAFRKTVR EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  293  GGSKAPLEYTGMVDAFRKTVRSEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDVLGVE  352

Query  265  IRISD  251
            +RISD
Sbjct  353  MRISD  357


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 84/169 (50%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R+EG R L+KG   +   +VP   + F  YE       WL + +   
Sbjct  80   KYNGTMQGLKYIWRSEGVRGLFKGNGTNCARIVPNSAVKFFSYEQAASGILWLYRRQSGN  139

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              ED++L+ V RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  140  --EDAQLTPVLRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TEKSPYQ  184

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y GM  A     R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  185  YRGMFHALGTVYREEGFRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  233



>ref|XP_007209295.1| hypothetical protein PRUPE_ppa007764mg [Prunus persica]
 gb|EMJ10494.1| hypothetical protein PRUPE_ppa007764mg [Prunus persica]
Length=356

 Score =   298 bits (763),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP QYRG+ HALSTV R EGPRALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  172  RLTVQTERSPRQYRGIAHALSTVFREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  231

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK++P GLVEDSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+V G+
Sbjct  232  LIKTRPFGLVEDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASVVVGD  291

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GKS+APLEYTGM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  292  GKSKAPLEYTGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDVLGVE  351

Query  265  IRISD  251
            +RISD
Sbjct  352  MRISD  356


 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 82/169 (49%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE       W  + +   
Sbjct  79   KYSGTIQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSYEEASKGILWFYRQQTGN  138

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              ED++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  139  --EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTV-------------QTERSPRQ  183

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A     R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  184  YRGIAHALSTVFREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  232



>ref|XP_008239064.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Prunus mume]
Length=356

 Score =   298 bits (763),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP QYRG+ HALSTV R EGPRALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  172  RLTVQTERSPRQYRGIAHALSTVFREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  231

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK++P GLVEDSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+V G+
Sbjct  232  LIKTRPFGLVEDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASVVVGD  291

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GKS+APLEYTGM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  292  GKSKAPLEYTGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDVLGVE  351

Query  265  IRISD  251
            +RISD
Sbjct  352  MRISD  356


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 82/169 (49%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE       W  + +   
Sbjct  79   KYSGTIQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSYEEASKGILWFYRRQTGN  138

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              ED++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  139  --EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTV-------------QTERSPRQ  183

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A     R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  184  YRGIAHALSTVFREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  232



>gb|KEH18704.1| grave disease carrier protein [Medicago truncatula]
Length=361

 Score =   298 bits (763),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKD+
Sbjct  177  RITVQTEKSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDY  236

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK+KP GL +DSELS+ TRLACGAAAGT+GQTVAYPLDVIRRRMQM GW  AAS++TG+
Sbjct  237  LIKTKPFGLAQDSELSVTTRLACGAAAGTIGQTVAYPLDVIRRRMQMTGWHNAASVITGD  296

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G  + PLEYTGM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIA+AFV+YE VKDILGVE
Sbjct  297  GVGKVPLEYTGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIALAFVSYEMVKDILGVE  356

Query  265  IRISD  251
            IRISD
Sbjct  357  IRISD  361


 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 84/168 (50%), Gaps = 16/168 (10%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIK--SKPLGL  599
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE     ++    +  G 
Sbjct  84   KYSGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILHLYRQQTG-  142

Query  598  VEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEY  419
             ED++L+ V RL  GA AG +  +  YP+D++R R+ +   K             +P +Y
Sbjct  143  NEDAQLTPVLRLGAGACAGIIAMSATYPMDMVRGRITVQTEK-------------SPYQY  189

Query  418  TGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
             GM  A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  190  RGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDYL  237



>ref|XP_012086759.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Jatropha curcas]
 gb|KDP25326.1| hypothetical protein JCGZ_20482 [Jatropha curcas]
Length=354

 Score =   298 bits (762),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  +NSP QYRG++HALSTVL+ EGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  170  RLTVQTQNSPRQYRGIYHALSTVLKEEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K+ P GLV+D+ELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+VTG+
Sbjct  230  LLKTNPFGLVQDNELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASVVTGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GK +APLEYTGM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  290  GKIKAPLEYTGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEIVKDVLGVE  349

Query  265  IRISD  251
            +RISD
Sbjct  350  VRISD  354


 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/169 (29%), Positives = 83/169 (49%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + + EG R L+KG   +   ++P   + F  YE       W+ + +   
Sbjct  77   KYNGTIQGLKYIWKTEGFRGLFKGNGTNCARIIPNSAVKFFSYEEASKGILWVYRQQTGN  136

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              +D++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +
Sbjct  137  --DDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TQNSPRQ  181

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A    ++ EG RALYKG +P+ + VVP + + F  YE +KD L
Sbjct  182  YRGIYHALSTVLKEEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  230



>ref|XP_002509930.1| Grave disease carrier protein, putative [Ricinus communis]
 gb|EEF51317.1| Grave disease carrier protein, putative [Ricinus communis]
Length=355

 Score =   298 bits (762),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP QY+G+FHALSTVL+ EGPRALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  171  RLTVQTEASPRQYKGIFHALSTVLKEEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  230

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+KSKP GLV+D+EL + TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS++TG+
Sbjct  231  LLKSKPFGLVQDNELGVATRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASVITGD  290

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GK++APLEYTGM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  291  GKTKAPLEYTGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYELVKDVLGVE  350

Query  265  IRISD  251
            +RISD
Sbjct  351  VRISD  355


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 83/169 (49%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE       W+ + +   
Sbjct  78   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEEASKGILWMYRQQTGN  137

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              +D++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +
Sbjct  138  --DDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TEASPRQ  182

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A    ++ EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  183  YKGIFHALSTVLKEEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  231



>ref|XP_010522928.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Tarenaya hassleriana]
Length=355

 Score =   298 bits (762),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV   NSPYQYRGMFHALSTVLR EGPRALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  171  RLTVQTLNSPYQYRGMFHALSTVLRQEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  230

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K+ P GLV+DSELS+ TRLACGAAAGTVGQT+AYPLDVIRRRMQMVGWK A+S+VTG+
Sbjct  231  LVKANPYGLVQDSELSVTTRLACGAAAGTVGQTIAYPLDVIRRRMQMVGWKDASSVVTGD  290

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G S+A LEY GMIDAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  291  GGSKASLEYNGMIDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDLLGVE  350

Query  265  IRISD  251
             RISD
Sbjct  351  FRISD  355


 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 83/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  78   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYLYRQQTGN  137

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            E+++L+ V RL  GA AG +  +  YP+D++R R+ +                 +P +Y 
Sbjct  138  ENAQLTPVLRLGAGATAGIIAMSATYPMDMVRGRLTVQ-------------TLNSPYQYR  184

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A    +R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  185  GMFHALSTVLRQEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  231



>ref|XP_006288044.1| hypothetical protein CARUB_v10001278mg [Capsella rubella]
 gb|EOA20942.1| hypothetical protein CARUB_v10001278mg [Capsella rubella]
Length=355

 Score =   298 bits (762),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV   NSPYQYRG+ HALSTVLR EGPRALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  171  RLTVQTANSPYQYRGIAHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  230

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K  P GLVE++EL+IVTRL CGA AGTVGQT+AYPLDVIRRRMQMVGWK A+S+VTGE
Sbjct  231  LVKDNPFGLVENNELTIVTRLTCGAVAGTVGQTIAYPLDVIRRRMQMVGWKDASSVVTGE  290

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+A LEYTGM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  291  GRSKASLEYTGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDVLGVE  350

Query  265  IRISD  251
             RISD
Sbjct  351  FRISD  355


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 84/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  78   KYSGTVQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYMYRQQTGN  137

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            E+++L+ V RL  GA AG +  +  YP+D++R R+ +               + +P +Y 
Sbjct  138  ENAQLTPVLRLGAGATAGIIAMSATYPMDMVRGRLTV-------------QTANSPYQYR  184

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            G+  A    +R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  185  GIAHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  231



>ref|XP_010427766.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Camelina sativa]
Length=355

 Score =   297 bits (761),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV   NSPYQYRG+ HALSTVLR EGPRALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  171  RLTVQTANSPYQYRGIAHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  230

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K  P GLVE++EL+IVTRL CGA AGTVGQT+AYPLDVIRRRMQMVGWK A+S+VTGE
Sbjct  231  LVKDNPFGLVENNELTIVTRLTCGAIAGTVGQTIAYPLDVIRRRMQMVGWKDASSVVTGE  290

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+A LEYTGM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  291  GRSKASLEYTGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDVLGVE  350

Query  265  IRISD  251
             RISD
Sbjct  351  FRISD  355


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 84/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  78   KYSGTVQGLKYIWRTEGIRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYMYRQQTGN  137

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            E+++L+ + RL  GA AG +  +  YP+D++R R+ +               + +P +Y 
Sbjct  138  ENAQLTPLLRLGAGATAGIIAMSATYPMDMVRGRLTV-------------QTANSPYQYR  184

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            G+  A    +R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  185  GIAHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  231



>ref|XP_010914053.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Elaeis guineensis]
Length=355

 Score =   297 bits (761),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHAL TV R EG RALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  171  RITVQTEKSPYQYRGMFHALGTVYREEGFRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  230

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKS+PLGLVEDSELS+VT+LACGA AGTVGQTVAYPLDVIRRRMQMVGW  AAS+V G+
Sbjct  231  LIKSRPLGLVEDSELSVVTKLACGAVAGTVGQTVAYPLDVIRRRMQMVGWNHAASVVAGQ  290

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+APLEYTGM+DAFRKTV  EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGVE
Sbjct  291  GRSKAPLEYTGMVDAFRKTVHNEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDILGVE  350

Query  265  IRISD  251
            +RISD
Sbjct  351  MRISD  355


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 83/169 (49%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE       WL + +   
Sbjct  78   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASSGILWLYRRQSGN  137

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              ED++L+ V RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  138  --EDAKLTPVLRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TEKSPYQ  182

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y GM  A     R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  183  YRGMFHALGTVYREEGFRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  231



>ref|XP_010422770.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Camelina sativa]
Length=355

 Score =   297 bits (761),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV   NSPYQYRG+ HALSTVLR EGPRALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  171  RLTVQTANSPYQYRGIAHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  230

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K  P GLVE++EL+IVTRL CGA AGTVGQT+AYPLDVIRRRMQMVGWK A+S+VTGE
Sbjct  231  LVKDNPFGLVENNELTIVTRLTCGAIAGTVGQTIAYPLDVIRRRMQMVGWKDASSVVTGE  290

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+A LEYTGM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  291  GRSKASLEYTGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDVLGVE  350

Query  265  IRISD  251
             RISD
Sbjct  351  FRISD  355


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 84/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  78   KYSGTVQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYMYRQQTGN  137

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            E+++L+ + RL  GA AG +  +  YP+D++R R+ +               + +P +Y 
Sbjct  138  ENAQLTPLLRLGAGATAGIIAMSATYPMDMVRGRLTV-------------QTANSPYQYR  184

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            G+  A    +R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  185  GIAHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  231



>ref|XP_010523787.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Tarenaya hassleriana]
Length=354

 Score =   297 bits (760),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SPYQYRGM HALSTVLR EGPRALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  170  RLTVQTEKSPYQYRGMVHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+KS+P G+V++SEL++ TRLACGA AGT+GQTVAYPLDV+RRRMQMVGWK A+S++TG+
Sbjct  230  LVKSRPFGIVDNSELTVTTRLACGAVAGTIGQTVAYPLDVVRRRMQMVGWKDASSVITGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G  +APLEY+GMIDAFRKTVR+EGV ALYKGLVPNSVKVVPSIAIAFVTYE+VKD+LGVE
Sbjct  290  GGGKAPLEYSGMIDAFRKTVRHEGVGALYKGLVPNSVKVVPSIAIAFVTYEKVKDLLGVE  349

Query  265  IRISD  251
             RISD
Sbjct  350  FRISD  354


 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 85/167 (51%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  77   KYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYLYQQQTGD  136

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            +++EL+ + RL  GA AG +  +  YP+D++R R+ +                ++P +Y 
Sbjct  137  DEAELTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TEKSPYQYR  183

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM+ A    +R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  184  GMVHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  230



>ref|XP_004298882.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Fragaria vesca subsp. vesca]
Length=358

 Score =   297 bits (760),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  ENSP QYRG+FHALSTV R EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  174  RLTVQTENSPRQYRGIFHALSTVFREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  233

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK++P GLV+DS+LSI TRLACGAAAGTVGQTVAYPLDV+RRRMQMVGWK AAS+VTG+
Sbjct  234  LIKTRPFGLVQDSDLSITTRLACGAAAGTVGQTVAYPLDVVRRRMQMVGWKDAASVVTGD  293

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GKS+A +EY GM+D FRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  294  GKSKAAIEYAGMVDTFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDVLGVE  353

Query  265  IRISD  251
            +RISD
Sbjct  354  MRISD  358


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 82/169 (49%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R+EG R L+KG   +   +VP   + F  YE       W  + +   
Sbjct  81   KYNGTVQGLKYIWRSEGFRGLFKGNGTNCARIVPNSAVKFFSYEEASRGILWFYRQQTGD  140

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              E+++L+ + RL  GA AG +  +  YPLD++R R+ +                 +P +
Sbjct  141  --ENAQLTPLLRLGAGACAGIIAMSATYPLDLVRGRLTVQ-------------TENSPRQ  185

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A     R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  186  YRGIFHALSTVFREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  234



>ref|XP_007135224.1| hypothetical protein PHAVU_010G111300g [Phaseolus vulgaris]
 gb|ESW07218.1| hypothetical protein PHAVU_010G111300g [Phaseolus vulgaris]
Length=355

 Score =   296 bits (758),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  171  RITVQTEASPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  230

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+KS   GL ++SELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGW  AAS++TG+
Sbjct  231  LVKSNAFGLADNSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWNHAASVLTGD  290

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+ + PLEYTGM+DAFRKTV++EG  ALYKGLVPNSVKVVPSIAIAFV+YE VKDILGVE
Sbjct  291  GRGKVPLEYTGMVDAFRKTVQHEGFGALYKGLVPNSVKVVPSIAIAFVSYEMVKDILGVE  350

Query  265  IRISD  251
            IRISD
Sbjct  351  IRISD  355


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 83/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  78   KYNGTIQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYMYQQQTGN  137

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +Y 
Sbjct  138  EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TEASPYQYR  184

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  185  GMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  231



>gb|KJB49523.1| hypothetical protein B456_008G123800 [Gossypium raimondii]
Length=352

 Score =   296 bits (757),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  ++SPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKD 
Sbjct  168  RLTVQTDSSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDR  227

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKSK  GLVEDSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+VTG+
Sbjct  228  LIKSKAFGLVEDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKEAASVVTGD  287

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+++APL YTGMIDAF KTVR+EG  ALYKGL PNSVKVVPSIA+AFVTYE VKDILGVE
Sbjct  288  GRNKAPLVYTGMIDAFGKTVRHEGFGALYKGLAPNSVKVVPSIALAFVTYEVVKDILGVE  347

Query  265  IRISD  251
            IRISD
Sbjct  348  IRISD  352


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 83/169 (49%), Gaps = 20/169 (12%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE       +L + +   
Sbjct  77   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYLYQQQ---  133

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              +D++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +
Sbjct  134  -TDDAQLTPLLRLGAGACAGIIAMSTTYPMDMVRGRLTVQ-------------TDSSPYQ  179

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y GM  A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  180  YRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDRL  228



>gb|KHG06223.1| Mitochondrial substrate carrier family protein B [Gossypium arboreum]
Length=354

 Score =   296 bits (757),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP  YRG+FHAL+TVLR EGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  170  RLTVQTEMSPRHYRGIFHALTTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK +P GLVEDSEL + T+LACGAAAGTVGQTVAYPLDVIRRRMQM GWK AAS+VTG+
Sbjct  230  LIKIRPFGLVEDSELGVTTKLACGAAAGTVGQTVAYPLDVIRRRMQMAGWKDAASVVTGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G S+APLEYTGM+DAFRKTVRYEG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  290  GNSKAPLEYTGMVDAFRKTVRYEGFGALYKGLVPNSVKVVPSIAIAFVTYELVKDVLGVE  349

Query  265  IRISD  251
            +RISD
Sbjct  350  LRISD  354


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 86/172 (50%), Gaps = 15/172 (9%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVY-ESLKDWLIKSKPLGLV  596
            +Y G    L  + + EG R ++KG   +   ++P   + F  Y E+ K  L   +     
Sbjct  77   KYNGTIQGLKYIWKTEGFRGMFKGNGTNCARIIPNSAVKFFSYEEASKGILYLYRQQSGN  136

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P  Y 
Sbjct  137  EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TEMSPRHYR  183

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIR  260
            G+  A    +R EG RALYKG +P+ + VVP + + F  YE +KD L ++IR
Sbjct  184  GIFHALTTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL-IKIR  234



>gb|KJB49521.1| hypothetical protein B456_008G123800 [Gossypium raimondii]
Length=354

 Score =   296 bits (757),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  ++SPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKD 
Sbjct  170  RLTVQTDSSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDR  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKSK  GLVEDSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+VTG+
Sbjct  230  LIKSKAFGLVEDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKEAASVVTGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+++APL YTGMIDAF KTVR+EG  ALYKGL PNSVKVVPSIA+AFVTYE VKDILGVE
Sbjct  290  GRNKAPLVYTGMIDAFGKTVRHEGFGALYKGLAPNSVKVVPSIALAFVTYEVVKDILGVE  349

Query  265  IRISD  251
            IRISD
Sbjct  350  IRISD  354


 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 83/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  77   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYLYQQQTGD  136

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            +D++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +Y 
Sbjct  137  DDAQLTPLLRLGAGACAGIIAMSTTYPMDMVRGRLTVQ-------------TDSSPYQYR  183

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  184  GMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDRL  230



>gb|KJB49522.1| hypothetical protein B456_008G123800 [Gossypium raimondii]
Length=319

 Score =   294 bits (753),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  ++SPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKD 
Sbjct  135  RLTVQTDSSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDR  194

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKSK  GLVEDSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+VTG+
Sbjct  195  LIKSKAFGLVEDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKEAASVVTGD  254

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+++APL YTGMIDAF KTVR+EG  ALYKGL PNSVKVVPSIA+AFVTYE VKDILGVE
Sbjct  255  GRNKAPLVYTGMIDAFGKTVRHEGFGALYKGLAPNSVKVVPSIALAFVTYEVVKDILGVE  314

Query  265  IRISD  251
            IRISD
Sbjct  315  IRISD  319


 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 83/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  42   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYLYQQQTGD  101

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            +D++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +Y 
Sbjct  102  DDAQLTPLLRLGAGACAGIIAMSTTYPMDMVRGRLTV-------------QTDSSPYQYR  148

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  149  GMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDRL  195



>ref|XP_009415476.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Musa acuminata subsp. malaccensis]
Length=357

 Score =   295 bits (756),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHAL TV R EG RALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  173  RITVQTEKSPYQYRGMFHALGTVYREEGFRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  232

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKS P GLVEDSELS+VTRLACGA AGT+GQTVAYPLDVIRRRMQMVGW  AAS+V GE
Sbjct  233  LIKSNPYGLVEDSELSVVTRLACGAVAGTIGQTVAYPLDVIRRRMQMVGWNNAASVVAGE  292

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+  LEYTGMIDAFRKTV +EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGVE
Sbjct  293  GRSKGSLEYTGMIDAFRKTVHHEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDILGVE  352

Query  265  IRISD  251
            +RISD
Sbjct  353  MRISD  357


 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 84/169 (50%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            QY G    L  + ++EG R L++G   +   +VP   + F  YE       WL + +   
Sbjct  80   QYNGTIQGLKYIWKSEGFRGLFRGNGTNCARIVPNSAVKFFSYEQASSGILWLYRRQSGN  139

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              ED++L+ V RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  140  --EDAQLTPVLRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TEKSPYQ  184

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y GM  A     R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  185  YRGMFHALGTVYREEGFRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  233



>ref|XP_009386307.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=357

 Score =   295 bits (755),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHAL TV   EG RALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  173  RITVQTEKSPYQYRGMFHALRTVYCEEGFRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  232

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK+ P GLVEDSELSIVTRL CGA AGTVGQTVAYPLDVIRRRMQMVGWK AASIVTG 
Sbjct  233  LIKTNPYGLVEDSELSIVTRLGCGAVAGTVGQTVAYPLDVIRRRMQMVGWKDAASIVTGH  292

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+APLEY GM+DAFRKTVR EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  293  GRSKAPLEYNGMVDAFRKTVRNEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDVLGVE  352

Query  265  IRISD  251
            +RISD
Sbjct  353  MRISD  357


 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 83/169 (49%), Gaps = 19/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            QY G    L  + ++EG R L+KG   +   ++P   + F  YE       WL +     
Sbjct  81   QYNGTIQGLKYIWKSEGFRGLFKGNGTNCARIIPNSAVKFFSYEQASSGILWLYRRHS--  138

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              +D++L+ V RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  139  -GKDAQLTPVLRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TEKSPYQ  184

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y GM  A R     EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  185  YRGMFHALRTVYCEEGFRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  233



>emb|CDY01954.1| BnaC02g27730D [Brassica napus]
Length=197

 Score =   289 bits (740),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+ V   NSPYQYRG+ HALSTV+R EGPRALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  13   RLAVQTANSPYQYRGIAHALSTVVREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  72

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K  P GLVE++EL+I+TRL+CGA AGTVGQT+AYPLDVIRRRMQMVGWK A+S+VTGE
Sbjct  73   LVKDNPFGLVENNELTIITRLSCGAIAGTVGQTIAYPLDVIRRRMQMVGWKSASSVVTGE  132

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+A LEY GM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  133  GRSKASLEYNGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDVLGVE  192

Query  265  IRISD  251
             RISD
Sbjct  193  FRISD  197



>ref|XP_009386297.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=358

 Score =   295 bits (755),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 159/185 (86%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHAL TV   EG RALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  174  RITVQTEKSPYQYRGMFHALRTVYCEEGFRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  233

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK+ P GLVEDSELSIVTRL CGA AGTVGQTVAYPLDVIRRRMQMVGWK AASIVTG 
Sbjct  234  LIKTNPYGLVEDSELSIVTRLGCGAVAGTVGQTVAYPLDVIRRRMQMVGWKDAASIVTGH  293

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+APLEY GM+DAFRKTVR EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  294  GRSKAPLEYNGMVDAFRKTVRNEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDVLGVE  353

Query  265  IRISD  251
            +RISD
Sbjct  354  MRISD  358


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 83/169 (49%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            QY G    L  + ++EG R L+KG   +   ++P   + F  YE       WL +     
Sbjct  81   QYNGTIQGLKYIWKSEGFRGLFKGNGTNCARIIPNSAVKFFSYEQASSGILWLYRRHSGK  140

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              ED++L+ V RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  141  --EDAQLTPVLRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TEKSPYQ  185

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y GM  A R     EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  186  YRGMFHALRTVYCEEGFRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  234



>ref|XP_010549230.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like, 
partial [Tarenaya hassleriana]
Length=180

 Score =   288 bits (737),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -3

Query  787  ENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKP  608
            E SPYQYRGM HALSTVLR EGPRALY+GWLPSVIGVVPYVGLNFAVYESLKDWL+KS+P
Sbjct  2    EKSPYQYRGMVHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDWLVKSRP  61

Query  607  LGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAP  428
             G+V++SEL++ TRLACGA AGT+GQTVAYPLDV+RRRMQMVGWK A+S++TG+G  +AP
Sbjct  62   FGIVDNSELTVTTRLACGAVAGTIGQTVAYPLDVVRRRMQMVGWKDASSVITGDGGGKAP  121

Query  427  LEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIRISD  251
            LEY+GMIDAFRKTVR+EGV ALYKGLVPNSVKVVPSIAIAFVTYE+VKD+LGVE RISD
Sbjct  122  LEYSGMIDAFRKTVRHEGVGALYKGLVPNSVKVVPSIAIAFVTYEKVKDLLGVEFRISD  180



>ref|XP_008798636.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Phoenix dactylifera]
Length=355

 Score =   294 bits (752),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHAL TV R EG RALY+GWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  171  RITVQTEKSPYQYRGMFHALGTVYREEGFRALYRGWLPSVIGVIPYVGLNFAVYESLKDW  230

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKS+PLGL+EDSELS+VT+LACGA AGTVGQTVAYPLDVIRRRMQMVGW  AAS++TGE
Sbjct  231  LIKSRPLGLIEDSELSVVTKLACGAVAGTVGQTVAYPLDVIRRRMQMVGWNHAASVLTGE  290

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+APLEY+GM+DAFRKTV  EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGV+
Sbjct  291  GRSKAPLEYSGMVDAFRKTVHNEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDILGVD  350

Query  265  IRISD  251
            +R+SD
Sbjct  351  MRLSD  355


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 83/169 (49%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE       WL + +   
Sbjct  78   KYNGTIQGLKYIWRTEGVRGLFKGNGTNCARIVPNSAVKFFSYEQASSGILWLYRRQSGN  137

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              ED++L+ V RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  138  --EDAQLTPVLRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TEKSPYQ  182

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y GM  A     R EG RALY+G +P+ + V+P + + F  YE +KD L
Sbjct  183  YRGMFHALGTVYREEGFRALYRGWLPSVIGVIPYVGLNFAVYESLKDWL  231



>ref|XP_010669340.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Beta vulgaris subsp. vulgaris]
Length=354

 Score =   294 bits (752),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 167/185 (90%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SP+QYRGM HALST+LR EGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  170  RITVQTEKSPFQYRGMVHALSTILREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L K++P GL++D ELS+ TRLACGA AGT+GQTVAYPLDVIRRRMQMVGW  A+SIVTG+
Sbjct  230  LAKARPFGLIQDGELSVTTRLACGAVAGTIGQTVAYPLDVIRRRMQMVGWNHASSIVTGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+ + PLEY GM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  290  GRGKVPLEYNGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDVLGVE  349

Query  265  IRISD  251
            +RISD
Sbjct  350  MRISD  354


 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 85/169 (50%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + + EG R L+KG   +   +VP   + F  YE       WL + +   
Sbjct  77   KYNGTIQGLKYIYQTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYQRQTGN  136

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              E+++L+ V RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  137  --ENAQLTPVLRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TEKSPFQ  181

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y GM+ A    +R EG RALYKG +P+ + VVP + + F  YE +KD L
Sbjct  182  YRGMVHALSTILREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  230



>ref|XP_003548513.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Glycine max]
 gb|KHN15957.1| Mitochondrial substrate carrier family protein B [Glycine soja]
Length=355

 Score =   294 bits (752),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHALSTVLR EG RALYKGWLPSVIGV+PYVGLNFAVYESLKD+
Sbjct  171  RITVQTEASPYQYRGMFHALSTVLREEGARALYKGWLPSVIGVIPYVGLNFAVYESLKDY  230

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKS P  LVE+SELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGW  AAS++TG+
Sbjct  231  LIKSNPFDLVENSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWNHAASVLTGD  290

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+ + PLEYTGMIDAFRKTV++EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  291  GRGKVPLEYTGMIDAFRKTVQHEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDVLGVE  350

Query  265  IRISD  251
            IRISD
Sbjct  351  IRISD  355


 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 82/167 (49%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIK-SKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE     ++   K     
Sbjct  78   KYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILHLYKQQTGN  137

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +Y 
Sbjct  138  EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TEASPYQYR  184

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  185  GMFHALSTVLREEGARALYKGWLPSVIGVIPYVGLNFAVYESLKDYL  231



>ref|XP_008791452.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Phoenix dactylifera]
Length=357

 Score =   294 bits (752),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 167/185 (90%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHAL TV R EG RALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  173  RITVQTEKSPYQYRGMFHALGTVYREEGFRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  232

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+KSKPLGLVEDSELS+VTRLACGA AGT+GQTVAYPLDVIRRRMQMVGW  AAS+V G+
Sbjct  233  LVKSKPLGLVEDSELSVVTRLACGAVAGTIGQTVAYPLDVIRRRMQMVGWNHAASVVAGQ  292

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
              S+APLEYTGM+DAFRKTV  EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  293  RGSKAPLEYTGMVDAFRKTVHSEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDVLGVE  352

Query  265  IRISD  251
            +RISD
Sbjct  353  MRISD  357


 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 83/169 (49%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R+EG R L+KG   +   +VP   + F  YE       W  + +   
Sbjct  80   KYNGTIQGLKYIWRSEGFRGLFKGNGTNCARIVPNSAVKFFSYEQAASGILWFYRRQSGN  139

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              E+++L+ V RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  140  --ENAQLTPVLRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TEKSPYQ  184

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y GM  A     R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  185  YRGMFHALGTVYREEGFRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  233



>gb|KDO76472.1| hypothetical protein CISIN_1g018449mg [Citrus sinensis]
Length=242

 Score =   290 bits (741),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 170/186 (91%), Gaps = 1/186 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP QYRG+FHAL+TVLR EGPR+LYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  57   RLTVQTEKSPRQYRGIFHALTTVLREEGPRSLYKGWLPSVIGVIPYVGLNFAVYESLKDW  116

Query  625  LIKSKPLGLVEDS-ELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTG  449
            LIKSK LGLV+D+ EL + TRLACGAAAGTVGQTVAYPLDVIRRRMQM GWK AAS+VTG
Sbjct  117  LIKSKALGLVDDNNELGVATRLACGAAAGTVGQTVAYPLDVIRRRMQMAGWKDAASVVTG  176

Query  448  EGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGV  269
            +GK++A LEY GM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGV
Sbjct  177  DGKTKATLEYNGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDILGV  236

Query  268  EIRISD  251
            E+RISD
Sbjct  237  EMRISD  242



>emb|CAN60283.1| hypothetical protein VITISV_011983 [Vitis vinifera]
Length=340

 Score =   293 bits (750),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  787  ENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKP  608
            E SP QYRG+FHALSTVLR EG RALYKGWLPSVIGV+PYVGLNFAVYESLKDWL+K+KP
Sbjct  162  EKSPRQYRGIFHALSTVLREEGARALYKGWLPSVIGVIPYVGLNFAVYESLKDWLMKAKP  221

Query  607  LGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAP  428
             GLVEDSEL + TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+VTG+G+ +AP
Sbjct  222  FGLVEDSELGVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASVVTGDGRGKAP  281

Query  427  LEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIRISD  251
            LEYTGM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGVE+RISD
Sbjct  282  LEYTGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDILGVEMRISD  340



>ref|XP_006444883.1| hypothetical protein CICLE_v10020846mg [Citrus clementina]
 ref|XP_006444884.1| hypothetical protein CICLE_v10020846mg [Citrus clementina]
 ref|XP_006491236.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Citrus sinensis]
 gb|ESR58123.1| hypothetical protein CICLE_v10020846mg [Citrus clementina]
 gb|ESR58124.1| hypothetical protein CICLE_v10020846mg [Citrus clementina]
 gb|KDO86405.1| hypothetical protein CISIN_1g038121mg [Citrus sinensis]
Length=354

 Score =   293 bits (751),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SPY+YRG+FHALSTVLR EGPRALY+GW PSVIGVVPYVGLNFAVYESLK W
Sbjct  170  RLTVQTEKSPYRYRGIFHALSTVLREEGPRALYRGWFPSVIGVVPYVGLNFAVYESLKVW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK+KPLGL EDSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK A+S+V G+
Sbjct  230  LIKTKPLGLAEDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKEASSVVIGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+++APLEY GMIDAFRKTVR+EG  ALYKGLVPNSVKVVPSI++AFVTYE VKDILGVE
Sbjct  290  GRNRAPLEYNGMIDAFRKTVRHEGFGALYKGLVPNSVKVVPSISLAFVTYEVVKDILGVE  349

Query  265  IRISD  251
            IRISD
Sbjct  350  IRISD  354


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 80/164 (49%), Gaps = 14/164 (9%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  77   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYLYQHHTGN  136

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED+EL+ + RL  GA AG +  +  YP+D++R R+ +                ++P  Y 
Sbjct  137  EDAELTPLLRLGAGACAGIIAMSATYPMDMVRGRLTV-------------QTEKSPYRYR  183

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVK  284
            G+  A    +R EG RALY+G  P+ + VVP + + F  YE +K
Sbjct  184  GIFHALSTVLREEGPRALYRGWFPSVIGVVPYVGLNFAVYESLK  227



>ref|XP_009394146.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Musa acuminata subsp. malaccensis]
Length=357

 Score =   293 bits (751),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHAL TV R EG RALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  173  RITVQTEKSPYQYRGMFHALGTVYREEGFRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  232

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKS P GLVEDSELS+VTRL CGA AGTVGQTVAYPLDVIRRRMQMVGWK AAS+VTG+
Sbjct  233  LIKSNPYGLVEDSELSVVTRLGCGAVAGTVGQTVAYPLDVIRRRMQMVGWKDAASVVTGQ  292

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S APLEYTGM+DAFRKTV +EG  ALYKGLVPN VKVVPSIAIAFVTYE VKD+L VE
Sbjct  293  GRSSAPLEYTGMVDAFRKTVHHEGFGALYKGLVPNLVKVVPSIAIAFVTYEVVKDLLEVE  352

Query  265  IRISD  251
            +RISD
Sbjct  353  MRISD  357


 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 84/169 (50%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            QY G    L  + ++EG R L++G   +   +VP   + F  YE       WL + +   
Sbjct  80   QYNGTIQGLKYIWKSEGLRGLFRGNGTNCARIVPNSAVKFFSYEQASSGILWLYRQQSGN  139

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              E+++L+ V RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  140  --EEAQLTPVLRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TEKSPYQ  184

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y GM  A     R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  185  YRGMFHALGTVYREEGFRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  233



>ref|XP_010055845.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
isoform X1 [Eucalyptus grandis]
 gb|KCW72394.1| hypothetical protein EUGRSUZ_E00845 [Eucalyptus grandis]
Length=353

 Score =   293 bits (750),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP QYRG++HALSTV + EGPRALY+GWLPSVIGVVPYVGLNFAVYESLKD+
Sbjct  169  RLTVQTEKSPRQYRGIYHALSTVFKEEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDY  228

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+++ P GLVED+ELS+ TRLACGAAAGT+GQTVAYPLDVIRRRMQMVGWKGA+S++ GE
Sbjct  229  LLQTNPFGLVEDNELSVTTRLACGAAAGTIGQTVAYPLDVIRRRMQMVGWKGASSVIVGE  288

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+APLEYTGM+DAFRKTVRYEG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  289  GRSKAPLEYTGMVDAFRKTVRYEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDVLGVE  348

Query  265  IRISD  251
            +RISD
Sbjct  349  MRISD  353


 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 84/169 (50%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE       WL + +P  
Sbjct  76   KYNGTMQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSYEQASHGILWLYRQQPGK  135

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              ED++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  136  --EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TEKSPRQ  180

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A     + EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  181  YRGIYHALSTVFKEEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDYL  229



>ref|XP_010544425.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Tarenaya hassleriana]
Length=355

 Score =   293 bits (750),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV   NSPYQYRG+FHALSTVLR EGPRALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  171  RLTVQTANSPYQYRGIFHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  230

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K+ P GL +DSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK A+S+VTG+
Sbjct  231  LVKANPYGLAQDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDASSVVTGD  290

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+ +A  EY+GMIDAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  291  GRGKASHEYSGMIDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDLLGVE  350

Query  265  IRISD  251
             RISD
Sbjct  351  FRISD  355


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 84/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + + EG R L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  78   KYNGTIQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYMYRQQTGN  137

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            E+++L+ V RL  GA AG +  +  YP+D++R R+ +               + +P +Y 
Sbjct  138  ENAQLTPVLRLGAGATAGIIAMSATYPMDMVRGRLTVQ-------------TANSPYQYR  184

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            G+  A    +R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  185  GIFHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  231



>ref|XP_009352376.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Pyrus x bretschneideri]
Length=356

 Score =   293 bits (750),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  + SP QYRG++HAL+TV R EGPRALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  172  RLTVQTDMSPRQYRGIYHALTTVFREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  231

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKS+P GLV+DSELS++TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+V G+
Sbjct  232  LIKSRPFGLVQDSELSVLTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASVVVGD  291

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GKS+A LEYTGM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  292  GKSRASLEYTGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDVLGVE  351

Query  265  IRISD  251
            +RISD
Sbjct  352  MRISD  356


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 82/169 (49%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y+G    L  + R EG R L+KG   +   +VP   + F  YE       W  + +   
Sbjct  79   KYKGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEEASKGILWFYRQQTGN  138

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              ED++L+ V RL  GA AG +  +  YP+D++R R+ +                 +P +
Sbjct  139  --EDAQLTPVLRLGAGACAGIIAMSATYPMDMVRGRLTV-------------QTDMSPRQ  183

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A     R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  184  YRGIYHALTTVFREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  232



>gb|ADE77740.1| unknown [Picea sitchensis]
Length=371

 Score =   293 bits (751),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  ENSPYQYRGMFHALSTVLR EGPRALYKGW PSVIGVVPYVGLNFAVYESLKDW
Sbjct  187  RLTVQTENSPYQYRGMFHALSTVLREEGPRALYKGWFPSVIGVVPYVGLNFAVYESLKDW  246

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+KS+P GLVE  +LS+VT+LACGAAAGTVGQTVAYPLDVIRRRMQMVGWK A+SIVTG+
Sbjct  247  LVKSRPFGLVEGEDLSMVTKLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDASSIVTGD  306

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+APL+Y+GM+DAFR+TVR EG  ALY+GLVPNSVKVVPSIAIAFVTYE ++D+L VE
Sbjct  307  GRSKAPLQYSGMVDAFRQTVRNEGFGALYRGLVPNSVKVVPSIAIAFVTYEALRDLLNVE  366

Query  265  IRISD  251
            +RISD
Sbjct  367  LRISD  371


 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 80/169 (47%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  +   EG R L+KG   +   +VP   + F  YE       W  + +   
Sbjct  94   KYNGTIQGLRYIWNTEGLRGLFKGNGTNCARIVPNSAVKFYSYEQASRAILWFYRQQTGN  153

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              ED+EL+ V RL  GA AG +  +  YP+D++R R+ +                 +P +
Sbjct  154  --EDAELTPVLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TENSPYQ  198

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y GM  A    +R EG RALYKG  P+ + VVP + + F  YE +KD L
Sbjct  199  YRGMFHALSTVLREEGPRALYKGWFPSVIGVVPYVGLNFAVYESLKDWL  247



>ref|XP_010055846.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
isoform X2 [Eucalyptus grandis]
Length=370

 Score =   293 bits (751),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP QYRG++HALSTV + EGPRALY+GWLPSVIGVVPYVGLNFAVYESLKD+
Sbjct  186  RLTVQTEKSPRQYRGIYHALSTVFKEEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDY  245

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+++ P GLVED+ELS+ TRLACGAAAGT+GQTVAYPLDVIRRRMQMVGWKGA+S++ GE
Sbjct  246  LLQTNPFGLVEDNELSVTTRLACGAAAGTIGQTVAYPLDVIRRRMQMVGWKGASSVIVGE  305

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+APLEYTGM+DAFRKTVRYEG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  306  GRSKAPLEYTGMVDAFRKTVRYEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDVLGVE  365

Query  265  IRISD  251
            +RISD
Sbjct  366  MRISD  370


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 84/186 (45%), Gaps = 35/186 (19%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD------------  629
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE                
Sbjct  76   KYNGTMQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSYEQASQYAKLFSFHHIFI  135

Query  628  --------WLIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWK  473
                    WL + +P    ED++L+ + RL  GA AG +  +  YP+D++R R+ +    
Sbjct  136  YFVHSGILWLYRQQPGK--EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTV----  189

Query  472  GAASIVTGEGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYE  293
                        ++P +Y G+  A     + EG RALY+G +P+ + VVP + + F  YE
Sbjct  190  ---------QTEKSPRQYRGIYHALSTVFKEEGPRALYRGWLPSVIGVVPYVGLNFAVYE  240

Query  292  QVKDIL  275
             +KD L
Sbjct  241  SLKDYL  246



>ref|XP_009336243.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
isoform X1 [Pyrus x bretschneideri]
Length=356

 Score =   293 bits (749),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  + SP QYRG++HAL+TV R EGPRALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  172  RLTVQTDMSPQQYRGIYHALTTVFREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  231

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKS+P GLV+DSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+V G+
Sbjct  232  LIKSRPFGLVQDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASVVVGD  291

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GKS A LEYTGM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  292  GKSGASLEYTGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDVLGVE  351

Query  265  IRISD  251
            +RISD
Sbjct  352  MRISD  356


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 81/169 (48%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R EG R L+KG   +   +VP   + F  Y+       W  + +   
Sbjct  79   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYDEASKGILWFYRQQTGN  138

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              ED++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +
Sbjct  139  --EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TDMSPQQ  183

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A     R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  184  YRGIYHALTTVFREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  232



>ref|XP_009336244.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
isoform X2 [Pyrus x bretschneideri]
Length=355

 Score =   292 bits (748),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  + SP QYRG++HAL+TV R EGPRALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  171  RLTVQTDMSPQQYRGIYHALTTVFREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  230

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKS+P GLV+DSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+V G+
Sbjct  231  LIKSRPFGLVQDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASVVVGD  290

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GKS A LEYTGM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  291  GKSGASLEYTGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDVLGVE  350

Query  265  IRISD  251
            +RISD
Sbjct  351  MRISD  355


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/166 (30%), Positives = 79/166 (48%), Gaps = 13/166 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            +Y G    L  + R EG R L+KG   +   +VP   + F  Y+     ++         
Sbjct  79   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYDEASKGILWFYRQQTGN  138

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
            D++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +Y G
Sbjct  139  DAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TDMSPQQYRG  185

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            +  A     R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  186  IYHALTTVFREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  231



>ref|NP_192019.1| adenine nucleotide transporter 1 [Arabidopsis thaliana]
 sp|O04619.1|ADNT1_ARATH RecName: Full=Mitochondrial adenine nucleotide transporter ADNT1; 
AltName: Full=Adenine nucleotide transporter 1 [Arabidopsis 
thaliana]
 gb|AAK25878.1|AF360168_1 putative carrier protein [Arabidopsis thaliana]
 gb|AAL06538.1|AF412085_1 AT4g01100/F2N1_16 [Arabidopsis thaliana]
 gb|AAB61037.1| similar to mitochondrial carrier family [Arabidopsis thaliana]
 emb|CAB80919.1| putative carrier protein [Arabidopsis thaliana]
 gb|AAL07192.1| putative carrier protein [Arabidopsis thaliana]
 emb|CAP64296.1| adenine nucleotide transporter, ADNT1 [Arabidopsis thaliana]
 gb|AEE81981.1| adenine nucleotide transporter 1 [Arabidopsis thaliana]
Length=352

 Score =   292 bits (747),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV   NSPYQYRG+ HAL+TVLR EGPRALY+GWLPSVIGVVPYVGLNF+VYESLKDW
Sbjct  168  RLTVQTANSPYQYRGIAHALATVLREEGPRALYRGWLPSVIGVVPYVGLNFSVYESLKDW  227

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K  P GLVE++EL++VTRL CGA AGTVGQT+AYPLDVIRRRMQMVGWK A++IVTGE
Sbjct  228  LVKENPYGLVENNELTVVTRLTCGAIAGTVGQTIAYPLDVIRRRMQMVGWKDASAIVTGE  287

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S A LEYTGM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  288  GRSTASLEYTGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDVLGVE  347

Query  265  IRISD  251
             RISD
Sbjct  348  FRISD  352


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/167 (30%), Positives = 84/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLI-KSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE   + ++   +     
Sbjct  75   KYSGTVQGLKHIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSYEQASNGILYMYRQRTGN  134

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            E+++L+ + RL  GA AG +  +  YP+D++R R+ +               + +P +Y 
Sbjct  135  ENAQLTPLLRLGAGATAGIIAMSATYPMDMVRGRLTVQ-------------TANSPYQYR  181

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            G+  A    +R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  182  GIAHALATVLREEGPRALYRGWLPSVIGVVPYVGLNFSVYESLKDWL  228



>ref|NP_001190650.1| adenine nucleotide transporter 1 [Arabidopsis thaliana]
 gb|AEE81982.1| adenine nucleotide transporter 1 [Arabidopsis thaliana]
Length=366

 Score =   292 bits (748),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV   NSPYQYRG+ HAL+TVLR EGPRALY+GWLPSVIGVVPYVGLNF+VYESLKDW
Sbjct  182  RLTVQTANSPYQYRGIAHALATVLREEGPRALYRGWLPSVIGVVPYVGLNFSVYESLKDW  241

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K  P GLVE++EL++VTRL CGA AGTVGQT+AYPLDVIRRRMQMVGWK A++IVTGE
Sbjct  242  LVKENPYGLVENNELTVVTRLTCGAIAGTVGQTIAYPLDVIRRRMQMVGWKDASAIVTGE  301

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S A LEYTGM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  302  GRSTASLEYTGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDVLGVE  361

Query  265  IRISD  251
             RISD
Sbjct  362  FRISD  366



>gb|ACU20385.1| unknown [Glycine max]
Length=197

 Score =   286 bits (732),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 167/185 (90%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHALSTVLR EG RALYKGWLPSVIGV+PYVGLNFAVYESLKD+
Sbjct  13   RITVQTEASPYQYRGMFHALSTVLREEGARALYKGWLPSVIGVIPYVGLNFAVYESLKDY  72

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKS P  LVE+SELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGW  AAS++TG+
Sbjct  73   LIKSNPFDLVENSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWNHAASVLTGD  132

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+ + PLEYTGMIDAFRK V++EG  ALYKGLVPN VKVVPSIAIAFVTYE VKD+LGVE
Sbjct  133  GRGKVPLEYTGMIDAFRKIVQHEGFGALYKGLVPNPVKVVPSIAIAFVTYEVVKDVLGVE  192

Query  265  IRISD  251
            IRISD
Sbjct  193  IRISD  197



>ref|XP_010544796.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Tarenaya hassleriana]
Length=354

 Score =   291 bits (746),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/185 (79%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SPYQYRGM HALSTVLR EGPRALY+GWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  170  RLTVQTEKSPYQYRGMVHALSTVLREEGPRALYRGWLPSVIGVIPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K++P G+ ++SEL++ TRLACGA AGT+GQTVAYPLDV+RRRMQMVGWK A++++TG+
Sbjct  230  LVKARPFGIADNSELTVTTRLACGAVAGTIGQTVAYPLDVVRRRMQMVGWKDASTVITGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+ +APLEY+GMIDAFRKTVR+EGV ALYKGLVPN VKVVPSIAIAFVTYE+VKD+LGVE
Sbjct  290  GRGKAPLEYSGMIDAFRKTVRHEGVGALYKGLVPNFVKVVPSIAIAFVTYEKVKDLLGVE  349

Query  265  IRISD  251
             RISD
Sbjct  350  FRISD  354


 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 85/167 (51%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  77   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYLYQQQTGN  136

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            +++EL+ + RL  GA AG +  +  YP+D++R R+ +                ++P +Y 
Sbjct  137  DEAELTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TEKSPYQYR  183

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM+ A    +R EG RALY+G +P+ + V+P + + F  YE +KD L
Sbjct  184  GMVHALSTVLREEGPRALYRGWLPSVIGVIPYVGLNFAVYESLKDWL  230



>gb|KFK42532.1| hypothetical protein AALP_AA1G006600 [Arabis alpina]
Length=354

 Score =   291 bits (746),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 169/185 (91%), Gaps = 1/185 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV   NSPYQYRG+ HALSTVLR EGPRALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  171  RLTVQTSNSPYQYRGIAHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  230

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K  P GLV+DSEL++ TRLACGAAAGTVGQT+AYPLDVIRRRMQMVGWK A+S+VTG+
Sbjct  231  LVKDNPFGLVQDSELTVTTRLACGAAAGTVGQTIAYPLDVIRRRMQMVGWKSASSVVTGD  290

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S A LEYTGM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  291  GRS-ASLEYTGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYELVKDVLGVE  349

Query  265  IRISD  251
             RISD
Sbjct  350  FRISD  354


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 85/167 (51%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R+EG R L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  78   KYNGTVQGLKYIWRSEGLRGLFKGNGTNCARIVPNSAVKFYSYEQASKGILYMYRQQTGN  137

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            E+++L+ V RL  GA AG +  +  YP+D++R R+ +               S +P +Y 
Sbjct  138  ENAQLTPVLRLMAGATAGIIAMSATYPMDMVRGRLTV-------------QTSNSPYQYR  184

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            G+  A    +R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  185  GIAHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  231



>emb|CDX74363.1| BnaA03g26840D [Brassica napus]
Length=353

 Score =   291 bits (744),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 169/185 (91%), Gaps = 2/185 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV   NSPYQYRG+ HALSTVLR EGPRALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  171  RLTVQTANSPYQYRGIAHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  230

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K  P GLVE++EL+I+TRL+CGA AGTVGQT+AYPLDVIRRRMQMVGWK A+S+VTGE
Sbjct  231  LVKDNPFGLVENNELTIITRLSCGAIAGTVGQTIAYPLDVIRRRMQMVGWKDASSVVTGE  290

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+  LEYTGM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  291  GRSK--LEYTGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDVLGVE  348

Query  265  IRISD  251
             RISD
Sbjct  349  FRISD  353


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 84/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  78   KYSGTVQGLKYIWRTEGVRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYMYRQQTGN  137

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            E+++L+ V RL  GA AG +  +  YP+D++R R+ +               + +P +Y 
Sbjct  138  ENAQLTPVLRLGAGATAGIIAMSATYPMDMVRGRLTV-------------QTANSPYQYR  184

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            G+  A    +R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  185  GIAHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  231



>emb|CDX71722.1| BnaC08g31520D [Brassica napus]
Length=338

 Score =   290 bits (743),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 173/187 (93%), Gaps = 2/187 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  + SPYQYRGM HALSTVLR EGPRALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  152  RLTVQTDKSPYQYRGMVHALSTVLRQEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  211

Query  625  LIKSKPLGLVED--SELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVT  452
            L+KSKP G++++  SEL++ TRLACGA AGT+GQTVAYPLDV+RRRMQMVGWK A+S++T
Sbjct  212  LVKSKPFGIIDNNNSELTVTTRLACGAIAGTMGQTVAYPLDVVRRRMQMVGWKDASSVIT  271

Query  451  GEGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILG  272
            G+G+ +AP+EY+GM+DAF+KTVR+EGV ALYKGLVPNSVKVVPSIAIAFVTYE+VKDILG
Sbjct  272  GDGRGKAPIEYSGMVDAFKKTVRHEGVGALYKGLVPNSVKVVPSIAIAFVTYEKVKDILG  331

Query  271  VEIRISD  251
            VE RISD
Sbjct  332  VEFRISD  338


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 85/167 (51%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  59   KYNGTVQGLKYIWRTEGFRGLFKGNGANCARIVPNSAVKFFSYEQASKGILYLYRQQTGN  118

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            +D++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +Y 
Sbjct  119  DDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TDKSPYQYR  165

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM+ A    +R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  166  GMVHALSTVLRQEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  212



>ref|XP_009134513.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Brassica rapa]
Length=353

 Score =   291 bits (744),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 169/185 (91%), Gaps = 2/185 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV   NSPYQYRG+ HALSTVLR EGPRALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  171  RLTVQTANSPYQYRGIAHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  230

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K  P GLVE++EL+I+TRL+CGA AGTVGQT+AYPLDVIRRRMQMVGWK A+S+VTGE
Sbjct  231  LVKDNPFGLVENNELTIITRLSCGAIAGTVGQTIAYPLDVIRRRMQMVGWKDASSVVTGE  290

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+  LEYTGM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  291  GRSK--LEYTGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDVLGVE  348

Query  265  IRISD  251
             RISD
Sbjct  349  FRISD  353


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 84/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + +  L   +     
Sbjct  78   KYSGTVQGLKYIWRTEGVRGLFKGNGTNCARIVPNSAVKFFSYEQASRGILYMYRQQTGN  137

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            E+++L+ V RL  GA AG +  +  YP+D++R R+ +               + +P +Y 
Sbjct  138  ENAQLTPVLRLGAGATAGIIAMSATYPMDMVRGRLTV-------------QTANSPYQYR  184

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            G+  A    +R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  185  GIAHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  231



>ref|XP_009116833.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Brassica rapa]
Length=339

 Score =   290 bits (743),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 173/187 (93%), Gaps = 2/187 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  + SPYQYRGM HALSTVLR EGPRALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  153  RLTVQTDKSPYQYRGMVHALSTVLRQEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  212

Query  625  LIKSKPLGLVED--SELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVT  452
            L+KSKP G++++  SEL++ TRLACGA AGT+GQTVAYPLDV+RRRMQMVGWK A+S++T
Sbjct  213  LVKSKPFGIIDNNNSELTVTTRLACGAIAGTMGQTVAYPLDVVRRRMQMVGWKDASSVIT  272

Query  451  GEGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILG  272
            G+G+ +AP+EY+GM+DAFRKTVR+EG+ ALYKGLVPNSVKVVPSIAIAFVTYE+VKDILG
Sbjct  273  GDGRGKAPIEYSGMVDAFRKTVRHEGLGALYKGLVPNSVKVVPSIAIAFVTYEKVKDILG  332

Query  271  VEIRISD  251
            VE RISD
Sbjct  333  VEFRISD  339


 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 85/167 (51%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  60   KYNGTVQGLKYIWRTEGFRGLFKGNGANCARIVPNSAVKFFSYEQASKGILYLYRQQTGN  119

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ++++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +Y 
Sbjct  120  DEAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TDKSPYQYR  166

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM+ A    +R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  167  GMVHALSTVLRQEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  213



>emb|CDY11371.1| BnaA09g39370D [Brassica napus]
Length=339

 Score =   290 bits (743),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 173/187 (93%), Gaps = 2/187 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  + SPYQYRGM HALSTVLR EGPRALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  153  RLTVQTDKSPYQYRGMVHALSTVLRQEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  212

Query  625  LIKSKPLGLVED--SELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVT  452
            L+KSKP G++++  SEL++ TRLACGA AGT+GQTVAYPLDV+RRRMQMVGWK A+S++T
Sbjct  213  LVKSKPFGIIDNNTSELTVTTRLACGAIAGTMGQTVAYPLDVVRRRMQMVGWKDASSVIT  272

Query  451  GEGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILG  272
            G+G+ +AP+EY+GM+DAFRKTVR+EG+ ALYKGLVPNSVKVVPSIAIAFVTYE+VKDILG
Sbjct  273  GDGRGKAPIEYSGMVDAFRKTVRHEGLGALYKGLVPNSVKVVPSIAIAFVTYEKVKDILG  332

Query  271  VEIRISD  251
            VE RISD
Sbjct  333  VEFRISD  339


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 85/167 (51%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  60   KYNGTVQGLKYIWRTEGFRGLFKGNGANCARIVPNSAVKFFSYEQASKGILYLYRQQTGN  119

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            +D++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +Y 
Sbjct  120  DDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TDKSPYQYR  166

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM+ A    +R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  167  GMVHALSTVLRQEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  213



>gb|KJB52266.1| hypothetical protein B456_008G252700 [Gossypium raimondii]
Length=354

 Score =   290 bits (743),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 155/185 (84%), Positives = 167/185 (90%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP  YRG+FHAL+TVL  EGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  170  RLTVQTEMSPRHYRGIFHALTTVLWEEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK +P GLVEDSEL + T+LACGAAAGTVGQTVAYPLDVIRRRMQM GWK AAS+VTG+
Sbjct  230  LIKRRPFGLVEDSELGVTTKLACGAAAGTVGQTVAYPLDVIRRRMQMAGWKDAASVVTGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G S+APLEYTGM+DAFRKTVRYEG  ALYKGLVPN VKVVPSIAIAFVTYE VKD+LGVE
Sbjct  290  GNSKAPLEYTGMVDAFRKTVRYEGFGALYKGLVPNPVKVVPSIAIAFVTYELVKDVLGVE  349

Query  265  IRISD  251
            +RISD
Sbjct  350  LRISD  354


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/167 (30%), Positives = 82/167 (49%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVY-ESLKDWLIKSKPLGLV  596
            +Y G    L  + + EG R ++KG   +   ++P   + F  Y E+ K  L   +    +
Sbjct  77   KYNGTIQGLKYIWKTEGFRGMFKGNGTNCARIIPNSAVKFFSYEEASKGILYLYRQQSGI  136

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P  Y 
Sbjct  137  EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TEMSPRHYR  183

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            G+  A    +  EG RALYKG +P+ + VVP + + F  YE +KD L
Sbjct  184  GIFHALTTVLWEEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  230



>gb|KJB49524.1| hypothetical protein B456_008G123800 [Gossypium raimondii]
Length=359

 Score =   290 bits (742),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -3

Query  787  ENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKP  608
            ++SPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKD LIKSK 
Sbjct  181  DSSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDRLIKSKA  240

Query  607  LGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAP  428
             GLVEDSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+VTG+G+++AP
Sbjct  241  FGLVEDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKEAASVVTGDGRNKAP  300

Query  427  LEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIRISD  251
            L YTGMIDAF KTVR+EG  ALYKGL PNSVKVVPSIA+AFVTYE VKDILGVEIRISD
Sbjct  301  LVYTGMIDAFGKTVRHEGFGALYKGLAPNSVKVVPSIALAFVTYEVVKDILGVEIRISD  359


 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 86/169 (51%), Gaps = 13/169 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  77   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYLYQQQTGD  136

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRM--QMVGWKGAASIVTGEGKSQAPLE  422
            +D++L+ + RL  GA AG +  +  YP+D++R R+  Q+   +  +S          P +
Sbjct  137  DDAQLTPLLRLGAGACAGIIAMSTTYPMDMVRGRLTVQLCLLQTDSS----------PYQ  186

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y GM  A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  187  YRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDRL  235



>ref|XP_006439392.1| hypothetical protein CICLE_v10020845mg [Citrus clementina]
 gb|ESR52632.1| hypothetical protein CICLE_v10020845mg [Citrus clementina]
Length=354

 Score =   290 bits (741),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 170/186 (91%), Gaps = 1/186 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP QYRG+FHAL+TVLR EGPR+LYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  169  RLTVQTEKSPRQYRGIFHALTTVLREEGPRSLYKGWLPSVIGVIPYVGLNFAVYESLKDW  228

Query  625  LIKSKPLGLVEDS-ELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTG  449
            LIKSK LGLV+D+ EL + TRLACGAAAGTVGQTVAYPLDVIRRRMQM GWK AAS+VTG
Sbjct  229  LIKSKALGLVDDNNELGVATRLACGAAAGTVGQTVAYPLDVIRRRMQMAGWKDAASVVTG  288

Query  448  EGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGV  269
            +GK++A LEY GM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGV
Sbjct  289  DGKTKATLEYNGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDILGV  348

Query  268  EIRISD  251
            E+RISD
Sbjct  349  EMRISD  354


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 84/169 (50%), Gaps = 19/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + ++EG R L+KG   +   ++P   + F  YE       WL + +   
Sbjct  77   KYNGTIQGLKYIWKSEGFRGLFKGNGTNCARIIPNSAVKFFSYEEASKGILWLYRRQTR-  135

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
               ++EL+ V RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  136  --NEAELTPVLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TEKSPRQ  180

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A    +R EG R+LYKG +P+ + V+P + + F  YE +KD L
Sbjct  181  YRGIFHALTTVLREEGPRSLYKGWLPSVIGVIPYVGLNFAVYESLKDWL  229



>ref|XP_006439393.1| hypothetical protein CICLE_v10020845mg [Citrus clementina]
 gb|ESR52633.1| hypothetical protein CICLE_v10020845mg [Citrus clementina]
 gb|KDO76470.1| hypothetical protein CISIN_1g018449mg [Citrus sinensis]
Length=355

 Score =   290 bits (741),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 170/186 (91%), Gaps = 1/186 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP QYRG+FHAL+TVLR EGPR+LYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  170  RLTVQTEKSPRQYRGIFHALTTVLREEGPRSLYKGWLPSVIGVIPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVEDS-ELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTG  449
            LIKSK LGLV+D+ EL + TRLACGAAAGTVGQTVAYPLDVIRRRMQM GWK AAS+VTG
Sbjct  230  LIKSKALGLVDDNNELGVATRLACGAAAGTVGQTVAYPLDVIRRRMQMAGWKDAASVVTG  289

Query  448  EGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGV  269
            +GK++A LEY GM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGV
Sbjct  290  DGKTKATLEYNGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDILGV  349

Query  268  EIRISD  251
            E+RISD
Sbjct  350  EMRISD  355


 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 85/169 (50%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + ++EG R L+KG   +   ++P   + F  YE       WL + +   
Sbjct  77   KYNGTIQGLKYIWKSEGFRGLFKGNGTNCARIIPNSAVKFFSYEEASKGILWLYRRQTRN  136

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              E++EL+ V RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  137  --EEAELTPVLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TEKSPRQ  181

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A    +R EG R+LYKG +P+ + V+P + + F  YE +KD L
Sbjct  182  YRGIFHALTTVLREEGPRSLYKGWLPSVIGVIPYVGLNFAVYESLKDWL  230



>gb|KFK30686.1| hypothetical protein AALP_AA6G014800 [Arabis alpina]
Length=355

 Score =   290 bits (741),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV   NSPYQYRG+ HAL TVLR EGPRALY+GW+PSVIGVVPYVGLNFAVYESLKDW
Sbjct  171  RLTVQTANSPYQYRGITHALVTVLRQEGPRALYRGWVPSVIGVVPYVGLNFAVYESLKDW  230

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK  P GL E+SEL IVTRL+CGA AGT+GQTVAYPLDVIRRRMQMVGWK A+S+VTG 
Sbjct  231  LIKDNPFGLAENSELGIVTRLSCGAVAGTLGQTVAYPLDVIRRRMQMVGWKDASSVVTGG  290

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G S+A LEYTGM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  291  GGSKASLEYTGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDVLGVE  350

Query  265  IRISD  251
             RISD
Sbjct  351  FRISD  355


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 85/168 (51%), Gaps = 16/168 (10%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLI--KSKPLGL  599
            +Y G    L  + R EG R L+KG   +   ++P   + F  YE   + ++    +  G 
Sbjct  78   KYNGTVQGLKYIWRTEGLRGLFKGNGTNCARIIPNSAVKFFSYERASEGILYMYRRQTG-  136

Query  598  VEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEY  419
             E+++L+ + RL  GA AG +  +  YP+D++R R+ +               + +P +Y
Sbjct  137  NENAQLTPLLRLGAGATAGIIAMSATYPMDMVRGRLTVQ-------------TANSPYQY  183

Query  418  TGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
             G+  A    +R EG RALY+G VP+ + VVP + + F  YE +KD L
Sbjct  184  RGITHALVTVLRQEGPRALYRGWVPSVIGVVPYVGLNFAVYESLKDWL  231



>gb|ABK96372.1| unknown [Populus trichocarpa x Populus deltoides]
Length=354

 Score =   289 bits (740),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  + SP QYRG+ HALSTVL+ EGPRALYKGWLPSVIGV+PYVGLNF+VYESLKDW
Sbjct  170  RLTVQTDKSPRQYRGIAHALSTVLKEEGPRALYKGWLPSVIGVIPYVGLNFSVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K+ P GLVED+EL + TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+VTG+
Sbjct  230  LLKTNPFGLVEDNELGVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASVVTGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+AP EY+GM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  290  GRSKAPHEYSGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDVLGVE  349

Query  265  IRISD  251
            +RISD
Sbjct  350  MRISD  354


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/169 (29%), Positives = 83/169 (49%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R EG R ++KG   +   +VP   + F  YE       W  + +   
Sbjct  77   KYNGTIQGLKYIWRTEGLRGMFKGNGTNCARIVPNSAVKFFSYEEASKRILWFYRQQTGN  136

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              +D++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  137  --DDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TDKSPRQ  181

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A    ++ EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  182  YRGIAHALSTVLKEEGPRALYKGWLPSVIGVIPYVGLNFSVYESLKDWL  230



>ref|XP_006476410.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Citrus sinensis]
Length=355

 Score =   289 bits (740),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 170/186 (91%), Gaps = 1/186 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP QYRG+FHAL+TVLR EGPR+LYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  170  RLTVQTEKSPRQYRGIFHALTTVLREEGPRSLYKGWLPSVIGVIPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVEDS-ELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTG  449
            LIKSK LGLV+D+ EL + TRLACGAAAGTVGQTVAYPLDVIRRRMQM GWK AAS+VTG
Sbjct  230  LIKSKALGLVDDNNELGVATRLACGAAAGTVGQTVAYPLDVIRRRMQMAGWKDAASVVTG  289

Query  448  EGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGV  269
            +GK++A LEY GM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGV
Sbjct  290  DGKAKAALEYNGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDILGV  349

Query  268  EIRISD  251
            E+RISD
Sbjct  350  EMRISD  355


 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 85/169 (50%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + ++EG R L+KG   +   ++P   + F  YE       WL + +   
Sbjct  77   KYNGTIQGLKYIWKSEGFRGLFKGNGTNCARIIPNSAVKFFSYEEASKGILWLYRRQTRN  136

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              E++EL+ V RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  137  --EEAELTPVLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TEKSPRQ  181

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A    +R EG R+LYKG +P+ + V+P + + F  YE +KD L
Sbjct  182  YRGIFHALTTVLREEGPRSLYKGWLPSVIGVIPYVGLNFAVYESLKDWL  230



>ref|XP_002297985.1| hypothetical protein POPTR_0001s10370g [Populus trichocarpa]
 gb|EEE82790.1| hypothetical protein POPTR_0001s10370g [Populus trichocarpa]
Length=354

 Score =   289 bits (740),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  + SP QYRG+ HALSTVL+ EGPRALYKGWLPSVIGV+PYVGLNF+VYESLKDW
Sbjct  170  RLTVQTDKSPRQYRGIAHALSTVLKEEGPRALYKGWLPSVIGVIPYVGLNFSVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K+ P GLVED+EL + TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+VTG+
Sbjct  230  LLKTNPFGLVEDNELGVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASVVTGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+AP EY+GM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  290  GRSKAPREYSGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDVLGVE  349

Query  265  IRISD  251
            +RISD
Sbjct  350  MRISD  354


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 49/169 (29%), Positives = 83/169 (49%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R EG R ++KG   +   +VP   + F  YE       W  + +   
Sbjct  77   KYNGTIQGLKYIWRTEGLRGMFKGNGTNCARIVPNSAVKFFSYEEASKRILWFYRQQTGN  136

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              +D++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  137  --DDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TDKSPRQ  181

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A    ++ EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  182  YRGIAHALSTVLKEEGPRALYKGWLPSVIGVIPYVGLNFSVYESLKDWL  230



>ref|XP_008360687.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Malus domestica]
Length=356

 Score =   289 bits (740),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  + SP QYRG++HAL+TV R EGPRALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  172  RLTVQTDMSPRQYRGIYHALTTVFREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  231

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKS+P GLV+DSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+V G+
Sbjct  232  LIKSRPFGLVQDSELSVPTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASVVVGD  291

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GK +A LEYTGM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  292  GKRRASLEYTGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDVLGVE  351

Query  265  IRISD  251
            +RISD
Sbjct  352  MRISD  356


 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 81/169 (48%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE       W  + +   
Sbjct  79   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEEASKGILWFYRQQTGN  138

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              ED++L+ V RL  GA AG +  +  YP+D++R R+ +                 +P +
Sbjct  139  --EDAQLTPVLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TDMSPRQ  183

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A     R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  184  YRGIYHALTTVFREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  232



>gb|KDO76471.1| hypothetical protein CISIN_1g018449mg [Citrus sinensis]
Length=288

 Score =   287 bits (734),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 170/186 (91%), Gaps = 1/186 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP QYRG+FHAL+TVLR EGPR+LYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  103  RLTVQTEKSPRQYRGIFHALTTVLREEGPRSLYKGWLPSVIGVIPYVGLNFAVYESLKDW  162

Query  625  LIKSKPLGLVEDS-ELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTG  449
            LIKSK LGLV+D+ EL + TRLACGAAAGTVGQTVAYPLDVIRRRMQM GWK AAS+VTG
Sbjct  163  LIKSKALGLVDDNNELGVATRLACGAAAGTVGQTVAYPLDVIRRRMQMAGWKDAASVVTG  222

Query  448  EGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGV  269
            +GK++A LEY GM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGV
Sbjct  223  DGKTKATLEYNGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDILGV  282

Query  268  EIRISD  251
            E+RISD
Sbjct  283  EMRISD  288


 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 85/169 (50%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + ++EG R L+KG   +   ++P   + F  YE       WL + +   
Sbjct  10   KYNGTIQGLKYIWKSEGFRGLFKGNGTNCARIIPNSAVKFFSYEEASKGILWLYRRQTRN  69

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              E++EL+ V RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  70   --EEAELTPVLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TEKSPRQ  114

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A    +R EG R+LYKG +P+ + V+P + + F  YE +KD L
Sbjct  115  YRGIFHALTTVLREEGPRSLYKGWLPSVIGVIPYVGLNFAVYESLKDWL  163



>emb|CDX91877.1| BnaC03g31790D [Brassica napus]
Length=353

 Score =   289 bits (739),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 168/185 (91%), Gaps = 2/185 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV   NSPYQYRG+ HALSTVLR EGPRALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  171  RLTVQTANSPYQYRGIAHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  230

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K  P GLVE++EL+I+TRL+CGA AGTVGQT+AYPLDVIRRRMQMVGWK A+S+VTGE
Sbjct  231  LVKDNPFGLVENNELTIITRLSCGAIAGTVGQTIAYPLDVIRRRMQMVGWKDASSVVTGE  290

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+  LEY GM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  291  GRSK--LEYNGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDVLGVE  348

Query  265  IRISD  251
             RISD
Sbjct  349  FRISD  353


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 84/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  78   KYSGTVQGLKYIWRTEGVRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYMYRQQTGN  137

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            E+++L+ V RL  GA AG +  +  YP+D++R R+ +               + +P +Y 
Sbjct  138  ENAQLTPVLRLGAGATAGIIAMSATYPMDMVRGRLTV-------------QTANSPYQYR  184

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            G+  A    +R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  185  GIAHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  231



>ref|XP_002874996.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH51255.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=352

 Score =   289 bits (739),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV   NSPYQYRG+ HALSTVLR EGPRALY+GWLPSVIGVVPYVGLNFAVYE+LKDW
Sbjct  168  RLTVQTANSPYQYRGIAHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAVYETLKDW  227

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K  P GLV++++L+IVTRL CGA AGTVGQ++AYPLDVIRRRMQMVGWK A+++VTGE
Sbjct  228  LLKDNPFGLVQNNDLTIVTRLTCGAIAGTVGQSIAYPLDVIRRRMQMVGWKDASAVVTGE  287

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+A LEYTGM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VK++LGVE
Sbjct  288  GRSKALLEYTGMMDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKEVLGVE  347

Query  265  IRISD  251
             RISD
Sbjct  348  FRISD  352


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 84/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  75   KYSGTVQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYMYRQRTGN  134

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            E+++L+ + RL  GA AG +  +  YP+D++R R+ +               + +P +Y 
Sbjct  135  ENAQLTPLLRLGAGATAGIIAMSATYPMDMVRGRLTVQ-------------TANSPYQYR  181

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            G+  A    +R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  182  GIAHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAVYETLKDWL  228



>emb|CDP12129.1| unnamed protein product [Coffea canephora]
Length=357

 Score =   289 bits (739),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP QYRG+FHAL TV   EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  173  RLTVQTEKSPTQYRGIFHALRTVFIEEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  232

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+KS+PLGL+++SELSI T+LACGA AGTVGQTVAYPLDVIRRRMQMVGWK AAS+VTG+
Sbjct  233  LVKSRPLGLIQESELSITTKLACGAVAGTVGQTVAYPLDVIRRRMQMVGWKDAASVVTGD  292

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GK + PLEY+GM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE  KDILGVE
Sbjct  293  GKRRVPLEYSGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEVAKDILGVE  352

Query  265  IRISD  251
            ++ISD
Sbjct  353  MKISD  357


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 81/169 (48%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R EG   L+KG   +   +VP   + F  YE       W  + K  G
Sbjct  80   KYNGTVQGLKYIWRTEGFMGLFKGNGTNCARIVPNSAVKFFSYEQASRQILWFYR-KQTG  138

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
               D+EL+ V RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  139  R-GDAELTPVLRLGAGACAGIIAMSATYPMDMVRGRLTV-------------QTEKSPTQ  184

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A R     EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  185  YRGIFHALRTVFIEEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  233



>ref|XP_006343883.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Solanum tuberosum]
Length=357

 Score =   288 bits (738),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 167/185 (90%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  + SP QYRG+FHAL TV   EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  173  RITVQTDKSPSQYRGIFHALRTVFVEEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  232

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K++P GL +D+ELS++T+L CGA AGT+GQTVAYPLDVIRRRMQM GWK AAS+V G+
Sbjct  233  LVKTRPFGLAQDTELSVMTKLGCGAVAGTIGQTVAYPLDVIRRRMQMGGWKNAASVVIGD  292

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GKS AP+EY+GMIDAFRKTVR+EGV ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGVE
Sbjct  293  GKSNAPIEYSGMIDAFRKTVRHEGVGALYKGLVPNSVKVVPSIAIAFVTYEVVKDILGVE  352

Query  265  IRISD  251
            +RISD
Sbjct  353  MRISD  357


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 88/181 (49%), Gaps = 19/181 (10%)
 Frame = -3

Query  805  RITVXXENS-PYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD  629
            +I +  +NS   +Y G    L  + R EG R ++KG   +   +VP   + F  YE    
Sbjct  68   KILLQVQNSHSIKYNGTVQGLKYIWRTEGLRGMFKGNGTNCARIVPNSAVKFFSYEEASK  127

Query  628  ---WLIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASI  458
               W  + +     ED+EL+ + RL  GA AG +  +  YP+D++R R+ +         
Sbjct  128  GILWFYRQQTGN--EDAELTPLLRLGAGACAGIIAMSATYPMDLVRGRITVQ--------  177

Query  457  VTGEGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDI  278
                   ++P +Y G+  A R     EG RALYKG +P+ + V+P + + F  YE +KD 
Sbjct  178  -----TDKSPSQYRGIFHALRTVFVEEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  232

Query  277  L  275
            L
Sbjct  233  L  233



>ref|XP_006396301.1| hypothetical protein EUTSA_v10028766mg [Eutrema salsugineum]
 gb|ESQ37754.1| hypothetical protein EUTSA_v10028766mg [Eutrema salsugineum]
Length=355

 Score =   288 bits (737),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV   NSPYQYRG+ HALSTVLR EG RALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  171  RLTVQTANSPYQYRGIAHALSTVLREEGFRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  230

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K  P GLVE+++L+I+TRL+CGA AGTVGQT+AYPLDVIRRRMQMVGWK A+S+VTG+
Sbjct  231  LVKDNPFGLVENNDLTIITRLSCGAIAGTVGQTIAYPLDVIRRRMQMVGWKDASSVVTGD  290

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+++A LEY+GMIDAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  291  GRNKAALEYSGMIDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDVLGVE  350

Query  265  IRISD  251
             RISD
Sbjct  351  FRISD  355


 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 86/171 (50%), Gaps = 22/171 (13%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLI-----KSKP  608
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE   + L+     ++K 
Sbjct  78   KYSGTVQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSYEQASEGLLYLYRRRTKN  137

Query  607  LGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAP  428
                E+++L+ + RL  GA AG +  +  YP+D++R R+ +               + +P
Sbjct  138  ----ENAQLTPLLRLGAGATAGIIAMSATYPMDMVRGRLTV-------------QTANSP  180

Query  427  LEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
             +Y G+  A    +R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  181  YQYRGIAHALSTVLREEGFRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  231



>ref|XP_004511523.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Cicer arietinum]
Length=330

 Score =   286 bits (732),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 168/185 (91%), Gaps = 2/185 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP QYRG+F+ALSTV R EG RALYKGWLPSVIGV+PYVGLNF+VYESLKDW
Sbjct  148  RLTVQTEASPRQYRGIFNALSTVFREEGARALYKGWLPSVIGVIPYVGLNFSVYESLKDW  207

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK+KPLG+ +DSELS+ TRLACGAAAGT+GQTVAYPLDVIRRRMQMVGWKGAAS+V G+
Sbjct  208  LIKTKPLGIAKDSELSVTTRLACGAAAGTIGQTVAYPLDVIRRRMQMVGWKGAASVVAGD  267

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GK  A  EYTGM+DAFRKTV+YEG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  268  GKGNA--EYTGMVDAFRKTVKYEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDVLGVE  325

Query  265  IRISD  251
            IRISD
Sbjct  326  IRISD  330


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 82/167 (49%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGL-V  596
            +Y G    L  + + EG R ++KG   +   ++P   + F  YE     ++    L    
Sbjct  55   KYNGTVQGLKYIWKTEGFRGMFKGNGTNCARIIPNSAVKFFSYEQASKGILNLYRLQTGN  114

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            E+++LS + RL  GA AG +  +  YP+D++R R+ +                 +P +Y 
Sbjct  115  EEAQLSPLLRLGAGACAGIIAMSATYPMDLVRGRLTVQ-------------TEASPRQYR  161

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            G+ +A     R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  162  GIFNALSTVFREEGARALYKGWLPSVIGVIPYVGLNFSVYESLKDWL  208



>gb|AES93971.2| substrate carrier family protein [Medicago truncatula]
Length=346

 Score =   286 bits (733),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 169/185 (91%), Gaps = 2/185 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP+QYRG+F+ALSTV R EG RALYKGWLPSVIGV+PYVGLNF+VYESLKDW
Sbjct  164  RLTVQTEASPHQYRGIFNALSTVFREEGARALYKGWLPSVIGVIPYVGLNFSVYESLKDW  223

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LI++KPLG+ +DSELS+ TRLACGAAAGT+GQTVAYPLDVIRRRMQM GWKGAAS+VTG+
Sbjct  224  LIQTKPLGIAQDSELSVTTRLACGAAAGTIGQTVAYPLDVIRRRMQMGGWKGAASVVTGD  283

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GK    LEYTGM+DAFRKTV+YEG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  284  GKGN--LEYTGMVDAFRKTVKYEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDVLGVE  341

Query  265  IRISD  251
            +RISD
Sbjct  342  MRISD  346


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/167 (29%), Positives = 82/167 (49%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGL-V  596
            +Y G    L  + + EG R ++KG   +   ++P   + F  YE   + ++    L    
Sbjct  71   KYNGTVQGLKYIWKTEGFRGMFKGNGTNCARIIPNSAVKFFSYEQASNGILSLYRLQTGN  130

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            E++ L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +Y 
Sbjct  131  EEAHLTPLLRLGAGACAGIIAMSATYPMDLVRGRLTVQ-------------TEASPHQYR  177

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            G+ +A     R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  178  GIFNALSTVFREEGARALYKGWLPSVIGVIPYVGLNFSVYESLKDWL  224



>ref|XP_009111419.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Brassica rapa]
 emb|CDY48505.1| BnaA09g00180D [Brassica napus]
 emb|CDY07175.1| BnaCnng01900D [Brassica napus]
Length=350

 Score =   286 bits (733),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 168/185 (91%), Gaps = 2/185 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV   NSPYQYRG+ HALSTVLR EGPRALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  168  RLTVQTANSPYQYRGIAHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  227

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K  P GLVE++EL+I+TRL+CGA AGTVGQT+AYPLDVIRRRMQMVGWK A+S+VTGE
Sbjct  228  LVKDNPFGLVENNELTIITRLSCGAIAGTVGQTIAYPLDVIRRRMQMVGWKDASSVVTGE  287

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+  LEY GM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  288  GRSK--LEYNGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDVLGVE  345

Query  265  IRISD  251
             +ISD
Sbjct  346  FKISD  350


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 85/169 (50%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE       +L + +P  
Sbjct  75   KYSGTVQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYLYRQQPGN  134

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              E+++L+ V RL  GA AG +  +  YP+D++R R+ +               + +P +
Sbjct  135  --ENAQLTPVLRLGAGATAGIIAMSATYPMDMVRGRLTVQ-------------TANSPYQ  179

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A    +R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  180  YRGIAHALSTVLREEGPRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  228



>ref|XP_011026923.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Populus euphratica]
Length=354

 Score =   286 bits (733),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  + SP QYRG+ HALSTVL+ EGPRALYKGWLPSVIGV+PYVGLNF+VYESLKDW
Sbjct  170  RLTVQTDKSPRQYRGIAHALSTVLKEEGPRALYKGWLPSVIGVIPYVGLNFSVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K+ P GLVED+EL + TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+VTG+
Sbjct  230  LLKTNPFGLVEDNELGVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASVVTGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+S+A  EY+GM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  290  GRSKASHEYSGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDVLGVE  349

Query  265  IRISD  251
            +RISD
Sbjct  350  MRISD  354


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/169 (29%), Positives = 83/169 (49%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R EG R ++KG   +   +VP   + F  YE       W  + +   
Sbjct  77   KYNGTIQGLKYIWRTEGLRGMFKGNGTNCARIVPNSAVKFFSYEEASKGILWFYRQQTGN  136

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              +D++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  137  --DDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TDKSPRQ  181

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A    ++ EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  182  YRGIAHALSTVLKEEGPRALYKGWLPSVIGVIPYVGLNFSVYESLKDWL  230



>ref|XP_002304548.1| hypothetical protein POPTR_0003s13730g [Populus trichocarpa]
 gb|EEE79527.1| hypothetical protein POPTR_0003s13730g [Populus trichocarpa]
Length=354

 Score =   285 bits (730),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  + SP QYRG+ HALSTVL+ EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  170  RLTVQTDKSPRQYRGIAHALSTVLKEEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K+KP GLVED+EL + TRLACGAAAGT GQTVAYPLDVIRRRMQMVGWK AAS+VTG+
Sbjct  230  LLKTKPFGLVEDNELGVATRLACGAAAGTFGQTVAYPLDVIRRRMQMVGWKDAASVVTGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+ +  LEYTGM+DAFRKTVR+EG  ALYKGLVPNSVKV+PSIAIAFVTYE VKD+L VE
Sbjct  290  GRGKTALEYTGMVDAFRKTVRHEGFGALYKGLVPNSVKVIPSIAIAFVTYEMVKDVLRVE  349

Query  265  IRISD  251
             RISD
Sbjct  350  TRISD  354


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/169 (29%), Positives = 83/169 (49%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R EG R ++KG   +   +VP   + F  YE       W  + +   
Sbjct  77   KYNGTIQGLKYIWRTEGLRGMFKGNGTNCARIVPNSAVKFFSYEEASKGILWFYRRQTGN  136

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              +D++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  137  --DDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TDKSPRQ  181

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A    ++ EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  182  YRGIAHALSTVLKEEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  230



>ref|XP_009763306.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Nicotiana sylvestris]
Length=355

 Score =   285 bits (729),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 167/185 (90%), Gaps = 2/185 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  + SP QYRG+FHAL TV   EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  173  RITVQTDKSPSQYRGIFHALRTVFVEEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  232

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K++PLGL +DSELS+ T+L CGA AGT+GQTVAYPLDVIRRRMQM GWK AAS+VTGE
Sbjct  233  LVKTRPLGLAQDSELSVTTKLGCGAVAGTIGQTVAYPLDVIRRRMQMGGWKNAASVVTGE  292

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
              S+APLEY+GM+DAFRKTVR+EGV ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGVE
Sbjct  293  --SKAPLEYSGMVDAFRKTVRHEGVGALYKGLVPNSVKVVPSIAIAFVTYEVVKDILGVE  350

Query  265  IRISD  251
            +RISD
Sbjct  351  MRISD  355


 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 82/169 (49%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE       W  + +   
Sbjct  80   KYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEEASRGILWFYRQQTGN  139

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              ED+EL+ + RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  140  --EDAELTPLLRLGAGACAGIIAMSATYPMDLVRGRITVQ-------------TDKSPSQ  184

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A R     EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  185  YRGIFHALRTVFVEEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  233



>ref|XP_004245537.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Solanum lycopersicum]
Length=357

 Score =   285 bits (730),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 167/185 (90%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  + SP QYRG+FHAL TV   EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  173  RITVQTDKSPSQYRGIFHALRTVFVEEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  232

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K++P GL +D+ELS++T+L CGA AGT+GQTVAYPLDVIRRRMQM GWK AAS+V G+
Sbjct  233  LVKTRPFGLAQDTELSVMTKLGCGAVAGTIGQTVAYPLDVIRRRMQMGGWKNAASVVIGD  292

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GK+ AP+EY+GM+DAFRKTVR+EGV ALYKGLVPNSVKVVPSIAIAFV+YE VKDILGVE
Sbjct  293  GKTNAPVEYSGMVDAFRKTVRHEGVGALYKGLVPNSVKVVPSIAIAFVSYEVVKDILGVE  352

Query  265  IRISD  251
            +RISD
Sbjct  353  MRISD  357


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 88/181 (49%), Gaps = 19/181 (10%)
 Frame = -3

Query  805  RITVXXENS-PYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD  629
            +I +  +NS   +Y G    L  + R EG R ++KG   +   +VP   + F  YE    
Sbjct  68   KILLQVQNSHSIKYNGTVQGLKYIWRTEGLRGMFKGNGTNCARIVPNSAVKFFSYEEASK  127

Query  628  ---WLIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASI  458
               W  + +     ED+EL+ + RL  GA AG +  +  YP+D++R R+ +         
Sbjct  128  GILWFYRQQTGN--EDAELTPLLRLGAGACAGIIAMSATYPMDLVRGRITVQ--------  177

Query  457  VTGEGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDI  278
                   ++P +Y G+  A R     EG RALYKG +P+ + V+P + + F  YE +KD 
Sbjct  178  -----TDKSPSQYRGIFHALRTVFVEEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  232

Query  277  L  275
            L
Sbjct  233  L  233



>ref|XP_003516718.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Glycine max]
 gb|KHN25655.1| Mitochondrial substrate carrier family protein B [Glycine soja]
Length=330

 Score =   284 bits (727),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 169/186 (91%), Gaps = 3/186 (2%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP QYRG+FHALSTV R EGPRALYKGWLPSVIGV+PYVGLNF+VYESLKDW
Sbjct  147  RLTVQTEASPRQYRGIFHALSTVFREEGPRALYKGWLPSVIGVIPYVGLNFSVYESLKDW  206

Query  625  LIKSKPLGL-VEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTG  449
            LI+SKP G+  +DSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+V G
Sbjct  207  LIRSKPFGMKAQDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASVVAG  266

Query  448  EGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGV  269
            EGKS+  LEYTGM+DAFRKTV++EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGV
Sbjct  267  EGKSK--LEYTGMVDAFRKTVQHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDILGV  324

Query  268  EIRISD  251
            E+RISD
Sbjct  325  EMRISD  330


 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 83/169 (49%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLK---DWLIKSKPLG  602
            +Y G    L  + + EG R ++KG   +   +VP   + F  YE       WL + +P  
Sbjct  54   KYNGTIQGLKYIWKTEGFRGMFKGNGTNCARIVPNSAVKFFSYEQASLGILWLYQRQPGN  113

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              E+++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +
Sbjct  114  --EEAQLTPILRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TEASPRQ  158

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A     R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  159  YRGIFHALSTVFREEGPRALYKGWLPSVIGVIPYVGLNFSVYESLKDWL  207



>ref|XP_006590494.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
isoform X2 [Glycine max]
Length=329

 Score =   284 bits (727),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 169/186 (91%), Gaps = 3/186 (2%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP QYRG+FHALSTV R EGPRALYKGWLPSVIGV+PYVGLNF+VYESLKDW
Sbjct  146  RLTVQTEASPCQYRGIFHALSTVFREEGPRALYKGWLPSVIGVIPYVGLNFSVYESLKDW  205

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWK-GAASIVTG  449
            LI+SKP G+ +DSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK  AAS+V G
Sbjct  206  LIRSKPFGIAQDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAAASVVAG  265

Query  448  EGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGV  269
            EGKS+  +EYTGM+DAFRKTV++EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGV
Sbjct  266  EGKSK--IEYTGMVDAFRKTVQHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDILGV  323

Query  268  EIRISD  251
            E+RISD
Sbjct  324  EMRISD  329


 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 82/169 (49%), Gaps = 19/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + + EG R ++KG   +   +VP   + F  YE       WL + +P  
Sbjct  54   KYNGTIQGLKYIWKTEGFRGMFKGNGTNCARIVPNSAVKFFSYEQASMGILWLYQRQP--  111

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
               +++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +
Sbjct  112  -GNEAQLTPILRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TEASPCQ  157

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A     R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  158  YRGIFHALSTVFREEGPRALYKGWLPSVIGVIPYVGLNFSVYESLKDWL  206



>ref|XP_011073667.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Sesamum indicum]
 ref|XP_011073676.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Sesamum indicum]
Length=357

 Score =   285 bits (729),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV    SP QYRG+FHAL TV   EGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  173  RLTVQTNKSPTQYRGIFHALRTVFTEEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  232

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK+ P GLVE+S+L++ TRLACGAAAG VGQTVAYPLDVIRRRMQMVGW+ AAS+VTG+
Sbjct  233  LIKTNPYGLVENSDLNVTTRLACGAAAGAVGQTVAYPLDVIRRRMQMVGWRHAASVVTGD  292

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GKS+ PLEYTGM+DAFRKTVRYEG  ALYKGL+PNSVKVVPSIAIAFVTYE VKDILGVE
Sbjct  293  GKSKTPLEYTGMVDAFRKTVRYEGFGALYKGLIPNSVKVVPSIAIAFVTYEVVKDILGVE  352

Query  265  IRISD  251
            ++I D
Sbjct  353  MKIPD  357


 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 84/169 (50%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE       WL + +   
Sbjct  80   KYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEEASKGILWLYRQQT--  137

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              ED++L+ + RL  GA AG +  +  YP+D++R R+ +               +++P +
Sbjct  138  GTEDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TNKSPTQ  184

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A R     EG RALYKG +P+ + VVP + + F  YE +KD L
Sbjct  185  YRGIFHALRTVFTEEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  233



>ref|XP_003538203.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
isoform X1 [Glycine max]
 gb|KHN35068.1| Mitochondrial substrate carrier family protein B [Glycine soja]
Length=330

 Score =   284 bits (726),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 169/186 (91%), Gaps = 3/186 (2%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP QYRG+FHALSTV R EGPRALYKGWLPSVIGV+PYVGLNF+VYESLKDW
Sbjct  147  RLTVQTEASPCQYRGIFHALSTVFREEGPRALYKGWLPSVIGVIPYVGLNFSVYESLKDW  206

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWK-GAASIVTG  449
            LI+SKP G+ +DSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK  AAS+V G
Sbjct  207  LIRSKPFGIAQDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAAASVVAG  266

Query  448  EGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGV  269
            EGKS+  +EYTGM+DAFRKTV++EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGV
Sbjct  267  EGKSK--IEYTGMVDAFRKTVQHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDILGV  324

Query  268  EIRISD  251
            E+RISD
Sbjct  325  EMRISD  330


 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 83/169 (49%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + + EG R ++KG   +   +VP   + F  YE       WL + +P  
Sbjct  54   KYNGTIQGLKYIWKTEGFRGMFKGNGTNCARIVPNSAVKFFSYEQASMGILWLYQRQPGN  113

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              E+++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +
Sbjct  114  --EEAQLTPILRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TEASPCQ  158

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A     R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  159  YRGIFHALSTVFREEGPRALYKGWLPSVIGVIPYVGLNFSVYESLKDWL  207



>ref|XP_006847299.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Amborella trichopoda]
 gb|ERN08880.1| hypothetical protein AMTR_s00015p00209030 [Amborella trichopoda]
Length=365

 Score =   285 bits (729),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 172/187 (92%), Gaps = 2/187 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SPY+YRGMF ALSTVLR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  179  RLTVQTEKSPYRYRGMFDALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  238

Query  625  LIKSKPLGLVE-DSE-LSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVT  452
            LIK+K LGLV+ DSE LS++TRL CGAAAGTVGQTVAYPLDVIRRRMQMVGWK A+SI+T
Sbjct  239  LIKTKALGLVDPDSEELSVLTRLGCGAAAGTVGQTVAYPLDVIRRRMQMVGWKDASSILT  298

Query  451  GEGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILG  272
             +G+S+APLEYTGM+DAFRKTVR EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKDILG
Sbjct  299  ADGRSKAPLEYTGMVDAFRKTVRNEGFGALYKGLVPNSVKVVPSIAIAFVTYEVVKDILG  358

Query  271  VEIRISD  251
            VE+RIS+
Sbjct  359  VEMRISE  365


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 85/169 (50%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + + EG R L+KG   +   +VP   + F  YE       WL + +P  
Sbjct  86   KYNGTIQGLKYIWQTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASSAILWLYRQQPGN  145

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              ED++L+ V RL  GA AG +  +  YPLD++R R+ +                ++P  
Sbjct  146  --EDAQLTPVLRLGAGACAGIIAMSATYPLDMVRGRLTVQ-------------TEKSPYR  190

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y GM DA    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  191  YRGMFDALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  239



>ref|XP_009617594.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Nicotiana tomentosiformis]
Length=355

 Score =   284 bits (727),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 166/185 (90%), Gaps = 2/185 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  + SP QYRG+FHAL TV   EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  173  RITVQTDKSPSQYRGIFHALRTVFVEEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  232

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K++P GL +DSELS+ T+L CGA AGT+GQTVAYPLDVIRRRMQM GWK AAS+VTGE
Sbjct  233  LVKTRPFGLAQDSELSVTTKLGCGAVAGTIGQTVAYPLDVIRRRMQMGGWKNAASVVTGE  292

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
              S+APLEY+GM+DAFRKTVR+EGV ALYKGLVPNSVKVVPSIAIAFVTYE VKDILGVE
Sbjct  293  --SKAPLEYSGMVDAFRKTVRHEGVGALYKGLVPNSVKVVPSIAIAFVTYEVVKDILGVE  350

Query  265  IRISD  251
            +RISD
Sbjct  351  MRISD  355


 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 82/169 (49%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE       W  + +   
Sbjct  80   KYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEEASRGILWFYRQQTGN  139

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              ED+EL+ + RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  140  --EDAELTPLLRLGAGACAGIIAMSATYPMDLVRGRITVQ-------------TDKSPSQ  184

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A R     EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  185  YRGIFHALRTVFVEEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  233



>ref|XP_011022540.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Populus euphratica]
Length=354

 Score =   284 bits (727),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 166/185 (90%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  + SP QYRG+ HALSTVL+ EGPRALYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  170  RLTVQTDKSPRQYRGIAHALSTVLKEEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K+KP GLVE++EL + TRLACGAAAGT GQTVAYPLDVIRRRMQMVGWK AAS+VTG+
Sbjct  230  LLKTKPFGLVEENELGVATRLACGAAAGTFGQTVAYPLDVIRRRMQMVGWKDAASVVTGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+ +  LEYTGMIDAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+L VE
Sbjct  290  GRGKTALEYTGMIDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDVLRVE  349

Query  265  IRISD  251
             RISD
Sbjct  350  TRISD  354


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/169 (29%), Positives = 83/169 (49%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R EG R ++KG   +   +VP   + F  YE       W  + +   
Sbjct  77   KYNGTIQGLKYIWRTEGLRGMFKGNGTNCARIVPNSAVKFFSYEEASKGILWFYRRQTGN  136

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              +D++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  137  --DDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TDKSPRQ  181

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A    ++ EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  182  YRGIAHALSTVLKEEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKDWL  230



>gb|AFK35995.1| unknown [Lotus japonicus]
Length=170

 Score =   275 bits (704),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 147/170 (86%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = -3

Query  760  MFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVEDSEL  581
            MFHALSTVLR EGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKP GL +DSEL
Sbjct  1    MFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPFGLAQDSEL  60

Query  580  SIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTGMIDA  401
             + TRLACGAAAGT+GQTVAYPLDVIRRRMQMVGW  AAS+V G+G+ + PLEYTGM+DA
Sbjct  61   GVTTRLACGAAAGTIGQTVAYPLDVIRRRMQMVGWNHAASVVAGDGRGKTPLEYTGMVDA  120

Query  400  FRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIRISD  251
            FRKTVRYEG  ALYKGLVPNSVKVVPSIA+ FVTYE VKDILGVEIRISD
Sbjct  121  FRKTVRYEGFGALYKGLVPNSVKVVPSIALGFVTYEMVKDILGVEIRISD  170


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 0/54 (0%)
 Frame = -3

Query  784  NSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  623
             +P +Y GM  A    +R EG  ALYKG +P+ + VVP + L F  YE +KD L
Sbjct  109  KTPLEYTGMVDAFRKTVRYEGFGALYKGLVPNSVKVVPSIALGFVTYEMVKDIL  162



>ref|XP_006654848.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Oryza brachyantha]
Length=355

 Score =   280 bits (717),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 163/185 (88%), Gaps = 2/185 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHAL TV R EG RALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  173  RITVQTEKSPYQYRGMFHALGTVYREEGFRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  232

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K+ PL L +D+EL +VTRL CGA AGT+GQTVAYPLDVIRRRMQMVGW  AASIVTGE
Sbjct  233  LLKTNPLDLAKDNELHVVTRLGCGAVAGTIGQTVAYPLDVIRRRMQMVGWNHAASIVTGE  292

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GK    L+Y GMIDAFRKTVRYEGV ALYKGLVPNSVKVVPSIAIAFVTYE VK++LGVE
Sbjct  293  GKE--ALQYNGMIDAFRKTVRYEGVGALYKGLVPNSVKVVPSIAIAFVTYEFVKEVLGVE  350

Query  265  IRISD  251
            +RISD
Sbjct  351  MRISD  355


 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 83/169 (49%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE       WL + +   
Sbjct  80   KYNGTVQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSYEQASSGILWLYRRQTGD  139

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              ED++LS + RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  140  --EDAQLSPLLRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TEKSPYQ  184

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y GM  A     R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  185  YRGMFHALGTVYREEGFRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  233



>ref|XP_003611013.1| Calcium-binding mitochondrial carrier protein SCaMC-1-B [Medicago 
truncatula]
Length=388

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 167/184 (91%), Gaps = 2/184 (1%)
 Frame = -3

Query  802  ITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  623
            + +  E SP+QYRG+F+ALSTV R EG RALYKGWLPSVIGV+PYVGLNF+VYESLKDWL
Sbjct  207  LILQTEASPHQYRGIFNALSTVFREEGARALYKGWLPSVIGVIPYVGLNFSVYESLKDWL  266

Query  622  IKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEG  443
            I++KPLG+ +DSELS+ TRLACGAAAGT+GQTVAYPLDVIRRRMQM GWKGAAS+VTG+G
Sbjct  267  IQTKPLGIAQDSELSVTTRLACGAAAGTIGQTVAYPLDVIRRRMQMGGWKGAASVVTGDG  326

Query  442  KSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEI  263
            K    LEYTGM+DAFRKTV+YEG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE+
Sbjct  327  KGN--LEYTGMVDAFRKTVKYEGFGALYKGLVPNSVKVVPSIAIAFVTYEMVKDVLGVEM  384

Query  262  RISD  251
            RISD
Sbjct  385  RISD  388



>ref|XP_010676334.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Beta vulgaris subsp. vulgaris]
Length=355

 Score =   278 bits (711),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 166/185 (90%), Gaps = 1/185 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  + SP QYRG++HAL+TV R EG RALYKGWLPSVIGV+PYVGLNFAVYESLKD+
Sbjct  172  RLTVQTDKSPQQYRGIYHALTTVFREEGARALYKGWLPSVIGVIPYVGLNFAVYESLKDY  231

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K  P GLV+D ELS+ TRLACGA AGT+GQTVAYPLDV+RRRMQMVGWK A++++TG+
Sbjct  232  LVKENPFGLVQDKELSVTTRLACGAVAGTIGQTVAYPLDVVRRRMQMVGWKDASTVITGD  291

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GK  A LEYTGM+DAFRKTVRYEG RALYKGLVPNSVKVVPSI+IAFVTYE VKD+LGVE
Sbjct  292  GKKVA-LEYTGMVDAFRKTVRYEGFRALYKGLVPNSVKVVPSISIAFVTYEVVKDLLGVE  350

Query  265  IRISD  251
            +RISD
Sbjct  351  MRISD  355


 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 83/169 (49%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + + EG R L+KG   +   +VP   + F  YE       WL + +   
Sbjct  79   KYNGTVQGLKYIWQTEGLRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWLYRQQTGN  138

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              ED+EL+ V RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  139  --EDAELTPVLRLGAGACAGIIAMSATYPMDLVRGRLTV-------------QTDKSPQQ  183

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A     R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  184  YRGIYHALTTVFREEGARALYKGWLPSVIGVIPYVGLNFAVYESLKDYL  232



>ref|XP_007158565.1| hypothetical protein PHAVU_002G163100g [Phaseolus vulgaris]
 gb|ESW30559.1| hypothetical protein PHAVU_002G163100g [Phaseolus vulgaris]
Length=334

 Score =   277 bits (708),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 149/185 (81%), Positives = 165/185 (89%), Gaps = 2/185 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP QYRG++HALSTV R EGPRALYKGWLPSVIGV+PYVGLNFA+YESLKDW
Sbjct  152  RLTVQTEASPRQYRGIYHALSTVFREEGPRALYKGWLPSVIGVIPYVGLNFALYESLKDW  211

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LI+SKP G+ +DSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AA +V GE
Sbjct  212  LIRSKPFGMGQDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAAPVVAGE  271

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GKS   +EY+GM+DAFRKTV +EG  ALYKGLVPNSVKVVPSIAIAFV+YE VKDILGVE
Sbjct  272  GKS--IMEYSGMVDAFRKTVHHEGFGALYKGLVPNSVKVVPSIAIAFVSYEMVKDILGVE  329

Query  265  IRISD  251
            +RIS 
Sbjct  330  VRISH  334


 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 91/181 (50%), Gaps = 19/181 (10%)
 Frame = -3

Query  805  RITVXXENSPY-QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLK  632
            +I +  +NS   +Y G    L  + + EG R L+KG   +   +VP   + F  YE +LK
Sbjct  47   KILLQVQNSQNIKYNGTSQGLKYIWKTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQALK  106

Query  631  D--WLIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASI  458
               W  + +P    E+++L+ + RL  GA AG +  +  YP+D++R R+ +         
Sbjct  107  GILWFYQQQPGN--EEAQLTPILRLGAGACAGIIAMSATYPMDMVRGRLTVQ--------  156

Query  457  VTGEGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDI  278
                    +P +Y G+  A     R EG RALYKG +P+ + V+P + + F  YE +KD 
Sbjct  157  -----TEASPRQYRGIYHALSTVFREEGPRALYKGWLPSVIGVIPYVGLNFALYESLKDW  211

Query  277  L  275
            L
Sbjct  212  L  212



>ref|NP_001130208.1| uncharacterized protein LOC100191302 [Zea mays]
 gb|ACF78358.1| unknown [Zea mays]
 gb|ACF84841.1| unknown [Zea mays]
 gb|ACF86208.1| unknown [Zea mays]
 gb|ACF88271.1| unknown [Zea mays]
 gb|ACG35197.1| Grave disease carrier protein [Zea mays]
 gb|ACL52670.1| unknown [Zea mays]
 gb|AFW79416.1| grave disease carrier protein isoform 1 [Zea mays]
 gb|AFW79417.1| grave disease carrier protein isoform 2 [Zea mays]
Length=355

 Score =   275 bits (703),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 160/185 (86%), Gaps = 2/185 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  + SPYQYRGMFHAL TV R EG RALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  173  RITVQTDKSPYQYRGMFHALGTVYREEGFRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  232

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+++   GL  D+EL +VTRL CGA AGT+GQTVAYPLDVIRRRMQMVGW  A SIVTG+
Sbjct  233  LLQTNSFGLANDNELHVVTRLGCGAVAGTIGQTVAYPLDVIRRRMQMVGWSHADSIVTGQ  292

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GK    L+Y GMIDAFRKTVR+EGV ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  293  GKE--ALQYNGMIDAFRKTVRHEGVGALYKGLVPNSVKVVPSIAIAFVTYEVVKDVLGVE  350

Query  265  IRISD  251
            +RISD
Sbjct  351  MRISD  355


 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 83/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  80   KYNGTVQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWAYRQQTGE  139

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +Y 
Sbjct  140  EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TDKSPYQYR  186

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A     R EG RALYKG +P+ + VVP + + F  YE +KD L
Sbjct  187  GMFHALGTVYREEGFRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  233



>ref|XP_003567810.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1 
[Brachypodium distachyon]
Length=354

 Score =   275 bits (703),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 160/184 (87%), Gaps = 2/184 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHAL TV R EG RALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  173  RITVQTEQSPYQYRGMFHALGTVYREEGFRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  232

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+++  LGL +D+EL IVTRL CGA AGT+GQTVAYPLDV+RRRMQMVGW  AASIVTGE
Sbjct  233  LLQTNTLGLAKDNELHIVTRLGCGAVAGTIGQTVAYPLDVVRRRMQMVGWNHAASIVTGE  292

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GK    L+Y GMIDAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  293  GKE--ALQYNGMIDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVLGVE  350

Query  265  IRIS  254
            +RI 
Sbjct  351  MRID  354


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 82/167 (49%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  +   EG R L+KG   +   +VP   + F  YE + +  L   +     
Sbjct  80   KYNGTVQGLKYIWGTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASRGILYLYRQQSGD  139

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++LS V RL  GA AG +  +  YP+D++R R+ +                Q+P +Y 
Sbjct  140  EDAQLSPVLRLGAGATAGIIAMSATYPMDMVRGRITVQ-------------TEQSPYQYR  186

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A     R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  187  GMFHALGTVYREEGFRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  233



>ref|XP_002441594.1| hypothetical protein SORBIDRAFT_09g030000 [Sorghum bicolor]
 gb|EES20024.1| hypothetical protein SORBIDRAFT_09g030000 [Sorghum bicolor]
Length=355

 Score =   274 bits (701),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 160/185 (86%), Gaps = 2/185 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  + SPYQYRGMFHAL TV R EG RALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  173  RITVQTDKSPYQYRGMFHALGTVYREEGFRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  232

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+++ P GL  D+EL +VTRL CGA AGT+GQTVAYPLDVIRRRMQMVGW  A SI+TG+
Sbjct  233  LLQTNPFGLANDNELHVVTRLGCGAVAGTIGQTVAYPLDVIRRRMQMVGWNHADSIITGK  292

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GK    L+Y GMIDAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  293  GKE--ALQYNGMIDAFRKTVRHEGAGALYKGLVPNSVKVVPSIAIAFVTYEVVKDVLGVE  350

Query  265  IRISD  251
            +RISD
Sbjct  351  MRISD  355


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 83/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L   +     
Sbjct  80   KYNGTVQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSYEQAAKGILWAYRQQTGE  139

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +Y 
Sbjct  140  EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TDKSPYQYR  186

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A     R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  187  GMFHALGTVYREEGFRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  233



>ref|XP_004961067.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Setaria italica]
Length=355

 Score =   273 bits (698),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/185 (79%), Positives = 160/185 (86%), Gaps = 2/185 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  + SPYQYRGMFHAL TV R EG RALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  173  RITVQTDKSPYQYRGMFHALGTVYREEGFRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  232

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+++ P GL   +EL +VTRL CGA AGT+GQTVAYPLDVIRRRMQMVGW  A SIVTG+
Sbjct  233  LLQTNPFGLANGNELHVVTRLGCGAVAGTIGQTVAYPLDVIRRRMQMVGWSHADSIVTGQ  292

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GK    L+Y GMIDAFRKTVR+EGV ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  293  GKE--ALQYNGMIDAFRKTVRHEGVGALYKGLVPNSVKVVPSIAIAFVTYEVVKDVLGVE  350

Query  265  IRISD  251
            +RISD
Sbjct  351  MRISD  355


 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 82/169 (49%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE       W  + +   
Sbjct  80   KYNGTIQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILWAYRQRTGD  139

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              ED++LS + RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  140  --EDAQLSPLLRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TDKSPYQ  184

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y GM  A     R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  185  YRGMFHALGTVYREEGFRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  233



>ref|NP_001056459.1| Os05g0585900 [Oryza sativa Japonica Group]
 gb|AAT47068.1| putative peroxisomal Ca-dependent solute carrier [Oryza sativa 
Japonica Group]
 dbj|BAF18373.1| Os05g0585900 [Oryza sativa Japonica Group]
 dbj|BAG93774.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64855.1| hypothetical protein OsJ_19712 [Oryza sativa Japonica Group]
Length=355

 Score =   273 bits (698),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 161/185 (87%), Gaps = 2/185 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHAL +V R EG RALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  173  RITVQTEKSPYQYRGMFHALGSVYREEGFRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  232

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+++ P  L +D+EL +VTRL CGA AGT+GQTVAYPLDVIRRRMQMVGW  AASIVTGE
Sbjct  233  LLQTNPYDLGKDNELHVVTRLGCGAVAGTIGQTVAYPLDVIRRRMQMVGWNNAASIVTGE  292

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GK    L+Y GMIDAFRKTVRYEGV ALYKGLVPNSVKVVPSIAIAFVTYE V+ +LGVE
Sbjct  293  GKE--ALQYNGMIDAFRKTVRYEGVGALYKGLVPNSVKVVPSIAIAFVTYEFVQKVLGVE  350

Query  265  IRISD  251
            +RISD
Sbjct  351  MRISD  355


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 83/169 (49%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE       WL + +   
Sbjct  80   KYNGTIQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSYEQASSGILWLYRQQTGN  139

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              ED++LS + RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  140  --EDAQLSPLLRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TEKSPYQ  184

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y GM  A     R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  185  YRGMFHALGSVYREEGFRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  233



>gb|EPS68599.1| hypothetical protein M569_06168 [Genlisea aurea]
Length=352

 Score =   273 bits (697),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 152/186 (82%), Positives = 165/186 (89%), Gaps = 4/186 (2%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHALSTVLR EG RALY+GWLPSVIGVVPYVGLNFAVYESLKD 
Sbjct  170  RITVQTEKSPYQYRGMFHALSTVLREEGFRALYRGWLPSVIGVVPYVGLNFAVYESLKDV  229

Query  625  LIKSKPLGLV-EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTG  449
            ++ SKPLGLV E+ EL +VTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGW  A S++ G
Sbjct  230  IVASKPLGLVNENDELGVVTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWANAGSVIRG  289

Query  448  EGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGV  269
            +GK    +EY GM+DAFRKTV+ EG RALYKGLVPNSVKVVPSIAIAFVTYEQVK++LGV
Sbjct  290  DGKG---VEYDGMVDAFRKTVKLEGYRALYKGLVPNSVKVVPSIAIAFVTYEQVKELLGV  346

Query  268  EIRISD  251
            EIRISD
Sbjct  347  EIRISD  352


 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 84/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG + L+KG   +   ++P   + F  YE + K  L   +     
Sbjct  77   RYNGTIQGLKYIWRTEGFKGLFKGNGTNCARIIPNSAVKFFSYEQASKGILYLYRQQTGN  136

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++ + V RL  GA AG +  +  YP+D++R R+ +   K             +P +Y 
Sbjct  137  EDAQHNPVLRLGAGACAGIIAMSATYPMDMVRGRITVQTEK-------------SPYQYR  183

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A    +R EG RALY+G +P+ + VVP + + F  YE +KD++
Sbjct  184  GMFHALSTVLREEGFRALYRGWLPSVIGVVPYVGLNFAVYESLKDVI  230



>gb|EMT21891.1| Mitochondrial substrate carrier family protein B [Aegilops tauschii]
Length=283

 Score =   270 bits (690),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 158/184 (86%), Gaps = 2/184 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHAL TV R EG RALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  102  RITVQTEKSPYQYRGMFHALGTVYREEGFRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  161

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L++S    L +D+EL +VTRL CGA AGT+GQTVAYPLDV+RRRMQMVGW  AASIVTGE
Sbjct  162  LLQSNAFDLAKDNELHVVTRLGCGAVAGTIGQTVAYPLDVVRRRMQMVGWSHAASIVTGE  221

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GK    L+Y GMIDAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  222  GKE--ALQYNGMIDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVLGVE  279

Query  265  IRIS  254
            +RI 
Sbjct  280  MRID  283


 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 83/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + +  L   +     
Sbjct  9    KYNGTVQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSYEQASRGILYLYRQQTGD  68

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            E+++LS + RL  GA AG +  +  YP+D++R R+ +                ++P +Y 
Sbjct  69   ENAQLSPILRLGAGATAGIIAMSATYPMDMVRGRITVQ-------------TEKSPYQYR  115

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A     R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  116  GMFHALGTVYREEGFRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  162



>gb|EAY99214.1| hypothetical protein OsI_21172 [Oryza sativa Indica Group]
Length=355

 Score =   272 bits (695),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 147/185 (79%), Positives = 161/185 (87%), Gaps = 2/185 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHAL +V R EG RALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  173  RITVQTEKSPYQYRGMFHALGSVYREEGFRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  232

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+++ P  L +D+EL +VTRL CGA AGT+GQTVAYPLDVIRRRMQMVGW  AASIVTGE
Sbjct  233  LLQTNPYDLGKDNELHVVTRLGCGAVAGTIGQTVAYPLDVIRRRMQMVGWNNAASIVTGE  292

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GK    L+Y GMIDAFRKTVRYEGV ALY+GLVPNSVKVVPSIAIAFVTYE V+ +LGVE
Sbjct  293  GKE--ALQYNGMIDAFRKTVRYEGVGALYQGLVPNSVKVVPSIAIAFVTYEFVQKVLGVE  350

Query  265  IRISD  251
            +RISD
Sbjct  351  MRISD  355


 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 55/169 (33%), Positives = 83/169 (49%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE       WL + +   
Sbjct  80   KYNGTIQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSYEQASSGILWLYRQQTGN  139

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              ED++LS + RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  140  --EDAQLSPLLRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TEKSPYQ  184

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y GM  A     R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  185  YRGMFHALGSVYREEGFRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  233



>dbj|BAJ94251.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK02453.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=354

 Score =   270 bits (691),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 158/184 (86%), Gaps = 2/184 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHAL TV R EG RALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  173  RITVQTEKSPYQYRGMFHALGTVYREEGFRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  232

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L++S    L +D+EL +VTRL CGA AGT+GQTVAYPLDV+RRRMQMVGW  AASIVTGE
Sbjct  233  LLQSNAFDLAKDNELHVVTRLGCGAVAGTIGQTVAYPLDVVRRRMQMVGWSHAASIVTGE  292

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GK    L+Y GM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  293  GKE--ALQYNGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVLGVE  350

Query  265  IRIS  254
            +RI 
Sbjct  351  MRID  354


 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 83/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + +  L   +     
Sbjct  80   KYNGTVQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSYEQASRGILYLYRQQTGD  139

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            E+++LS + RL  GA AG +  +  YP+D++R R+ +                ++P +Y 
Sbjct  140  ENAQLSPILRLGAGATAGIIAMSATYPMDMVRGRITVQ-------------TEKSPYQYR  186

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A     R EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  187  GMFHALGTVYREEGFRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  233



>dbj|BAJ85614.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=354

 Score =   268 bits (684),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 157/184 (85%), Gaps = 2/184 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E SPYQYRGMFHAL TV   EG RALY+GWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  173  RITVQTEKSPYQYRGMFHALGTVYCEEGFRALYRGWLPSVIGVVPYVGLNFAVYESLKDW  232

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L++S    L +D+EL +VTRL CGA AGT+GQTVAYPLDV+RRRMQMVGW  AASIVTGE
Sbjct  233  LLQSNAFDLAKDNELHVVTRLGCGAVAGTIGQTVAYPLDVVRRRMQMVGWSHAASIVTGE  292

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            GK    L+Y GM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIAFVTYE VKD+LGVE
Sbjct  293  GKE--ALQYNGMVDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIAFVTYEAVKDVLGVE  350

Query  265  IRIS  254
            +RI 
Sbjct  351  MRID  354


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 82/167 (49%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + +  L   +     
Sbjct  80   KYNGTVQGLKYIWRTEGLRGLFKGNGTNCARIVPNSAVKFFSYEQASRGILYLYRQQTGD  139

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            E+++LS + RL  GA AG +  +  YP+D++R R+ +                ++P +Y 
Sbjct  140  ENAQLSPILRLGAGATAGIIAMSATYPMDMVRGRITVQ-------------TEKSPYQYR  186

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A       EG RALY+G +P+ + VVP + + F  YE +KD L
Sbjct  187  GMFHALGTVYCEEGFRALYRGWLPSVIGVVPYVGLNFAVYESLKDWL  233



>gb|KJB41486.1| hypothetical protein B456_007G106400 [Gossypium raimondii]
Length=331

 Score =   261 bits (667),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV  E+SPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGV+PYVGLNF+VYESLKDW
Sbjct  170  RITVQTESSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFSVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIKS+P GLVEDSELS+ TRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWK AAS+V+G+
Sbjct  230  LIKSRPFGLVEDSELSVTTRLACGAAAGTVGQTVAYPLDVIRRRMQMVGWKDAASVVSGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKV  329
            G+++A LEYTGMIDAFRKTVR+EG  ALYKGLVPNSVKV
Sbjct  290  GRNKASLEYTGMIDAFRKTVRHEGFGALYKGLVPNSVKV  328


 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 83/168 (49%), Gaps = 16/168 (10%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIK--SKPLGL  599
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE     ++    +  G 
Sbjct  77   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILYLYQRQTG-  135

Query  598  VEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEY  419
             ED++L+ + RL  GA AG +  +  YP+D++R R+ +                 +P +Y
Sbjct  136  NEDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRITVQ-------------TESSPYQY  182

Query  418  TGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
             GM  A    +R EG RALYKG +P+ + V+P + + F  YE +KD L
Sbjct  183  RGMFHALSTVLREEGPRALYKGWLPSVIGVIPYVGLNFSVYESLKDWL  230



>gb|KJB24251.1| hypothetical protein B456_004G135200 [Gossypium raimondii]
Length=335

 Score =   260 bits (664),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 151/165 (92%), Gaps = 0/165 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP+QYRG+FHALSTVLR EGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  170  RLTVQTEKSPHQYRGIFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK KPLGLVEDSEL + TRLACGAAAGT+GQTVAYPLDVIRRRMQMVGWK AAS+VTG+
Sbjct  230  LIKRKPLGLVEDSELGVTTRLACGAAAGTIGQTVAYPLDVIRRRMQMVGWKDAASVVTGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAI  311
            GK++AP+EY GM+D FRKTVRYEG  ALYKGLVPNSVK+V S+ +
Sbjct  290  GKNKAPIEYNGMVDTFRKTVRYEGFGALYKGLVPNSVKMVDSMHL  334


 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 84/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R ++KG   +   ++P   + F  YE + K  L   +     
Sbjct  77   KYNGTIQGLKYIWRTEGFRGMFKGNGTNCARIIPNSAVKFFSYEEASKGILYLYRQQSGN  136

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +Y 
Sbjct  137  EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TEKSPHQYR  183

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            G+  A    +R EG RALYKG +P+ + VVP + + F  YE +KD L
Sbjct  184  GIFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  230



>gb|KJB24248.1| hypothetical protein B456_004G135200 [Gossypium raimondii]
Length=332

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP+QYRG+FHALSTVLR EGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  170  RLTVQTEKSPHQYRGIFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK KPLGLVEDSEL + TRLACGAAAGT+GQTVAYPLDVIRRRMQMVGWK AAS+VTG+
Sbjct  230  LIKRKPLGLVEDSELGVTTRLACGAAAGTIGQTVAYPLDVIRRRMQMVGWKDAASVVTGD  289

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKV  329
            GK++AP+EY GM+D FRKTVRYEG  ALYKGLVPNSVKV
Sbjct  290  GKNKAPIEYNGMVDTFRKTVRYEGFGALYKGLVPNSVKV  328


 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 84/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R ++KG   +   ++P   + F  YE + K  L   +     
Sbjct  77   KYNGTIQGLKYIWRTEGFRGMFKGNGTNCARIIPNSAVKFFSYEEASKGILYLYRQQSGN  136

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +Y 
Sbjct  137  EDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TEKSPHQYR  183

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            G+  A    +R EG RALYKG +P+ + VVP + + F  YE +KD L
Sbjct  184  GIFHALSTVLREEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  230



>ref|XP_001766394.1| predicted protein [Physcomitrella patens]
 gb|EDQ68722.1| predicted protein [Physcomitrella patens]
Length=365

 Score =   254 bits (649),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 163/185 (88%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  ++SPY+Y+GM+HA  T+++ EG RALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  181  RLTVQTQDSPYRYKGMYHAFRTIIQEEGARALYKGWLPSVIGVVPYVGLNFAVYESLKDW  240

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            ++K       + ++L+++T+L CGAAAGTVGQTVAYPLDVIRRR+QMVGWK A+ IVT +
Sbjct  241  ILKHPHWQPDDGADLAVLTKLGCGAAAGTVGQTVAYPLDVIRRRLQMVGWKSASPIVTAD  300

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+ + P++YTGM+DAFRKTV+YEGV ALYKGLVPNSVKVVPSIA+AFVTYE +KD++GVE
Sbjct  301  GQVKQPMQYTGMVDAFRKTVKYEGVGALYKGLVPNSVKVVPSIALAFVTYELMKDLMGVE  360

Query  265  IRISD  251
            +RISD
Sbjct  361  MRISD  365


 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 82/165 (50%), Gaps = 14/165 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVY-ESLKDWLIKSKPLGLV  596
            +Y G    L ++  +EG R  +KG   +   ++P   + F  Y E+ K  L   +     
Sbjct  88   KYSGTIQGLKSIWGSEGIRGFFKGNGTNCARIIPNSAVKFFAYEEASKSILWAYRKESGQ  147

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
             D+EL+ V RL  GA AG +  +  YP+D++R R+ +                 +P  Y 
Sbjct  148  PDAELTPVLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TQDSPYRYK  194

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKD  281
            GM  AFR  ++ EG RALYKG +P+ + VVP + + F  YE +KD
Sbjct  195  GMYHAFRTIIQEEGARALYKGWLPSVIGVVPYVGLNFAVYESLKD  239



>ref|XP_001756133.1| predicted protein [Physcomitrella patens]
 gb|EDQ78999.1| predicted protein [Physcomitrella patens]
Length=365

 Score =   250 bits (638),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 159/185 (86%), Gaps = 0/185 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  ++ P  Y+GM+HA  T++  EG RALYKGWLPSVIGVVPYVGLNFAVYESLKDW
Sbjct  181  RLTVQTQDGPLHYKGMYHAFRTIIHEEGARALYKGWLPSVIGVVPYVGLNFAVYESLKDW  240

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            ++K       + ++L+++T+L CGAAAGTVGQTVAYPLDVIRRR+QMVGWK A+ IVT +
Sbjct  241  ILKHPQWQPDDGADLAVLTKLGCGAAAGTVGQTVAYPLDVIRRRLQMVGWKSASPIVTAD  300

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G+ + P++YTGM+DAFRKTV+YEGV ALYKGLVPNSVKVVPSIA+AFVTYE +KD++GVE
Sbjct  301  GQVKQPMQYTGMVDAFRKTVKYEGVGALYKGLVPNSVKVVPSIALAFVTYELMKDLMGVE  360

Query  265  IRISD  251
            +RISD
Sbjct  361  MRISD  365


 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 85/165 (52%), Gaps = 14/165 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVY-ESLKDWLIKSKPLGLV  596
            +Y G    L ++  +EG R  +KG   +   ++P   + F  Y E+ +  L   +     
Sbjct  88   KYSGTIQGLKSIWGSEGLRGFFKGNGTNCARIIPNSAVKFFAYEEASRSILWAYRKESDQ  147

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
             D+EL+ V RL  GA AG +  +  YP+D++R R+         ++ T +G    PL Y 
Sbjct  148  PDAELTPVLRLGAGACAGIIAMSATYPMDMVRGRL---------TVQTQDG----PLHYK  194

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKD  281
            GM  AFR  +  EG RALYKG +P+ + VVP + + F  YE +KD
Sbjct  195  GMYHAFRTIIHEEGARALYKGWLPSVIGVVPYVGLNFAVYESLKD  239



>gb|KDO76473.1| hypothetical protein CISIN_1g018449mg [Citrus sinensis]
Length=333

 Score =   243 bits (620),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 145/160 (91%), Gaps = 1/160 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E SP QYRG+FHAL+TVLR EGPR+LYKGWLPSVIGV+PYVGLNFAVYESLKDW
Sbjct  170  RLTVQTEKSPRQYRGIFHALTTVLREEGPRSLYKGWLPSVIGVIPYVGLNFAVYESLKDW  229

Query  625  LIKSKPLGLVED-SELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTG  449
            LIKSK LGLV+D +EL + TRLACGAAAGTVGQTVAYPLDVIRRRMQM GWK AAS+VTG
Sbjct  230  LIKSKALGLVDDNNELGVATRLACGAAAGTVGQTVAYPLDVIRRRMQMAGWKDAASVVTG  289

Query  448  EGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKV  329
            +GK++A LEY GM+DAFRKTVR+EG  ALYKGLVPNSVKV
Sbjct  290  DGKTKATLEYNGMVDAFRKTVRHEGFGALYKGLVPNSVKV  329


 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 85/169 (50%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD---WLIKSKPLG  602
            +Y G    L  + ++EG R L+KG   +   ++P   + F  YE       WL + +   
Sbjct  77   KYNGTIQGLKYIWKSEGFRGLFKGNGTNCARIIPNSAVKFFSYEEASKGILWLYRRQTRN  136

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
              E++EL+ V RL  GA AG +  +  YP+D++R R+ +                ++P +
Sbjct  137  --EEAELTPVLRLGAGACAGIIAMSATYPMDMVRGRLTVQ-------------TEKSPRQ  181

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            Y G+  A    +R EG R+LYKG +P+ + V+P + + F  YE +KD L
Sbjct  182  YRGIFHALTTVLREEGPRSLYKGWLPSVIGVIPYVGLNFAVYESLKDWL  230



>ref|XP_008355175.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1, 
partial [Malus domestica]
Length=149

 Score =   221 bits (562),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -3

Query  676  VPYVGLNFAVYESLKDWLIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRR  497
            VPYVGLNFAVYESLKDWLIKS+P GLV+D++LS+ TRLACGAAAGTVGQTVAYPLDVIRR
Sbjct  8    VPYVGLNFAVYESLKDWLIKSRPFGLVQDTDLSVTTRLACGAAAGTVGQTVAYPLDVIRR  67

Query  496  RMQMVGWKGAASIVTGEGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSI  317
            RMQMVGW  AAS+V+G+G S+ PLEYTGM+DAFRKTVR+EG  ALYKGLVPN VKVVPSI
Sbjct  68   RMQMVGWSHAASVVSGDGISKTPLEYTGMVDAFRKTVRHEGFGALYKGLVPNCVKVVPSI  127

Query  316  AIAFVTYEQVKDILGVEIRISD  251
            AIAFVTYE VKD+LGVEIRISD
Sbjct  128  AIAFVTYEMVKDVLGVEIRISD  149


 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 33/55 (60%), Gaps = 0/55 (0%)
 Frame = -3

Query  787  ENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  623
              +P +Y GM  A    +R+EG  ALYKG +P+ + VVP + + F  YE +KD L
Sbjct  87   SKTPLEYTGMVDAFRKTVRHEGFGALYKGLVPNCVKVVPSIAIAFVTYEMVKDVL  141



>gb|KCW78145.1| hypothetical protein EUGRSUZ_D02348 [Eucalyptus grandis]
Length=309

 Score =   223 bits (568),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  ENSPYQYRGMFHALS+VLR EGPRALYKGWLPSVIGV+PYVGLNFAVYESLK+W
Sbjct  170  RLTVQTENSPYQYRGMFHALSSVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKEW  229

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            LIK++P GL+EDSELS+ TRLACGA AGTVGQTVAYPLDVIRRRMQMVGW  A+SIVTG+
Sbjct  230  LIKNRPFGLMEDSELSVTTRLACGAVAGTVGQTVAYPLDVIRRRMQMVGWNNASSIVTGD  289

Query  445  GKSQAPLEYTGMIDAFRKTV  386
            G+++A LEY GM+DAFRKT+
Sbjct  290  GRAKAALEYNGMVDAFRKTL  309


 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 83/167 (50%), Gaps = 14/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYE-SLKDWLIKSKPLGLV  596
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE + K  L+  +     
Sbjct  77   KYNGTVQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASKGILLLYQQQTGN  136

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            ED++L+   RL  GA AG +  +  YP+D++R R+ +                 +P +Y 
Sbjct  137  EDAQLTPPLRLGAGACAGIIAMSATYPMDLVRGRLTVQ-------------TENSPYQYR  183

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GM  A    +R EG RALYKG +P+ + V+P + + F  YE +K+ L
Sbjct  184  GMFHALSSVLREEGPRALYKGWLPSVIGVIPYVGLNFAVYESLKEWL  230



>ref|XP_010095712.1| Pentatricopeptide repeat-containing protein [Morus notabilis]
 gb|EXB61982.1| Pentatricopeptide repeat-containing protein [Morus notabilis]
Length=811

 Score =   226 bits (575),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -3

Query  676  VPYVGLNFAVYESLKDWLIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRR  497
            VPYVGLNFAVYESLKDWLIKSKP G+V+++ELS+ TRLACGAAAGTVGQTVAYPLDVIRR
Sbjct  670  VPYVGLNFAVYESLKDWLIKSKPFGIVDENELSVTTRLACGAAAGTVGQTVAYPLDVIRR  729

Query  496  RMQMVGWKGAASIVTGEGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSI  317
            RMQMVGW  AAS+VTG+G+ +APLEY GM+DAFRKTVR+EG  ALYKGL+PNSVKVVPSI
Sbjct  730  RMQMVGWHNAASVVTGDGRGKAPLEYNGMVDAFRKTVRHEGFGALYKGLIPNSVKVVPSI  789

Query  316  AIAFVTYEQVKDILGVEIRISD  251
            AIAFVTYE VKDILGVEIRISD
Sbjct  790  AIAFVTYEMVKDILGVEIRISD  811


 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/43 (91%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGV  677
            RITV  E SPYQYRGMFHALSTVLR EGPRALYKGWLPSVIGV
Sbjct  173  RITVQTEKSPYQYRGMFHALSTVLREEGPRALYKGWLPSVIGV  215


 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 74/150 (49%), Gaps = 16/150 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD--WLIKSKPLGL  599
            +Y G    L  + R EG R L+KG   +   +VP   + F  YE   +   L+  +  G 
Sbjct  80   KYNGTIQGLKYIWRTEGFRGLFKGNGTNCARIVPNSAVKFFSYEQASNGILLLYRQQTG-  138

Query  598  VEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEY  419
             ED++L+ + RL  GA AG +  +  YP+D++R R+ +                ++P +Y
Sbjct  139  NEDAQLTPLLRLGAGACAGIIAMSATYPMDMVRGRITV-------------QTEKSPYQY  185

Query  418  TGMIDAFRKTVRYEGVRALYKGLVPNSVKV  329
             GM  A    +R EG RALYKG +P+ + V
Sbjct  186  RGMFHALSTVLREEGPRALYKGWLPSVIGV  215


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -3

Query  781  SPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL  623
            +P +Y GM  A    +R+EG  ALYKG +P+ + VVP + + F  YE +KD L
Sbjct  751  APLEYNGMVDAFRKTVRHEGFGALYKGLIPNSVKVVPSIAIAFVTYEMVKDIL  803



>ref|XP_002979197.1| hypothetical protein SELMODRAFT_233298 [Selaginella moellendorffii]
 ref|XP_002992318.1| hypothetical protein SELMODRAFT_186674 [Selaginella moellendorffii]
 gb|EFJ06594.1| hypothetical protein SELMODRAFT_186674 [Selaginella moellendorffii]
 gb|EFJ19605.1| hypothetical protein SELMODRAFT_233298 [Selaginella moellendorffii]
Length=361

 Score =   211 bits (537),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 143/185 (77%), Gaps = 5/185 (3%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  + S   Y GM HA  T++R EG +ALYKGWLPSVIGVVPYVGLNFAVYESLKD+
Sbjct  182  RLTVQTKGSESSYNGMLHAARTIVRMEGWQALYKGWLPSVIGVVPYVGLNFAVYESLKDY  241

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            ++K +P G V  SEL+++T+L CGA AG  GQTVAYPLDVIRRRMQM GW    + + G+
Sbjct  242  IVKEEPFGPVPGSELAVLTKLGCGAVAGATGQTVAYPLDVIRRRMQMGGWY--TTTINGQ  299

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
               +  + Y GM+DAF +TV+ EG  ALYKGLVPNSVKVVPSIA+AFVTYE +KD++ +E
Sbjct  300  ---KVQVHYNGMLDAFSQTVKKEGFTALYKGLVPNSVKVVPSIALAFVTYEIMKDLMTLE  356

Query  265  IRISD  251
             RI+D
Sbjct  357  YRITD  361


 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 93/178 (52%), Gaps = 17/178 (10%)
 Frame = -3

Query  805  RITVXXENSPY-QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD  629
            +I +  +NS   +Y+GMF  L T+   EG +  + G   +   +VP   + F  YE   +
Sbjct  77   KILLQVQNSQNARYKGMFQGLRTIWNTEGVKGFFIGNGVNCARIVPNSAVKFLSYEHAAN  136

Query  628  WLIKS--KPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIV  455
             ++ +  +  G  E +EL+ V RL  GA AG +  +  YP+D+IR R+  V  KG+ S  
Sbjct  137  AILWAYRRETGDSE-AELNPVLRLGAGACAGIIAMSATYPMDMIRGRL-TVQTKGSES--  192

Query  454  TGEGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKD  281
                       Y GM+ A R  VR EG +ALYKG +P+ + VVP + + F  YE +KD
Sbjct  193  ----------SYNGMLHAARTIVRMEGWQALYKGWLPSVIGVVPYVGLNFAVYESLKD  240



>ref|XP_011399125.1| Calcium-binding mitochondrial carrier protein SCaMC-2-A [Auxenochlorella 
protothecoides]
 gb|KFM26229.1| Calcium-binding mitochondrial carrier protein SCaMC-2-A [Auxenochlorella 
protothecoides]
Length=320

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 146/185 (79%), Gaps = 6/185 (3%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV   +S  QYRGM+HA S+++  EG  AL++GWLPSVIGVVPYVGLNFAVYE+LKD 
Sbjct  142  RITVQ-HSSHAQYRGMWHAASSIVAQEGLVALWRGWLPSVIGVVPYVGLNFAVYETLKDL  200

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            ++K+   G  ++ +L+I TRLACGA AGT+GQTVAYP DV+RRR+QM GW GA S+   E
Sbjct  201  IVKA--YGCRDERDLAIATRLACGATAGTLGQTVAYPFDVVRRRLQMSGWAGAQSLHAAE  258

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G   A + Y+GM D F +T+R EGV AL+KGL PN +KVVPSIAIAFVTYEQVK++LG E
Sbjct  259  G---AAVRYSGMTDCFVRTIREEGVTALFKGLGPNYLKVVPSIAIAFVTYEQVKEVLGAE  315

Query  265  IRISD  251
            IR+SD
Sbjct  316  IRLSD  320


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 89/177 (50%), Gaps = 15/177 (8%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            +I +  + +   Y G+F  +  +  ++G R L+KG   + I ++P   + F  YE L   
Sbjct  40   KILMQVQGTEKVYTGIFQGVRHMWVSDGIRGLFKGNGLNCIRIIPNQAIKFMTYEQLSR-  98

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
             I    +    D +L+   RLA GA AG VG +  YPLD+IR R            +T +
Sbjct  99   KISHALIDRGGDGQLTPGLRLAAGAGAGIVGMSATYPLDMIRGR------------ITVQ  146

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
              S A  +Y GM  A    V  EG+ AL++G +P+ + VVP + + F  YE +KD++
Sbjct  147  HSSHA--QYRGMWHAASSIVAQEGLVALWRGWLPSVIGVVPYVGLNFAVYETLKDLI  201



>ref|XP_005849239.1| hypothetical protein CHLNCDRAFT_34838 [Chlorella variabilis]
 gb|EFN57137.1| hypothetical protein CHLNCDRAFT_34838 [Chlorella variabilis]
Length=320

 Score =   204 bits (519),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 144/185 (78%), Gaps = 6/185 (3%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV    +P QYRG++HA   ++R EG  AL++GWLPSVIGVVPYVGLNF VYE+LKD 
Sbjct  142  RITVQEAGNP-QYRGLWHATGCIIREEGLLALWRGWLPSVIGVVPYVGLNFGVYETLKDV  200

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            +IK+   GL ++ +LSI  RL CGA AGT+GQT+AYP DV+RRR+Q+ GW GA ++    
Sbjct  201  IIKT--WGLRDERDLSIAVRLGCGALAGTMGQTLAYPFDVVRRRLQVSGWSGAKNLHADH  258

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G++ A   Y GM+D F +TVR EG++AL+KGL PN VKVVPSIAIAFVTYEQVK+ILG E
Sbjct  259  GQAVA---YRGMMDCFVRTVREEGIQALFKGLAPNYVKVVPSIAIAFVTYEQVKEILGAE  315

Query  265  IRISD  251
            IR+SD
Sbjct  316  IRLSD  320


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 91/177 (51%), Gaps = 15/177 (8%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            +I +  + +   Y G++   S + RN+G R ++KG   + I +VP   + F  YE L   
Sbjct  40   KILMQVQGNEKMYTGVWQGTSHMFRNDGIRGMFKGNGLNCIRIVPNQAIKFLTYEQLSR-  98

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
             I    +    D +L+ + RL+ GAAAG VG +  YPLD++R R+ +             
Sbjct  99   KISHHLIDNGGDGQLTPLLRLSAGAAAGVVGMSATYPLDMVRGRITV-------------  145

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
             +     +Y G+  A    +R EG+ AL++G +P+ + VVP + + F  YE +KD++
Sbjct  146  -QEAGNPQYRGLWHATGCIIREEGLLALWRGWLPSVIGVVPYVGLNFGVYETLKDVI  201



>gb|KDD76091.1| hypothetical protein H632_c360p1 [Helicosporidium sp. ATCC 50920]
Length=264

 Score =   201 bits (510),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 115/185 (62%), Positives = 141/185 (76%), Gaps = 5/185 (3%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RI+V        YRGM HA+S ++R EG  AL++GWLPSVIGVVPYVGLNF+VYE+LKD 
Sbjct  85   RISVQSAGQAPMYRGMGHAISVIVRQEGVLALWRGWLPSVIGVVPYVGLNFSVYETLKDT  144

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K+   G  ++ +LSI TRLACGAAAGT GQTVAYP DV RRR+Q+ GW+GA+ +    
Sbjct  145  LVKT--YGCRDERDLSIATRLACGAAAGTTGQTVAYPFDVCRRRLQVSGWEGASKLHADH  202

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G +   + Y GM+D F +TVR EGV AL+KGLVPN  KVVPSIAIAFV+YEQVK++LG E
Sbjct  203  GHA---IAYRGMVDCFVRTVREEGVSALFKGLVPNYYKVVPSIAIAFVSYEQVKELLGAE  259

Query  265  IRISD  251
             RISD
Sbjct  260  FRISD  264


 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 78/157 (50%), Gaps = 21/157 (13%)
 Frame = -3

Query  733  RNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLK----DWLIKSKPLGLVEDSELSIVTR  566
            R+EG R L+ G   + + ++P   + F  YE L      +LI         D  L+ + R
Sbjct  6    RSEGLRGLFVGNGLNCMRIIPNSAIKFFTYEQLSRKIGHYLIDHHG----GDGTLTPLQR  61

Query  565  LacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTGMIDAFRKTV  386
            L  GA AG +  +  YPLD++R R+ +            +   QAP+ Y GM  A    V
Sbjct  62   LTAGAGAGIIAMSTTYPLDMVRGRISV------------QSAGQAPM-YRGMGHAISVIV  108

Query  385  RYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            R EGV AL++G +P+ + VVP + + F  YE +KD L
Sbjct  109  RQEGVLALWRGWLPSVIGVVPYVGLNFSVYETLKDTL  145



>ref|XP_001693350.1| mitochondrial carrier protein [Chlamydomonas reinhardtii]
 gb|EDP03376.1| mitochondrial carrier protein [Chlamydomonas reinhardtii]
Length=345

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 139/185 (75%), Gaps = 6/185 (3%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E    QYRG+ HA  T+L  EGP A YKGWLPSVIGVVPYVGLNFAVYE+LK  
Sbjct  167  RLTVQ-EGKNQQYRGIVHAARTILAQEGPLAFYKGWLPSVIGVVPYVGLNFAVYETLKAM  225

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K    GL ++ EL+I  RL CGA AG++GQTVAYP DV RRR+QM GW+GA  + +  
Sbjct  226  LLKQ--YGLRDERELTIGARLGCGAIAGSMGQTVAYPFDVARRRLQMSGWQGAKDLHSHG  283

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G   A   YTGM+D F +TVR EG++AL+KGL PN +KVVPSIAIAFVTYEQVK+ LGVE
Sbjct  284  GNVVA---YTGMVDCFVRTVREEGMQALFKGLWPNYLKVVPSIAIAFVTYEQVKEWLGVE  340

Query  265  IRISD  251
             RIS+
Sbjct  341  FRISE  345


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/177 (31%), Positives = 87/177 (49%), Gaps = 15/177 (8%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            +I +  + +   YRG++  L  + R EG R + KG   + + ++P   + F  YE L   
Sbjct  65   KILMQVQGNEQIYRGVWQGLVHMARTEGVRGMMKGNWTNCVRIIPNSAVKFLTYEQLSRE  124

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            +            EL+  TRL  GA AG +  +  YPLD++R R+ +            E
Sbjct  125  M-SDHYRATTGSGELTPGTRLLAGACAGIIAMSATYPLDMVRGRLTVQ-----------E  172

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            GK+Q   +Y G++ A R  +  EG  A YKG +P+ + VVP + + F  YE +K +L
Sbjct  173  GKNQ---QYRGIVHAARTILAQEGPLAFYKGWLPSVIGVVPYVGLNFAVYETLKAML  226



>ref|XP_002957829.1| mitochondrial substrate carrier [Volvox carteri f. nagariensis]
 gb|EFJ41066.1| mitochondrial substrate carrier [Volvox carteri f. nagariensis]
Length=316

 Score =   193 bits (491),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 140/185 (76%), Gaps = 6/185 (3%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E    QYRG+ HA   ++  EGP ALY+GWLPSVIGVVPYVGLNFAVYE+LK  
Sbjct  138  RLTVQ-EGRNQQYRGIVHATRMIVSQEGPLALYRGWLPSVIGVVPYVGLNFAVYETLKAG  196

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+K    G+ ++ ELSIVTRL CGA AG++GQTVAYP DV RRR+QM GW+GA  + +  
Sbjct  197  LMKQ--YGMRDERELSIVTRLGCGAMAGSMGQTVAYPFDVARRRLQMSGWQGAKDLHSHA  254

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G     + Y GM+D F +TVR EGV+AL+KGL PN +KVVPSIAIAFVTYEQ+K+ +GVE
Sbjct  255  GDV---VVYRGMVDCFVRTVREEGVQALFKGLWPNYLKVVPSIAIAFVTYEQMKEWMGVE  311

Query  265  IRISD  251
             RI++
Sbjct  312  FRIAE  316


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 84/174 (48%), Gaps = 15/174 (9%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            +I +  + +   YRG++  L  + R EG R + KG   + + ++P   + F  YE L   
Sbjct  36   KILMQVQGNEKIYRGVWQGLVHMARTEGVRGMMKGNWTNCVRIIPNSAVKFLTYEQLSRE  95

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            +            EL+   RL  GA AG +  +  YPLD++R R           +   E
Sbjct  96   M-SDHYRSTTGSGELTPTLRLLAGACAGIIAMSATYPLDMVRGR-----------LTVQE  143

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVK  284
            G++Q   +Y G++ A R  V  EG  ALY+G +P+ + VVP + + F  YE +K
Sbjct  144  GRNQ---QYRGIVHATRMIVSQEGPLALYRGWLPSVIGVVPYVGLNFAVYETLK  194



>gb|KIZ03643.1| putative calcium-binding carrier [Monoraphidium neglectum]
Length=304

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 134/185 (72%), Gaps = 6/185 (3%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV  E    QY G+ HA  T+L+ EG  A Y+GWLPSVIGV+PYVGLNF VYE+LK  
Sbjct  126  RLTVQ-EGRNVQYTGIVHAARTILKEEGALAFYRGWLPSVIGVIPYVGLNFGVYETLKAS  184

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L+     GL ++ ELS+  RL CGA AGT GQTVAYP DV RRR+Q+ GW+GA  + +  
Sbjct  185  LLTH--YGLRDERELSVAARLGCGALAGTTGQTVAYPFDVARRRLQVSGWQGARELHSDH  242

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G   A   Y GM D F +TVR EG++AL+KGL PN +KVVPSIAIAFVTYEQVK+ LGVE
Sbjct  243  GSVVA---YRGMTDCFVRTVREEGMQALFKGLWPNYLKVVPSIAIAFVTYEQVKEFLGVE  299

Query  265  IRISD  251
            IRIS+
Sbjct  300  IRISE  304



>ref|XP_005643443.1| mitochondrial carrier protein [Coccomyxa subellipsoidea C-169]
 gb|EIE18899.1| mitochondrial carrier protein [Coccomyxa subellipsoidea C-169]
Length=326

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 139/185 (75%), Gaps = 8/185 (4%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV      ++YRG+ HA + +   EG  AL+KGWLPSVIGV+PYVGLNFAVYE+LKD 
Sbjct  150  RLTVQSMEGVHRYRGIVHAATVI---EGIIALWKGWLPSVIGVIPYVGLNFAVYETLKDN  206

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            ++K   L   ++ ELS ++RLACG  AGT GQTVAYPLDV+RRRMQM GW+GA  +    
Sbjct  207  VLKFYELN--DERELSTMSRLACGGVAGTTGQTVAYPLDVVRRRMQMSGWQGAQELHAEG  264

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            G + A   Y GMID F +TVR EG +AL+KGL+PN +KVVPSIAIAFVTYE++K+ LGVE
Sbjct  265  GHAVA---YKGMIDCFVRTVREEGTKALFKGLLPNYIKVVPSIAIAFVTYEKLKEGLGVE  321

Query  265  IRISD  251
            +RIS 
Sbjct  322  LRISS  326


 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 91/178 (51%), Gaps = 23/178 (13%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            +I +  + S   Y G++  L  + +NEG R +++G   + + ++P   + F  YE     
Sbjct  48   KILMQVQGSNKVYTGVWQGLKLMSKNEGIRGMFRGNWTNCVRIIPNSAVKFLTYEQ----  103

Query  625  LIKSKPLGLVE---DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIV  455
            L +     L+E   D +++ + RLA GA AG VG +  YPLD++R R+ +   +G     
Sbjct  104  LCRRISHHLIENGGDGQMTPLLRLAAGAGAGIVGMSATYPLDMVRGRLTVQSMEGVH---  160

Query  454  TGEGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKD  281
                       Y G++ A   TV  EG+ AL+KG +P+ + V+P + + F  YE +KD
Sbjct  161  ----------RYRGIVHA--ATV-IEGIIALWKGWLPSVIGVIPYVGLNFAVYETLKD  205



>ref|XP_003055917.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH59293.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=393

 Score =   185 bits (469),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 133/186 (72%), Gaps = 4/186 (2%)
 Frame = -3

Query  805  RITVXXENSPY-QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD  629
            R+TV  +     QY GM HA   ++R EG RALYKGWLPSVIGV+PYVGLNFAVY +LKD
Sbjct  210  RLTVQVDGKGMKQYTGMMHATRVIVREEGARALYKGWLPSVIGVIPYVGLNFAVYGTLKD  269

Query  628  WLIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTG  449
            +    +  GL    +LS+ + LACG  AG +GQTVAYP DV RR++Q+ GW+GA ++  G
Sbjct  270  YAADFQ--GLDSAKDLSVASGLACGGVAGAIGQTVAYPFDVCRRKLQVAGWEGAKALAEG  327

Query  448  E-GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILG  272
            E  +  + + YTGMID F KTV+ EGV AL+ GL  N VKV PSIAIAFVTYE++K +LG
Sbjct  328  EHARRLSNVRYTGMIDCFVKTVKNEGVGALFHGLSANYVKVAPSIAIAFVTYEELKKLLG  387

Query  271  VEIRIS  254
            VE+ IS
Sbjct  388  VELYIS  393


 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 90/164 (55%), Gaps = 13/164 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
             Y+G+   LS +LR EG   ++KG   + + +VP     F  YE L+ +L+K +     E
Sbjct  119  SYKGVLGGLSHILRTEGVLGMFKGNGANCVRIVPNSASKFLAYEFLEGFLVK-RARESDE  177

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
            +++L  VTRL  GA AG    +  YPLD++R R+ +         V G+G  Q    YTG
Sbjct  178  NAQLGPVTRLIAGAGAGVFAMSATYPLDMVRGRLTVQ--------VDGKGMKQ----YTG  225

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKD  281
            M+ A R  VR EG RALYKG +P+ + V+P + + F  Y  +KD
Sbjct  226  MMHATRVIVREEGARALYKGWLPSVIGVIPYVGLNFAVYGTLKD  269



>ref|XP_002500487.1| predicted protein, partial [Micromonas sp. RCC299]
 gb|ACO61745.1| predicted protein, partial [Micromonas sp. RCC299]
Length=303

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 125/179 (70%), Gaps = 2/179 (1%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+T   +    QY  M HA   ++R EG  ALYKGWLPSVIGV+PYVGLNFAVY +LKD 
Sbjct  127  RLTTQVDGKYKQYTSMTHAARVIVREEGALALYKGWLPSVIGVIPYVGLNFAVYGTLKD-  185

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
             + ++  GL    +LS+   LACG  AG +GQTVAYP DV RR++Q+ GW GA ++  GE
Sbjct  186  -VVAEWQGLKSGKDLSVPLGLACGGVAGAIGQTVAYPFDVCRRKLQVAGWAGAKALAEGE  244

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGV  269
             K  A + YTGM+D F KTVR+EGV AL+ GL  N VKV PSIAIAFV YE+VK +LGV
Sbjct  245  AKHLAEMRYTGMVDCFVKTVRHEGVGALFHGLSANYVKVAPSIAIAFVCYEEVKKLLGV  303


 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 57/169 (34%), Positives = 89/169 (53%), Gaps = 22/169 (13%)
 Frame = -3

Query  769  YRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLI----KSKPLG  602
            Y G+   L+ ++R EG   ++KG   + I +VP     F  YE+L+ WL+    +S P  
Sbjct  37   YNGVLRGLTHIMRTEGMVGMFKGNGANCIRIVPNSASKFLAYETLESWLLSRARESDP--  94

Query  601  LVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLE  422
               +++L  +TRL  GA AG    +  YPLD++R R+         + V G+ K     +
Sbjct  95   ---NAQLGPLTRLTAGAGAGIFAMSATYPLDMVRGRLT--------TQVDGKYK-----Q  138

Query  421  YTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            YT M  A R  VR EG  ALYKG +P+ + V+P + + F  Y  +KD++
Sbjct  139  YTSMTHAARVIVREEGALALYKGWLPSVIGVIPYVGLNFAVYGTLKDVV  187



>emb|CEF97253.1| Mitochondrial substrate/solute carrier [Ostreococcus tauri]
Length=323

 Score =   168 bits (425),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 97/173 (56%), Positives = 125/173 (72%), Gaps = 10/173 (6%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
             YRG++HA + + + EG  A YKGWLPSVIGV+PYVGLNFA+YE+LKD  +K +  GL  
Sbjct  160  NYRGIYHAATVIAQREGIGAFYKGWLPSVIGVIPYVGLNFAIYETLKDQTVKFQ--GLNS  217

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             +ELS+++ L CG  AG VGQTVAYP DV RRR+Q+ GW  A       G ++ P+ YTG
Sbjct  218  AAELSVLSGLVCGGIAGAVGQTVAYPFDVCRRRLQVSGWAQA-------GVAKGPV-YTG  269

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIRIS  254
            M+D FRKTV  EGV AL+ GL  N VK++PSIAIAFV Y+Q+K IL  E++I+
Sbjct  270  MLDCFRKTVAEEGVTALFHGLSANYVKIMPSIAIAFVVYDQLKIILKPEVKIT  322


 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 86/163 (53%), Gaps = 15/163 (9%)
 Frame = -3

Query  769  YRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVED  590
            Y G+   ++ + + EG R L+KG   + + +VP   + F  YE +   L++ +     ++
Sbjct  60   YNGVVSGMAHMWKTEGMRGLFKGNGANCVRIVPNSAVKFFCYEHMAHGLLELRRT-FDQN  118

Query  589  SELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTGM  410
            +E+ ++TRL  GA AG V  +  YPLD+IR R+         ++  G G++     Y G+
Sbjct  119  AEMDVLTRLGGGAGAGIVAMSATYPLDMIRGRL---------TVQKGGGEN-----YRGI  164

Query  409  IDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKD  281
              A     + EG+ A YKG +P+ + V+P + + F  YE +KD
Sbjct  165  YHAATVIAQREGIGAFYKGWLPSVIGVIPYVGLNFAIYETLKD  207



>ref|XP_007511830.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17951.1| predicted protein [Bathycoccus prasinos]
Length=415

 Score =   170 bits (430),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 128/184 (70%), Gaps = 9/184 (5%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV    + +QY GM  A   ++++EG  +LYKG LPSVIGV+PYVGLNFAVYE+LKD 
Sbjct  238  RLTVQA-GTVHQYNGMVDATRKIIQHEGVGSLYKGLLPSVIGVIPYVGLNFAVYETLKDM  296

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L  +  L L    ELS+   L CG  AG VGQTVAYP DV+RRR+Q+ GW+G+AS     
Sbjct  297  L--AAKLELKSSKELSVAQSLTCGGFAGAVGQTVAYPFDVVRRRLQVAGWQGSAS-----  349

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
             K+    +Y+GM+D F K  RYEGV A + GL  N +KV+PSIAIAFVTYE+VK +L V+
Sbjct  350  -KTMEKAKYSGMMDCFGKIARYEGVGAFFHGLSANYIKVMPSIAIAFVTYEEVKRVLQVD  408

Query  265  IRIS  254
            + IS
Sbjct  409  LHIS  412


 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 97/172 (56%), Gaps = 15/172 (9%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            +Y  ++  L+T+LR +G R  + G   + I +VP   + F  YE + D + + +   L  
Sbjct  147  EYGTVYRGLNTILRKDGLRGFFIGNGANCIRIVPNSAVKFFCYERITDAIFQFRRT-LDP  205

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
            + E+++  RLA GA AG +  T  YPLD++R R+ +              ++    +Y G
Sbjct  206  ECEMNVFNRLAGGAGAGIIAMTSVYPLDMVRGRLTV--------------QAGTVHQYNG  251

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIRI  257
            M+DA RK +++EGV +LYKGL+P+ + V+P + + F  YE +KD+L  ++ +
Sbjct  252  MVDATRKIIQHEGVGSLYKGLLPSVIGVIPYVGLNFAVYETLKDMLAAKLEL  303



>ref|XP_003078331.1| putative carrier protein (ISS) [Ostreococcus tauri]
Length=424

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 126/174 (72%), Gaps = 10/174 (6%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
             YRG++HA + + + EG  A YKGWLPSVIGV+PYVGLNFA+YE+LKD  +K +  GL  
Sbjct  163  NYRGIYHAATVIAQREGIGAFYKGWLPSVIGVIPYVGLNFAIYETLKDQTVKFQ--GLNS  220

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             +ELS+++ L CG  AG VGQTVAYP DV RRR+Q+ GW  A       G ++ P+ YTG
Sbjct  221  AAELSVLSGLVCGGIAGAVGQTVAYPFDVCRRRLQVSGWAQA-------GVAKGPV-YTG  272

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIRISD  251
            M+D FRKTV  EGV AL+ GL  N VK++PSIAIAFV Y+Q+K IL  E++I++
Sbjct  273  MLDCFRKTVAEEGVTALFHGLSANYVKIMPSIAIAFVVYDQLKIILKPEVKITE  326


 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 86/163 (53%), Gaps = 15/163 (9%)
 Frame = -3

Query  769  YRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVED  590
            Y G+   ++ + + EG R L+KG   + + +VP   + F  YE +   L++ +     ++
Sbjct  63   YNGVVSGMAHMWKTEGMRGLFKGNGANCVRIVPNSAVKFFCYEHMAHGLLELRRT-FDQN  121

Query  589  SELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTGM  410
            +E+ ++TRL  GA AG V  +  YPLD+IR R+         ++  G G++     Y G+
Sbjct  122  AEMDVLTRLGGGAGAGIVAMSATYPLDMIRGRL---------TVQKGGGEN-----YRGI  167

Query  409  IDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKD  281
              A     + EG+ A YKG +P+ + V+P + + F  YE +KD
Sbjct  168  YHAATVIAQREGIGAFYKGWLPSVIGVIPYVGLNFAIYETLKD  210



>ref|XP_001416737.1| MC family transporter: aspartate/glutamate (Ca2+-activated) [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO95030.1| MC family transporter: aspartate/glutamate (Ca2+-activated) [Ostreococcus 
lucimarinus CCE9901]
Length=340

 Score =   163 bits (412),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 120/173 (69%), Gaps = 9/173 (5%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
             YRG++HA + + + EG  A YKGW PSVIGV+PYVGLNFA+YE+LKD  +K +  GL  
Sbjct  175  NYRGIYHAFTVIAQKEGFGAFYKGWTPSVIGVIPYVGLNFAIYETLKDQTVKMQ--GLRS  232

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             S+LS+   L CG  AG VGQTVAYP DV RRR+Q+ GW      V    ++  P+ YTG
Sbjct  233  ASDLSVFAGLVCGGVAGAVGQTVAYPFDVCRRRLQVSGW------VQAGVQAGGPV-YTG  285

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIRIS  254
            M D FR+TV  EGV AL+ GL  N +K++PSIAIAFV Y+Q+K IL  EI+IS
Sbjct  286  MFDCFRRTVAEEGVSALFHGLSANYIKIMPSIAIAFVVYDQLKIILKPEIKIS  338


 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 87/168 (52%), Gaps = 8/168 (5%)
 Frame = -3

Query  784  NSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPL  605
            +S   Y G++  LS + + EG + L+KG   + + +VP   + F  YE +   L+  +  
Sbjct  63   SSSSAYNGVYSGLSHMWKTEGVKGLFKGNGANCVRIVPNSAVKFFCYEHMAHGLLDLRRT  122

Query  604  GLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPL  425
               +D+E+ ++TRL  GA AG V  +  YPLD+IR R+ +   K AA      G +    
Sbjct  123  -FDKDAEMDVLTRLGGGAGAGIVAMSATYPLDMIRGRLTV--QKSAADAAKSGGAN----  175

Query  424  EYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKD  281
             Y G+  AF    + EG  A YKG  P+ + V+P + + F  YE +KD
Sbjct  176  -YRGIYHAFTVIAQKEGFGAFYKGWTPSVIGVIPYVGLNFAIYETLKD  222



>gb|KJE90615.1| EF-hand domain-containing protein, variant [Capsaspora owczarzaki 
ATCC 30864]
Length=349

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 109/178 (61%), Gaps = 18/178 (10%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEG-PRALYKGWLPSVIGVVPYVGLNFAVYESLKD  629
            R++   E    +Y+G++  L T+LR EG  R L++G  P+++GV PYV LNF VYES+K 
Sbjct  177  RLSAQGEGPDRKYKGIYDCLRTILREEGGARGLFRGLSPTLMGVAPYVALNFTVYESIKR  236

Query  628  WLIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTG  449
            WL+       ++  ELS+  RL CGA AG   Q++ YP DVIRRRMQM G  G +     
Sbjct  237  WLLDQ-----MQVKELSVPVRLLCGALAGATAQSITYPFDVIRRRMQMKGCSGPS-----  286

Query  448  EGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
                     YT  ++AF   +R EGVR LYKG+VPN +KV PS++I+FV YE  K +L
Sbjct  287  -------FAYTSTLNAFTTIIRVEGVRGLYKGMVPNCLKVAPSMSISFVMYEFCKKLL  337


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 88/185 (48%), Gaps = 24/185 (13%)
 Frame = -3

Query  799  TVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLI  620
            T   E +P  +R + H    + + EG    +KG   +VI ++PY  + FA YE  K  L+
Sbjct  84   TAAQEQAPTVWRSLVH----IFKTEGLMGYFKGNGTNVIRMIPYSAVQFAAYEQYKKLLL  139

Query  619  K-SKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEG  443
                P+      +L+   RL  GA AG       YPLD+IR R+             GEG
Sbjct  140  TYPSPV-----DDLNTPRRLFAGAMAGITSVCATYPLDLIRTRLS----------AQGEG  184

Query  442  KSQAPLEYTGMIDAFRKTVRYEG-VRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
              +   +Y G+ D  R  +R EG  R L++GL P  + V P +A+ F  YE +K  L  +
Sbjct  185  PDR---KYKGIYDCLRTILREEGGARGLFRGLSPTLMGVAPYVALNFTVYESIKRWLLDQ  241

Query  265  IRISD  251
            +++ +
Sbjct  242  MQVKE  246



>ref|XP_002862152.1| hypothetical protein ARALYDRAFT_920176 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38410.1| hypothetical protein ARALYDRAFT_920176 [Arabidopsis lyrata subsp. 
lyrata]
Length=79

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = -3

Query  487  MVGWKGAASIVTGEGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIA  308
            MVGWK A+++VTGEG+S+A LEYTGM+DAFRKTVR+EG  ALYKGLVPNSVKVVPSIAIA
Sbjct  1    MVGWKDASAVVTGEGRSKALLEYTGMMDAFRKTVRHEGFGALYKGLVPNSVKVVPSIAIA  60

Query  307  FVTYEQVKDILGVEIRISD  251
            FVTYE VK++LGVE RISD
Sbjct  61   FVTYEMVKEVLGVEFRISD  79



>ref|XP_004364767.1| EF-hand domain-containing protein [Capsaspora owczarzaki ATCC 
30864]
 gb|KJE90614.1| EF-hand domain-containing protein [Capsaspora owczarzaki ATCC 
30864]
Length=352

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 109/178 (61%), Gaps = 18/178 (10%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEG-PRALYKGWLPSVIGVVPYVGLNFAVYESLKD  629
            R++   E    +Y+G++  L T+LR EG  R L++G  P+++GV PYV LNF VYES+K 
Sbjct  180  RLSAQGEGPDRKYKGIYDCLRTILREEGGARGLFRGLSPTLMGVAPYVALNFTVYESIKR  239

Query  628  WLIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTG  449
            WL+       ++  ELS+  RL CGA AG   Q++ YP DVIRRRMQM G  G +     
Sbjct  240  WLLDQ-----MQVKELSVPVRLLCGALAGATAQSITYPFDVIRRRMQMKGCSGPS-----  289

Query  448  EGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
                     YT  ++AF   +R EGVR LYKG+VPN +KV PS++I+FV YE  K +L
Sbjct  290  -------FAYTSTLNAFTTIIRVEGVRGLYKGMVPNCLKVAPSMSISFVMYEFCKKLL  340


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 88/185 (48%), Gaps = 24/185 (13%)
 Frame = -3

Query  799  TVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLI  620
            T   E +P  +R + H    + + EG    +KG   +VI ++PY  + FA YE  K  L+
Sbjct  87   TAAQEQAPTVWRSLVH----IFKTEGLMGYFKGNGTNVIRMIPYSAVQFAAYEQYKKLLL  142

Query  619  K-SKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEG  443
                P+      +L+   RL  GA AG       YPLD+IR R+             GEG
Sbjct  143  TYPSPV-----DDLNTPRRLFAGAMAGITSVCATYPLDLIRTRLS----------AQGEG  187

Query  442  KSQAPLEYTGMIDAFRKTVRYEG-VRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
              +   +Y G+ D  R  +R EG  R L++GL P  + V P +A+ F  YE +K  L  +
Sbjct  188  PDR---KYKGIYDCLRTILREEGGARGLFRGLSPTLMGVAPYVALNFTVYESIKRWLLDQ  244

Query  265  IRISD  251
            +++ +
Sbjct  245  MQVKE  249



>gb|ETO75235.1| hypothetical protein F444_09145 [Phytophthora parasitica P1976]
Length=300

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 109/177 (62%), Gaps = 18/177 (10%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV    +   + G+F+ LSTV+R EG R +Y+G LP++ G+ PYVGLNF V+E+L+  
Sbjct  137  RLTVQGGLANTAHTGIFNVLSTVVRTEGLRGVYRGVLPTIWGIAPYVGLNFTVFETLRTT  196

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            + ++      E+ E   +  LACGA AG  GQT AYP+D++RRR Q+   +G A+     
Sbjct  197  MPRN------ENGEPDTMYLLACGALAGACGQTAAYPMDILRRRFQLSAMRGGAT-----  245

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
                   EYT  +   R  VR EGVR LYKGL PN +KVVPSIAI F + E +K ++
Sbjct  246  -------EYTSTLGGLRTIVREEGVRGLYKGLAPNFIKVVPSIAIMFTSNELMKRVI  295


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/167 (30%), Positives = 81/167 (49%), Gaps = 21/167 (13%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            +YR +  +L  +   EG R  +KG   + + V PYV + FA +E L       KPL + E
Sbjct  51   KYRSVGQSLRQIHAEEGLRGYFKGNGANCVRVFPYVAIQFAAFEKL-------KPLLISE  103

Query  592  DSE-LSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
             +E LS + +L  GA AG V   + YPLD  R R+ + G               A   +T
Sbjct  104  GAETLSPLQKLFGGAIAGVVSVCITYPLDAARARLTVQG-------------GLANTAHT  150

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            G+ +     VR EG+R +Y+G++P    + P + + F  +E ++  +
Sbjct  151  GIFNVLSTVVRTEGLRGVYRGVLPTIWGIAPYVGLNFTVFETLRTTM  197



>gb|ETI46538.1| hypothetical protein F443_09091 [Phytophthora parasitica P1569]
Length=300

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 109/177 (62%), Gaps = 18/177 (10%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV    +   + G+F+ LSTV+R EG R +Y+G LP++ G+ PYVGLNF V+E+L+  
Sbjct  137  RLTVQGGLANTAHTGIFNVLSTVVRTEGLRGVYRGVLPTIWGITPYVGLNFTVFETLRTT  196

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            + ++      E+ E   +  LACGA AG  GQT AYP+D++RRR Q+   +G A+     
Sbjct  197  VPRN------ENGEPDTMYLLACGALAGACGQTAAYPMDILRRRFQLSAMRGGAT-----  245

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
                   EYT  +   R  VR EGVR LYKGL PN +KVVPSIAI F + E +K ++
Sbjct  246  -------EYTSTLGGLRTIVREEGVRGLYKGLAPNFIKVVPSIAIMFTSNELMKRVI  295


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 80/164 (49%), Gaps = 21/164 (13%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            +YR +  +L  +   EG R  +KG   + + V PYV + FA +E L       KPL + E
Sbjct  51   KYRSVGQSLRQIHAEEGLRGYFKGNGANCVRVFPYVAIQFAAFEKL-------KPLLISE  103

Query  592  DSE-LSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
             +E LS + +L  GA AG V   + YPLD  R R+ + G               A   +T
Sbjct  104  GAETLSPLQKLFGGAIAGVVSVCITYPLDAARARLTVQG-------------GLANTAHT  150

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVK  284
            G+ +     VR EG+R +Y+G++P    + P + + F  +E ++
Sbjct  151  GIFNVLSTVVRTEGLRGVYRGVLPTIWGITPYVGLNFTVFETLR  194



>gb|ETL93014.1| hypothetical protein L917_08748 [Phytophthora parasitica]
Length=300

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 109/177 (62%), Gaps = 18/177 (10%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV    +   + G+F+ LSTV+R EG R +Y+G LP++ G+ PYVGLNF V+E+L+  
Sbjct  137  RLTVQGGLANTAHTGIFNVLSTVVRTEGLRGVYRGVLPTIWGIAPYVGLNFTVFETLRTT  196

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            + ++      E+ E   +  LACGA AG  GQT AYP+D++RRR Q+   +G A+     
Sbjct  197  VPRN------ENGEPDTMYLLACGALAGACGQTAAYPMDILRRRFQLSAMRGGAT-----  245

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
                   EYT  +   R  VR EGVR LYKGL PN +KVVPSIAI F + E +K ++
Sbjct  246  -------EYTSTLGGLRTIVREEGVRGLYKGLAPNFIKVVPSIAIMFTSNELMKRVI  295


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 80/164 (49%), Gaps = 21/164 (13%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            +YR +  +L  +   EG R  +KG   + + V PYV + FA +E L       KPL + E
Sbjct  51   KYRSVGQSLRQIHAEEGLRGYFKGNGANCVRVFPYVAIQFAAFEKL-------KPLLISE  103

Query  592  DSE-LSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
             +E LS + +L  GA AG V   + YPLD  R R+ + G               A   +T
Sbjct  104  GAETLSPLQKLFGGAIAGVVSVCITYPLDAARARLTVQG-------------GLANTAHT  150

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVK  284
            G+ +     VR EG+R +Y+G++P    + P + + F  +E ++
Sbjct  151  GIFNVLSTVVRTEGLRGVYRGVLPTIWGIAPYVGLNFTVFETLR  194



>gb|ETM46311.1| hypothetical protein L914_08781 [Phytophthora parasitica]
Length=300

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 109/177 (62%), Gaps = 18/177 (10%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV    +   + G+F+ LSTV+R EG R +Y+G LP++ G+ PYVGLNF V+E+L+  
Sbjct  137  RLTVQGGLANTAHTGIFNVLSTVVRTEGLRGVYRGVLPTIWGIAPYVGLNFTVFETLRTT  196

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            + ++      E+ E   +  LACGA AG  GQT AYP+D++RRR Q+   +G A+     
Sbjct  197  VPRN------ENEEPDTMYLLACGALAGACGQTAAYPMDILRRRFQLSAMRGGAT-----  245

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
                   EYT  +   R  VR EGVR LYKGL PN +KVVPSIAI F + E +K ++
Sbjct  246  -------EYTSTLGGLRTIVREEGVRGLYKGLAPNFIKVVPSIAIMFTSNELMKRVI  295


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 80/164 (49%), Gaps = 21/164 (13%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            +YR +  +L  +   EG R  +KG   + + V PYV + FA +E L       KPL + E
Sbjct  51   KYRSVGQSLRQIHAEEGLRGYFKGNGANCVRVFPYVAIQFAAFEKL-------KPLLISE  103

Query  592  DSE-LSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
             +E LS + +L  GA AG V   + YPLD  R R+ + G               A   +T
Sbjct  104  GAETLSPLQKLFGGAIAGVVSVCITYPLDAARARLTVQG-------------GLANTAHT  150

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVK  284
            G+ +     VR EG+R +Y+G++P    + P + + F  +E ++
Sbjct  151  GIFNVLSTVVRTEGLRGVYRGVLPTIWGIAPYVGLNFTVFETLR  194



>ref|XP_008905983.1| hypothetical protein PPTG_11619 [Phytophthora parasitica INRA-310]
 gb|ETN08796.1| hypothetical protein PPTG_11619 [Phytophthora parasitica INRA-310]
Length=325

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 109/177 (62%), Gaps = 18/177 (10%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV    +   + G+F+ LSTV+R EG R +Y+G LP++ G+ PYVGLNF V+E+L+  
Sbjct  162  RLTVQGGLANTAHTGIFNVLSTVVRTEGLRGVYRGVLPTIWGIAPYVGLNFTVFETLRTT  221

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            + ++      E+ E   +  LACGA AG  GQT AYP+D++RRR Q+   +G A+     
Sbjct  222  VPRN------ENGEPDTMYLLACGALAGACGQTAAYPMDILRRRFQLSAMRGGAT-----  270

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
                   EYT  +   R  VR EGVR LYKGL PN +KVVPSIAI F + E +K ++
Sbjct  271  -------EYTSTLGGLRTIVREEGVRGLYKGLAPNFIKVVPSIAIMFTSNELMKRVI  320


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 80/164 (49%), Gaps = 21/164 (13%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            +YR +  +L  +   EG R  +KG   + + V PYV + FA +E L       KPL + E
Sbjct  76   KYRSVGQSLRQIHAEEGLRGYFKGNGANCVRVFPYVAIQFAAFEKL-------KPLLISE  128

Query  592  DSE-LSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
             +E LS + +L  GA AG V   + YPLD  R R+ + G               A   +T
Sbjct  129  GAETLSPLQKLFGGAIAGVVSVCITYPLDAARARLTVQG-------------GLANTAHT  175

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVK  284
            G+ +     VR EG+R +Y+G++P    + P + + F  +E ++
Sbjct  176  GIFNVLSTVVRTEGLRGVYRGVLPTIWGIAPYVGLNFTVFETLR  219



>gb|ETK86468.1| hypothetical protein L915_08908 [Phytophthora parasitica]
Length=325

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 109/177 (62%), Gaps = 18/177 (10%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV    +   + G+F+ LSTV+R EG R +Y+G LP++ G+ PYVGLNF V+E+L+  
Sbjct  162  RLTVQGGLANTAHTGIFNVLSTVVRTEGLRGVYRGVLPTIWGIAPYVGLNFTVFETLRTT  221

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            + ++      E+ E   +  LACGA AG  GQT AYP+D++RRR Q+   +G A+     
Sbjct  222  VPRN------ENGEPDTMYLLACGALAGACGQTAAYPMDILRRRFQLSAMRGGAT-----  270

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
                   EYT  +   R  VR EGVR LYKGL PN +KVVPSIAI F + E +K ++
Sbjct  271  -------EYTSTLGGLRTIVREEGVRGLYKGLAPNFIKVVPSIAIMFTSNELMKRVI  320


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 80/164 (49%), Gaps = 21/164 (13%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            +YR +  +L  +   EG R  +KG   + + V PYV + FA +E L       KPL + E
Sbjct  76   KYRSVGQSLRQIHAEEGLRGYFKGNGANCVRVFPYVAIQFAAFEKL-------KPLLISE  128

Query  592  DSE-LSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
             +E LS + +L  GA AG V   + YPLD  R R+ + G               A   +T
Sbjct  129  GAETLSPLQKLFGGAIAGVVSVCITYPLDAARARLTVQG-------------GLANTAHT  175

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVK  284
            G+ +     VR EG+R +Y+G++P    + P + + F  +E ++
Sbjct  176  GIFNVLSTVVRTEGLRGVYRGVLPTIWGIAPYVGLNFTVFETLR  219



>gb|AFW83145.1| hypothetical protein ZEAMMB73_772585 [Zea mays]
Length=342

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 97/130 (75%), Gaps = 4/130 (3%)
 Frame = -3

Query  676  VPYVGLNFAVYESLKDWLIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRR  497
            + +V + F   +   D LI++   GL  D+E+ +VTRL CGA AGT+GQTVAYPLDVI R
Sbjct  217  LAFVLIGFFTTQCAPD-LIQTNSFGLANDNEIHVVTRLECGAVAGTIGQTVAYPLDVISR  275

Query  496  RMQMVGWKGAASIVTGEGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSI  317
            RM MVGW  A SIV G+ K    L+Y GMI+AFRKTVR+ GV ALYKGLVPNSVKVVPSI
Sbjct  276  RMYMVGWSHADSIVIGQVKE--ALQYNGMINAFRKTVRH-GVGALYKGLVPNSVKVVPSI  332

Query  316  AIAFVTYEQV  287
            AIAFVTYE V
Sbjct  333  AIAFVTYEVV  342



>gb|ETP44384.1| hypothetical protein F442_09023 [Phytophthora parasitica P10297]
Length=300

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 109/177 (62%), Gaps = 18/177 (10%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV    +   + G+F+ LSTV+R EG R +Y+G LP++ G+ PYVGLNF V+E+L+  
Sbjct  137  RLTVQGGLANTAHTGIFNVLSTVVRTEGLRGVYRGVLPTIWGIAPYVGLNFTVFETLRTT  196

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            + ++      E+ E   +  LACGA AG  GQT AYP+D++RRR Q+   +G A+     
Sbjct  197  VPRN------ENGEPDTMYLLACGALAGACGQTAAYPMDILRRRFQLSAMRGGAT-----  245

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
                   EYT  +   R  VR EGVR LYKGL PN +KVVPSIAI F + E +K ++
Sbjct  246  -------EYTITLGGLRTIVREEGVRGLYKGLAPNFIKVVPSIAIMFTSNELMKRVI  295


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 80/164 (49%), Gaps = 21/164 (13%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            +YR +  +L  +   EG R  +KG   + + V PYV + FA +E L       KPL + E
Sbjct  51   KYRSVGQSLRQIHAEEGLRGYFKGNGANCVRVFPYVAIQFAAFEKL-------KPLLISE  103

Query  592  DSE-LSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
             +E LS + +L  GA AG V   + YPLD  R R+ + G               A   +T
Sbjct  104  GAETLSPLQKLFGGAIAGVVSVCITYPLDAARARLTVQG-------------GLANTAHT  150

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVK  284
            G+ +     VR EG+R +Y+G++P    + P + + F  +E ++
Sbjct  151  GIFNVLSTVVRTEGLRGVYRGVLPTIWGIAPYVGLNFTVFETLR  194



>gb|ETL39886.1| hypothetical protein L916_08827 [Phytophthora parasitica]
Length=325

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 109/177 (62%), Gaps = 18/177 (10%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV    +   + G+F+ LSTV+R EG R +Y+G LP++ G+ PYVGLNF V+E+L+  
Sbjct  162  RLTVQGGLANTAHTGIFNVLSTVVRTEGLRGVYRGVLPTIWGIAPYVGLNFTVFETLRTT  221

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            + ++      E+ E   +  LACGA AG  GQT AYP+D++RRR Q+   +G A+     
Sbjct  222  VPRN------ENGEPDTMYLLACGALAGACGQTAAYPMDILRRRFQLSAMRGGAT-----  270

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
                   EYT  +   R  V+ EGVR LYKGL PN +KVVPSIAI F + E +K ++
Sbjct  271  -------EYTSTLGGLRTIVQEEGVRGLYKGLAPNFIKVVPSIAIMFTSNELMKRVI  320


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 80/164 (49%), Gaps = 21/164 (13%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            +YR +  +L  +   EG R  +KG   + + V PYV + FA +E L       KPL + E
Sbjct  76   KYRSVGQSLRQIHAEEGLRGYFKGNGANCVRVFPYVAIQFAAFEKL-------KPLLISE  128

Query  592  DSE-LSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
             +E LS + +L  GA AG V   + YPLD  R R+ + G               A   +T
Sbjct  129  GAETLSPLQKLFGGAIAGVVSVCITYPLDAARARLTVQG-------------GLANTAHT  175

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVK  284
            G+ +     VR EG+R +Y+G++P    + P + + F  +E ++
Sbjct  176  GIFNVLSTVVRTEGLRGVYRGVLPTIWGIAPYVGLNFTVFETLR  219



>gb|ETP16331.1| hypothetical protein F441_09055 [Phytophthora parasitica CJ01A1]
Length=341

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 109/177 (62%), Gaps = 18/177 (10%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV    +   + G+F+ LSTV+R EG R +Y+G LP++ G+ PYVGLNF V+E+L+  
Sbjct  178  RLTVQGGLANTAHTGIFNVLSTVVRTEGLRGVYRGVLPTIWGIAPYVGLNFTVFETLRTT  237

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            + ++      E+ E   +  LACGA AG  GQT AYP+D++RRR Q+   +G A+     
Sbjct  238  VPRN------ENGEPDTMYLLACGALAGACGQTAAYPMDILRRRFQLSAMRGGAT-----  286

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
                   EYT  +   R  V+ EGVR LYKGL PN +KVVPSIAI F + E +K ++
Sbjct  287  -------EYTSTLGGLRTIVQEEGVRGLYKGLAPNFIKVVPSIAIMFTSNELMKRVI  336


 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 80/164 (49%), Gaps = 21/164 (13%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            +YR +  +L  +   EG R  +KG   + + V PYV + FA +E L       KPL + E
Sbjct  92   KYRSVGQSLRQIHAEEGLRGYFKGNGANCVRVFPYVAIQFAAFEKL-------KPLLISE  144

Query  592  DSE-LSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
             +E LS + +L  GA AG V   + YPLD  R R+ + G               A   +T
Sbjct  145  GAETLSPLQKLFGGAIAGVVSVCITYPLDAARARLTVQG-------------GLANTAHT  191

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVK  284
            G+ +     VR EG+R +Y+G++P    + P + + F  +E ++
Sbjct  192  GIFNVLSTVVRTEGLRGVYRGVLPTIWGIAPYVGLNFTVFETLR  235



>ref|XP_009527785.1| hypothetical protein PHYSODRAFT_559383 [Phytophthora sojae]
 gb|EGZ18727.1| hypothetical protein PHYSODRAFT_559383 [Phytophthora sojae]
Length=303

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 105/171 (61%), Gaps = 18/171 (11%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV    +   + G+ + LSTV+R EG R +Y+G LP++ G+ PYVGLNF V+E+L++ 
Sbjct  139  RLTVQGGLANTAHTGILNTLSTVVRTEGLRGVYRGVLPTIWGIAPYVGLNFTVFETLRNT  198

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            + ++      E+ E   +  LACGA AG  GQT AYP+D++RRR Q+   +G A+     
Sbjct  199  VPRN------ENGEPDAMYLLACGALAGACGQTAAYPMDILRRRFQLSAMRGDAT-----  247

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYE  293
                   EYT  +   R  VR EGVR LYKGL PN +KVVPSIAI F T E
Sbjct  248  -------EYTSTLGGLRTIVREEGVRGLYKGLAPNFIKVVPSIAIMFTTNE  291


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 80/168 (48%), Gaps = 19/168 (11%)
 Frame = -3

Query  784  NSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPL  605
            +SP +YR +  +L  +   EG R   KG   + + V PYV + FA +E LK  LI     
Sbjct  49   SSPVKYRTIGQSLRQIHAEEGLRGFLKGNGANCVRVFPYVAIQFAAFERLKPLLISDGA-  107

Query  604  GLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPL  425
                   LS + +L  GA AG V   + YPLD  R R+ + G               A  
Sbjct  108  -----ETLSPLQKLFGGAVAGVVSVCITYPLDAARARLTVQG-------------GLANT  149

Query  424  EYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKD  281
             +TG+++     VR EG+R +Y+G++P    + P + + F  +E +++
Sbjct  150  AHTGILNTLSTVVRTEGLRGVYRGVLPTIWGIAPYVGLNFTVFETLRN  197



>ref|XP_008866918.1| hypothetical protein H310_04369 [Aphanomyces invadans]
 gb|ETW03962.1| hypothetical protein H310_04369 [Aphanomyces invadans]
Length=306

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 102/177 (58%), Gaps = 20/177 (11%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV    +  QY G+FHAL   ++ EG + LY+G  P+++G+ PYVGLNF V+ESL+  
Sbjct  148  RITVQGNLTSQQYNGIFHALQVTVQQEGIKGLYRGMSPTIVGIAPYVGLNFMVFESLRQN  207

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
              K       E     ++  L CGA AG  GQ+ AYP D++RRR Q+             
Sbjct  208  APKD------EFGRQDMLYLLGCGAIAGACGQSAAYPFDLMRRRFQL-------------  248

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
              + +  +YTG  DA R   + EG+   YKGLVPNSVKV+PSIA+ FVT E +K  L
Sbjct  249  -NTLSEKQYTGTWDAVRSIYQTEGIVGFYKGLVPNSVKVIPSIAVMFVTNEAMKRCL  304


 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 85/166 (51%), Gaps = 19/166 (11%)
 Frame = -3

Query  778  PYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGL  599
            P QY  M  +L  ++  EG R ++KG   + + V PY  + FA +E L+  L ++     
Sbjct  60   PKQYTSMAQSLRKIMVEEGWRGMFKGNGANCVRVFPYTAIQFAAFEKLRPVLAEAG----  115

Query  598  VEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEY  419
               ++LS V +L  G+ AG V   V YPLD IR R+           V G   SQ   +Y
Sbjct  116  --TTDLSPVRKLIAGSIAGVVSVAVTYPLDFIRARI----------TVQGNLTSQ---QY  160

Query  418  TGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKD  281
             G+  A + TV+ EG++ LY+G+ P  V + P + + F+ +E ++ 
Sbjct  161  NGIFHALQVTVQQEGIKGLYRGMSPTIVGIAPYVGLNFMVFESLRQ  206



>ref|XP_001626526.1| predicted protein [Nematostella vectensis]
 gb|EDO34426.1| predicted protein [Nematostella vectensis]
Length=335

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 79/199 (40%), Positives = 106/199 (53%), Gaps = 29/199 (15%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEG---PRALYKGWLPSVIGVVPYVGLNFAVYESL  635
            R  +  + +  +YRG+ HA  T+L  EG      LY+G +P+ +G+ PYVGLNFAVYE+L
Sbjct  155  RTRLSAQGADRKYRGIVHAFRTILNEEGGFFSGCLYRGLVPTAMGIAPYVGLNFAVYETL  214

Query  634  KDWLIKS--------KPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVG  479
            K +L  +            + +D EL +  +L CG+ AG V QT  YPLDV+RRRMQM G
Sbjct  215  KGFLFSTVMASSQGASLTNIRKDRELPVNFKLMCGSLAGAVSQTATYPLDVVRRRMQMKG  274

Query  478  WKGAASIVTGEGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVT  299
             +             A   Y   + AF   V+ EG R LYKG+ PN +KV PS+ I F  
Sbjct  275  IR-------------ADFAYKSTLHAFSSIVKLEGFRGLYKGMWPNILKVAPSVGIQFAA  321

Query  298  YEQVKDILGVEIRISD*WR  242
            YE  K  L      S+ WR
Sbjct  322  YELSKSFL-----YSNKWR  335


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 54/170 (32%), Positives = 80/170 (47%), Gaps = 25/170 (15%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            +++G+   L  + + EG    +KG   +VI + PY  + FA YE  K      K L + +
Sbjct  70   KFKGVLPTLIQIGKEEGILGYFKGNGTNVIRIFPYSAVQFAAYEEYK------KLLNIPD  123

Query  592  DSELSI-VTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            D E    + RL  GA AG    T  YPLD+IR R+   G               A  +Y 
Sbjct  124  DPEHQTPIKRLVAGAMAGVTSITATYPLDLIRTRLSAQG---------------ADRKYR  168

Query  415  GMIDAFRKTVRYEG---VRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            G++ AFR  +  EG      LY+GLVP ++ + P + + F  YE +K  L
Sbjct  169  GIVHAFRTILNEEGGFFSGCLYRGLVPTAMGIAPYVGLNFAVYETLKGFL  218



>gb|KDO25589.1| hypothetical protein SPRG_08888 [Saprolegnia parasitica CBS 223.65]
Length=303

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 101/174 (58%), Gaps = 20/174 (11%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV    +  QY G++HAL   +++EG   LY+G  P+V+G+ PYVGLNF V+ESL+  
Sbjct  146  RMTVPDAMTKQQYHGIWHALKVTVQHEGVTGLYRGMSPTVVGIAPYVGLNFMVFESLR--  203

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
               S PL         ++  L CGA AG  GQ+ AYP D++RRR QM             
Sbjct  204  --ASAPLD--ASGRPDMLYLLGCGAVAGACGQSAAYPFDLMRRRFQMTALSDK-------  252

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVK  284
                   +Y G +DA     R+EG+R  YKGL+PNSVKV+PSIA+ FVT E +K
Sbjct  253  -------QYNGTMDAVTTIYRHEGIRGFYKGLIPNSVKVIPSIAVMFVTNEAMK  299


 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 82/165 (50%), Gaps = 19/165 (12%)
 Frame = -3

Query  778  PYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGL  599
            P QY  M  +L  ++  EG R ++KG   + + V PY  + FA++E L+  L+       
Sbjct  58   PKQYGSMLQSLRKIMAEEGWRGMFKGNGANCVRVFPYAAIQFAMFEKLRPILVSDGA---  114

Query  598  VEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEY  419
                +L+ + +L  G+ AG     V YPLD IR RM         ++     K Q    Y
Sbjct  115  ---KDLTSLQKLLAGSIAGVASVIVTYPLDFIRARM---------TVPDAMTKQQ----Y  158

Query  418  TGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVK  284
             G+  A + TV++EGV  LY+G+ P  V + P + + F+ +E ++
Sbjct  159  HGIWHALKVTVQHEGVTGLYRGMSPTVVGIAPYVGLNFMVFESLR  203


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -3

Query  781  SPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLI  620
            S  QY G   A++T+ R+EG R  YKG +P+ + V+P + + F   E++K W++
Sbjct  250  SDKQYNGTMDAVTTIYRHEGIRGFYKGLIPNSVKVIPSIAVMFVTNEAMKRWIM  303



>ref|XP_008608708.1| hypothetical protein SDRG_04802 [Saprolegnia diclina VS20]
 gb|EQC37775.1| hypothetical protein SDRG_04802 [Saprolegnia diclina VS20]
Length=302

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 101/174 (58%), Gaps = 20/174 (11%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV    +  QY G++HAL   +++EG   LY+G  P+V+G+ PYVGLNF V+ESL+  
Sbjct  145  RMTVPDAMTKQQYTGIWHALKVTVQHEGVTGLYRGMSPTVVGIAPYVGLNFMVFESLR--  202

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
               S PL         ++  L CGA AG  GQ+ AYP D++RRR QM             
Sbjct  203  --ASAPLD--ASGRPDMLYLLGCGAVAGACGQSAAYPFDLMRRRFQMTALSDK-------  251

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVK  284
                   +Y G +DA     R+EG+R  YKGL+PNSVKV+PSIA+ FVT E +K
Sbjct  252  -------QYNGTMDAVTTIYRHEGIRGFYKGLIPNSVKVIPSIAVMFVTNEAMK  298


 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 82/168 (49%), Gaps = 19/168 (11%)
 Frame = -3

Query  787  ENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKP  608
               P  Y  M  +L  ++  EG R ++KG   + + V PY  + FA++E L+  ++    
Sbjct  54   STEPKAYGSMLQSLRKIMAEEGWRGMFKGNGANCVRVFPYAAIQFAMFEKLRPIMVSDGA  113

Query  607  LGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAP  428
                   +L+ + +L  G+ AG     V YPLD IR RM         ++     K Q  
Sbjct  114  ------KDLTSLQKLLAGSIAGVASVIVTYPLDFIRARM---------TVPDAMTKQQ--  156

Query  427  LEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVK  284
              YTG+  A + TV++EGV  LY+G+ P  V + P + + F+ +E ++
Sbjct  157  --YTGIWHALKVTVQHEGVTGLYRGMSPTVVGIAPYVGLNFMVFESLR  202


 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 34/54 (63%), Gaps = 0/54 (0%)
 Frame = -3

Query  781  SPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLI  620
            S  QY G   A++T+ R+EG R  YKG +P+ + V+P + + F   E++K W++
Sbjct  249  SDKQYNGTMDAVTTIYRHEGIRGFYKGLIPNSVKVIPSIAVMFVTNEAMKRWIM  302



>gb|EFA84007.1| EF-hand domain-containing protein [Polysphondylium pallidum PN500]
Length=419

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 105/180 (58%), Gaps = 22/180 (12%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV       +Y G+  A   ++  EG R LYKG   S +GV PYV +NF  YE+LK +
Sbjct  254  RLTVQIHEQ--KYTGIADAYRKIVAEEGYRGLYKGLFTSALGVAPYVAINFTTYETLKYF  311

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
              K        D  L++V  L  GA +G   QT+ YP+D++RRR+Q+ G  GA       
Sbjct  312  FSK--------DKNLTVVNSLIFGAISGATAQTITYPIDLLRRRLQVQGIGGA-------  356

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
                 PL Y+G +DA +K ++ EGVR LYKG++P  +KV+P+I+I+F  YE +K +LG+ 
Sbjct  357  -----PLIYSGPLDACKKVIKEEGVRGLYKGMIPCYLKVIPAISISFCVYELMKSLLGIN  411


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 77/160 (48%), Gaps = 24/160 (15%)
 Frame = -3

Query  763  GMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVEDSE  584
            G+  +L  + + EG R L+KG   +VI + PY  + F  YE  K          +   S 
Sbjct  174  GVIKSLVNMYKVEGFRGLFKGNGTNVIRIAPYSAIQFLSYEKYKK---------VNGQSH  224

Query  583  LSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTGMID  404
            L     L  G +AG       YPLD+IR R+         ++   E K      YTG+ D
Sbjct  225  LHTGQNLFVGGSAGVTSLLFTYPLDLIRSRL---------TVQIHEQK------YTGIAD  269

Query  403  AFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVK  284
            A+RK V  EG R LYKGL  +++ V P +AI F TYE +K
Sbjct  270  AYRKIVAEEGYRGLYKGLFTSALGVAPYVAINFTTYETLK  309



>dbj|BAC11071.1| unnamed protein product [Homo sapiens]
Length=208

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 104/171 (61%), Gaps = 16/171 (9%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            QY+G+      +L  EGPRA Y+G+LP+V+G++PY G++ AVYE+LK+W ++       +
Sbjct  54   QYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQQYSH---D  110

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI   EG  Q       
Sbjct  111  SADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASI---EGGPQ-----LS  157

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIR  260
            M+   R  +  EG+R LY+G+ PN +KV+P+++I++V YE +K  LGV  R
Sbjct  158  MLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR  208



>ref|XP_012087988.1| PREDICTED: mitochondrial substrate carrier family protein B [Jatropha 
curcas]
 gb|KDP24542.1| hypothetical protein JCGZ_25106 [Jatropha curcas]
Length=357

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 104/177 (59%), Gaps = 17/177 (10%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R  +  + +   YRGM+HA ST++R EG   LYKG   +++GV P + L+F+VYESL+ +
Sbjct  191  RTRLAAQRNTIYYRGMWHAFSTIIREEGFLGLYKGLAATLLGVGPSIALSFSVYESLRSF  250

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
                +P     DS +++   LACG+ +G    T  +PLD++RRRMQ+ G  G A + T  
Sbjct  251  WQTQRP----NDSTVAV--SLACGSLSGIASSTATFPLDLVRRRMQLEGAGGRARVYT--  302

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
                     TG+       +R EG+R LY+G++P   KVVPS+ I F+TYE +K +L
Sbjct  303  ---------TGLFGTLGHIIRNEGLRGLYRGILPEYCKVVPSVGIIFMTYETLKMLL  350


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 79/176 (45%), Gaps = 30/176 (17%)
 Frame = -3

Query  745  STVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE---DSELSI  575
            S V+  EG RA +KG L +++  +PY  +NF  YE  K  L     LGL     ++ + +
Sbjct  109  SRVIHEEGFRAFWKGNLVTIVHRLPYSSVNFYAYERYKSLL--QSFLGLERQRGNATMDL  166

Query  574  VTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTGMIDAFR  395
                  G  AG    +  YPLD++R R+                  +  + Y GM  AF 
Sbjct  167  AVHFIGGGLAGITAASATYPLDLVRTRL---------------AAQRNTIYYRGMWHAFS  211

Query  394  KTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIRISD*WRTLKPN  227
              +R EG   LYKGL    + V PSIA++F  YE ++            W+T +PN
Sbjct  212  TIIREEGFLGLYKGLAATLLGVGPSIALSFSVYESLRSF----------WQTQRPN  257



>emb|CDP06562.1| unnamed protein product [Coffea canephora]
Length=340

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 107/177 (60%), Gaps = 17/177 (10%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R  +  + S   YRG++HALST+ R+EG   LYKG   +++GV P + ++F+VYE+L+ +
Sbjct  174  RTRLAAQRSAIYYRGIWHALSTICRDEGFYGLYKGLGATLLGVGPSIAISFSVYETLRSF  233

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
                +P    +DS  ++V  LACG+ +G    T  +PLD++RRR Q+ G  G A +    
Sbjct  234  WHSERP----DDS--TVVVSLACGSLSGIASSTATFPLDLVRRRKQLEGVGGRARVYN--  285

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
                     TG++  F   +R EG+R LY+G++P   KVVPS+ I F+TYE +K++L
Sbjct  286  ---------TGLLGTFGHIIRTEGLRGLYRGIMPEYYKVVPSVGIVFMTYETLKNLL  333


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 73/173 (42%), Gaps = 28/173 (16%)
 Frame = -3

Query  739  VLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVEDSELSI--VTR  566
            ++  EG RA ++G L ++   +PY  +NF  YE  K  L+KS P         S      
Sbjct  94   IVNEEGFRAFWRGNLVTIAHRLPYSSVNFYAYERYKS-LLKSIPAFSSHGGNASTDAFVH  152

Query  565  LacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTGMIDAFRKTV  386
               G  AG    +  YPLD++R R+                  ++ + Y G+  A     
Sbjct  153  FIGGGLAGITAASATYPLDLVRTRL---------------AAQRSAIYYRGIWHALSTIC  197

Query  385  RYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIRISD*WRTLKPN  227
            R EG   LYKGL    + V PSIAI+F  YE ++            W + +P+
Sbjct  198  RDEGFYGLYKGLGATLLGVGPSIAISFSVYETLRSF----------WHSERPD  240



>ref|XP_002945883.1| mitochondrial substrate carrier [Volvox carteri f. nagariensis]
 gb|EFJ52878.1| mitochondrial substrate carrier [Volvox carteri f. nagariensis]
Length=297

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 100/185 (54%), Gaps = 26/185 (14%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+ +   N PY  +G  HA + + R EG  +LYKG +P++IG+ PY  LNFA Y+ +K W
Sbjct  138  RLRLALPNHPY--KGAIHAATMMARTEGLISLYKGLVPTLIGIAPYAALNFASYDLIKKW  195

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            L          +   S V  L  G A+GT   +V YPLD IRRRMQM             
Sbjct  196  LYHG-------ERPQSSVANLLVGGASGTFAASVCYPLDTIRRRMQM-------------  235

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
             K QA   Y   +DAF+     EGVR  Y+G V NSVKVVP  AI  V+YE +K +LGV+
Sbjct  236  -KGQA---YRNQLDAFQTIWAREGVRGFYRGWVANSVKVVPQNAIRMVSYEAMKQLLGVK  291

Query  265  IRISD  251
               +D
Sbjct  292  KAKTD  296


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 75/170 (44%), Gaps = 24/170 (14%)
 Frame = -3

Query  784  NSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPL  605
             SP  Y G+  A   +LR EG  A +KG   ++I + PY     A  ++ K  L      
Sbjct  51   TSPTAYTGVGQAGLKILREEGFLAFWKGNGVNIIRIFPYSAAQLASNDTYKRLLAD----  106

Query  604  GLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPL  425
               E  EL++  RL  GA AG     + +PLD +R R+ +                    
Sbjct  107  ---EHHELTVPRRLLAGACAGMTATALTHPLDTVRLRLALPNH-----------------  146

Query  424  EYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
             Y G I A     R EG+ +LYKGLVP  + + P  A+ F +Y+ +K  L
Sbjct  147  PYKGAIHAATMMARTEGLISLYKGLVPTLIGIAPYAALNFASYDLIKKWL  196



>ref|XP_011526580.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
isoform X5 [Homo sapiens]
Length=549

 Score =   118 bits (296),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 106/173 (61%), Gaps = 16/173 (9%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            QY+G+      +L  EGPRA Y+G+LP+V+G++PY G++ AVYE+LK+W ++       +
Sbjct  361  QYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQQYSH---D  417

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI   EG  Q       
Sbjct  418  SADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASI---EGGPQ-----LS  464

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIRIS  254
            M+   R  +  EG+R LY+G+ PN +KV+P+++I++V YE +K  LGV  RIS
Sbjct  465  MLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSRIS  517



>ref|XP_004344612.1| carrier superfamily protein, partial [Acanthamoeba castellanii 
str. Neff]
 gb|ELR20869.1| carrier superfamily protein, partial [Acanthamoeba castellanii 
str. Neff]
Length=551

 Score =   118 bits (296),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 107/172 (62%), Gaps = 17/172 (10%)
 Frame = -3

Query  784  NSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPL  605
            ++P +YRG+ H +S+++R +G  AL++G LPSV+GV+PY G++FAVY +L+D   +  P 
Sbjct  393  SAPGEYRGIMHCISSIVRTDGVSALFRGLLPSVVGVIPYAGVDFAVYSTLRDVYTRRYP-  451

Query  604  GLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPL  425
                ++   ++T   CGA + T GQ VAYPL ++R R+Q  G  G             P+
Sbjct  452  ----NTHPGVLTVFVCGAISSTCGQVVAYPLQLVRTRLQTQGMAG------------RPM  495

Query  424  EYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGV  269
             Y GM DAF K  + +G+   Y G++PN +K +P+++I+++ YEQV   +G+
Sbjct  496  LYNGMSDAFFKIWKCDGLLGFYSGILPNFMKAIPAVSISYIVYEQVSRGMGI  547


 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 84/165 (51%), Gaps = 23/165 (14%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            +YRG++++L  +    G +  Y+G   ++I + P   + F  YES+K  L +       +
Sbjct  304  EYRGIWNSLKKIYFESGWKGFYRGNGTNIIKIAPESAVKFWAYESIKRMLCR-------D  356

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             S  +I  +L  G+AAG + QT  YPL++ + R+ +                 AP EY G
Sbjct  357  SSAPAIKEKLIAGSAAGAISQTAIYPLEITKTRLAV----------------SAPGEYRG  400

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDI  278
            ++      VR +GV AL++GL+P+ V V+P   + F  Y  ++D+
Sbjct  401  IMHCISSIVRTDGVSALFRGLLPSVVGVIPYAGVDFAVYSTLRDV  445



>ref|XP_011526579.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
isoform X4 [Homo sapiens]
Length=560

 Score =   118 bits (296),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 106/173 (61%), Gaps = 16/173 (9%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            QY+G+      +L  EGPRA Y+G+LP+V+G++PY G++ AVYE+LK+W ++       +
Sbjct  361  QYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQQYS---HD  417

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI   EG  Q       
Sbjct  418  SADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASI---EGGPQ-----LS  464

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIRIS  254
            M+   R  +  EG+R LY+G+ PN +KV+P+++I++V YE +K  LGV  RIS
Sbjct  465  MLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSRIS  517



>ref|XP_010262655.1| PREDICTED: mitochondrial substrate carrier family protein B-like 
isoform X2 [Nelumbo nucifera]
 ref|XP_010262656.1| PREDICTED: mitochondrial substrate carrier family protein B-like 
isoform X2 [Nelumbo nucifera]
 ref|XP_010262657.1| PREDICTED: mitochondrial substrate carrier family protein B-like 
isoform X2 [Nelumbo nucifera]
 ref|XP_010262658.1| PREDICTED: mitochondrial substrate carrier family protein B-like 
isoform X2 [Nelumbo nucifera]
Length=266

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 105/177 (59%), Gaps = 17/177 (10%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R  +  + +   YRGM+H LST+ R+EG   LYKG   +++GV P + ++F+VYE+L+  
Sbjct  100  RTRLAAQTNVVYYRGMWHTLSTISRDEGVVGLYKGLGATLLGVGPSIAISFSVYETLRSL  159

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
                +P    +DS   ++  LACG+ +G    T  +PLD++RRRMQ+ G  G A +    
Sbjct  160  WQSQRP----QDSP--VLVSLACGSLSGIASSTATFPLDLVRRRMQLEGAAGRARVYK--  211

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
                     TG++  FR  +R EG+R LY+G++P   KVVPS+ I F+TYE +K +L
Sbjct  212  ---------TGLLGTFRHIIRTEGLRGLYRGILPEYYKVVPSVGIVFMTYETIKMLL  259


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 80/176 (45%), Gaps = 30/176 (17%)
 Frame = -3

Query  745  STVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVEDSE---LSI  575
            S ++  EG RA +KG L ++   +PY  ++F  YE  K+ L++S P GL    E     +
Sbjct  18   SRIVYEEGFRAFWKGNLVTIAHRLPYSSVSFYAYERYKN-LLQSIP-GLESHRENITADL  75

Query  574  VTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTGMIDAFR  395
              RL  G  AG    ++ YPLD++R R+                     + Y GM     
Sbjct  76   CVRLVGGGLAGITAASITYPLDLVRTRL---------------AAQTNVVYYRGMWHTLS  120

Query  394  KTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIRISD*WRTLKPN  227
               R EGV  LYKGL    + V PSIAI+F  YE ++ +          W++ +P 
Sbjct  121  TISRDEGVVGLYKGLGATLLGVGPSIAISFSVYETLRSL----------WQSQRPQ  166



>ref|XP_008049193.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
isoform X1 [Tarsius syrichta]
Length=384

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 103/171 (60%), Gaps = 16/171 (9%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            QY+G+      +L  EGPRA Y+G+LP+V+G++PY G++ AVYE+LK+W ++        
Sbjct  230  QYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQEYSH---N  286

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI   EG  Q       
Sbjct  287  SADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASI---EGAPQ-----LS  333

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIR  260
            M+   R  +  EGVR LY+G+ PN +KV+P+++I++V YE +K  LGV  R
Sbjct  334  MLGLLRHILSQEGVRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR  384



>gb|EAW69088.1| solute carrier family 25 (mitochondrial carrier; phosphate carrier), 
member 23, isoform CRA_b [Homo sapiens]
Length=452

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 105/172 (61%), Gaps = 16/172 (9%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            QY+G+      +L  EGPRA Y+G+LP+V+G++PY G++ AVYE+LK+W ++       +
Sbjct  230  QYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQQYSH---D  286

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI   EG  Q       
Sbjct  287  SADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASI---EGGPQ-----LS  333

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIRI  257
            M+   R  +  EG+R LY+G+ PN +KV+P+++I++V YE +K  LGV  R+
Sbjct  334  MLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSRL  385



>ref|XP_002901049.1| Mitochondrial Carrier (MC) Family [Phytophthora infestans T30-4]
 gb|EEY59439.1| Mitochondrial Carrier (MC) Family [Phytophthora infestans T30-4]
Length=298

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 109/183 (60%), Gaps = 23/183 (13%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV    +   + G+F+ LS+V+R EG R +Y+G LP++ G+ PYVGLNF V+ +L+  
Sbjct  137  RLTVQGGLANTAHTGVFNVLSSVVRTEGLRGVYRGVLPTICGIAPYVGLNFTVFVTLRTT  196

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            + ++      E++E   +  LACGA AG  GQT AYP+D++RRR Q+   +G A+     
Sbjct  197  VPRN------ENTEPDTMYLLACGALAGACGQTAAYPMDILRRRFQLSAMRGDAT-----  245

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
                   EYT  +   R  V+ EGVR LYKGL PN +KVVPSIAI     E+  +    +
Sbjct  246  -------EYTSTLGGLRTIVQEEGVRGLYKGLAPNFIKVVPSIAI-----ERTDETCDQK  293

Query  265  IRI  257
            IR+
Sbjct  294  IRL  296


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 77/163 (47%), Gaps = 21/163 (13%)
 Frame = -3

Query  781  SPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLG  602
            +P +YR +  +L  +   EG    ++G   + + V PYV + FA +E LK  LI      
Sbjct  48   APVKYRSVGQSLRQIHAGEGLSGYFRGNGANCVRVFPYVAIQFAAFEKLKPLLIS-----  102

Query  601  LVEDSE-LSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPL  425
              E +E LS + +L  GA AG V   + YPLD  R R+ + G               A  
Sbjct  103  --EGAETLSPLQKLFGGAIAGVVSVCITYPLDAARARLTVQG-------------GLANT  147

Query  424  EYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTY  296
             +TG+ +     VR EG+R +Y+G++P    + P + + F  +
Sbjct  148  AHTGVFNVLSSVVRTEGLRGVYRGVLPTICGIAPYVGLNFTVF  190



>ref|XP_004358737.1| EF-hand domain-containing protein [Dictyostelium fasciculatum]
 gb|EGG20887.1| EF-hand domain-containing protein [Dictyostelium fasciculatum]
Length=398

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 103/182 (57%), Gaps = 21/182 (12%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+TV       +Y G+ +   TV++ EG   LYKG   S +GV PYV +NF  YESLK +
Sbjct  231  RLTVQINEQ--KYNGILNTYRTVVKEEGYAGLYKGLFTSALGVAPYVAINFTTYESLKYF  288

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
                      E   LS+   L  GA +G   QT  YP+D++RRR+Q+ G  G        
Sbjct  289  FTP-------EGEHLSVPQSLLYGAVSGATAQTFTYPIDLLRRRLQVQGIGGK-------  334

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
                 P  Y+G  DA +K V+ EGV+ LYKG++P  +KV+P+I+I+F  YE +K++LG++
Sbjct  335  -----PAVYSGPFDACKKIVQEEGVKGLYKGMIPCYLKVIPAISISFCVYELMKNLLGID  389

Query  265  IR  260
             +
Sbjct  390  SK  391


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 85/172 (49%), Gaps = 21/172 (12%)
 Frame = -3

Query  799  TVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLI  620
            ++  E+   QY  +F +L T+ R EG   L+KG   +VI + PY  + F  YE  K++L+
Sbjct  136  SMNLESGAPQYGSVFTSLRTMYRTEGLMGLFKGNGTNVIRIAPYSAIQFLAYEKYKEFLM  195

Query  619  KSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGK  440
            +           L+    L  G AAG       YPLD+IR R+         ++   E K
Sbjct  196  EDGK------KHLTTAQNLIVGGAAGVTSLLFTYPLDLIRARL---------TVQINEQK  240

Query  439  SQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVK  284
                  Y G+++ +R  V+ EG   LYKGL  +++ V P +AI F TYE +K
Sbjct  241  ------YNGILNTYRTVVKEEGYAGLYKGLFTSALGVAPYVAINFTTYESLK  286



>ref|XP_009802224.1| PREDICTED: mitochondrial substrate carrier family protein B-like 
isoform X2 [Nicotiana sylvestris]
Length=345

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 105/165 (64%), Gaps = 17/165 (10%)
 Frame = -3

Query  769  YRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVED  590
            YRG++HAL T+ R EG   LYKG   +++GV P + ++F+VY++++ +    +P    ED
Sbjct  194  YRGIWHALQTISREEGIAGLYKGMGATLLGVGPNLAISFSVYDTVRSYWQSHRP----ED  249

Query  589  SELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTGM  410
            S  +++  LACG+ +G    TV +PLD++RRRMQ+ G  G A I             TG+
Sbjct  250  S--TVLVSLACGSLSGVASSTVTFPLDLVRRRMQLEGAGGRARIYK-----------TGL  296

Query  409  IDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            + AF + ++ EG+R LY+G++P   KVVPSI I F+TYE++K IL
Sbjct  297  VGAFSRIIQTEGLRGLYRGILPEYYKVVPSIGIVFMTYEKMKQIL  341


 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 79/165 (48%), Gaps = 24/165 (15%)
 Frame = -3

Query  760  MFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL-----IKSKPLGLV  596
            ++   S ++R EG RA +KG L ++   +PY  ++F  +E  K+ L     ++S+   + 
Sbjct  95   IWQEASRIVREEGYRAFWKGNLVTIAHRLPYSSISFYAFERYKNVLQLILGVESQGENIT  154

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
             D    +  RL  G  +G    +V YPLD++R R+                  +  + Y 
Sbjct  155  AD----LCIRLVGGGLSGITAASVTYPLDLVRTRL---------------AAQRNVIYYR  195

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKD  281
            G+  A +   R EG+  LYKG+    + V P++AI+F  Y+ V+ 
Sbjct  196  GIWHALQTISREEGIAGLYKGMGATLLGVGPNLAISFSVYDTVRS  240



>ref|XP_010262654.1| PREDICTED: mitochondrial substrate carrier family protein B-like 
isoform X1 [Nelumbo nucifera]
Length=352

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 105/177 (59%), Gaps = 17/177 (10%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R  +  + +   YRGM+H LST+ R+EG   LYKG   +++GV P + ++F+VYE+L+  
Sbjct  186  RTRLAAQTNVVYYRGMWHTLSTISRDEGVVGLYKGLGATLLGVGPSIAISFSVYETLRSL  245

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
                +P    +DS   ++  LACG+ +G    T  +PLD++RRRMQ+ G  G A +    
Sbjct  246  WQSQRP----QDSP--VLVSLACGSLSGIASSTATFPLDLVRRRMQLEGAAGRARVYK--  297

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
                     TG++  FR  +R EG+R LY+G++P   KVVPS+ I F+TYE +K +L
Sbjct  298  ---------TGLLGTFRHIIRTEGLRGLYRGILPEYYKVVPSVGIVFMTYETIKMLL  345


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/176 (31%), Positives = 80/176 (45%), Gaps = 30/176 (17%)
 Frame = -3

Query  745  STVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVEDSE---LSI  575
            S ++  EG RA +KG L ++   +PY  ++F  YE  K+ L++S P GL    E     +
Sbjct  104  SRIVYEEGFRAFWKGNLVTIAHRLPYSSVSFYAYERYKN-LLQSIP-GLESHRENITADL  161

Query  574  VTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTGMIDAFR  395
              RL  G  AG    ++ YPLD++R R+                     + Y GM     
Sbjct  162  CVRLVGGGLAGITAASITYPLDLVRTRL---------------AAQTNVVYYRGMWHTLS  206

Query  394  KTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIRISD*WRTLKPN  227
               R EGV  LYKGL    + V PSIAI+F  YE ++ +          W++ +P 
Sbjct  207  TISRDEGVVGLYKGLGATLLGVGPSIAISFSVYETLRSL----------WQSQRPQ  252



>ref|XP_009843699.1| hypothetical protein H257_16824 [Aphanomyces astaci]
 gb|ETV66723.1| hypothetical protein H257_16824 [Aphanomyces astaci]
Length=310

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 99/177 (56%), Gaps = 20/177 (11%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            RITV    +   Y G+ HA    ++ EG + LY+G  P+++G+ PYVGLNF V+ESL+  
Sbjct  152  RITVQGNLTTQHYNGILHAFQVTIQQEGVKGLYRGMSPTIVGIAPYVGLNFMVFESLRQN  211

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
              K       E     ++  L CGA AG  GQ+ AYP D++RRR Q+             
Sbjct  212  APKD------EFGRQDMLYLLGCGAIAGACGQSAAYPFDLMRRRFQL-------------  252

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
              + +  +YTG  DA R   + EGV   YKGLVPNSVKV+PSIA+ FVT E +K  L
Sbjct  253  -NTLSEKQYTGTWDAVRSIYQSEGVVGFYKGLVPNSVKVIPSIAVMFVTNEALKRYL  308


 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 86/168 (51%), Gaps = 19/168 (11%)
 Frame = -3

Query  784  NSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPL  605
              P QY GM  +L  ++  EG R ++KG   + + V PY  + FA +E L+  L +    
Sbjct  62   TEPKQYTGMAQSLRKIMVEEGWRGMFKGNGANCVRVFPYTAIQFAAFERLRPVLAEPGA-  120

Query  604  GLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPL  425
                 ++LS + +L  G+ AG V   + YPLD IR R+           V G   +Q   
Sbjct  121  -----TDLSPLRKLLAGSIAGVVSVALTYPLDFIRARI----------TVQGNLTTQ---  162

Query  424  EYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKD  281
             Y G++ AF+ T++ EGV+ LY+G+ P  V + P + + F+ +E ++ 
Sbjct  163  HYNGILHAFQVTIQQEGVKGLYRGMSPTIVGIAPYVGLNFMVFESLRQ  210



>ref|XP_006045177.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
isoform X2 [Bubalus bubalis]
Length=503

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 118/210 (56%), Gaps = 26/210 (12%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD-WLIKSKPLGLV  596
            QY+G+      +L  EGP A Y+G+LP+V+G++PY G++ AVYE+LK+ WL +       
Sbjct  314  QYKGLLDCAWQILEREGPHAFYRGYLPNVLGIIPYAGIDLAVYETLKNRWLQQYSH----  369

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            + ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI   EG  Q      
Sbjct  370  DSADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASI---EGAPQ-----L  416

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIRI-SD*WRT  239
             M+   R  +  EGVR LY+G+ PN +KV+P+++I++V YE +K  LGV  R  +  WR 
Sbjct  417  SMLGLLRHILSQEGVRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSRSPALNWRI  476

Query  238  LKPNFVGKG*HRRLCTLNAQKLGTNSSQCS  149
            L P         R+  L AQ L + S + S
Sbjct  477  LDPLL-------RVLDLQAQPLDSGSQETS  499



>ref|XP_011798923.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
[Colobus angolensis palliatus]
Length=384

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 104/171 (61%), Gaps = 16/171 (9%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            QY+G+      +L  EGPRA Y+G+LP+V+G++PY G++ AVYE+LK+W ++       +
Sbjct  230  QYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQQYSH---D  286

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI   EG  Q       
Sbjct  287  SADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASI---EGGPQ-----LS  333

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIR  260
            M+   R  +  EG+R LY+G+ PN +KV+P+++I++V YE +K  LGV  R
Sbjct  334  MLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR  384



>dbj|BAB70825.1| unnamed protein product [Homo sapiens]
Length=384

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 104/171 (61%), Gaps = 16/171 (9%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            QY+G+      +L  EGPRA Y+G+LP+V+G++PY G++ AVYE+LK+W ++       +
Sbjct  230  QYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQQYSH---D  286

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI   EG  Q       
Sbjct  287  SADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASI---EGGPQ-----LS  333

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIR  260
            M+   R  +  EG+R LY+G+ PN +KV+P+++I++V YE +K  LGV  R
Sbjct  334  MLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR  384



>ref|XP_009615663.1| PREDICTED: mitochondrial substrate carrier family protein B-like 
isoform X1 [Nicotiana tomentosiformis]
Length=345

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 105/165 (64%), Gaps = 17/165 (10%)
 Frame = -3

Query  769  YRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVED  590
            YRG++HAL T+ R EG   LYKG   +++GV P + ++F+VY++++ +    +P    ED
Sbjct  194  YRGIWHALQTISREEGIAGLYKGMGATLLGVGPNLAISFSVYDTVRSYWQSRRP----ED  249

Query  589  SELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTGM  410
            S  +++  LACG+ +G    TV +PLD++RRRMQ+ G  G A I             TG+
Sbjct  250  S--TVLVSLACGSLSGVASSTVTFPLDLVRRRMQLEGAGGRARIYK-----------TGL  296

Query  409  IDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            + AF + ++ EG+R LY+G++P   KVVPSI I F+TYE++K IL
Sbjct  297  VGAFNRIIQTEGLRGLYRGILPEYYKVVPSIGIVFMTYEKMKQIL  341


 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 45/165 (27%), Positives = 79/165 (48%), Gaps = 24/165 (15%)
 Frame = -3

Query  760  MFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWL-----IKSKPLGLV  596
            ++   S ++R EG RA +KG L ++   +PY  ++F  +E  K+ L     ++S+   + 
Sbjct  95   IWQEASRIVREEGYRAFWKGNLVTIAHRLPYSSISFYAFERYKNVLQLILGVESQGENIT  154

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
             D    +  RL  G  +G    +V YPLD++R R+                  +  + Y 
Sbjct  155  AD----LCIRLVGGGLSGITAASVTYPLDLVRTRL---------------AAQRNVIYYR  195

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKD  281
            G+  A +   R EG+  LYKG+    + V P++AI+F  Y+ V+ 
Sbjct  196  GIWHALQTISREEGIAGLYKGMGATLLGVGPNLAISFSVYDTVRS  240



>ref|XP_002131752.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-1 
isoform X2 [Ciona intestinalis]
Length=474

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 106/168 (63%), Gaps = 13/168 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            QY G+F     VLRNEGP+A +KG++P+ +G++PY G++  +YE+LK++ IK+      E
Sbjct  318  QYSGIFDCAFKVLRNEGPKAFFKGYIPNCLGIIPYAGIDLCIYETLKNYWIKTYG---AE  374

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
              + S++  LACG  + T GQ  +YPL ++R +MQ      A + +    K+Q     T 
Sbjct  375  KEKPSVLLLLACGTTSSTCGQLASYPLALVRTKMQ------AQASLPNHDKNQK----TS  424

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGV  269
            M+  FR  V+ +GV  LY+GL PN +KV P+++I++V YE+++  LGV
Sbjct  425  MVSLFRSIVQTDGVFGLYRGLAPNFMKVAPAVSISYVVYEKMRMHLGV  472



>ref|XP_010347829.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
isoform X1 [Saimiri boliviensis boliviensis]
Length=384

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 104/171 (61%), Gaps = 16/171 (9%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            QY+G+      +L  EGPRA Y+G+LP+V+G++PY G++ AVYE+LK+W ++       +
Sbjct  230  QYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQQYSH---D  286

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI   EG  Q       
Sbjct  287  SADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASI---EGGPQ-----LS  333

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIR  260
            M+   R  +  EG+R LY+G+ PN +KV+P+++I++V YE +K  LGV  R
Sbjct  334  MLALLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR  384



>ref|XP_011019212.1| PREDICTED: mitochondrial substrate carrier family protein B-like 
[Populus euphratica]
Length=352

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 104/177 (59%), Gaps = 17/177 (10%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R  +  + +   YRG+ HA  T+ R EG   LYKG   +++GV P + ++F+VYESL+ +
Sbjct  186  RTRLAAQRNTIYYRGILHAFHTICREEGFLGLYKGLGATLLGVGPSIAISFSVYESLRSF  245

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
             +  +P     DS  +++  LACG+ +G    T  +PLD++RRRMQ+ G  G A + T  
Sbjct  246  WLSKRP----NDS--TVMASLACGSLSGIASSTATFPLDLVRRRMQLEGAGGQARVYT--  297

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
                     TG+  AF + ++ EG+R +Y+G++P   KVVP + I F+TYE +K +L
Sbjct  298  ---------TGLFGAFARIIQTEGLRGMYRGILPEYYKVVPGVGIVFMTYETLKMLL  345


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 52/176 (30%), Positives = 75/176 (43%), Gaps = 30/176 (17%)
 Frame = -3

Query  745  STVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE---DSELSI  575
            S V+  EG RA +KG L ++   +PY  ++F  YE  K  L     LG+     D    +
Sbjct  104  SRVMNEEGFRAFWKGNLVTIAHRLPYSSVSFYAYERYKSLL--QSVLGVENHRGDGTADL  161

Query  574  VTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTGMIDAFR  395
                  G  AG    +  YPLD++R R+                  +  + Y G++ AF 
Sbjct  162  AVHFIGGGMAGITAASATYPLDLVRTRLA---------------AQRNTIYYRGILHAFH  206

Query  394  KTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIRISD*WRTLKPN  227
               R EG   LYKGL    + V PSIAI+F  YE ++            W + +PN
Sbjct  207  TICREEGFLGLYKGLGATLLGVGPSIAISFSVYESLRSF----------WLSKRPN  252



>ref|XP_010782176.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like 
[Notothenia coriiceps]
Length=246

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 101/169 (60%), Gaps = 18/169 (11%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD-WLIKSKPLGLV  596
            QY GM H    +L  EG RA Y+G+LP+ +G++PY G+  AVYE+LK+ WL ++      
Sbjct  93   QYSGMAHCARQILTREGVRAFYRGYLPNTLGIIPYAGIELAVYETLKNAWLKRNA----A  148

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
            + ++  ++  L CG  + T GQ  +YPL +IR RMQ        +    EGK +      
Sbjct  149  DSADPGVLVLLGCGTISSTCGQLASYPLALIRTRMQ--------AQAAHEGKPKLT----  196

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGV  269
             M+  F+  + +EGV  LY+GL PN +KV+P+++I++V YE +K +LGV
Sbjct  197  -MVGQFKHIISHEGVPGLYRGLTPNFLKVIPAVSISYVVYEHMKKVLGV  244



>ref|XP_008240217.1| PREDICTED: mitochondrial substrate carrier family protein B-like 
[Prunus mume]
 ref|XP_008240223.1| PREDICTED: mitochondrial substrate carrier family protein B-like 
[Prunus mume]
Length=347

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 107/185 (58%), Gaps = 18/185 (10%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R  +  + +   YRG+ HA  T+ R EG   LYKG   +++GV P + ++F+VYE+L+ +
Sbjct  181  RTRLAAQRNALYYRGIGHAFHTICREEGFLGLYKGLGATLLGVGPSIAISFSVYEALRSF  240

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
                +P     DS  +++  LACG+ +G    T  +PLD++RRRMQ+ G  G A I    
Sbjct  241  WQSERP----NDS--TVMVSLACGSLSGIASSTATFPLDLVRRRMQLEGAGGRARIYN--  292

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
                     TG++  F+  +R EG+R LY+G++P   KVVPS+ I F+TYE +K +L   
Sbjct  293  ---------TGLVGTFKHIIRTEGLRGLYRGILPEYYKVVPSVGIVFMTYETLKMLLS-R  342

Query  265  IRISD  251
            I+ SD
Sbjct  343  IQTSD  347


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 77/178 (43%), Gaps = 25/178 (14%)
 Frame = -3

Query  760  MFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVEDSEL  581
            ++H  S ++  EG RA ++G L ++   +PY  ++F  YE  K  L       L  ++  
Sbjct  95   IWHEASRIVNEEGFRAFWRGNLVTIAHRLPYSSVSFYAYERYKQLLHSLLGENLRGNAST  154

Query  580  SIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTGMIDA  401
             +      G  AG    +  YPLD++R R+                  +  L Y G+  A
Sbjct  155  DMCVHFLGGGMAGLTAASATYPLDLVRTRL---------------AAQRNALYYRGIGHA  199

Query  400  FRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIRISD*WRTLKPN  227
            F    R EG   LYKGL    + V PSIAI+F  YE ++            W++ +PN
Sbjct  200  FHTICREEGFLGLYKGLGATLLGVGPSIAISFSVYEALRSF----------WQSERPN  247



>ref|XP_011405585.1| PREDICTED: mitochondrial adenine nucleotide transporter ADNT1-like 
[Amphimedon queenslandica]
Length=334

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 75/194 (39%), Positives = 112/194 (58%), Gaps = 22/194 (11%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEG---PRALYKGWLPSVIGVVPYVGLNFAVYESL  635
            R+++  E S  +Y+ +      +L+ EG     ALY+G +P+ +G+ PYVGLNFA+YE L
Sbjct  153  RLSIQQEESHKKYKNITQTFKVILKEEGGFWSGALYRGLVPTAMGIAPYVGLNFAIYEML  212

Query  634  KDWLIK------SKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWK  473
            K +++            L+ D E+ ++ +L CGA +G   Q++ YPLDVIRRRMQM   +
Sbjct  213  KGYVMNIVFSTDDTRSQLMLDDEMPVLWKLTCGAISGATAQSITYPLDVIRRRMQM---R  269

Query  472  GAASIVTGEGKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYE  293
            GA S +           YT   +A +   R EG+ + YKG++PN +KV PS+ I FVTYE
Sbjct  270  GARSDL---------FPYTSTPNAIQTMYRVEGIGSFYKGMIPNLLKVAPSMGITFVTYE  320

Query  292  QVKDIL-GVEIRIS  254
              K  L G+ I+ S
Sbjct  321  FTKARLYGIPIKWS  334


 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 83/166 (50%), Gaps = 21/166 (13%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            +++G+  +L T+ R EG R  YKG   +VI +VPYV + FA YE  K  L  S      +
Sbjct  66   KFQGVTSSLRTIWREEGIRGYYKGNGTNVIRIVPYVAVQFAAYEEFKKLLKVSS-----D  120

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
              E S   RL  GA AG    T  YPLD++R R+ +              + ++  +Y  
Sbjct  121  AREQSPFKRLLAGALAGITSVTATYPLDLVRTRLSI-------------QQEESHKKYKN  167

Query  412  MIDAFRKTVRYEG---VRALYKGLVPNSVKVVPSIAIAFVTYEQVK  284
            +   F+  ++ EG     ALY+GLVP ++ + P + + F  YE +K
Sbjct  168  ITQTFKVILKEEGGFWSGALYRGLVPTAMGIAPYVGLNFAIYEMLK  213



>ref|XP_007205473.1| hypothetical protein PRUPE_ppa008053mg [Prunus persica]
 gb|EMJ06672.1| hypothetical protein PRUPE_ppa008053mg [Prunus persica]
Length=347

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 107/185 (58%), Gaps = 18/185 (10%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R  +  + +   YRG+ HA  T+ R EG   LYKG   +++GV P + ++F+VYE+L+ +
Sbjct  181  RTRLAAQRNALYYRGIGHAFHTICREEGFLGLYKGLGATLLGVGPSIAISFSVYEALRSF  240

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
                +P     DS  +++  LACG+ +G    T  +PLD++RRRMQ+ G  G A I    
Sbjct  241  WQSERP----NDS--TVMVSLACGSLSGIASSTATFPLDLVRRRMQLEGAGGRARIYN--  292

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
                     TG++  F+  +R EG+R LY+G++P   KVVPS+ I F+TYE +K +L   
Sbjct  293  ---------TGLVGTFKHIIRTEGLRGLYRGILPEYYKVVPSVGIVFMTYETLKMLLS-R  342

Query  265  IRISD  251
            I+ SD
Sbjct  343  IQASD  347


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 77/178 (43%), Gaps = 25/178 (14%)
 Frame = -3

Query  760  MFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVEDSEL  581
            ++H  S ++  EG RA ++G L ++   +PY  ++F  YE  K  L       L  ++  
Sbjct  95   IWHEASRIVNEEGFRAFWRGNLVTIAHRLPYSSVSFYAYERYKQLLHSLLGENLRGNAST  154

Query  580  SIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTGMIDA  401
             +      G  AG    +  YPLD++R R+                  +  L Y G+  A
Sbjct  155  DMCVHFLGGGMAGLTAASATYPLDLVRTRL---------------AAQRNALYYRGIGHA  199

Query  400  FRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIRISD*WRTLKPN  227
            F    R EG   LYKGL    + V PSIAI+F  YE ++            W++ +PN
Sbjct  200  FHTICREEGFLGLYKGLGATLLGVGPSIAISFSVYEALRSF----------WQSERPN  247



>ref|XP_001696228.1| mitochondrial substrate carrier protein [Chlamydomonas reinhardtii]
 gb|EDP08205.1| mitochondrial substrate carrier protein [Chlamydomonas reinhardtii]
Length=297

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 102/185 (55%), Gaps = 26/185 (14%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R+ +   N PY  +G   A + ++R EG  +LYKG +P++IG+ PY  LNFA Y+ +K W
Sbjct  138  RLRLALPNHPY--KGAIDAATIMVRTEGMISLYKGLVPTLIGIAPYAALNFASYDLIKKW  195

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
            +          +   S +  L  G  +GT+  ++ YPLD IRRRMQM             
Sbjct  196  MYHG-------ERPQSAMANLLVGGTSGTIAASICYPLDTIRRRMQM-------------  235

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
             K QA   Y   +DAFR  +  EG+R  Y+G V N+VKVVP  AI  V+YE +K++LGV+
Sbjct  236  -KGQA---YKNQMDAFRTIMAKEGMRGFYRGWVANTVKVVPQNAIRMVSYEAMKNVLGVK  291

Query  265  IRISD  251
               +D
Sbjct  292  KAKTD  296


 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 76/167 (46%), Gaps = 24/167 (14%)
 Frame = -3

Query  784  NSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPL  605
             SP  Y G+  A   ++R EG  A +KG   ++I + PY     A  ++ K  L      
Sbjct  51   TSPTAYTGVGQAAMKIIREEGFLAFWKGNGVNIIRIFPYSAAQLASNDTYKRLLAD----  106

Query  604  GLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPL  425
               E  ELS+  RL  GA AG     + +PLD +R R+ +                    
Sbjct  107  ---EKHELSVPRRLLAGACAGMTATALTHPLDTVRLRLALPNH-----------------  146

Query  424  EYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVK  284
             Y G IDA    VR EG+ +LYKGLVP  + + P  A+ F +Y+ +K
Sbjct  147  PYKGAIDAATIMVRTEGMISLYKGLVPTLIGIAPYAALNFASYDLIK  193



>ref|XP_010658512.1| PREDICTED: mitochondrial substrate carrier family protein B isoform 
X2 [Vitis vinifera]
Length=287

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 96/163 (59%), Gaps = 17/163 (10%)
 Frame = -3

Query  769  YRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVED  590
            YRG+ H L T++R EG   LYKG   +++GV P + +NF+VYE+L+      +P     D
Sbjct  134  YRGIGHTLQTIVREEGIWGLYKGLGATLLGVGPSIAINFSVYETLRSSWHSQRP----ND  189

Query  589  SELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTGM  410
            S  +++  L CG+ +G    T  +PLD++RRRMQ+ G  G A + T           TG+
Sbjct  190  S--TVLVSLTCGSLSGIASSTATFPLDLVRRRMQLEGAGGRARVYT-----------TGL  236

Query  409  IDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKD  281
               FR  +R EG+R LY+G++P   KVVP + I F+TYE +K+
Sbjct  237  FGTFRHIIRTEGLRGLYRGILPEYYKVVPGVGICFMTYETLKN  279



>ref|XP_002674890.1| predicted protein [Naegleria gruberi]
 gb|EFC42146.1| predicted protein [Naegleria gruberi]
Length=328

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 99/179 (55%), Gaps = 17/179 (9%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R  +  +  P  Y G+ HAL  + + EG + LY+G +P+++G+ PYV LNF  YE L   
Sbjct  159  RCRLSAQYEPKIYHGINHALKLIYQTEGIKGLYRGIVPTLLGIAPYVALNFTTYEHL---  215

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
              K K L  +    L +VT+L  GA +GT  QTV YP DV+RRRMQMVG  GA  +    
Sbjct  216  --KVKSLEYLGSDNLGVVTKLVLGAVSGTFAQTVTYPFDVVRRRMQMVGMSGAEELP---  270

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGV  269
                       M  AFR+  +  G    YKGL+ N +KV+P ++I FV YE +K  LG+
Sbjct  271  ---------KTMPSAFRQVYQKYGFTGFYKGLLSNYMKVIPVVSINFVVYEYMKIFLGL  320


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 80/163 (49%), Gaps = 20/163 (12%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            +Y G+  +L  + + EG    +KG   +V+ +VPY  + F  YE  K+W++   P     
Sbjct  74   KYNGIIRSLIKIGKEEGISGYFKGNGSNVVRIVPYTAVQFVSYEKYKEWMMNMNP-----  128

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
            D  L+   RL CG  AG     V+YPLDV+R R+                    P  Y G
Sbjct  129  DGRLTTWQRLNCGGLAGMTSVIVSYPLDVVRCRLS---------------AQYEPKIYHG  173

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVK  284
            +  A +   + EG++ LY+G+VP  + + P +A+ F TYE +K
Sbjct  174  INHALKLIYQTEGIKGLYRGIVPTLLGIAPYVALNFTTYEHLK  216



>ref|XP_008970918.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
isoform X2 [Pan paniscus]
Length=432

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 104/171 (61%), Gaps = 16/171 (9%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            QY+G+      +L  EGPRA Y+G+LP+V+G++PY G++ AVYE+LK+W ++       +
Sbjct  278  QYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQQY---CHD  334

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI   EG  Q       
Sbjct  335  SADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASI---EGGPQ-----LS  381

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIR  260
            M+   R  +  EG+R LY+G+ PN +KV+P+++I++V YE +K  LGV  R
Sbjct  382  MLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR  432



>ref|XP_003798042.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
[Otolemur garnettii]
Length=468

 Score =   115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 103/171 (60%), Gaps = 16/171 (9%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            QY+G+      +L  EGPRA Y+G+LP+V+G++PY G++ AVYE+LK+W ++       +
Sbjct  314  QYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQQYS---HD  370

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI  G   S        
Sbjct  371  SADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASIDGGPQPS--------  417

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIR  260
            M+   R  +  EG+R LY+G+ PN +KV+P+++I++V YE +K  LGV  R
Sbjct  418  MLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVSSR  468



>ref|XP_002761674.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
isoform X2 [Callithrix jacchus]
Length=468

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 104/171 (61%), Gaps = 16/171 (9%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            QY+G+      +L  EGPRA Y+G+LP+V+G++PY G++ AVYE+LK+W ++       +
Sbjct  314  QYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQQY---CHD  370

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI   EG  Q       
Sbjct  371  SADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASI---EGGPQ-----LS  417

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIR  260
            M+   R  +  EG+R LY+G+ PN +KV+P+++I++V YE +K  LGV  R
Sbjct  418  MLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR  468



>ref|XP_003819385.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
isoform X1 [Pan paniscus]
Length=468

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 104/171 (61%), Gaps = 16/171 (9%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            QY+G+      +L  EGPRA Y+G+LP+V+G++PY G++ AVYE+LK+W ++       +
Sbjct  314  QYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQQY---CHD  370

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI   EG  Q       
Sbjct  371  SADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASI---EGGPQ-----LS  417

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIR  260
            M+   R  +  EG+R LY+G+ PN +KV+P+++I++V YE +K  LGV  R
Sbjct  418  MLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR  468



>ref|XP_007993182.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
isoform X2 [Chlorocebus sabaeus]
Length=468

 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 104/171 (61%), Gaps = 16/171 (9%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            QY+G+      +L  EGPRA Y+G+LP+V+G++PY G++ AVYE+LK+W ++       +
Sbjct  314  QYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQQYS---HD  370

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI   EG  Q       
Sbjct  371  SADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASI---EGGPQLS-----  417

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIR  260
            M+   R  +  EG+R LY+G+ PN +KV+P+++I++V YE +K  LGV  R
Sbjct  418  MLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR  468



>ref|XP_007489085.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
isoform X3 [Monodelphis domestica]
Length=368

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 103/172 (60%), Gaps = 18/172 (10%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD-WLIKSKPLGLV  596
            QY+G+      +L  EGPRA YKG+LP+V+G++PY G++ AVYE+LK+ WL +       
Sbjct  214  QYKGLLDCARQILEQEGPRAFYKGYLPNVLGIIPYAGIDLAVYETLKNRWLQQDSH----  269

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
              ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI   EG  Q      
Sbjct  270  HSADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASI---EGAPQLT----  317

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIR  260
             M+  FR  +  EGV  LY+G+ PN +KV+P+++I++V YE +K  LGV  R
Sbjct  318  -MLGLFRHILSREGVWGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTTR  368



>ref|XP_007409754.1| hypothetical protein MELLADRAFT_48294 [Melampsora larici-populina 
98AG31]
 gb|EGG06794.1| hypothetical protein MELLADRAFT_48294 [Melampsora larici-populina 
98AG31]
Length=327

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 92/150 (61%), Gaps = 17/150 (11%)
 Frame = -3

Query  724  GPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVEDSELSIVTRLacgaaa  545
            G R LY+G +P+VIGV PYVG NFA YE LK            + S  +++ +L CGA A
Sbjct  192  GLRGLYRGLIPTVIGVAPYVGSNFASYEFLKQTFCPPD-----QSSPYNVLKKLGCGAFA  246

Query  544  gtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTGMIDAFRKTVRYEGVRA  365
            G + QTV YPLDV+RRRMQ+ G  G +             +Y G  DA +K +R EG+R 
Sbjct  247  GGMSQTVTYPLDVLRRRMQVTGMNGMS------------FKYDGAWDATKKIIRNEGLRG  294

Query  364  LYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            LYKGL PN +KVVPSI  +FVTYE V+D L
Sbjct  295  LYKGLWPNLLKVVPSIGTSFVTYEIVRDWL  324


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 84/167 (50%), Gaps = 13/167 (8%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
             Y+GM+ +L  + + EG R  ++G   +VI + PY  + F+ YE  K  L +  P     
Sbjct  71   NYQGMWPSLVKIGKTEGWRGYFRGNGINVIRIAPYSAIQFSAYEVAKKLLTRLSP-----  125

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
              EL+   RL  GA AG       YPLD++R R+ ++    +A I T   K QA    TG
Sbjct  126  TQELNTPLRLTAGAIAGICSVVATYPLDLVRSRLSII----SAEIGT---KPQAHQNSTG  178

Query  412  MIDAFRKTVRYE-GVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
            +I    +  + E G+R LY+GL+P  + V P +   F +YE +K   
Sbjct  179  IIKTSLEIYKTEGGLRGLYRGLIPTVIGVAPYVGSNFASYEFLKQTF  225


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -3

Query  775  YQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLI  620
            ++Y G + A   ++RNEG R LYKG  P+++ VVP +G +F  YE ++DWL+
Sbjct  274  FKYDGAWDATKKIIRNEGLRGLYKGLWPNLLKVVPSIGTSFVTYEIVRDWLL  325



>ref|XP_007993181.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
isoform X1 [Chlorocebus sabaeus]
Length=474

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 104/171 (61%), Gaps = 16/171 (9%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            QY+G+      +L  EGPRA Y+G+LP+V+G++PY G++ AVYE+LK+W ++       +
Sbjct  314  QYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQQYSH---D  370

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI   EG  Q       
Sbjct  371  SADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASI---EGGPQ-----LS  417

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIR  260
            M+   R  +  EG+R LY+G+ PN +KV+P+++I++V YE +K  LGV  R
Sbjct  418  MLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR  468



>ref|XP_011744787.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
isoform X1 [Macaca nemestrina]
Length=474

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 104/171 (61%), Gaps = 16/171 (9%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            QY+G+      +L  EGPRA Y+G+LP+V+G++PY G++ AVYE+LK+W ++       +
Sbjct  314  QYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQQYSH---D  370

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI   EG  Q       
Sbjct  371  SADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASI---EGGPQ-----LS  417

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIR  260
            M+   R  +  EG+R LY+G+ PN +KV+P+++I++V YE +K  LGV  R
Sbjct  418  MLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR  468



>ref|XP_012067384.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3-like 
[Jatropha curcas]
 gb|KDP41876.1| hypothetical protein JCGZ_26894 [Jatropha curcas]
Length=497

 Score =   115 bits (289),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 94/155 (61%), Gaps = 16/155 (10%)
 Frame = -3

Query  730  NEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVEDSELSIVTRLacga  551
             EGPRA Y+G +PS++G++PY G++ A YE+LKD   K     +++DSE   + +L CG 
Sbjct  359  QEGPRAFYRGLIPSLLGIIPYAGIDLAAYETLKDMSKKY----ILQDSEPGPLIQLGCGT  414

Query  550  aagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTGMIDAFRKTVRYEGV  371
             +G +G T  YPL V+R RMQ             + +S     Y GM D FRKT ++EG+
Sbjct  415  LSGALGATCVYPLQVVRTRMQ------------AQRRSNTGAAYNGMSDVFRKTFQHEGI  462

Query  370  RALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
            R  YKG+ PN +KVVPS +I ++ YE +K  L +E
Sbjct  463  RGFYKGIFPNMLKVVPSASITYMVYEAMKKSLDLE  497



>ref|XP_005587761.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
isoform X1 [Macaca fascicularis]
Length=474

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 104/171 (61%), Gaps = 16/171 (9%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            QY+G+      +L  EGPRA Y+G+LP+V+G++PY G++ AVYE+LK+W ++       +
Sbjct  314  QYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQQYSH---D  370

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI   EG  Q       
Sbjct  371  SADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASI---EGGPQ-----LS  417

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIR  260
            M+   R  +  EG+R LY+G+ PN +KV+P+++I++V YE +K  LGV  R
Sbjct  418  MLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR  468



>ref|XP_011928654.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
isoform X1 [Cercocebus atys]
Length=468

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 104/171 (61%), Gaps = 16/171 (9%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            QY+G+      +L  EGPRA Y+G+LP+V+G++PY G++ AVYE+LK+W ++       +
Sbjct  314  QYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQQYS---HD  370

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI   EG  Q       
Sbjct  371  SADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASI---EGGPQ-----LS  417

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIR  260
            M+   R  +  EG+R LY+G+ PN +KV+P+++I++V YE +K  LGV  R
Sbjct  418  MLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR  468



>ref|XP_007489084.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
isoform X2 [Monodelphis domestica]
Length=385

 Score =   115 bits (287),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 103/172 (60%), Gaps = 18/172 (10%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD-WLIKSKPLGLV  596
            QY+G+      +L  EGPRA YKG+LP+V+G++PY G++ AVYE+LK+ WL +       
Sbjct  231  QYKGLLDCARQILEQEGPRAFYKGYLPNVLGIIPYAGIDLAVYETLKNRWLQQDSH----  286

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
              ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI   EG  Q      
Sbjct  287  HSADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASI---EGAPQLT----  334

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIR  260
             M+  FR  +  EGV  LY+G+ PN +KV+P+++I++V YE +K  LGV  R
Sbjct  335  -MLGLFRHILSREGVWGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTTR  385



>ref|XP_005587762.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
isoform X2 [Macaca fascicularis]
Length=468

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 104/171 (61%), Gaps = 16/171 (9%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            QY+G+      +L  EGPRA Y+G+LP+V+G++PY G++ AVYE+LK+W ++       +
Sbjct  314  QYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQQYS---HD  370

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI   EG  Q       
Sbjct  371  SADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASI---EGGPQLS-----  417

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIR  260
            M+   R  +  EG+R LY+G+ PN +KV+P+++I++V YE +K  LGV  R
Sbjct  418  MLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR  468



>ref|XP_002529856.1| Mitochondrial deoxynucleotide carrier, putative [Ricinus communis]
 gb|EEF32506.1| Mitochondrial deoxynucleotide carrier, putative [Ricinus communis]
Length=363

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 103/177 (58%), Gaps = 17/177 (10%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R  +  + +   YRG++HA +T+ R EG   LYKG   +++GV P + ++F+VYESL+ +
Sbjct  198  RTRLATQRNTIYYRGIWHAFNTICREEGFLGLYKGLGATLLGVGPSIAISFSVYESLRSF  257

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
                +P     DS  +I   LACG+ +G    T  +PLD++RRRMQ+ G  G A + T  
Sbjct  258  WRSKRP----NDS--TIAVSLACGSLSGIAASTATFPLDLVRRRMQLEGAGGRARVYT--  309

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
                     TG+   F   +R EG+R LY+G++P   KVVPS+ I F+TYE +K +L
Sbjct  310  ---------TGLFGTFGHIIRQEGLRGLYRGILPEYYKVVPSVGIVFMTYETLKMLL  357


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 56/182 (31%), Positives = 83/182 (46%), Gaps = 32/182 (18%)
 Frame = -3

Query  760  MFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIK----SKPLGLVE  593
            ++H  + V+  EG RA +KG L +++  +PY  +NF  YE  K +L       K  G V 
Sbjct  111  LWHEATRVINEEGFRAFWKGNLVTIVHRLPYSSVNFYAYERYKSFLQSVFGLEKQRGNV-  169

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             S+L++      G  AG    +  YPLD++R R+                  +  + Y G
Sbjct  170  TSDLAV--HFVAGGLAGITAASATYPLDLVRTRL---------------ATQRNTIYYRG  212

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIRISD*WRTLK  233
            +  AF    R EG   LYKGL    + V PSIAI+F  YE ++            WR+ +
Sbjct  213  IWHAFNTICREEGFLGLYKGLGATLLGVGPSIAISFSVYESLRSF----------WRSKR  262

Query  232  PN  227
            PN
Sbjct  263  PN  264



>ref|XP_010365471.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
isoform X1 [Rhinopithecus roxellana]
Length=468

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 104/171 (61%), Gaps = 16/171 (9%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            QY+G+      +L  EGPRA Y+G+LP+V+G++PY G++ AVYE+LK+W ++       +
Sbjct  314  QYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQQYS---HD  370

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI   EG  Q       
Sbjct  371  SADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASI---EGGPQ-----LS  417

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIR  260
            M+   R  +  EG+R LY+G+ PN +KV+P+++I++V YE +K  LGV  R
Sbjct  418  MLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR  468



>ref|NP_001244844.1| calcium-binding mitochondrial carrier protein SCaMC-3 [Macaca 
mulatta]
 ref|XP_011744794.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
isoform X2 [Macaca nemestrina]
Length=468

 Score =   115 bits (288),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 104/171 (61%), Gaps = 16/171 (9%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            QY+G+      +L  EGPRA Y+G+LP+V+G++PY G++ AVYE+LK+W ++       +
Sbjct  314  QYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQQYS---HD  370

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI   EG  Q       
Sbjct  371  SADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASI---EGGPQ-----LS  417

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIR  260
            M+   R  +  EG+R LY+G+ PN +KV+P+++I++V YE +K  LGV  R
Sbjct  418  MLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR  468



>ref|XP_004059894.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
[Gorilla gorilla gorilla]
Length=468

 Score =   115 bits (288),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 104/171 (61%), Gaps = 16/171 (9%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            QY+G+      +L  EGPRA Y+G+LP+V+G++PY G++ AVYE+LK+W ++       +
Sbjct  314  QYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQQYS---HD  370

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI   EG  Q       
Sbjct  371  SADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASI---EGGPQ-----LS  417

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIR  260
            M+   R  +  EG+R LY+G+ PN +KV+P+++I++V YE +K  LGV  R
Sbjct  418  MLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR  468



>ref|XP_011744807.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
isoform X4 [Macaca nemestrina]
Length=438

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 104/171 (61%), Gaps = 16/171 (9%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            QY+G+      +L  EGPRA Y+G+LP+V+G++PY G++ AVYE+LK+W ++       +
Sbjct  278  QYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQQYS---HD  334

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI   EG  Q       
Sbjct  335  SADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASI---EGGPQ-----LS  381

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIR  260
            M+   R  +  EG+R LY+G+ PN +KV+P+++I++V YE +K  LGV  R
Sbjct  382  MLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR  432



>ref|XP_009432750.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
[Pan troglodytes]
Length=468

 Score =   115 bits (288),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 104/171 (61%), Gaps = 16/171 (9%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            QY+G+      +L  EGPRA Y+G+LP+V+G++PY G++ AVYE+LK+W ++       +
Sbjct  314  QYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQQYS---HD  370

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI   EG  Q       
Sbjct  371  SADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASI---EGGPQ-----LS  417

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIR  260
            M+   R  +  EG+R LY+G+ PN +KV+P+++I++V YE +K  LGV  R
Sbjct  418  MLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR  468



>ref|XP_011526577.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
isoform X2 [Homo sapiens]
Length=577

 Score =   116 bits (291),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 105/172 (61%), Gaps = 16/172 (9%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            QY+G+      +L  EGPRA Y+G+LP+V+G++PY G++ AVYE+LK+W ++       +
Sbjct  314  QYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQQYSH---D  370

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI   EG  Q       
Sbjct  371  SADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASI---EGGPQ-----LS  417

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIRI  257
            M+   R  +  EG+R LY+G+ PN +KV+P+++I++V YE +K  LGV  R+
Sbjct  418  MLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSRL  469



>gb|ACG46518.1| protein brittle-1 [Zea mays]
 gb|ACN31813.1| unknown [Zea mays]
 tpg|DAA53502.1| TPA: protein brittle-1 [Zea mays]
Length=325

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 66/185 (36%), Positives = 107/185 (58%), Gaps = 18/185 (10%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R  +  + +   Y+G+FHA+ST+ R+EG + LYKG   +++GV P + ++F+VYESL+ +
Sbjct  157  RTRLATQKTTRYYKGIFHAVSTICRDEGVKGLYKGLGATLLGVGPSIAISFSVYESLRSY  216

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
                +P     DS  + V  L  G+ +G    T  +PLD+++RRMQ+ G  G AS+    
Sbjct  217  WQMERP----HDS--TAVVSLFSGSLSGIASSTATFPLDLVKRRMQLQGAAGTASV----  266

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVE  266
                   + + +    R  ++ EG+R  Y+G+ P  +KVVPS+ IAF+TYE +K +L   
Sbjct  267  -------QKSTISGTVRDILQREGLRGFYRGIAPEYLKVVPSVGIAFMTYETLKGLLS-S  318

Query  265  IRISD  251
            I I D
Sbjct  319  IDIDD  323


 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 80/160 (50%), Gaps = 17/160 (11%)
 Frame = -3

Query  760  MFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVEDSEL  581
            ++H  S + R EG  A +KG L +++  +PY  ++F  YE  K+ L+++ P GL  DS  
Sbjct  73   IWHEASRIFREEGIEAFWKGNLVTIVHRLPYSAISFYSYERYKN-LLQTVP-GLDRDSNN  130

Query  580  SIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTGMIDA  401
              V RL  G  AG    ++ YPLDV+R R+                  +    Y G+  A
Sbjct  131  VGVVRLLGGGLAGITAASLTYPLDVVRTRL---------------ATQKTTRYYKGIFHA  175

Query  400  FRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKD  281
                 R EGV+ LYKGL    + V PSIAI+F  YE ++ 
Sbjct  176  VSTICRDEGVKGLYKGLGATLLGVGPSIAISFSVYESLRS  215



>ref|NP_077008.2| calcium-binding mitochondrial carrier protein SCaMC-3 [Homo sapiens]
 sp|Q9BV35.2|SCMC3_HUMAN RecName: Full=Calcium-binding mitochondrial carrier protein SCaMC-3; 
AltName: Full=Mitochondrial ATP-Mg/Pi carrier protein 
2; AltName: Full=Mitochondrial Ca(2+)-dependent solute carrier 
protein 2; AltName: Full=Small calcium-binding mitochondrial 
carrier protein 3; AltName: Full=Solute carrier family 
25 member 23 [Homo sapiens]
 emb|CAF04059.1| mitochondrial ATP-Mg/Pi carrier [Homo sapiens]
 emb|CAF04494.1| small calcium-binding mitochondrial carrier 3 [Homo sapiens]
 gb|AAU95077.1| mitochondrial Ca2+-dependent solute carrier protein 2 [Homo sapiens]
 gb|EAW69089.1| solute carrier family 25 (mitochondrial carrier; phosphate carrier), 
member 23, isoform CRA_c [Homo sapiens]
 dbj|BAG57727.1| unnamed protein product [Homo sapiens]
Length=468

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 104/171 (61%), Gaps = 16/171 (9%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE  593
            QY+G+      +L  EGPRA Y+G+LP+V+G++PY G++ AVYE+LK+W ++       +
Sbjct  314  QYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQQYS---HD  370

Query  592  DSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTG  413
             ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI   EG  Q       
Sbjct  371  SADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASI---EGGPQ-----LS  417

Query  412  MIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIR  260
            M+   R  +  EG+R LY+G+ PN +KV+P+++I++V YE +K  LGV  R
Sbjct  418  MLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTSR  468



>ref|XP_007489083.1| PREDICTED: calcium-binding mitochondrial carrier protein SCaMC-3 
isoform X1 [Monodelphis domestica]
Length=421

 Score =   115 bits (287),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 103/172 (60%), Gaps = 18/172 (10%)
 Frame = -3

Query  772  QYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKD-WLIKSKPLGLV  596
            QY+G+      +L  EGPRA YKG+LP+V+G++PY G++ AVYE+LK+ WL +       
Sbjct  267  QYKGLLDCARQILEQEGPRAFYKGYLPNVLGIIPYAGIDLAVYETLKNRWLQQDSH----  322

Query  595  EDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYT  416
              ++  I+  LACG  + T GQ  +YPL ++R RMQ       ASI   EG  Q      
Sbjct  323  HSADPGILVLLACGTISSTCGQIASYPLALVRTRMQ-----AQASI---EGAPQLT----  370

Query  415  GMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDILGVEIR  260
             M+  FR  +  EGV  LY+G+ PN +KV+P+++I++V YE +K  LGV  R
Sbjct  371  -MLGLFRHILSREGVWGLYRGIAPNFMKVIPAVSISYVVYENMKQALGVTTR  421



>ref|XP_007026884.1| Mitochondrial substrate carrier family protein [Theobroma cacao]
 gb|EOY07386.1| Mitochondrial substrate carrier family protein [Theobroma cacao]
Length=355

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 105/177 (59%), Gaps = 17/177 (10%)
 Frame = -3

Query  805  RITVXXENSPYQYRGMFHALSTVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDW  626
            R  +  + +   YRG++HA  T+ R+EG   LYKG   +++GV P + ++F+VYESL+ +
Sbjct  189  RTRLAAQRNAIYYRGIWHAFHTICRDEGIFGLYKGLGATLLGVGPSIAISFSVYESLRSY  248

Query  625  LIKSKPLGLVEDSELSIVTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGE  446
                +P    +DS  +I+  LACG+ +G    T  +P+D++RRRMQ+ G  G A + T  
Sbjct  249  WQLQRP----DDS--TIMVSLACGSLSGIASSTATFPIDLVRRRMQLEGAAGRARVYT--  300

Query  445  GKSQAPLEYTGMIDAFRKTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKDIL  275
                     TG+   FR  ++ EG+R LY+G++P   KVVP + I F+TYE +K +L
Sbjct  301  ---------TGLFGTFRHIIQSEGLRGLYRGILPEYYKVVPGVGIVFMTYETLKMLL  348


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 73/158 (46%), Gaps = 20/158 (13%)
 Frame = -3

Query  745  STVLRNEGPRALYKGWLPSVIGVVPYVGLNFAVYESLKDWLIKSKPLGLVE---DSELSI  575
            S ++  EG RA +KG + ++   +PY  +NF  YE  K +L     LGL +   ++   +
Sbjct  107  SRIMNEEGVRAFWKGNMVTIAHRLPYSSVNFYAYERYKSFL--QSILGLEDQRGNASADL  164

Query  574  VTRLacgaaagtvgqtvAYPLDVIRRRMQMVGWKGAASIVTGEGKSQAPLEYTGMIDAFR  395
                  G  AG    +  YPLD++R R+                  +  + Y G+  AF 
Sbjct  165  CVHFVGGGLAGMTAASATYPLDLVRTRL---------------AAQRNAIYYRGIWHAFH  209

Query  394  KTVRYEGVRALYKGLVPNSVKVVPSIAIAFVTYEQVKD  281
               R EG+  LYKGL    + V PSIAI+F  YE ++ 
Sbjct  210  TICRDEGIFGLYKGLGATLLGVGPSIAISFSVYESLRS  247



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1683214431688