BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13759

Length=1292
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009611551.1|  PREDICTED: polyol transporter 5-like               493   6e-167   Nicotiana tomentosiformis
ref|XP_009596634.1|  PREDICTED: polyol transporter 5-like               488   1e-165   Nicotiana tomentosiformis
ref|XP_009766648.1|  PREDICTED: polyol transporter 5-like               487   7e-165   Nicotiana sylvestris
ref|XP_009800568.1|  PREDICTED: polyol transporter 5-like               482   6e-163   Nicotiana sylvestris
ref|XP_006365518.1|  PREDICTED: polyol transporter 5-like               474   3e-159   Solanum tuberosum [potatoes]
ref|XP_011092774.1|  PREDICTED: polyol transporter 5-like               466   8e-157   Sesamum indicum [beniseed]
ref|XP_002313809.1|  putative sorbitol transporter family protein       464   5e-156   Populus trichocarpa [western balsam poplar]
ref|XP_011088358.1|  PREDICTED: polyol transporter 5-like               464   8e-156   Sesamum indicum [beniseed]
ref|XP_002519083.1|  sugar transporter, putative                        463   2e-155   Ricinus communis
emb|CDO97075.1|  unnamed protein product                                461   8e-155   Coffea canephora [robusta coffee]
gb|ABK29439.1|  sugar transport protein                                 461   9e-155   Coffea canephora [robusta coffee]
gb|AFI61955.1|  polyol transporter                                      460   2e-154   Camellia sinensis [black tea]
ref|XP_010096202.1|  Polyol transporter 5                               460   3e-154   Morus notabilis
ref|XP_011048787.1|  PREDICTED: polyol transporter 5-like               458   2e-153   Populus euphratica
ref|XP_012069670.1|  PREDICTED: polyol transporter 5-like               455   9e-153   Jatropha curcas
ref|XP_006361759.1|  PREDICTED: polyol transporter 5-like               452   3e-152   Solanum tuberosum [potatoes]
ref|XP_009785575.1|  PREDICTED: polyol transporter 5-like isoform X2    444   9e-151   Nicotiana sylvestris
ref|NP_001287655.1|  polyol transporter 5-like                          450   2e-150   Solanum lycopersicum
ref|XP_012069657.1|  PREDICTED: putative polyol transporter 1           449   6e-150   Jatropha curcas
ref|XP_011037561.1|  PREDICTED: polyol transporter 5                    448   8e-150   Populus euphratica
ref|XP_007042744.1|  Polyol/monosaccharide transporter 5                447   4e-149   
ref|XP_009785574.1|  PREDICTED: polyol transporter 5-like isoform X1    439   8e-149   Nicotiana sylvestris
gb|KJB32189.1|  hypothetical protein B456_005G228500                    444   8e-148   Gossypium raimondii
gb|AAM44082.1|  putative sorbitol transporter                           443   8e-148   Prunus cerasus [pie cherry]
ref|XP_006487182.1|  PREDICTED: polyol transporter 5-like               443   1e-147   Citrus sinensis [apfelsine]
ref|XP_006423215.1|  hypothetical protein CICLE_v10028170mg             443   1e-147   Citrus clementina [clementine]
ref|XP_004299107.1|  PREDICTED: polyol transporter 5-like               443   1e-147   Fragaria vesca subsp. vesca
gb|KHG20989.1|  Polyol transporter 5 -like protein                      442   2e-147   Gossypium arboreum [tree cotton]
ref|XP_009602627.1|  PREDICTED: polyol transporter 5-like               442   3e-147   Nicotiana tomentosiformis
ref|XP_004507415.1|  PREDICTED: polyol transporter 5-like               441   6e-147   Cicer arietinum [garbanzo]
gb|ACB56939.1|  mannitol transporter                                    440   8e-147   Artemisia annua [sweet Annie]
ref|NP_001281033.1|  polyol transporter 5-like                          441   1e-146   Malus domestica [apple tree]
ref|XP_008387370.1|  PREDICTED: putative polyol transporter 1           440   2e-146   Malus domestica [apple tree]
ref|XP_002305419.2|  hypothetical protein POPTR_0004s15960g             440   2e-146   Populus trichocarpa [western balsam poplar]
gb|EPS69995.1|  sugar transport protein                                 439   2e-146   Genlisea aurea
emb|CAP58707.1|  putative polyol transported protein 2                  440   3e-146   Hevea brasiliensis [jebe]
ref|XP_009344435.1|  PREDICTED: putative polyol transporter 1           439   5e-146   Pyrus x bretschneideri [bai li]
gb|AGG19155.1|  sorbitol transporter                                    439   5e-146   Pyrus pyrifolia [sha li]
ref|XP_008387369.1|  PREDICTED: putative polyol transporter 1 iso...    439   6e-146   
gb|ACD68477.1|  plasma membrane mannitol transporter                    435   7e-146   Arachis hypogaea [goober]
ref|XP_009375627.1|  PREDICTED: putative polyol transporter 1           438   8e-146   Pyrus x bretschneideri [bai li]
ref|XP_009344433.1|  PREDICTED: putative polyol transporter 1           438   1e-145   Pyrus x bretschneideri [bai li]
ref|XP_009375628.1|  PREDICTED: putative polyol transporter 1           438   1e-145   Pyrus x bretschneideri [bai li]
gb|ACB86853.1|  mannitol transporter                                    438   1e-145   Citrus sinensis [apfelsine]
ref|XP_006423216.1|  hypothetical protein CICLE_v10028174mg             437   1e-145   Citrus clementina [clementine]
ref|XP_003541068.1|  PREDICTED: polyol transporter 5-like               437   2e-145   
gb|KHN25361.1|  Polyol transporter 5                                    436   4e-145   Glycine soja [wild soybean]
gb|KEH30427.1|  polyol/monosaccharide transporter 1                     429   5e-145   Medicago truncatula
ref|NP_001280902.1|  putative polyol transporter 1                      436   6e-145   Malus domestica [apple tree]
ref|XP_008387377.1|  PREDICTED: putative polyol transporter 1           435   1e-144   
ref|XP_009375822.1|  PREDICTED: putative polyol transporter 1           434   2e-144   Pyrus x bretschneideri [bai li]
gb|EYU37769.1|  hypothetical protein MIMGU_mgv1a005015mg                433   3e-144   Erythranthe guttata [common monkey flower]
gb|AAZ80876.1|  putative sorbitol transporter                           426   4e-144   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_003631630.1|  PREDICTED: polyol transporter 5                    433   5e-144   Vitis vinifera
gb|AGY96955.1|  polyol transporter 1                                    433   5e-144   Vitis vinifera
ref|XP_008246181.1|  PREDICTED: polyol transporter 5-like               427   6e-144   Prunus mume [ume]
ref|XP_008387376.1|  PREDICTED: putative polyol transporter 1           433   6e-144   
ref|XP_012069681.1|  PREDICTED: putative polyol transporter 1           433   1e-143   Jatropha curcas
ref|XP_006487181.1|  PREDICTED: polyol transporter 5-like               433   1e-143   Citrus sinensis [apfelsine]
ref|XP_008387373.1|  PREDICTED: putative polyol transporter 1           432   1e-143   
ref|XP_009336961.1|  PREDICTED: putative polyol transporter 1           431   3e-143   Pyrus x bretschneideri [bai li]
ref|XP_009378956.1|  PREDICTED: putative polyol transporter 1           432   3e-143   Pyrus x bretschneideri [bai li]
ref|XP_009345075.1|  PREDICTED: putative polyol transporter 1           432   3e-143   Pyrus x bretschneideri [bai li]
ref|XP_008236795.1|  PREDICTED: polyol transporter 5-like               431   7e-143   Prunus mume [ume]
gb|KEH30425.1|  polyol/monosaccharide transporter 1                     428   8e-143   Medicago truncatula
dbj|BAM66295.1|  sorbitol transporter                                   427   1e-142   Pyrus pyrifolia [sha li]
ref|XP_009344431.1|  PREDICTED: putative polyol transporter 1           430   1e-142   Pyrus x bretschneideri [bai li]
ref|XP_010065405.1|  PREDICTED: polyol transporter 5-like               430   1e-142   Eucalyptus grandis [rose gum]
ref|XP_009342008.1|  PREDICTED: putative polyol transporter 1           430   1e-142   Pyrus x bretschneideri [bai li]
ref|XP_009350912.1|  PREDICTED: putative polyol transporter 1           430   1e-142   Pyrus x bretschneideri [bai li]
gb|KEH30426.1|  polyol/monosaccharide transporter 1                     429   2e-142   Medicago truncatula
ref|XP_010065409.1|  PREDICTED: polyol transporter 5-like               429   2e-142   Eucalyptus grandis [rose gum]
gb|AAY88181.2|  mannitol transporter 1                                  427   2e-142   Olea europaea
ref|XP_008368693.1|  PREDICTED: polyol transporter 5-like               422   3e-142   
ref|XP_011078883.1|  PREDICTED: polyol transporter 5-like isoform X1    429   4e-142   Sesamum indicum [beniseed]
ref|XP_008345143.1|  PREDICTED: polyol transporter 5-like               429   4e-142   Malus domestica [apple tree]
ref|XP_011078884.1|  PREDICTED: polyol transporter 5-like isoform X2    428   4e-142   Sesamum indicum [beniseed]
ref|XP_009342010.1|  PREDICTED: putative polyol transporter 1           428   6e-142   Pyrus x bretschneideri [bai li]
ref|XP_008393068.1|  PREDICTED: putative polyol transporter 1           428   7e-142   Malus domestica [apple tree]
ref|XP_008236773.1|  PREDICTED: putative polyol transporter 1           427   1e-141   Prunus mume [ume]
gb|KHN39768.1|  Polyol transporter 5                                    427   1e-141   Glycine soja [wild soybean]
ref|XP_008368694.1|  PREDICTED: polyol transporter 5-like               426   1e-141   
ref|XP_009345072.1|  PREDICTED: putative polyol transporter 1           426   2e-141   
ref|XP_009350914.1|  PREDICTED: putative polyol transporter 1           426   3e-141   Pyrus x bretschneideri [bai li]
ref|NP_001281038.1|  polyol transporter 5-like                          424   6e-141   Malus domestica [apple tree]
ref|NP_001236592.1|  sorbitol-like transporter                          426   6e-141   
ref|XP_009345071.1|  PREDICTED: putative polyol transporter 1           425   8e-141   Pyrus x bretschneideri [bai li]
ref|NP_001289249.1|  polyol transporter 5-like                          424   2e-140   Pyrus x bretschneideri [bai li]
ref|XP_004300990.1|  PREDICTED: polyol transporter 5-like               424   2e-140   Fragaria vesca subsp. vesca
ref|XP_009342009.1|  PREDICTED: putative polyol transporter 1           424   2e-140   Pyrus x bretschneideri [bai li]
gb|AGG19156.1|  sorbitol transporter                                    422   4e-140   Pyrus pyrifolia [sha li]
ref|XP_008236797.1|  PREDICTED: putative polyol transporter 2           424   4e-140   Prunus mume [ume]
ref|XP_004148857.1|  PREDICTED: polyol transporter 5-like               423   7e-140   Cucumis sativus [cucumbers]
ref|XP_009344434.1|  PREDICTED: polyol transporter 5-like               421   8e-140   Pyrus x bretschneideri [bai li]
ref|XP_009375629.1|  PREDICTED: polyol transporter 5-like               421   1e-139   Pyrus x bretschneideri [bai li]
ref|XP_010254895.1|  PREDICTED: polyol transporter 5-like               422   1e-139   Nelumbo nucifera [Indian lotus]
dbj|BAM66296.1|  sorbitol transporter                                   419   1e-139   Pyrus pyrifolia [sha li]
gb|AAL85876.2|AF480069_1  mannitol transporter                          422   1e-139   Apium graveolens Dulce Group [celery]
emb|CAP58706.1|  putative polyol transporter protein 1                  422   1e-139   Hevea brasiliensis [jebe]
ref|XP_006349557.1|  PREDICTED: polyol transporter 5-like               422   2e-139   Solanum tuberosum [potatoes]
ref|XP_007199793.1|  hypothetical protein PRUPE_ppa004456mg             421   2e-139   Prunus persica
gb|AAO39267.1|AF482011_1  sorbitol transporter                          421   2e-139   Prunus cerasus [pie cherry]
ref|XP_007200667.1|  hypothetical protein PRUPE_ppa015294mg             422   3e-139   
ref|XP_007200254.1|  hypothetical protein PRUPE_ppa015090mg             421   3e-139   Prunus persica
ref|XP_007200117.1|  hypothetical protein PRUPE_ppa018884mg             421   3e-139   Prunus persica
ref|XP_009375838.1|  PREDICTED: putative polyol transporter 1           421   4e-139   Pyrus x bretschneideri [bai li]
ref|XP_008236796.1|  PREDICTED: polyol transporter 5-like               420   5e-139   Prunus mume [ume]
ref|XP_007200033.1|  hypothetical protein PRUPE_ppa024323mg             421   5e-139   
ref|XP_008387375.1|  PREDICTED: polyol transporter 5-like               420   5e-139   
ref|XP_008236860.1|  PREDICTED: putative polyol transporter 1           420   6e-139   Prunus mume [ume]
emb|CAJ29291.1|  putative polyol transporter protein 4                  420   1e-138   Lotus japonicus
ref|XP_008359575.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...    420   1e-138   
ref|NP_001281036.1|  polyol transporter 5-like                          418   2e-138   Malus domestica [apple tree]
ref|XP_008361285.1|  PREDICTED: putative polyol transporter 1           419   3e-138   
emb|CDP10064.1|  unnamed protein product                                418   3e-138   Coffea canephora [robusta coffee]
ref|XP_006384498.1|  hypothetical protein POPTR_0004s15900g             417   4e-138   
ref|XP_007042751.1|  Polyol/monosaccharide transporter 5, putative      418   5e-138   
ref|XP_006349565.1|  PREDICTED: polyol transporter 5-like               417   1e-137   Solanum tuberosum [potatoes]
ref|XP_007199207.1|  hypothetical protein PRUPE_ppa021762mg             417   1e-137   Prunus persica
gb|AIU41385.1|  sorbitol transporter 1                                  416   2e-137   Prunus salicina [Japanese plum]
ref|XP_007131851.1|  hypothetical protein PHAVU_011G046700g             416   4e-137   Phaseolus vulgaris [French bean]
ref|XP_004500821.1|  PREDICTED: polyol transporter 5-like               415   5e-137   Cicer arietinum [garbanzo]
ref|XP_003607077.1|  Sorbitol-like transporter                          414   1e-136   Medicago truncatula
ref|XP_010068107.1|  PREDICTED: polyol transporter 5-like               413   1e-136   Eucalyptus grandis [rose gum]
ref|XP_007135989.1|  hypothetical protein PHAVU_009G008900g             414   2e-136   Phaseolus vulgaris [French bean]
ref|XP_009345073.1|  PREDICTED: polyol transporter 5-like               412   2e-136   Pyrus x bretschneideri [bai li]
ref|XP_010527590.1|  PREDICTED: polyol transporter 5-like               414   2e-136   Tarenaya hassleriana [spider flower]
gb|KCW62858.1|  hypothetical protein EUGRSUZ_G00452                     414   2e-136   Eucalyptus grandis [rose gum]
ref|XP_003603886.1|  Mannitol transporter                               412   6e-136   Medicago truncatula
gb|AAO88964.1|  sorbitol transporter                                    410   1e-135   Malus domestica [apple tree]
ref|XP_008245305.1|  PREDICTED: polyol transporter 5-like               410   3e-135   Prunus mume [ume]
ref|XP_011088360.1|  PREDICTED: polyol transporter 5-like               410   4e-135   Sesamum indicum [beniseed]
gb|ABX71752.1|  mannitol transporter                                    409   1e-134   Apium graveolens
gb|AAT06053.2|  sorbitol transporter                                    409   1e-134   Malus domestica [apple tree]
ref|XP_008245258.1|  PREDICTED: polyol transporter 5-like               408   2e-134   Prunus mume [ume]
ref|XP_010028575.1|  PREDICTED: polyol transporter 5-like               408   5e-134   Eucalyptus grandis [rose gum]
ref|NP_188513.1|  polyol transporter 5                                  408   6e-134   Arabidopsis thaliana [mouse-ear cress]
gb|AAN07021.1|  putative mannitol transporter                           407   1e-133   Phelipanche ramosa
ref|XP_010909852.1|  PREDICTED: putative polyol transporter 1           406   2e-133   Elaeis guineensis
ref|XP_002885281.1|  ATPLT5                                             407   2e-133   Arabidopsis lyrata subsp. lyrata
gb|KJB12315.1|  hypothetical protein B456_002G011400                    406   2e-133   Gossypium raimondii
emb|CDX95491.1|  BnaC01g33830D                                          406   3e-133   
emb|CAD58709.1|  polyol transporter                                     406   3e-133   Plantago major [cart-track plant]
ref|XP_009112300.1|  PREDICTED: polyol transporter 5                    405   7e-133   Brassica rapa
gb|AAG43998.1|AF215837_1  mannitol transporter                          404   1e-132   Apium graveolens Dulce Group [celery]
gb|EYU20732.1|  hypothetical protein MIMGU_mgv1a026176mg                403   2e-132   Erythranthe guttata [common monkey flower]
ref|XP_010507195.1|  PREDICTED: polyol transporter 5                    404   2e-132   Camelina sativa [gold-of-pleasure]
ref|XP_010465998.1|  PREDICTED: polyol transporter 5-like               404   2e-132   Camelina sativa [gold-of-pleasure]
ref|XP_006577924.1|  PREDICTED: polyol transporter 5-like               402   3e-132   Glycine max [soybeans]
emb|CDY61985.1|  BnaC03g73840D                                          403   3e-132   Brassica napus [oilseed rape]
gb|KJB12316.1|  hypothetical protein B456_002G011500                    403   3e-132   Gossypium raimondii
ref|XP_008791366.1|  PREDICTED: polyol transporter 5-like               402   5e-132   
gb|KJB12318.1|  hypothetical protein B456_002G011700                    402   8e-132   Gossypium raimondii
ref|XP_007131850.1|  hypothetical protein PHAVU_011G046600g             401   1e-131   Phaseolus vulgaris [French bean]
ref|XP_008800418.1|  PREDICTED: polyol transporter 5-like               401   2e-131   Phoenix dactylifera
ref|XP_009135601.1|  PREDICTED: polyol transporter 5                    401   2e-131   Brassica rapa
ref|XP_009407915.1|  PREDICTED: putative polyol transporter 1           400   4e-131   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK30307.1|  hypothetical protein AALP_AA7G244900                    400   5e-131   Arabis alpina [alpine rockcress]
ref|XP_010487804.1|  PREDICTED: polyol transporter 5-like               400   6e-131   Camelina sativa [gold-of-pleasure]
ref|XP_008775333.1|  PREDICTED: polyol transporter 5-like               399   9e-131   Phoenix dactylifera
ref|XP_006406559.1|  hypothetical protein EUTSA_v10020495mg             399   2e-130   Eutrema salsugineum [saltwater cress]
ref|XP_008800420.1|  PREDICTED: polyol transporter 5-like               398   3e-130   Phoenix dactylifera
ref|XP_002467638.1|  hypothetical protein SORBIDRAFT_01g031360          397   6e-130   Sorghum bicolor [broomcorn]
ref|XP_010905472.1|  PREDICTED: polyol transporter 5-like               397   8e-130   
ref|XP_010690917.1|  PREDICTED: polyol transporter 5 isoform X2         396   3e-129   
ref|XP_010690916.1|  PREDICTED: polyol transporter 5 isoform X1         396   5e-129   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004148312.2|  PREDICTED: polyol transporter 5-like               394   8e-129   Cucumis sativus [cucumbers]
ref|XP_008447049.1|  PREDICTED: polyol transporter 5                    394   9e-129   Cucumis melo [Oriental melon]
tpg|DAA45950.1|  TPA: hypothetical protein ZEAMMB73_850316              394   1e-128   
ref|XP_008653287.1|  PREDICTED: polyol transporter 5-like               393   2e-128   Zea mays [maize]
gb|EAZ04480.1|  hypothetical protein OsI_26629                          393   2e-128   Oryza sativa Indica Group [Indian rice]
ref|XP_003562817.1|  PREDICTED: polyol transporter 5-like               393   3e-128   Brachypodium distachyon [annual false brome]
dbj|BAC83310.1|  putative sorbitol transporter                          392   3e-128   Oryza sativa Japonica Group [Japonica rice]
emb|CAR82417.1|  polyol transporter                                     385   8e-128   Plantago major [cart-track plant]
ref|XP_006657888.1|  PREDICTED: polyol transporter 5-like               391   1e-127   Oryza brachyantha
ref|XP_006297395.1|  hypothetical protein CARUB_v10013420mg             391   2e-127   Capsella rubella
ref|NP_001060108.1|  Os07g0582400                                       392   2e-127   
ref|XP_003540961.2|  PREDICTED: polyol transporter 5-like               391   3e-127   Glycine max [soybeans]
ref|XP_002460923.1|  hypothetical protein SORBIDRAFT_02g037570          390   4e-127   Sorghum bicolor [broomcorn]
ref|XP_004958137.1|  PREDICTED: polyol transporter 5-like               390   4e-127   Setaria italica
ref|XP_010254894.1|  PREDICTED: polyol transporter 5-like               389   7e-127   Nelumbo nucifera [Indian lotus]
gb|KHN25431.1|  Polyol transporter 5                                    389   7e-127   Glycine soja [wild soybean]
ref|XP_007131852.1|  hypothetical protein PHAVU_011G046800g             388   2e-126   Phaseolus vulgaris [French bean]
gb|AEX55225.1|  sugar transporter                                       388   2e-126   Allium sativum
ref|XP_008795608.1|  PREDICTED: putative polyol transporter 1           388   3e-126   Phoenix dactylifera
ref|XP_009395604.1|  PREDICTED: putative polyol transporter 1           389   3e-126   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007131748.1|  hypothetical protein PHAVU_011G038700g             387   4e-126   Phaseolus vulgaris [French bean]
emb|CAD58710.1|  polyol transporter                                     387   5e-126   Plantago major [cart-track plant]
ref|XP_004983901.1|  PREDICTED: polyol transporter 5-like isoform X1    387   9e-126   Setaria italica
ref|XP_010527594.1|  PREDICTED: polyol transporter 5-like isoform X4    385   2e-125   Tarenaya hassleriana [spider flower]
ref|XP_009396401.1|  PREDICTED: polyol transporter 5-like               384   7e-125   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010527591.1|  PREDICTED: polyol transporter 5-like isoform X1    384   8e-125   Tarenaya hassleriana [spider flower]
ref|XP_010527593.1|  PREDICTED: polyol transporter 5-like isoform X3    384   1e-124   Tarenaya hassleriana [spider flower]
ref|XP_010527592.1|  PREDICTED: polyol transporter 5-like isoform X2    384   2e-124   Tarenaya hassleriana [spider flower]
ref|NP_001045505.2|  Os01g0966900                                       380   9e-124   
ref|XP_009407903.1|  PREDICTED: polyol transporter 5-like               380   2e-123   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ85302.1|  predicted protein                                      381   2e-123   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT15230.1|  Polyol transporter 5                                    380   2e-123   
gb|EYU42629.1|  hypothetical protein MIMGU_mgv1a0059092mg               371   3e-123   Erythranthe guttata [common monkey flower]
gb|EAY88906.1|  hypothetical protein OsI_10385                          380   3e-123   Oryza sativa Indica Group [Indian rice]
gb|EEE58504.1|  hypothetical protein OsJ_09775                          379   8e-123   Oryza sativa Japonica Group [Japonica rice]
gb|EMS55536.1|  Polyol transporter 5                                    378   1e-122   Triticum urartu
gb|ABF94465.1|  Sugar transporter family protein, expressed             378   4e-122   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008795604.1|  PREDICTED: putative polyol transporter 1           377   5e-122   Phoenix dactylifera
ref|XP_010905473.1|  PREDICTED: putative polyol transporter 1           376   1e-121   
ref|XP_006856084.1|  PREDICTED: polyol transporter 5                    375   2e-121   Amborella trichopoda
ref|XP_002463086.1|  hypothetical protein SORBIDRAFT_02g037590          373   7e-121   Sorghum bicolor [broomcorn]
ref|XP_004983902.1|  PREDICTED: polyol transporter 5-like isoform X2    372   2e-120   
ref|XP_010530516.1|  PREDICTED: putative polyol transporter 1           365   9e-120   Tarenaya hassleriana [spider flower]
ref|XP_007201628.1|  hypothetical protein PRUPE_ppa021469mg             369   1e-119   
ref|XP_008795607.1|  PREDICTED: polyol transporter 5-like isoform X2    369   3e-119   Phoenix dactylifera
ref|NP_001168177.1|  uncharacterized protein LOC100381931               369   4e-119   Zea mays [maize]
ref|XP_008795606.1|  PREDICTED: polyol transporter 5-like isoform X1    369   5e-119   Phoenix dactylifera
ref|NP_001141158.1|  hypothetical protein                               367   8e-119   Zea mays [maize]
emb|CDY72601.1|  BnaAnng41630D                                          363   2e-118   Brassica napus [oilseed rape]
ref|XP_008667512.1|  PREDICTED: hypothetical protein isoform X1         368   2e-118   Zea mays [maize]
ref|XP_006649564.1|  PREDICTED: polyol transporter 5-like               368   2e-118   Oryza brachyantha
ref|XP_002460924.1|  hypothetical protein SORBIDRAFT_02g037580          366   4e-118   Sorghum bicolor [broomcorn]
ref|XP_004958138.1|  PREDICTED: polyol transporter 5-like               366   4e-118   Setaria italica
ref|XP_008466959.1|  PREDICTED: polyol transporter 5-like               357   8e-118   Cucumis melo [Oriental melon]
ref|XP_008452333.1|  PREDICTED: polyol transporter 5-like isoform X2    365   1e-117   Cucumis melo [Oriental melon]
ref|XP_006856085.2|  PREDICTED: polyol transporter 5                    364   2e-117   
emb|CDP17996.1|  unnamed protein product                                365   2e-117   Coffea canephora [robusta coffee]
gb|ERN17552.1|  hypothetical protein AMTR_s00059p00123280               364   4e-117   Amborella trichopoda
ref|XP_010442448.1|  PREDICTED: putative polyol transporter 2           364   4e-117   Camelina sativa [gold-of-pleasure]
ref|XP_008452332.1|  PREDICTED: putative polyol transporter 2 iso...    365   5e-117   Cucumis melo [Oriental melon]
ref|XP_009121227.1|  PREDICTED: putative polyol transporter 1           363   7e-117   Brassica rapa
emb|CDY24775.1|  BnaA08g15350D                                          362   1e-116   Brassica napus [oilseed rape]
ref|XP_009109331.1|  PREDICTED: probable polyol transporter 6           362   1e-116   Brassica rapa
ref|XP_004148314.2|  PREDICTED: polyol transporter 5-like               362   2e-116   Cucumis sativus [cucumbers]
ref|XP_002884156.1|  predicted protein                                  362   2e-116   Arabidopsis lyrata subsp. lyrata
emb|CDY46217.1|  BnaA07g03530D                                          362   2e-116   Brassica napus [oilseed rape]
emb|CDY46218.1|  BnaA07g03520D                                          362   2e-116   Brassica napus [oilseed rape]
emb|CDY35469.1|  BnaC03g61910D                                          362   3e-116   Brassica napus [oilseed rape]
ref|XP_010908358.1|  PREDICTED: probable polyol transporter 6           362   4e-116   
ref|XP_008465477.1|  PREDICTED: polyol transporter 5-like               361   4e-116   Cucumis melo [Oriental melon]
ref|NP_001060109.2|  Os07g0582500                                       361   4e-116   
ref|XP_009121388.1|  PREDICTED: LOW QUALITY PROTEIN: putative pol...    361   5e-116   Brassica rapa
dbj|BAC83311.1|  putative sorbitol transporter                          361   6e-116   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002886203.1|  hypothetical protein ARALYDRAFT_343514             360   1e-115   Arabidopsis lyrata subsp. lyrata
gb|EAZ04481.1|  hypothetical protein OsI_26630                          359   2e-115   Oryza sativa Indica Group [Indian rice]
ref|XP_008447047.1|  PREDICTED: polyol transporter 5-like               359   3e-115   Cucumis melo [Oriental melon]
ref|XP_006299557.1|  hypothetical protein CARUB_v10015731mg             359   3e-115   Capsella rubella
ref|XP_010435020.1|  PREDICTED: putative polyol transporter 2           359   3e-115   Camelina sativa [gold-of-pleasure]
ref|XP_004985337.1|  PREDICTED: polyol transporter 5-like isoform X1    358   5e-115   Setaria italica
ref|XP_006409469.1|  hypothetical protein EUTSA_v10023129mg             358   5e-115   Eutrema salsugineum [saltwater cress]
ref|XP_002440825.1|  hypothetical protein SORBIDRAFT_09g007450          358   7e-115   Sorghum bicolor [broomcorn]
gb|KGN56185.1|  hypothetical protein Csa_3G095020                       357   8e-115   Cucumis sativus [cucumbers]
ref|XP_008795662.1|  PREDICTED: probable polyol transporter 6           357   9e-115   
ref|NP_179210.1|  polyol/monosaccharide transporter 2                   357   2e-114   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179209.1|  polyol/monosaccharide transporter 1                   357   2e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010095276.1|  putative polyol transporter 6                      357   2e-114   Morus notabilis
ref|XP_010468639.1|  PREDICTED: putative polyol transporter 2           357   3e-114   Camelina sativa [gold-of-pleasure]
ref|XP_010495901.1|  PREDICTED: putative polyol transporter 1           357   3e-114   Camelina sativa [gold-of-pleasure]
ref|NP_001147446.1|  sorbitol transporter                               357   3e-114   Zea mays [maize]
gb|ACN26310.1|  unknown                                                 355   3e-114   Zea mays [maize]
ref|XP_010445995.1|  PREDICTED: putative polyol transporter 2           356   3e-114   Camelina sativa [gold-of-pleasure]
ref|NP_001132062.1|  proton myo-inositol cotransporter                  356   3e-114   Zea mays [maize]
ref|XP_006411974.1|  hypothetical protein EUTSA_v10024974mg             356   4e-114   Eutrema salsugineum [saltwater cress]
ref|XP_009138439.1|  PREDICTED: probable polyol transporter 6           356   4e-114   Brassica rapa
ref|XP_009142783.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    356   5e-114   Brassica rapa
ref|XP_010548339.1|  PREDICTED: probable polyol transporter 6           355   6e-114   Tarenaya hassleriana [spider flower]
ref|XP_004985338.1|  PREDICTED: polyol transporter 5-like isoform X2    355   9e-114   
gb|KJB12317.1|  hypothetical protein B456_002G011600                    354   1e-113   Gossypium raimondii
ref|XP_011650543.1|  PREDICTED: putative polyol transporter 2           355   1e-113   Cucumis sativus [cucumbers]
gb|ACG35144.1|  proton myo-inositol cotransporter                       355   2e-113   Zea mays [maize]
ref|XP_004509296.1|  PREDICTED: probable polyol transporter 3-like      353   3e-113   Cicer arietinum [garbanzo]
ref|XP_011659070.1|  PREDICTED: polyol transporter 5-like               354   4e-113   Cucumis sativus [cucumbers]
dbj|BAK00091.1|  predicted protein                                      354   5e-113   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010472919.1|  PREDICTED: putative polyol transporter 2           353   5e-113   Camelina sativa [gold-of-pleasure]
ref|XP_010472942.1|  PREDICTED: putative polyol transporter 2           353   5e-113   Camelina sativa [gold-of-pleasure]
dbj|BAJ86116.1|  predicted protein                                      353   6e-113   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008670519.1|  PREDICTED: putative polyol transporter 1           353   7e-113   
ref|XP_006285274.1|  hypothetical protein CARUB_v10006648mg             352   7e-113   Capsella rubella
gb|KHN41994.1|  Putative polyol transporter 6                           351   8e-113   Glycine soja [wild soybean]
ref|XP_010484928.1|  PREDICTED: putative polyol transporter 1           352   1e-112   Camelina sativa [gold-of-pleasure]
ref|XP_010446763.1|  PREDICTED: probable polyol transporter 6           352   2e-112   
ref|XP_006590682.1|  PREDICTED: probable polyol transporter 6-like      352   2e-112   Glycine max [soybeans]
ref|XP_010531022.1|  PREDICTED: probable polyol transporter 6           351   2e-112   Tarenaya hassleriana [spider flower]
emb|CDX72594.1|  BnaC07g46160D                                          357   2e-112   
ref|XP_010516958.1|  PREDICTED: putative polyol transporter 2           352   2e-112   
ref|XP_004148303.1|  PREDICTED: polyol transporter 5-like               351   4e-112   
gb|EMS66679.1|  Putative polyol transporter 2                           348   4e-112   
dbj|BAJ93158.1|  predicted protein                                      351   4e-112   
ref|XP_010530847.1|  PREDICTED: putative polyol transporter 1           351   4e-112   
ref|XP_008447044.1|  PREDICTED: polyol transporter 5-like               350   7e-112   
ref|XP_003558586.1|  PREDICTED: polyol transporter 5-like               350   9e-112   
ref|XP_003562818.1|  PREDICTED: polyol transporter 5-like               350   1e-111   
ref|XP_010432153.1|  PREDICTED: probable polyol transporter 6           348   2e-111   
ref|XP_007156029.1|  hypothetical protein PHAVU_003G252500g             348   3e-111   
ref|NP_195385.1|  putative polyol transporter 6                         348   4e-111   
ref|XP_002866999.1|  hypothetical protein ARALYDRAFT_490969             347   6e-111   
gb|EMT00465.1|  Putative polyol transporter 1                           348   6e-111   
ref|XP_010442571.1|  PREDICTED: putative polyol transporter 2           347   1e-110   
ref|NP_001182999.1|  uncharacterized protein LOC100501319               343   2e-110   
ref|XP_009371568.1|  PREDICTED: probable polyol transporter 6           346   3e-110   
ref|XP_003616024.1|  hypothetical protein MTR_5g075300                  345   9e-110   
gb|KHN41995.1|  Putative polyol transporter 3                           343   1e-109   
tpg|DAA63328.1|  TPA: hypothetical protein ZEAMMB73_585953              343   1e-109   
gb|KFK30287.1|  hypothetical protein AALP_AA7G242000                    345   1e-109   
ref|XP_008338123.1|  PREDICTED: probable polyol transporter 6           344   2e-109   
ref|XP_008812826.1|  PREDICTED: polyol transporter 5-like               336   2e-109   
ref|XP_008651795.1|  PREDICTED: uncharacterized protein LOC100501...    343   3e-109   
emb|CDP02097.1|  unnamed protein product                                343   3e-109   
ref|XP_006590681.1|  PREDICTED: probable polyol transporter 3-like      342   6e-109   
ref|XP_003629474.1|  hypothetical protein MTR_8g077890                  342   8e-109   
ref|XP_010444944.1|  PREDICTED: probable polyol transporter 6           347   9e-109   
ref|XP_012084471.1|  PREDICTED: probable polyol transporter 6           342   1e-108   
ref|XP_006827104.1|  PREDICTED: polyol transporter 5                    342   2e-108   
gb|ACJ85829.1|  unknown                                                 340   4e-108   
dbj|BAJ93015.1|  predicted protein                                      341   5e-108   
ref|XP_006425707.1|  hypothetical protein CICLE_v10027247mg             340   5e-108   
gb|AFK37582.1|  unknown                                                 340   5e-108   
gb|EMS61414.1|  Polyol transporter 5                                    336   8e-108   
ref|XP_004148302.1|  PREDICTED: putative polyol transporter 2           340   2e-107   
emb|CDP02044.1|  unnamed protein product                                339   2e-107   
ref|XP_010548048.1|  PREDICTED: putative polyol transporter 1           338   3e-107   
ref|XP_007156923.1|  hypothetical protein PHAVU_002G028600g             338   3e-107   
gb|AEI98623.1|  hypothetical protein 111O18.10                          338   4e-107   
ref|XP_008447045.1|  PREDICTED: polyol transporter 5-like               338   4e-107   
emb|CDP18000.1|  unnamed protein product                                337   1e-106   
ref|XP_010497333.1|  PREDICTED: putative polyol transporter 1           330   2e-106   
emb|CAJ29288.1|  putative polyol transporter 1                          335   2e-106   
ref|XP_008241649.1|  PREDICTED: probable polyol transporter 6           336   2e-106   
ref|XP_008338588.1|  PREDICTED: probable polyol transporter 6           335   3e-106   
gb|ACN35873.1|  unknown                                                 332   9e-106   
gb|KJB40206.1|  hypothetical protein B456_007G051000                    334   1e-105   
ref|XP_010229631.1|  PREDICTED: putative polyol transporter 1           335   1e-105   
ref|XP_004958139.1|  PREDICTED: putative polyol transporter 1-like      334   1e-105   
ref|XP_009356716.1|  PREDICTED: probable polyol transporter 6           334   1e-105   
ref|NP_001049270.1|  Os03g0197200                                       326   2e-105   
ref|XP_009627595.1|  PREDICTED: probable polyol transporter 6           333   3e-105   
ref|XP_007046983.1|  Major facilitator superfamily protein              333   5e-105   
ref|XP_010530848.1|  PREDICTED: LOW QUALITY PROTEIN: putative pol...    332   8e-105   
ref|XP_008447046.1|  PREDICTED: polyol transporter 5-like               332   1e-104   
ref|XP_008440694.1|  PREDICTED: probable polyol transporter 6           330   2e-104   
ref|XP_009799010.1|  PREDICTED: probable polyol transporter 6           330   3e-104   
gb|ERM94340.1|  hypothetical protein AMTR_s00010p00243630               330   3e-104   
gb|EAY77363.1|  hypothetical protein OsI_05348                          329   3e-104   
ref|XP_002531429.1|  sugar transporter, putative                        330   3e-104   
ref|XP_006827103.2|  PREDICTED: polyol transporter 5                    330   4e-104   
ref|XP_007203922.1|  hypothetical protein PRUPE_ppa017052mg             330   5e-104   
ref|XP_011025750.1|  PREDICTED: probable polyol transporter 3           330   5e-104   
gb|KHN00554.1|  Putative polyol transporter 3                           328   2e-103   
gb|KHN44499.1|  Putative polyol transporter 3                           326   5e-103   
ref|XP_008447048.1|  PREDICTED: LOW QUALITY PROTEIN: putative pol...    327   7e-103   
ref|XP_003548895.1|  PREDICTED: probable polyol transporter 3-like      326   1e-102   
ref|XP_002310213.2|  mannitol transporter family protein                326   2e-102   
ref|XP_011659069.1|  PREDICTED: putative polyol transporter 1 iso...    325   2e-102   
ref|XP_004148313.1|  PREDICTED: putative polyol transporter 1 iso...    325   3e-102   
ref|NP_001049269.1|  Os03g0197100                                       325   5e-102   
ref|XP_002267872.1|  PREDICTED: probable polyol transporter 6 iso...    324   8e-102   
emb|CDP17999.1|  unnamed protein product                                324   9e-102   
gb|KCW58602.1|  hypothetical protein EUGRSUZ_H01261                     322   1e-101   
ref|XP_006658740.1|  PREDICTED: polyol transporter 5-like               323   3e-101   
gb|EMS52712.1|  Putative polyol transporter 2                           323   3e-101   
ref|XP_010070046.1|  PREDICTED: probable polyol transporter 6           323   3e-101   
ref|XP_011658491.1|  PREDICTED: probable polyol transporter 6           322   6e-101   
ref|XP_007156922.1|  hypothetical protein PHAVU_002G028500g             320   2e-100   
emb|CDX75588.1|  BnaA01g01140D                                          319   4e-100   
ref|XP_006363185.1|  PREDICTED: probable polyol transporter 6-like      319   5e-100   
ref|XP_006649563.1|  PREDICTED: polyol transporter 5-like               320   6e-100   
gb|KCW58603.1|  hypothetical protein EUGRSUZ_H01262                     317   1e-99    
ref|XP_010317209.1|  PREDICTED: probable polyol transporter 6 iso...    317   1e-99    
ref|XP_010317207.1|  PREDICTED: probable polyol transporter 6 iso...    317   1e-99    
ref|XP_004233513.1|  PREDICTED: probable polyol transporter 6 iso...    318   2e-99    
gb|EYU40145.1|  hypothetical protein MIMGU_mgv1a004984mg                318   2e-99    
ref|XP_004980363.1|  PREDICTED: polyol transporter 5-like               318   2e-99    
ref|NP_001289849.1|  probable polyol transporter 6                      318   2e-99    
emb|CDY67098.1|  BnaCnng53530D                                          317   4e-99    
ref|XP_010026167.1|  PREDICTED: probable polyol transporter 6           317   5e-99    
ref|XP_010531021.1|  PREDICTED: probable polyol transporter 3           317   7e-99    
ref|XP_009411236.1|  PREDICTED: probable polyol transporter 6           315   7e-99    
ref|XP_004985339.1|  PREDICTED: polyol transporter 5-like               317   1e-98    
dbj|BAO96231.1|  polyol/monosaccharide Transporter 8                    315   2e-98    
gb|ACF83985.1|  unknown                                                 314   2e-98    
ref|XP_004148315.2|  PREDICTED: polyol transporter 5-like               315   2e-98    
tpg|DAA43975.1|  TPA: polyol transporter protein 4                      315   3e-98    
gb|ACG47895.1|  polyol transporter protein 4                            315   3e-98    
gb|ACL53204.1|  unknown                                                 312   3e-98    
ref|NP_001142160.1|  hypothetical protein                               315   4e-98    
ref|XP_008668471.1|  PREDICTED: hypothetical protein isoform X1         315   6e-98    
dbj|BAJ86526.1|  predicted protein                                      315   7e-98    
ref|XP_006409145.1|  hypothetical protein EUTSA_v10022657mg             314   7e-98    
gb|ACJ85869.1|  unknown                                                 311   1e-97    
ref|NP_001151390.1|  carbohydrate transporter/ sugar porter             314   1e-97    
ref|XP_008679503.1|  PREDICTED: carbohydrate transporter/ sugar p...    313   1e-97    
dbj|BAK07233.1|  predicted protein                                      313   2e-97    
ref|XP_002468337.1|  hypothetical protein SORBIDRAFT_01g044010          313   2e-97    
ref|NP_001150711.1|  LOC100284344                                       313   4e-97    
ref|XP_009112494.1|  PREDICTED: probable polyol transporter 3           312   4e-97    
ref|XP_006346943.1|  PREDICTED: probable polyol transporter 6-like      311   8e-97    
ref|XP_002886176.1|  predicted protein                                  311   1e-96    
ref|XP_008447302.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...    310   4e-96    
gb|KFK40217.1|  hypothetical protein AALP_AA3G345800                    308   6e-96    
ref|XP_010489553.1|  PREDICTED: probable polyol transporter 3           309   8e-96    
ref|XP_011100123.1|  PREDICTED: uncharacterized protein LOC105178355    321   8e-96    
ref|XP_009396729.1|  PREDICTED: probable polyol transporter 6           307   9e-96    
ref|NP_179438.1|  putative polyol transporter 3                         308   2e-95    
ref|XP_010467666.1|  PREDICTED: probable polyol transporter 3           308   2e-95    
emb|CDY66868.1|  BnaUnng01720D                                          307   2e-95    
ref|XP_010414363.1|  PREDICTED: probable polyol transporter 3           307   2e-95    
ref|XP_003558585.1|  PREDICTED: putative polyol transporter 1           307   7e-95    
ref|XP_004301902.2|  PREDICTED: probable polyol transporter 6           306   1e-94    
ref|XP_004983249.1|  PREDICTED: probable polyol transporter 3-like      304   7e-94    
ref|NP_001064429.1|  Os10g0360100                                       303   7e-94    
ref|XP_006297471.1|  hypothetical protein CARUB_v10013492mg             303   1e-93    
gb|KFK40045.1|  hypothetical protein AALP_AA3G322700                    303   1e-93    
gb|AAK13147.1|AC083945_22  Putative sugar transporter                   303   5e-93    
gb|ACL01287.1|  sorbitol transporter                                    293   1e-92    
ref|XP_004233968.1|  PREDICTED: probable polyol transporter 6           300   2e-92    
ref|XP_004233514.1|  PREDICTED: probable polyol transporter 6           300   2e-92    
gb|AFK46229.1|  unknown                                                 299   5e-92    
dbj|BAJ98962.1|  predicted protein                                      290   2e-91    
ref|XP_006346993.1|  PREDICTED: probable polyol transporter 6-like      296   3e-91    
gb|KHN41999.1|  Putative polyol transporter 6                           295   5e-91    
ref|XP_007216663.1|  hypothetical protein PRUPE_ppb017057mg             290   5e-91    
ref|XP_002439891.1|  hypothetical protein SORBIDRAFT_09g022100          296   8e-91    
gb|AAL38359.1|  sugar transporter protein                               286   2e-90    
ref|XP_003538845.1|  PREDICTED: probable polyol transporter 3-like      295   2e-90    
gb|KHN41996.1|  Putative polyol transporter 6                           292   5e-90    
ref|XP_003538847.1|  PREDICTED: probable polyol transporter 3-like      293   1e-89    
emb|CAJ29290.2|  putative polyol transporter protein 3                  292   2e-89    
gb|KHN41998.1|  Putative polyol transporter 6                           290   4e-89    
ref|XP_004983248.1|  PREDICTED: probable polyol transporter 3-like      291   4e-89    
ref|XP_003561393.1|  PREDICTED: probable polyol transporter 6           290   1e-88    
ref|XP_010244297.1|  PREDICTED: putative polyol transporter 1           286   4e-87    
ref|XP_007013176.1|  Polyol/monosaccharide transporter 5 isoform 3      280   3e-86    
ref|XP_004512223.1|  PREDICTED: probable polyol transporter 3-like      283   5e-86    
ref|XP_010068000.1|  PREDICTED: polyol transporter 5-like               284   6e-86    
ref|XP_004512978.1|  PREDICTED: polyol transporter 5-like               282   9e-86    
gb|EPS67834.1|  hypothetical protein M569_06938                         282   9e-86    
ref|XP_012076685.1|  PREDICTED: polyol transporter 5-like               282   1e-85    
emb|CDY70259.1|  BnaCnng67460D                                          272   4e-85    
ref|XP_007013174.1|  Polyol/monosaccharide transporter 5 isoform 1      281   5e-85    
gb|EAZ15802.1|  hypothetical protein OsJ_31220                          280   7e-85    
ref|XP_004976318.1|  PREDICTED: probable polyol transporter 4-lik...    280   1e-84    
gb|KCW62671.1|  hypothetical protein EUGRSUZ_G00231                     278   1e-84    
ref|XP_012076686.1|  PREDICTED: polyol transporter 5-like               280   1e-84    
ref|XP_004976317.1|  PREDICTED: probable polyol transporter 4-lik...    280   2e-84    
ref|XP_009398416.1|  PREDICTED: probable polyol transporter 4           280   2e-84    
ref|XP_002514303.1|  sugar transporter, putative                        279   3e-84    
ref|NP_001068332.1|  Os11g0637200                                       277   4e-84    
ref|XP_010680814.1|  PREDICTED: probable polyol transporter 3           278   4e-84    
gb|KCW55336.1|  hypothetical protein EUGRSUZ_I01255                     276   5e-84    
ref|XP_006451145.1|  hypothetical protein CICLE_v10008031mg             278   5e-84    
ref|XP_009374073.1|  PREDICTED: probable polyol transporter 6           278   6e-84    
ref|XP_011458734.1|  PREDICTED: probable polyol transporter 6           279   6e-84    
ref|XP_004979794.1|  PREDICTED: polyol transporter 5-like               277   8e-84    
ref|XP_008778282.1|  PREDICTED: probable polyol transporter 4           278   2e-83    
ref|XP_006475614.1|  PREDICTED: polyol transporter 5-like isoform X1    277   2e-83    
gb|KCW55335.1|  hypothetical protein EUGRSUZ_I01255                     275   2e-83    
ref|XP_004979804.1|  PREDICTED: polyol transporter 5-like               275   4e-83    
ref|XP_008805626.1|  PREDICTED: probable polyol transporter 4           275   6e-83    
gb|ERM98564.1|  hypothetical protein AMTR_s00109p00027810               273   8e-83    
ref|XP_007203309.1|  hypothetical protein PRUPE_ppa025908mg             274   8e-83    
ref|XP_007160334.1|  hypothetical protein PHAVU_002G312900g             274   8e-83    
gb|EMT28181.1|  Putative polyol transporter 4                           275   9e-83    
ref|XP_006663617.1|  PREDICTED: polyol transporter 5-like               272   1e-82    
ref|XP_003533389.1|  PREDICTED: polyol transporter 5-like               275   2e-82    
gb|EMS52332.1|  putative polyol transporter 4                           275   2e-82    
ref|XP_011096257.1|  PREDICTED: probable polyol transporter 4           275   2e-82    
ref|XP_010935630.1|  PREDICTED: probable polyol transporter 4           275   2e-82    
ref|XP_003611968.1|  hypothetical protein MTR_5g019870                  273   2e-82    
ref|XP_007013178.1|  Polyol/monosaccharide transporter 5 isoform 2      269   2e-82    
ref|XP_009371465.1|  PREDICTED: polyol transporter 5-like               273   2e-82    
ref|XP_003618299.1|  Mannitol transporter                               274   3e-82    
gb|EMT00773.1|  Polyol transporter 5                                    272   5e-82    
dbj|BAJ92224.1|  predicted protein                                      271   6e-82    
gb|KHN41997.1|  Putative polyol transporter 6                           271   7e-82    
ref|XP_011458741.1|  PREDICTED: polyol transporter 5-like               272   7e-82    
ref|XP_003529995.1|  PREDICTED: polyol transporter 5-like               273   7e-82    
gb|KHN36112.1|  Putative polyol transporter 6                           271   1e-81    
ref|XP_007156919.1|  hypothetical protein PHAVU_002G028200g             272   1e-81    
ref|XP_006833286.2|  PREDICTED: polyol transporter 5                    272   2e-81    
ref|XP_002514302.1|  sugar transporter, putative                        272   2e-81    
ref|XP_006475613.1|  PREDICTED: polyol transporter 5-like               272   2e-81    
gb|KDO50887.1|  hypothetical protein CISIN_1g009185mg                   272   3e-81    
ref|XP_010099586.1|  Polyol transporter 5                               271   3e-81    
ref|XP_008386449.1|  PREDICTED: polyol transporter 5-like               271   3e-81    
ref|XP_006451144.1|  hypothetical protein CICLE_v10007938mg             272   3e-81    
ref|XP_008677945.1|  PREDICTED: polyol transporter 5-like               270   3e-81    
ref|XP_002451169.1|  hypothetical protein SORBIDRAFT_05g025280          270   4e-81    
ref|XP_011045507.1|  PREDICTED: probable polyol transporter 4           271   4e-81    
dbj|BAJ95805.1|  predicted protein                                      271   5e-81    
ref|XP_011015401.1|  PREDICTED: probable polyol transporter 4           271   5e-81    
ref|XP_003539908.1|  PREDICTED: probable polyol transporter 4-like      271   6e-81    
gb|KJB77296.1|  hypothetical protein B456_012G130400                    270   7e-81    
ref|XP_007149864.1|  hypothetical protein PHAVU_005G105000g             270   8e-81    
ref|XP_007013177.1|  Polyol/monosaccharide transporter 5 isoform 1      270   1e-80    
ref|XP_010688202.1|  PREDICTED: polyol transporter 5-like               269   1e-80    
ref|XP_002280978.1|  PREDICTED: polyol transporter 5                    269   1e-80    
ref|XP_004514460.1|  PREDICTED: probable polyol transporter 4-like      270   2e-80    
ref|XP_008242649.1|  PREDICTED: probable polyol transporter 6           270   2e-80    
ref|XP_007203539.1|  hypothetical protein PRUPE_ppa1027213mg            270   2e-80    
ref|XP_011460253.1|  PREDICTED: probable polyol transporter 4           269   2e-80    
ref|XP_003580190.1|  PREDICTED: probable polyol transporter 4           269   2e-80    
ref|XP_003543341.2|  PREDICTED: probable polyol transporter 4-like      270   3e-80    
gb|KHN36625.1|  Putative polyol transporter 4                           269   3e-80    
ref|XP_003620669.1|  Myo-inositol transporter                           268   4e-80    



>ref|XP_009611551.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=539

 Score =   493 bits (1268),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 243/328 (74%), Positives = 271/328 (83%), Gaps = 9/328 (3%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             VSVLAMPESPRWLVMQGRLGDARRVL KTSDS EEA +RLADIKEAAGIPEHC+D++V V
Sbjct  210   VSVLAMPESPRWLVMQGRLGDARRVLNKTSDSLEEAQLRLADIKEAAGIPEHCNDDIVEV  269

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               KR   D+VWREL  SPTPAV HIL+TGVGIH FQQASGIDAVVLY PRIFEKAGIKSD
Sbjct  270   -PKRPKGDNVWRELIFSPTPAVRHILLTGVGIHFFQQASGIDAVVLYSPRIFEKAGIKSD  328

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
              DKLL T+A+GF KT+FILVATF LDK GRRPLLLTSV GMV +L LL   LT+ID S +
Sbjct  329   HDKLLATVAVGFVKTIFILVATFMLDKSGRRPLLLTSVAGMVLSLMLLATGLTIIDQSEQ  388

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KV WA+A++I M LAYVA FSIG GPITWVYSSEIFPL+LRATGCS+G  +NRVTSGVVS
Sbjct  389   KVVWAIALSITMVLAYVALFSIGMGPITWVYSSEIFPLRLRATGCSIGVAVNRVTSGVVS  448

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SL KAI+IGG+FFLYA +AAV +VFFFTLMPETQGKTLEE EALFGTF+ WR   R
Sbjct  449   MTFLSLEKAITIGGAFFLYAGLAAVAFVFFFTLMPETQGKTLEEMEALFGTFWNWRKTAR  508

Query  387   EVD--------AKKANNNSQLQMGTLQA  328
             E+          K +N+N Q+QMG   A
Sbjct  509   ELKEAKITEKTEKNSNDNGQIQMGIAPA  536



>ref|XP_009596634.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=526

 Score =   488 bits (1257),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 235/320 (73%), Positives = 271/320 (85%), Gaps = 1/320 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             +SVLAMPESPRWLVMQGRL +AR VL KTS+SPEEA +RL++IKEAAGIPE C+D+VV V
Sbjct  205   ISVLAMPESPRWLVMQGRLSEARTVLKKTSESPEEADLRLSEIKEAAGIPECCNDDVVEV  264

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               KR   DSVWRELFISPTPA+ HI++TG+GIH FQQASGID+VVLY P IFEKAGIKSD
Sbjct  265   -PKRPKGDSVWRELFISPTPAIKHIVLTGLGIHFFQQASGIDSVVLYSPTIFEKAGIKSD  323

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             TD+LL T+A+G  KT+F+LVATF LD+ GRRPLLLTSVGGMV +L  L + LTVIDHS  
Sbjct  324   TDRLLATVAVGIIKTIFVLVATFLLDRVGRRPLLLTSVGGMVMSLIFLSIGLTVIDHSDG  383

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
              V WA+A+ I M LAYVA FSIGAGPITWVYSSEIFPL+LRATGCSL   +NRVTSGVVS
Sbjct  384   TVFWAIALCITMVLAYVALFSIGAGPITWVYSSEIFPLRLRATGCSLAVALNRVTSGVVS  443

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SL KAI+IGG+FF YA +A + WVFFFTLMPETQGKTLEETE LFGTFF+WR   R
Sbjct  444   MTFLSLEKAITIGGAFFFYAGLAGLAWVFFFTLMPETQGKTLEETEELFGTFFKWRLTLR  503

Query  387   EVDAKKANNNSQLQMGTLQA  328
             E+ AK+ NNN+Q+QM T+ A
Sbjct  504   ELKAKEKNNNAQIQMATVPA  523



>ref|XP_009766648.1| PREDICTED: polyol transporter 5-like [Nicotiana sylvestris]
Length=526

 Score =   487 bits (1253),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 234/320 (73%), Positives = 269/320 (84%), Gaps = 1/320 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             +SVLAMPESPRWLVMQGRL +AR VL K S+SPEEA +RL++IKEAAGIPE C+D+VV V
Sbjct  205   ISVLAMPESPRWLVMQGRLSEARTVLKKISESPEEADLRLSEIKEAAGIPECCNDDVVEV  264

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               KR   DSVWRELF+SPTPA+ HIL+TG+GIH FQQASGID+VVLY P IFEKAGIKSD
Sbjct  265   -PKRPKGDSVWRELFVSPTPAIKHILLTGLGIHFFQQASGIDSVVLYSPTIFEKAGIKSD  323

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             TD+LL T+A+G  KT+FILVATF LD+ GRRPLLLTSVGGMV +L  L + LTVIDHS  
Sbjct  324   TDRLLATVAVGIIKTIFILVATFLLDRVGRRPLLLTSVGGMVMSLIFLSIGLTVIDHSDG  383

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
              V WA+A+ I M L YVA FSIGAGPITWVYSSEIFPL+LRATGC L   +NRVTSGVVS
Sbjct  384   TVFWAIALCITMVLVYVALFSIGAGPITWVYSSEIFPLRLRATGCGLAVALNRVTSGVVS  443

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SL KAI+IGG+FFLYA +A + WVFFFTLMPETQGKTLEETE LFG FF+WRS  R
Sbjct  444   MTFLSLEKAITIGGAFFLYAGLAGLAWVFFFTLMPETQGKTLEETEELFGNFFKWRSTLR  503

Query  387   EVDAKKANNNSQLQMGTLQA  328
             E+ AK+ NNN+Q+QM T+ A
Sbjct  504   ELQAKEENNNAQIQMATVPA  523



>ref|XP_009800568.1| PREDICTED: polyol transporter 5-like [Nicotiana sylvestris]
Length=534

 Score =   482 bits (1241),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 240/325 (74%), Positives = 270/325 (83%), Gaps = 6/325 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             VSVLAMPESPRWLVMQGRLGDARRVL KTSDS EEA +RLADIK AAGIPEHC+D++V V
Sbjct  208   VSVLAMPESPRWLVMQGRLGDARRVLNKTSDSLEEAQLRLADIKAAAGIPEHCNDDIVEV  267

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               KR   D+VWREL  SPTPAV HIL+TGVGIH FQQASGIDAVVLY PRIFEKAGIKSD
Sbjct  268   -PKRPKGDNVWRELIFSPTPAVRHILLTGVGIHFFQQASGIDAVVLYSPRIFEKAGIKSD  326

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
              DKLL T+A+GF KT+FILVATF LDK GRRPLLLTSV GMV +L LL   LT+ID S +
Sbjct  327   HDKLLATVAVGFVKTIFILVATFMLDKSGRRPLLLTSVAGMVLSLLLLATGLTIIDQSEQ  386

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KV WA+A++I M LAYVA FSIG GPITWVYSSEIFPL+LRATGCS+G  +NRVTSGVVS
Sbjct  387   KVVWAIALSITMVLAYVALFSIGMGPITWVYSSEIFPLRLRATGCSIGVAVNRVTSGVVS  446

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SL K+I+IGG+FFLY  +AAV +VFFFTLMPETQGKTLEE EALFG+F+ WR   R
Sbjct  447   MTFLSLVKSITIGGAFFLYFGLAAVAFVFFFTLMPETQGKTLEEMEALFGSFWDWRKTAR  506

Query  387   E-----VDAKKANNNSQLQMGTLQA  328
             E     +  K +N+N Q+QMGT  A
Sbjct  507   ELKEAKITEKNSNDNGQIQMGTAPA  531



>ref|XP_006365518.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=566

 Score =   474 bits (1219),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 238/327 (73%), Positives = 274/327 (84%), Gaps = 6/327 (2%)
 Frame = -3

Query  1290  GVSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVT  1111
              VSVLAMPESPRWLVMQGRLGDARRVL KTSDS +EA +RLADIK+AAGIPE+C+D++V 
Sbjct  226   AVSVLAMPESPRWLVMQGRLGDARRVLNKTSDSLQEAQLRLADIKQAAGIPENCNDDIVE  285

Query  1110  VTKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
             V  KR + D+VW+EL  SPTPA+ HILITGVGIH FQQASGIDAVVLY P+IFEKAGIKS
Sbjct  286   V-PKRANGDNVWKELIFSPTPAIRHILITGVGIHFFQQASGIDAVVLYSPKIFEKAGIKS  344

Query  930   DTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH  751
             D D+LLCT+A+G  KT+FILVATF LD+ GRRPLLLTSVGGMV +L LL   LT+IDHS 
Sbjct  345   DHDRLLCTVAVGVVKTLFILVATFMLDRSGRRPLLLTSVGGMVASLVLLATGLTIIDHSE  404

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             +K+ WA+A+ I+M LAYVA FSIG GPITWVYSSEIFPL LRATGCS+G  +NRVTSGVV
Sbjct  405   QKLVWAIALCISMVLAYVALFSIGMGPITWVYSSEIFPLTLRATGCSIGVAVNRVTSGVV  464

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
             SMTF+SL KAI+IG +FFLYAA+AAV WVFF+TLMPETQGKTLEE E LFGTF+ WR R 
Sbjct  465   SMTFLSLQKAITIGAAFFLYAALAAVAWVFFYTLMPETQGKTLEEMETLFGTFWNWRERG  524

Query  390   REVD-----AKKANNNSQLQMGTLQAA  325
             RE+       K +N+N Q+QMGT   A
Sbjct  525   RELKELKKTEKNSNDNGQIQMGTNNPA  551



>ref|XP_011092774.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=519

 Score =   466 bits (1199),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 221/317 (70%), Positives = 265/317 (84%), Gaps = 1/317 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLG+A+RVL +TSDS EE+ +RL+DIKEAAGIPE+CDD++V+V
Sbjct  198   LGVLAMPESPRWLVMQGRLGEAKRVLDRTSDSLEESKLRLSDIKEAAGIPENCDDDIVSV  257

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +K+   +  VWR+L   PTPAV HIL+  VGIH FQQASGID+VVLY P IFEKAGI +D
Sbjct  258   SKQPHGQ-GVWRDLLFRPTPAVRHILMCAVGIHFFQQASGIDSVVLYSPEIFEKAGITND  316

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             TDKLL T+A+GFTKT+FILVATF LDK GRRPLLL+SV GM+ +L  LG+ LT+I+H+ +
Sbjct  317   TDKLLATMAVGFTKTLFILVATFLLDKIGRRPLLLSSVAGMILSLVGLGIGLTIIEHADQ  376

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WAVA+ IA  L+YVA FSIG GPITWVYSSEIFPL+LRA GCS+G   NRVTSG++S
Sbjct  377   KLIWAVALCIATVLSYVAFFSIGMGPITWVYSSEIFPLRLRAQGCSMGVAANRVTSGMIS  436

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFISLYKAISIGG+FFLYA IAA+ WVFF+TL PETQGKTLEE E  FGTFF+WRS  R
Sbjct  437   MTFISLYKAISIGGAFFLYAGIAAIAWVFFYTLYPETQGKTLEEMETFFGTFFKWRSTMR  496

Query  387   EVDAKKANNNSQLQMGT  337
              ++ KK  +N QLQ+ T
Sbjct  497   ALEEKKGESNGQLQLTT  513



>ref|XP_002313809.1| putative sorbitol transporter family protein [Populus trichocarpa]
 gb|EEE87764.1| putative sorbitol transporter family protein [Populus trichocarpa]
Length=533

 Score =   464 bits (1195),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 223/318 (70%), Positives = 263/318 (83%), Gaps = 4/318 (1%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VL MPESPRWLVMQGRLG+AR+VL KTSDS EE+  RL+DIKEAAGIP+ C+D++V V K
Sbjct  213   VLGMPESPRWLVMQGRLGEARKVLDKTSDSKEESQQRLSDIKEAAGIPQDCNDDIVHVQK  272

Query  1101  KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTD  922
             +   E  VW+EL I PTPAV HILI G+GIH FQQASGIDAVVLY PRIFEKAGI S  D
Sbjct  273   QSHGE-GVWKELLIYPTPAVRHILICGIGIHFFQQASGIDAVVLYSPRIFEKAGITSSND  331

Query  921   KLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKV  742
             KLL T+A+GFTKTVFILVATF LD+ GRRPLLL+SVGGMV +LA LG  LT+IDHS EK+
Sbjct  332   KLLATVAVGFTKTVFILVATFLLDRIGRRPLLLSSVGGMVLSLATLGFGLTMIDHSDEKL  391

Query  741   PWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMT  562
             PWAVA++IAM LAYV+ FSIG GPITWVYSSEIFPLKLRA G S+G  +NRVTSGV+S T
Sbjct  392   PWAVALSIAMVLAYVSFFSIGMGPITWVYSSEIFPLKLRAQGTSMGVAVNRVTSGVISTT  451

Query  561   FISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV  382
             FI LYKAI+IGGSFFL+A +AAVGW+FF+  +PET+G+TLE+ E LFG+FF+WRS  ++ 
Sbjct  452   FILLYKAITIGGSFFLFAGVAAVGWLFFYACLPETRGRTLEDMEVLFGSFFKWRSALKDE  511

Query  381   DAKKAN---NNSQLQMGT  337
               K+ +   N  Q+QMGT
Sbjct  512   QRKEVSSGENGGQIQMGT  529



>ref|XP_011088358.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=532

 Score =   464 bits (1193),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 219/323 (68%), Positives = 266/323 (82%), Gaps = 1/323 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             ++VLAMPESPRWLVMQGRLG+AR VL KTSDSPEE+ +RLA+IKEAAGIPEHC+D++V V
Sbjct  206   IAVLAMPESPRWLVMQGRLGEARTVLDKTSDSPEESKLRLAEIKEAAGIPEHCNDDIVAV  265

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+   E  VWREL + PTPAV HIL+  VGIH FQQASGID+VVLY P IF++AGI  D
Sbjct  266   PKQHHGE-GVWRELLLRPTPAVRHILMCAVGIHFFQQASGIDSVVLYSPEIFKRAGITKD  324

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             T++LL T+A+GFTKTVFILVATF LDK GRRPLLL+SVGGMV +L  LG+ LT++++S  
Sbjct  325   TEQLLATMAVGFTKTVFILVATFLLDKIGRRPLLLSSVGGMVASLVGLGLGLTIVENSDH  384

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WA+A+ I+  L++VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+S
Sbjct  385   KMVWAIALCISTVLSFVAFFSIGMGPITWVYSSEIFPLRLRAQGCSMGVAMNRVTSGVIS  444

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFISLY AISIGG FFLYA IAAV WVFF+T +PETQGKTLEE E LFGTF++WRS  R
Sbjct  445   MTFISLYNAISIGGVFFLYAGIAAVAWVFFYTFLPETQGKTLEEMETLFGTFYKWRSTLR  504

Query  387   EVDAKKANNNSQLQMGTLQAANK  319
              ++ KK   + Q+QM    +++K
Sbjct  505   ALNEKKREGDRQVQMRNATSSSK  527



>ref|XP_002519083.1| sugar transporter, putative [Ricinus communis]
 gb|EEF43294.1| sugar transporter, putative [Ricinus communis]
Length=539

 Score =   463 bits (1192),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 222/321 (69%), Positives = 262/321 (82%), Gaps = 5/321 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLV+QGRLGDA+RVL +TSDS EE+  RLADIK+AAGIP+ C+D+VV V
Sbjct  209   VIVLAMPESPRWLVLQGRLGDAKRVLDRTSDSMEESQARLADIKQAAGIPQDCNDDVVQV  268

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              ++   E  VWREL ++PTP+V HIL+  +GIH FQQASGIDAVVLY PRIFEKAGI+SD
Sbjct  269   QRQSHGE-GVWRELLLNPTPSVRHILVCAIGIHFFQQASGIDAVVLYSPRIFEKAGIRSD  327

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
              DKLL T+A+GF KT+FILVATF LD+ GRRPLLL+SV GM+ +LA LG SLTVIDHSHE
Sbjct  328   NDKLLATVAVGFVKTIFILVATFLLDRIGRRPLLLSSVAGMIFSLATLGFSLTVIDHSHE  387

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WAVA+ IAM LAYVA FSIG GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+S
Sbjct  388   KLTWAVALCIAMILAYVAFFSIGMGPITWVYSSEIFPLRLRAQGASMGVAVNRVTSGVIS  447

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
              TFISLYK I+IGG+FFL+AAIA+V W FFFT +PETQG+TLE+ E LFG F +WRS  +
Sbjct  448   TTFISLYKGITIGGAFFLFAAIASVAWTFFFTCLPETQGRTLEDMEVLFGHFIKWRSAAK  507

Query  387   EVDAKKA----NNNSQLQMGT  337
             +    KA      N Q+QMGT
Sbjct  508   DEKLNKAEFHGETNGQIQMGT  528



>emb|CDO97075.1| unnamed protein product [Coffea canephora]
Length=529

 Score =   461 bits (1186),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 222/323 (69%), Positives = 266/323 (82%), Gaps = 3/323 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLG+A+ VL KTSDS EEA +RL+DIKEAAGIPEHC+D+VV V
Sbjct  209   LGVLAMPESPRWLVMQGRLGEAKGVLDKTSDSLEEAQLRLSDIKEAAGIPEHCNDDVVAV  268

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +K    E  VWR+L + PTP+VLHIL+ G GIH FQQ+SGIDAVVLY PRIFEKAGI  D
Sbjct  269   SKNSHGE-GVWRDLLVHPTPSVLHILLAGAGIHFFQQSSGIDAVVLYSPRIFEKAGITKD  327

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             TDKLL T+A+GFTKT+FILVATF LDK GRRPLLL+SV GM+ +LALLG+ LT++DHS  
Sbjct  328   TDKLLATMAVGFTKTLFILVATFFLDKVGRRPLLLSSVAGMIGSLALLGVGLTIVDHSEH  387

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WAVA  + M LAYV+ FSIG GPITWVYSSEIFPL+LRA GCS+G   NRVTSGV+S
Sbjct  388   KMVWAVAWCLIMVLAYVSFFSIGLGPITWVYSSEIFPLRLRAQGCSIGVAANRVTSGVIS  447

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SL KAI+ GG+FFL+A IA+V + FF+TL+PET+G+TLEE E LFGTFF+WR++ R
Sbjct  448   MTFLSLSKAITTGGAFFLFAGIASVAFAFFYTLLPETRGRTLEEMEELFGTFFQWRTKMR  507

Query  387   EVDAKKANNNSQLQMGTLQAANK  319
             E++ +K     QLQMGT   A K
Sbjct  508   ELEKQK--TGQQLQMGTTATAAK  528



>gb|ABK29439.1| sugar transport protein [Coffea canephora]
Length=529

 Score =   461 bits (1186),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 222/323 (69%), Positives = 266/323 (82%), Gaps = 3/323 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLG+A+ VL KTSDS EEA +RL+DIKEAAGIPEHC+D+VV V
Sbjct  209   LGVLAMPESPRWLVMQGRLGEAKGVLDKTSDSLEEAQLRLSDIKEAAGIPEHCNDDVVAV  268

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +KK   E  VWR+L + PTP+VLHIL+ G GIH FQQ+SGIDAVVLY PRIFEKAGI  D
Sbjct  269   SKKSHGE-GVWRDLLVHPTPSVLHILLAGAGIHFFQQSSGIDAVVLYSPRIFEKAGITKD  327

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             TDKLL T+A+GFTKT+FILVATF LDK GRRPLLL+SV GM+ +LALLG+ LT++DHS  
Sbjct  328   TDKLLATMAVGFTKTLFILVATFFLDKVGRRPLLLSSVAGMIGSLALLGVGLTIVDHSEH  387

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WAVA  + M LAYV+ FSIG GPITWVYSSEIFPL+LRA GCS+G   NRVTSGV+S
Sbjct  388   KMVWAVAWCLIMVLAYVSFFSIGLGPITWVYSSEIFPLRLRAQGCSIGVAANRVTSGVIS  447

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SL KAI+ GG+FFL+A IA+V + FF+TL+PET+G+TLEE E LFGTFF+WR++ R
Sbjct  448   MTFLSLSKAITTGGAFFLFAGIASVAFAFFYTLLPETRGRTLEEMEELFGTFFQWRTKMR  507

Query  387   EVDAKKANNNSQLQMGTLQAANK  319
             E++ +K     QLQMGT     K
Sbjct  508   ELEKQK--TGQQLQMGTTATVAK  528



>gb|AFI61955.1| polyol transporter [Camellia sinensis]
Length=532

 Score =   460 bits (1184),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 221/322 (69%), Positives = 262/322 (81%), Gaps = 6/322 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLV+QGRLGDA+RVL KTSDS EEA +RLADIKEAAGIPE C+D+ V V
Sbjct  208   LGVLAMPESPRWLVLQGRLGDAKRVLDKTSDSKEEAQLRLADIKEAAGIPEECNDDAVPV  267

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               KR     VW+EL + PTP VLHILI GVGIH FQQASGIDAVVLY P+IFEKAGI S 
Sbjct  268   -PKRSHGGGVWKELVLHPTPTVLHILIAGVGIHFFQQASGIDAVVLYSPKIFEKAGITSK  326

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             +DKLL T+A+GFTKT+FILVATF LD+ GRRPLLL+SVGGM+ +LA L +SLT+IDHS +
Sbjct  327   SDKLLATVAVGFTKTIFILVATFLLDRVGRRPLLLSSVGGMILSLAGLAVSLTIIDHSEK  386

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KV WAVA+AI   L++V  FSIG GPI WVYSSEIFPL+LRA G S+GT +NR+ SG +S
Sbjct  387   KVAWAVALAITTVLSFVGTFSIGMGPIAWVYSSEIFPLRLRAQGTSIGTAMNRLISGTIS  446

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFISLY AISIGG+FFL+  +A V WVFF+TL+PETQG+TLEE + LFGTFF+WRS  R
Sbjct  447   MTFISLYNAISIGGAFFLFMGVAIVSWVFFYTLLPETQGRTLEEMQVLFGTFFKWRSTLR  506

Query  387   EVDAKKA-----NNNSQLQMGT  337
             E++  K      N+N Q+Q+GT
Sbjct  507   EMEKNKKIRDNDNSNGQIQLGT  528



>ref|XP_010096202.1| Polyol transporter 5 [Morus notabilis]
 gb|EXB63597.1| Polyol transporter 5 [Morus notabilis]
Length=541

 Score =   460 bits (1184),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 224/335 (67%), Positives = 265/335 (79%), Gaps = 13/335 (4%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VL MPESPRWLVMQGRLG+A+RVL KTSDS EEA +RL+DIK+AAGIPEHC D+VV V
Sbjct  208   VVVLIMPESPRWLVMQGRLGEAKRVLDKTSDSLEEAQLRLSDIKQAAGIPEHCTDDVVQV  267

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +K R   + VWREL + PTPAV HILIT +GIH FQQ SGIDAVVLY PRIFEKAGI S 
Sbjct  268   SK-RSHGEGVWRELLLHPTPAVRHILITAIGIHFFQQISGIDAVVLYSPRIFEKAGITSS  326

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLL T+A+GF KT+FILVATF LD+ GRRPLLL+SVGGM+ +LA LG++LTVIDHS E
Sbjct  327   DKKLLATMAVGFVKTLFILVATFLLDRIGRRPLLLSSVGGMIFSLASLGIALTVIDHSSE  386

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WA+ + IAM LAYVA FSIG GPITWVYSSEIFPLKLRA G S+   +NRVTSGV+S
Sbjct  387   KLMWAIVLCIAMVLAYVAFFSIGLGPITWVYSSEIFPLKLRAQGASMAVAVNRVTSGVIS  446

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ-  391
             M+FISLYK I+IGG+FFL+AA+A V WVFF+TL+PETQG+TLE+ E LFG FF+WRS   
Sbjct  447   MSFISLYKGITIGGAFFLFAALAVVAWVFFYTLLPETQGRTLEDMEVLFGKFFKWRSANE  506

Query  390   --------REVDAKKANN---NSQLQMGTLQAANK  319
                     +EV+ +  NN   N  +Q+GT +   K
Sbjct  507   ILKNNSMGKEVNGQDNNNAKANGHIQLGTTKDQTK  541



>ref|XP_011048787.1| PREDICTED: polyol transporter 5-like [Populus euphratica]
Length=532

 Score =   458 bits (1178),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 220/317 (69%), Positives = 259/317 (82%), Gaps = 3/317 (1%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             V  MPESPRWLVMQGRLG+AR+VL KTSDS EE+  RL+DIKEAAGIP  C+D++V V K
Sbjct  213   VFGMPESPRWLVMQGRLGEARKVLDKTSDSKEESQQRLSDIKEAAGIPHDCNDDIVHVQK  272

Query  1101  KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTD  922
             +   E  VW+EL I PTP+V HILI G+GIH FQQASGIDAVVLY PRIFEKAGI S  D
Sbjct  273   QSHGE-GVWKELLIYPTPSVRHILICGIGIHFFQQASGIDAVVLYSPRIFEKAGITSSND  331

Query  921   KLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKV  742
             KLL T+A+GFTKTVFILVATF LD+ GRRPLLL+SVGGMV +L+ LG  LT+IDHS EK+
Sbjct  332   KLLATVAVGFTKTVFILVATFFLDRIGRRPLLLSSVGGMVLSLSTLGFGLTMIDHSDEKL  391

Query  741   PWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMT  562
             PWAVA++IAM LAYV+ FSIG GPITWVYSSEIFPLKLRA G S+G  +NRVTSGV+S T
Sbjct  392   PWAVALSIAMVLAYVSFFSIGMGPITWVYSSEIFPLKLRAQGTSMGVAVNRVTSGVISTT  451

Query  561   FISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV  382
             FI LYKAI+IGGSFFL+A +AAVGW+FF+  +PET+G+TLE+ E LFG FF WRS  ++ 
Sbjct  452   FILLYKAITIGGSFFLFAGVAAVGWLFFYACLPETRGRTLEDMEVLFGHFFNWRSALKDE  511

Query  381   DAKKAN--NNSQLQMGT  337
               K+ +  N  Q+QMGT
Sbjct  512   QRKEVSGENGGQIQMGT  528



>ref|XP_012069670.1| PREDICTED: polyol transporter 5-like [Jatropha curcas]
 gb|KDP46229.1| hypothetical protein JCGZ_10069 [Jatropha curcas]
Length=514

 Score =   455 bits (1171),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 215/319 (67%), Positives = 257/319 (81%), Gaps = 5/319 (2%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VL MPESPRWL++QGRLG+A+RVL +TSDS EE+  RLADIKEAAGIP+ C+D++V V K
Sbjct  188   VLVMPESPRWLILQGRLGEAKRVLDRTSDSKEESEARLADIKEAAGIPQDCNDDIVQVQK  247

Query  1101  KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTD  922
             +   E  VWREL + PTP+V HIL+  +GIH FQQASGIDAVVLY PRIFEKAGI SD +
Sbjct  248   QSHGE-GVWRELLLHPTPSVRHILVCAIGIHFFQQASGIDAVVLYSPRIFEKAGITSDDN  306

Query  921   KLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKV  742
             KLL T+A+GF KT+FILVATF LD+ GRRPLLL SV GM+ +LA LG SLT+IDHSH+K+
Sbjct  307   KLLATVAVGFVKTMFILVATFFLDRIGRRPLLLASVAGMIFSLATLGFSLTIIDHSHDKL  366

Query  741   PWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMT  562
              WA+ + I M LAYVA FSIG GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+SMT
Sbjct  367   TWAIVLCITMVLAYVAFFSIGMGPITWVYSSEIFPLRLRAQGASMGVAVNRVTSGVISMT  426

Query  561   FISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV  382
             FISLYK I+IGG+FFL+AAIA V W FFFT +PETQG+TLE+ E LFG F  WRS  +E 
Sbjct  427   FISLYKGITIGGAFFLFAAIATVAWTFFFTCLPETQGRTLEDMEVLFGRFINWRSALKEE  486

Query  381   DAKK----ANNNSQLQMGT  337
             + KK    + NN Q+Q+GT
Sbjct  487   NLKKKAANSENNGQIQLGT  505



>ref|XP_006361759.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=475

 Score =   452 bits (1164),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 218/317 (69%), Positives = 256/317 (81%), Gaps = 1/317 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             +S++ MPESPRWLVM+GRL +AR VL KTS+SPEEA  RL DIKEAAGIPEHC+D+VV V
Sbjct  154   ISIITMPESPRWLVMKGRLHEARIVLNKTSESPEEAESRLRDIKEAAGIPEHCNDDVVQV  213

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               K    D+VW+ELFISPT ++ HI++TG+GIH FQQASGID+VVLY P IFE+AGIKSD
Sbjct  214   -PKHPKGDNVWKELFISPTQSIKHIVLTGIGIHFFQQASGIDSVVLYSPTIFERAGIKSD  272

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
              D+LL T+A+G  KTVFILVATF LD+ GRRPLLLTS GGM  +L LL + L VID S+ 
Sbjct  273   HDRLLATVAMGCVKTVFILVATFLLDRVGRRPLLLTSFGGMTISLILLSIGLAVIDRSNS  332

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             +V WAVA+ + M   YVA FSIGAGPI WVY SE+FPLKLRATG S+G  +NRVTSGV+S
Sbjct  333   QVTWAVALCVMMVSVYVALFSIGAGPIAWVYGSEVFPLKLRATGFSVGVAVNRVTSGVIS  392

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SL KAI+I G+FF YA IA + WVFFFTLMPETQGKTLEET ALFGTFF WRS  R
Sbjct  393   MTFLSLEKAITIQGAFFSYAGIAGMAWVFFFTLMPETQGKTLEETVALFGTFFEWRSTAR  452

Query  387   EVDAKKANNNSQLQMGT  337
             E+  KK NNN ++QM T
Sbjct  453   ELKGKKMNNNDEIQMAT  469



>ref|XP_009785575.1| PREDICTED: polyol transporter 5-like isoform X2 [Nicotiana sylvestris]
Length=336

 Score =   444 bits (1141),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 211/322 (66%), Positives = 254/322 (79%), Gaps = 3/322 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHC-DDEVVT  1111
             + VLAMPESPRWLVMQGRLGDA+RVL +TSD+ EE+ MRLADIKEAAGIP+ C DD +V+
Sbjct  14    LGVLAMPESPRWLVMQGRLGDAKRVLDRTSDTLEESKMRLADIKEAAGIPQDCQDDNIVS  73

Query  1110  VTKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
             VT++    + VWRELF+ PTPAVLHILI G+GIH FQQASGIDAVVLY PRI+EKAGI  
Sbjct  74    VTRRSSHGEGVWRELFLHPTPAVLHILIAGIGIHFFQQASGIDAVVLYSPRIYEKAGITK  133

Query  930   DTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH  751
             D D+LL TIA+G  KT FILVATF +DK GRR LLL+S GGM+ +L  L   LT+IDHS 
Sbjct  134   DNDRLLATIAVGCMKTFFILVATFLVDKVGRRVLLLSSCGGMILSLLGLATGLTIIDHSD  193

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
              K+ WA+ + I  TL+ VA FSIG GPI WVYSSEIFPL+LRA GCS+G  +NR  SG +
Sbjct  194   HKLKWAIVLCICTTLSSVAFFSIGMGPIAWVYSSEIFPLRLRAQGCSIGVAVNRAMSGAI  253

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
              MTFISLYKAISIGG+FFLY  IA + W+FF+ L+PETQG+TLEE E LFGTFF+WRS  
Sbjct  254   LMTFISLYKAISIGGAFFLYTGIAIIAWIFFYALLPETQGRTLEEMEELFGTFFKWRSTM  313

Query  390   REVDAKK--ANNNSQLQMGTLQ  331
             +E+   K  ++ ++Q+QMG  Q
Sbjct  314   KELKKNKVESDGSAQVQMGNSQ  335



>ref|NP_001287655.1| polyol transporter 5-like [Solanum lycopersicum]
 dbj|BAO96229.1| polyol/monosaccharide transporter 4 [Solanum lycopersicum]
Length=541

 Score =   450 bits (1158),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 236/325 (73%), Positives = 270/325 (83%), Gaps = 6/325 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             VSVLAMPESPRWLVMQGRLGDARRVL KTSDS +EA  RLADIK+AAGIPE+C+D++V V
Sbjct  201   VSVLAMPESPRWLVMQGRLGDARRVLNKTSDSLQEAQFRLADIKQAAGIPENCNDDIVEV  260

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               KR   D+VW+EL  SPTPAV HILITGVGIH FQQASGIDAVVLY P+IFEKAGIKSD
Sbjct  261   -PKRPTGDNVWKELVFSPTPAVRHILITGVGIHFFQQASGIDAVVLYSPKIFEKAGIKSD  319

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
              DKLLCT+A+G  KT+FILVATF LD+ GRR LLLTSVGGMV +L LL   LT+I+HS +
Sbjct  320   HDKLLCTVAVGVVKTLFILVATFMLDRSGRRRLLLTSVGGMVASLVLLATGLTIIEHSEQ  379

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WA+A+ IAM LAYVA FSIG GPITWVYSSEIFPL+LRATGCS+G  +NRVTSGVVS
Sbjct  380   KLIWAIALCIAMVLAYVALFSIGMGPITWVYSSEIFPLRLRATGCSIGVAVNRVTSGVVS  439

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SL KAI+IG +FFLYAA+AAV  VFF+TLMPETQGKTLEE E LFGTF+ WR+R R
Sbjct  440   MTFLSLEKAITIGAAFFLYAALAAVALVFFYTLMPETQGKTLEEMETLFGTFWNWRARAR  499

Query  387   EVD-----AKKANNNSQLQMGTLQA  328
             E+       K +N+N  + MGT  A
Sbjct  500   ELKELKKTEKNSNDNGHIPMGTSNA  524



>ref|XP_012069657.1| PREDICTED: putative polyol transporter 1 [Jatropha curcas]
Length=542

 Score =   449 bits (1155),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 211/319 (66%), Positives = 257/319 (81%), Gaps = 5/319 (2%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VL MPESPRWL++QGRLG+A+RVL +TSDS EE+  RLADIKEAAGIP+ C+D++V V K
Sbjct  216   VLVMPESPRWLILQGRLGEAKRVLDRTSDSKEESEARLADIKEAAGIPQDCNDDIVQVQK  275

Query  1101  KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTD  922
             +   E  VWREL + PTP+V HIL+  +GIH FQQASGIDAVVLY PRIFEKAGI SD +
Sbjct  276   QSHGE-GVWRELLLHPTPSVRHILVCAIGIHFFQQASGIDAVVLYSPRIFEKAGITSDDN  334

Query  921   KLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKV  742
             KLL T+A+GF KT+FILVATF LD+ GRRPLLLTSV GM+ +LA LG SLT+IDHSH+K+
Sbjct  335   KLLATVAVGFVKTMFILVATFLLDRIGRRPLLLTSVAGMIFSLATLGFSLTIIDHSHDKL  394

Query  741   PWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMT  562
              WA+ + + M LAYVA FSIG GPITWVYSSEIFPL+LRA G S+G  +NR+TSGV+S T
Sbjct  395   TWAIVLCLTMVLAYVAFFSIGMGPITWVYSSEIFPLRLRAQGTSMGVAVNRLTSGVISTT  454

Query  561   FISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV  382
             FISLYK I++GG+FFL+AAIA V W FFFT +PET+G+TLE+ E LFG+F  WRS  +E 
Sbjct  455   FISLYKGITMGGAFFLFAAIATVAWTFFFTCLPETRGRTLEDMEVLFGSFINWRSALKED  514

Query  381   DAKK----ANNNSQLQMGT  337
               KK    + NN Q+Q+GT
Sbjct  515   SLKKKAASSENNGQIQLGT  533



>ref|XP_011037561.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037562.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037564.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037565.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037566.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037567.1| PREDICTED: polyol transporter 5 [Populus euphratica]
Length=531

 Score =   448 bits (1153),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 220/319 (69%), Positives = 253/319 (79%), Gaps = 6/319 (2%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             V  MPESPRWLVMQGRLGDAR+VL KTSDS EE+  RL++IKEAAGIP+ C+D+VV V K
Sbjct  213   VFGMPESPRWLVMQGRLGDARKVLGKTSDSKEESQQRLSEIKEAAGIPQDCNDDVVRVQK  272

Query  1101  KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTD  922
             K   E  VW+ELFI PT  V HIL+ G+GIH FQQASGIDAVVLY   IFEKAGI S  D
Sbjct  273   KSHGE-GVWKELFIYPTRPVRHILLCGIGIHFFQQASGIDAVVLYSTNIFEKAGITSSND  331

Query  921   KLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKV  742
             KLL T+A+GFTKTVFILVATF LD+ GRRPLLL+SVGGM+ +LA LG  LT+IDHSHEK+
Sbjct  332   KLLATVAVGFTKTVFILVATFLLDRIGRRPLLLSSVGGMILSLATLGFGLTIIDHSHEKL  391

Query  741   PWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMT  562
             PWAVA++IAM LA+VA FSIG GPI WVYSSEIFPL+LRA G  +G  +NRVTSGV+S T
Sbjct  392   PWAVALSIAMVLAFVAFFSIGMGPIAWVYSSEIFPLRLRAQGTGMGVAVNRVTSGVISTT  451

Query  561   FISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS----R  394
             FI LYKAISIGGSFFL+A IA V WVFFF   PET+G+TLE+ E LFG F  WRS     
Sbjct  452   FIMLYKAISIGGSFFLFAGIATVAWVFFFACFPETRGRTLEDMEVLFGNFISWRSALKDE  511

Query  393   QREVDAKKANNNSQLQMGT  337
             Q+E +A    N+ Q+QMGT
Sbjct  512   QKEGEA-HGGNDGQIQMGT  529



>ref|XP_007042744.1| Polyol/monosaccharide transporter 5 [Theobroma cacao]
 gb|EOX98575.1| Polyol/monosaccharide transporter 5 [Theobroma cacao]
Length=538

 Score =   447 bits (1149),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 216/324 (67%), Positives = 256/324 (79%), Gaps = 9/324 (3%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + V+AMPESPRWLVMQGRLG+A+RVL KTSD+ EEA +RL+DIKEAAGIP+ C D++V V
Sbjct  211   IGVIAMPESPRWLVMQGRLGEAKRVLDKTSDTKEEAQLRLSDIKEAAGIPQDCTDDIVQV  270

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              KK   E  VW+EL + PTPAV H+LI  +GIH FQQASGIDAVVLY PRIFEKAGI S 
Sbjct  271   QKKSHGE-GVWKELLLYPTPAVRHVLICAIGIHFFQQASGIDAVVLYSPRIFEKAGITSS  329

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
              +KLL T+A+GF KT+FILVATF LD+ GRRPLLL+SVGGMV +LA LG+SLT+IDHS E
Sbjct  330   DEKLLATVAVGFVKTIFILVATFFLDRIGRRPLLLSSVGGMVASLATLGLSLTIIDHSDE  389

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WA+A+ I M LAYVA FSIG GPITWVYSSEIFPL+LRA G S+G   NRVTSGV+S
Sbjct  390   KLMWAIALCITMVLAYVAFFSIGMGPITWVYSSEIFPLRLRAQGASMGVAANRVTSGVIS  449

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS---  397
             M+FISLYKAISIGG+FFL+A +A V W FF+T +PETQGKTLEE E LFG    WR    
Sbjct  450   MSFISLYKAISIGGAFFLFAGVATVAWFFFYTCLPETQGKTLEEMEGLFGKLMGWRKEAK  509

Query  396   ----RQREVDAKKANNNSQLQMGT  337
                 R +EV+     +N Q+Q+G 
Sbjct  510   KLKMRMKEVNG-DGTSNGQIQLGN  532



>ref|XP_009785574.1| PREDICTED: polyol transporter 5-like isoform X1 [Nicotiana sylvestris]
Length=355

 Score =   439 bits (1130),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 207/311 (67%), Positives = 247/311 (79%), Gaps = 1/311 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHC-DDEVVT  1111
             + VLAMPESPRWLVMQGRLGDA+RVL +TSD+ EE+ MRLADIKEAAGIP+ C DD +V+
Sbjct  14    LGVLAMPESPRWLVMQGRLGDAKRVLDRTSDTLEESKMRLADIKEAAGIPQDCQDDNIVS  73

Query  1110  VTKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
             VT++    + VWRELF+ PTPAVLHILI G+GIH FQQASGIDAVVLY PRI+EKAGI  
Sbjct  74    VTRRSSHGEGVWRELFLHPTPAVLHILIAGIGIHFFQQASGIDAVVLYSPRIYEKAGITK  133

Query  930   DTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH  751
             D D+LL TIA+G  KT FILVATF +DK GRR LLL+S GGM+ +L  L   LT+IDHS 
Sbjct  134   DNDRLLATIAVGCMKTFFILVATFLVDKVGRRVLLLSSCGGMILSLLGLATGLTIIDHSD  193

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
              K+ WA+ + I  TL+ VA FSIG GPI WVYSSEIFPL+LRA GCS+G  +NR  SG +
Sbjct  194   HKLKWAIVLCICTTLSSVAFFSIGMGPIAWVYSSEIFPLRLRAQGCSIGVAVNRAMSGAI  253

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
              MTFISLYKAISIGG+FFLY  IA + W+FF+TL+PETQG+TLEE E LFGTFF+WRS  
Sbjct  254   LMTFISLYKAISIGGAFFLYTGIAIIAWIFFYTLLPETQGRTLEEMEELFGTFFKWRSTM  313

Query  390   REVDAKKANNN  358
             +E+   K  ++
Sbjct  314   KELKKNKVESD  324



>gb|KJB32189.1| hypothetical protein B456_005G228500 [Gossypium raimondii]
Length=539

 Score =   444 bits (1141),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 212/324 (65%), Positives = 254/324 (78%), Gaps = 8/324 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVMQGRLG+A++VL KTSDS EEA +RL++IKEAAGIP+ C D+VV V
Sbjct  213   VGVLAMPESPRWLVMQGRLGEAKKVLDKTSDSIEEAQLRLSEIKEAAGIPQECTDDVVKV  272

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              +KR   + VW+EL + PTPAV H+LI G+GIH FQQASGIDAVVLY P IFEKAGI S 
Sbjct  273   -QKRSHGEGVWKELLLYPTPAVRHVLICGIGIHFFQQASGIDAVVLYSPTIFEKAGITSS  331

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLL T+A+GF KT+ IL+ATF LD+ GRRPLLL+S+ GMV +L  LG SLT+IDHSHE
Sbjct  332   DGKLLATVAVGFVKTITILIATFLLDRIGRRPLLLSSIIGMVASLTTLGFSLTIIDHSHE  391

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+PWA+ + I M LAYVA FSIG GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+S
Sbjct  392   KIPWAIGLCITMVLAYVALFSIGMGPITWVYSSEIFPLRLRAQGASMGVAVNRVTSGVIS  451

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFISLY+AISIGG+FFL+A +A V  +FF+   PETQGKTLEE E LFG FF WR   +
Sbjct  452   MTFISLYEAISIGGAFFLFAGVAMVATLFFYMFYPETQGKTLEEMEGLFGKFFGWREEAK  511

Query  387   EVDAKK-------ANNNSQLQMGT  337
             ++  KK         +N Q+Q+G 
Sbjct  512   KLKMKKTMEVSGDGTSNGQIQLGN  535



>gb|AAM44082.1| putative sorbitol transporter [Prunus cerasus]
Length=538

 Score =   443 bits (1140),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 223/331 (67%), Positives = 264/331 (80%), Gaps = 10/331 (3%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDAR+VL KTSDS EE+ +RL +IKEAAGIPEHC+D++V V
Sbjct  209   IGVLAMPESPRWLVMQGRLGDARKVLDKTSDSLEESKLRLGEIKEAAGIPEHCNDDIVEV  268

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              KKR     VW++L + PTPAV HIL+  VG+H FQQASGIDAVVLY PRIFEKAGI + 
Sbjct  269   -KKRSQGQEVWKQLLLRPTPAVRHILMCAVGLHFFQQASGIDAVVLYSPRIFEKAGITNP  327

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
                LLCT+A+GF KTVFILVATF LD+ GRRPLLLTSV GMV TLA LG+ LT+IDHS E
Sbjct  328   DHVLLCTVAVGFVKTVFILVATFMLDRIGRRPLLLTSVAGMVFTLACLGLGLTIIDHSGE  387

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WA+A+++ M LAYVA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRV SGV+S
Sbjct  388   KIMWAIALSLTMVLAYVAFFSIGMGPITWVYSSEIFPLQLRAQGCSIGVAVNRVVSGVLS  447

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFISLYKAI+IGG+FFL+AAIAAVGW FFFT++PETQG+TLE+ E LFG F+RWR    
Sbjct  448   MTFISLYKAITIGGAFFLFAAIAAVGWTFFFTMLPETQGRTLEDMEVLFGKFYRWRKANA  507

Query  387   EVDAKKANNNS---------QLQMGTLQAAN  322
              +  KK  ++          Q+Q+GT   AN
Sbjct  508   LLKQKKQVDHGDGNNNPNNPQIQLGTKGQAN  538



>ref|XP_006487182.1| PREDICTED: polyol transporter 5-like [Citrus sinensis]
Length=535

 Score =   443 bits (1139),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/329 (68%), Positives = 260/329 (79%), Gaps = 10/329 (3%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVMQGRL DA++VL KTSDS EE+ +RLADIKEAAGIPE C+D+VV V
Sbjct  210   VGVLAMPESPRWLVMQGRLADAKKVLDKTSDSKEESMLRLADIKEAAGIPEDCNDDVVQV  269

Query  1107  TK-KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
              K  RG+   VW+EL + PTPAV HI++  VGIH FQQASGIDAVVLY PRIFEKAGI S
Sbjct  270   PKINRGE--GVWKELLVRPTPAVRHIIVAAVGIHFFQQASGIDAVVLYSPRIFEKAGIAS  327

Query  930   DTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH  751
                KLL T+A+GF KT+FILVATF LDK GRRPLLL+SV GM+ +LA L +SLTVID SH
Sbjct  328   SDKKLLATVAVGFVKTIFILVATFLLDKIGRRPLLLSSVAGMIASLATLAISLTVIDQSH  387

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             +K+ WA+ +AI+  L+YVA FSIG GPITWVYSSEI PLKLRA G S+G  +NRVTSGVV
Sbjct  388   KKMIWAIGLAISTVLSYVAFFSIGMGPITWVYSSEILPLKLRAQGASIGVMVNRVTSGVV  447

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRW-RSR  394
             SMTF+SL KAI+IGGSFFLYA+IA+V WVFF+T +PETQGKTLEE  ALFG  FRW R  
Sbjct  448   SMTFLSLSKAITIGGSFFLYASIASVAWVFFYTCLPETQGKTLEEMGALFGN-FRWLRDS  506

Query  393   QREVDAKKAN-----NNSQLQMGTLQAAN  322
             +RE    KAN     + S +Q+G +   N
Sbjct  507   KREKRRNKANEINGDSASNVQLGPVSNGN  535



>ref|XP_006423215.1| hypothetical protein CICLE_v10028170mg [Citrus clementina]
 gb|ESR36455.1| hypothetical protein CICLE_v10028170mg [Citrus clementina]
Length=535

 Score =   443 bits (1139),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 223/329 (68%), Positives = 259/329 (79%), Gaps = 10/329 (3%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVMQGRL DA++VL KTSDS EE+ +RLADIKEAAGIPE C+D+VV V
Sbjct  210   VGVLAMPESPRWLVMQGRLADAKKVLDKTSDSKEESMLRLADIKEAAGIPEDCNDDVVQV  269

Query  1107  TK-KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
              K  RG+   VW+EL + PTPAV HI++  VGIH FQQASGIDAVVLY PRIFEKAGI S
Sbjct  270   PKINRGE--GVWKELLVRPTPAVRHIIVAAVGIHFFQQASGIDAVVLYSPRIFEKAGIAS  327

Query  930   DTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH  751
                KLL T+A+GF KT+FILVATF LDK GRRPLLL+SV GM+ +LA L +SLTVID SH
Sbjct  328   SDKKLLATVAVGFVKTIFILVATFLLDKIGRRPLLLSSVAGMIASLATLAISLTVIDQSH  387

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             +K+ WA+ +AI+  L+YVA FSIG GPITWVYSSEI PLKLRA G S+G  +NRVTSGVV
Sbjct  388   KKMIWAIGLAISTVLSYVAFFSIGMGPITWVYSSEILPLKLRAQGASIGVMVNRVTSGVV  447

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRW-RSR  394
             SMTF+SL KAI+IGGSFFLYA+IA+V WVFF+T +PETQGKTLEE  ALFG  FRW R  
Sbjct  448   SMTFLSLSKAITIGGSFFLYASIASVAWVFFYTCLPETQGKTLEEMGALFGN-FRWLRDS  506

Query  393   QREVDAKKANN-----NSQLQMGTLQAAN  322
             +RE    KAN       S +Q+G +   N
Sbjct  507   KREKRRNKANEINGDGASNVQLGPVSNGN  535



>ref|XP_004299107.1| PREDICTED: polyol transporter 5-like [Fragaria vesca subsp. vesca]
Length=535

 Score =   443 bits (1139),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 214/324 (66%), Positives = 255/324 (79%), Gaps = 8/324 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDA+ VL +TSDS EE+ +RLADIKEAAGIPEHC+D++V V
Sbjct  209   IGVLAMPESPRWLVMQGRLGDAKIVLDRTSDSMEESKLRLADIKEAAGIPEHCNDDIVQV  268

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+   ED VW+EL + PTPAV HILI  VGIH FQQASGIDAVVLY PRIF+ AGI S 
Sbjct  269   AKRSHGED-VWKELILHPTPAVRHILIAAVGIHFFQQASGIDAVVLYSPRIFKYAGITSK  327

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
                LL TIA+G  KT+FILVATF LD+ GRRPLLL+S+ GM+ +LA LG  LT++ HS E
Sbjct  328   NKLLLATIAVGSVKTIFILVATFLLDRIGRRPLLLSSMAGMIASLACLGFGLTIVVHSDE  387

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KV WAV ++I M L YVA FSIG GPITWVYSSEIFPLKLRA GCS+G  +NRV SG +S
Sbjct  388   KVMWAVVLSITMVLVYVAFFSIGMGPITWVYSSEIFPLKLRAQGCSIGVAVNRVVSGTLS  447

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS---  397
             MTFISLY+AI+IGG+FFL+A IAAVGWVFF+T++PETQG+TLE+ E LFG F +W+    
Sbjct  448   MTFISLYEAITIGGAFFLFAGIAAVGWVFFYTMLPETQGRTLEDMEVLFGKFHKWKKANA  507

Query  396   --RQREVDAKKAN--NNSQLQMGT  337
               R + VD    +  N  Q+Q+GT
Sbjct  508   LLRNKRVDPNSNDTANGGQVQLGT  531



>gb|KHG20989.1| Polyol transporter 5 -like protein [Gossypium arboreum]
Length=539

 Score =   442 bits (1138),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 212/324 (65%), Positives = 254/324 (78%), Gaps = 8/324 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVMQGRLG+A++VL KTS+S EEA +RL++IKEAAGIP+ C D+VV V
Sbjct  213   VGVLAMPESPRWLVMQGRLGEAKKVLDKTSESIEEAQLRLSEIKEAAGIPQECTDDVVKV  272

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              +KR   + VW+ELF+ PTPAV H+LI G+GIH FQQASGIDAVVLY P IFEKAGI S 
Sbjct  273   -QKRSHGEGVWKELFLYPTPAVRHVLICGIGIHFFQQASGIDAVVLYSPTIFEKAGITSS  331

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               +LL T+A+GF KT+ IL+ATF LD+ GRRPLLL+S+ GMV +L  LG SLT+IDHSHE
Sbjct  332   DGELLATVAVGFVKTITILIATFLLDRIGRRPLLLSSIIGMVASLTTLGFSLTIIDHSHE  391

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+PWA+ + I M LAYVA FSIG GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+S
Sbjct  392   KIPWAIGLCITMVLAYVALFSIGMGPITWVYSSEIFPLRLRAQGASMGVAVNRVTSGVIS  451

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFISLYKAISIGG+FFL+A IA V  +FF+   PETQGKTLEE E LFG F  WR   +
Sbjct  452   MTFISLYKAISIGGAFFLFAGIATVATLFFYMFYPETQGKTLEEMEGLFGKFIGWREEAK  511

Query  387   EVDAKK-------ANNNSQLQMGT  337
             ++  KK         +N Q+Q+G 
Sbjct  512   KLKMKKTMEVNGDGTSNGQIQLGN  535



>ref|XP_009602627.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=531

 Score =   442 bits (1137),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 211/322 (66%), Positives = 253/322 (79%), Gaps = 3/322 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHC-DDEVVT  1111
             + VLAMPESPRWLVMQGRLGDA+RVL +TSD+ EE+ MRLADIKEAAGIP+ C DD +V+
Sbjct  209   LGVLAMPESPRWLVMQGRLGDAKRVLDRTSDTLEESKMRLADIKEAAGIPQDCQDDSIVS  268

Query  1110  VTKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
             VT++    + VWRELF+ PTPAVLHILI G+GIH FQQASGIDAVVLY PRIFEKAGI  
Sbjct  269   VTRRSSHGEGVWRELFLHPTPAVLHILIAGIGIHFFQQASGIDAVVLYSPRIFEKAGITK  328

Query  930   DTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH  751
             D D LL TIA+G  KT FIL+ATF +DK GRR LLL+S GGM+ +L  L   LT+IDHS 
Sbjct  329   DNDILLATIAVGCMKTFFILIATFLVDKVGRRVLLLSSCGGMILSLLGLATGLTIIDHSD  388

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
              K+ WA+ + I  TL+ VA FSIG GPI WVYSSEIFPL+LRA GCS+G  +NR  SG +
Sbjct  389   HKLKWAIVLCICTTLSSVAFFSIGMGPIAWVYSSEIFPLRLRAQGCSIGVAVNRAMSGAI  448

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
              MTFISLYKAISIGG+FFLY  IA + W+FF+TL+PETQG+TLEE E LFGTFF+WRS  
Sbjct  449   LMTFISLYKAISIGGAFFLYTGIAVIAWIFFYTLLPETQGRTLEEMEELFGTFFKWRSTM  508

Query  390   REVDAKK--ANNNSQLQMGTLQ  331
             +E+   K  ++ ++Q+QM   Q
Sbjct  509   KELKKNKVESDGSAQVQMENSQ  530



>ref|XP_004507415.1| PREDICTED: polyol transporter 5-like [Cicer arietinum]
Length=526

 Score =   441 bits (1134),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 217/321 (68%), Positives = 259/321 (81%), Gaps = 6/321 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVM+GRLGDA +VL KTSDS EEA +RLA+IK AAGIPE C+D+VV V
Sbjct  204   VGVLAMPESPRWLVMRGRLGDAIKVLNKTSDSKEEAQLRLAEIKRAAGIPEDCNDDVVQV  263

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             T K    D VW+ELF+ PTPAV HI+I  +GIH FQQASG+DAVVLY P+IF+KAGIK D
Sbjct  264   TNKN-TGDGVWKELFLYPTPAVRHIVIAALGIHFFQQASGVDAVVLYSPKIFQKAGIKDD  322

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             T +LL TIA+GF KT+FILVATF LD+ GRRPLLLTSVGGMV +L  L +SLT+IDHS  
Sbjct  323   THQLLATIAVGFVKTIFILVATFMLDRVGRRPLLLTSVGGMVLSLLTLAVSLTIIDHSET  382

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WAV ++IA  L+YVA FSIGAGPITWVYSSEIFPL+LRA G ++G  +NRVTSGV+S
Sbjct  383   KLMWAVGLSIATVLSYVATFSIGAGPITWVYSSEIFPLRLRAQGAAMGVVVNRVTSGVIS  442

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFR----WR  400
             MTF+SL KAI+IGG+FFL+ AIAA GWVFF+T++PETQGKTLEE E  FG F R    + 
Sbjct  443   MTFLSLSKAITIGGAFFLFGAIAAAGWVFFYTMLPETQGKTLEEMEGSFGKFGRKSQSYD  502

Query  399   SRQREVDAKKANNNSQLQMGT  337
             S   E+D  K +  +Q+Q+GT
Sbjct  503   STHNELDNGK-DQVAQVQLGT  522



>gb|ACB56939.1| mannitol transporter [Artemisia annua]
Length=522

 Score =   440 bits (1132),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 214/317 (68%), Positives = 251/317 (79%), Gaps = 9/317 (3%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VL MPESPRWLVMQGRLGDA+ VL KTSDS EE+ +RLADIK AAGIPE C+D++V V
Sbjct  207   LGVLGMPESPRWLVMQGRLGDAKTVLDKTSDSLEESRLRLADIKAAAGIPEDCNDDIVKV  266

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +K    E  +W+EL I PTP V HIL+  +GIH FQQASGIDAVVLY  RIFEKAGI  D
Sbjct  267   SKDSHGE-GIWKELLIHPTPTVRHILMAAIGIHFFQQASGIDAVVLYSTRIFEKAGITHD  325

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             T KLL TIA+GF KTVFILVATF LDK GRRPLLL+SV GM+ +L  LG+ LT+IDHS  
Sbjct  326   TPKLLATIAVGFVKTVFILVATFFLDKVGRRPLLLSSVAGMILSLMGLGIGLTIIDHSDH  385

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WA+A+ IA  L+YVA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR+ SGV+ 
Sbjct  386   KIEWAIALCIATILSYVAFFSIGMGPITWVYSSEIFPLRLRAQGCSMGVAVNRIVSGVIG  445

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFISLYKAI+IGG+FFL+  +A VG+VFF+TL PETQGK LEE E +FGTFFRWR+RQ 
Sbjct  446   MTFISLYKAITIGGAFFLFTGVAIVGFVFFYTLYPETQGKNLEEVEEVFGTFFRWRTRQA  505

Query  387   EVD--------AKKANN  361
             E+D        +KKA N
Sbjct  506   ELDRAKEAEMVSKKAQN  522



>ref|NP_001281033.1| polyol transporter 5-like [Malus domestica]
 dbj|BAD42345.1| sorbitol transporter [Malus domestica]
Length=535

 Score =   441 bits (1133),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 221/329 (67%), Positives = 256/329 (78%), Gaps = 8/329 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVMQGRLGDA RVL KTSDS EE+ +RLADIKEAAGIPEHC D+VV V
Sbjct  208   VGVLAMPESPRWLVMQGRLGDATRVLDKTSDSKEESMLRLADIKEAAGIPEHCTDDVVQV  267

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+   +D VW+EL + PTPAV HILI  +GIH FQQASGIDAVVLY PRIFEKAGI + 
Sbjct  268   PKRSQGQD-VWKELLLHPTPAVRHILICAIGIHFFQQASGIDAVVLYSPRIFEKAGITNS  326

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLLCT+A+GF KTVFILVATF +DK GRRPLLL SV GM+ +L  LG+ LT+ID +HE
Sbjct  327   DKKLLCTVAVGFVKTVFILVATFFVDKVGRRPLLLASVAGMILSLTGLGLGLTIIDQNHE  386

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             ++ WA  + + M L YVA FSIG GPITWVYSSEIFPLKLRA GCSLG  +NRV SGV+S
Sbjct  387   RILWAAVLCLTMVLLYVAFFSIGMGPITWVYSSEIFPLKLRAQGCSLGVAMNRVVSGVLS  446

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFISLY+AI+IGG+FFLYAAIA+V WVFFFT++PET G+TLE+ E LFG F +WR    
Sbjct  447   MTFISLYEAITIGGAFFLYAAIASVAWVFFFTMLPETHGRTLEDMEVLFGKFHKWRKANA  506

Query  387   EVDAKKA-------NNNSQLQMGTLQAAN  322
              +  KK         NN Q+Q+GT    N
Sbjct  507   LLKQKKNASHGDGITNNGQVQLGTRGQVN  535



>ref|XP_008387370.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=538

 Score =   440 bits (1132),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 213/318 (67%), Positives = 248/318 (78%), Gaps = 2/318 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVMQGRLGDA RVL KTSDS EEA +RLADIKEAAGIPEHC D+VV V
Sbjct  210   VGVLAMPESPRWLVMQGRLGDATRVLNKTSDSKEEALLRLADIKEAAGIPEHCTDDVVQV  269

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+   +D VW+EL + PTPAV HILI  VGIH FQQASGIDA+VLY PR+FEKAGI + 
Sbjct  270   PKRSKGQD-VWKELLLHPTPAVRHILICAVGIHFFQQASGIDAIVLYSPRVFEKAGITNS  328

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH-  751
               KLLCT+A+G  KTVFILVATF LD+ GRRPLLL+SV GMV +L  LG++LT+ID  H 
Sbjct  329   DHKLLCTVAVGLAKTVFILVATFLLDRIGRRPLLLSSVAGMVFSLGSLGVALTIIDQHHG  388

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
              K+ W  A+ + M +AY A FSIG GPITWVYSSEIFPLKLRA GCS+G  +NRV SGV+
Sbjct  389   AKMTWTTALCLTMVIAYAALFSIGLGPITWVYSSEIFPLKLRAQGCSMGVAMNRVVSGVL  448

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
             SMTFISLYKAI++GG+FFLY  IAAV WVFF+T+ PETQG+TLE+ E LFG F +WR   
Sbjct  449   SMTFISLYKAITMGGAFFLYGGIAAVAWVFFYTMYPETQGRTLEDMEILFGKFHKWREAN  508

Query  390   REVDAKKANNNSQLQMGT  337
               ++ K   N+     GT
Sbjct  509   AMLETKTQVNHGDGNNGT  526



>ref|XP_002305419.2| hypothetical protein POPTR_0004s15960g [Populus trichocarpa]
 gb|EEE85930.2| hypothetical protein POPTR_0004s15960g [Populus trichocarpa]
Length=531

 Score =   440 bits (1131),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 217/320 (68%), Positives = 251/320 (78%), Gaps = 8/320 (3%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             V+ MPESPRWLVMQGRLGDAR+VL KTSD+ EE+  RL+DIKEAAGIP+ C+D+VV V K
Sbjct  213   VIGMPESPRWLVMQGRLGDARKVLDKTSDTKEESQQRLSDIKEAAGIPQDCNDDVVRVQK  272

Query  1101  KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTD  922
             K   E  VW+ELF+ PT  V HIL+ G+GIH FQQASGIDAVVLY   IFEKAGI S  D
Sbjct  273   KSHGE-GVWKELFVHPTRPVRHILLCGIGIHFFQQASGIDAVVLYSTNIFEKAGITSSND  331

Query  921   KLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKV  742
             KLL T+A+GFTKTVFILVATF LD+ GRRPLLL+SVGGMV +LA LG  LT+IDHS EK+
Sbjct  332   KLLATVAVGFTKTVFILVATFLLDRIGRRPLLLSSVGGMVLSLATLGFGLTIIDHSPEKL  391

Query  741   PWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMT  562
             PWAVA++IAM LA+VA FSIG GPI WVYSSEIFPL+LRA G  +G  +NRVTSGV+S T
Sbjct  392   PWAVALSIAMVLAFVAFFSIGMGPIPWVYSSEIFPLRLRAQGTGMGVAMNRVTSGVISTT  451

Query  561   FISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV  382
             FI LYKAISIGG+FFL+A  A V WVFFF   PET+G+TLE+ E LFG F  WRS  +  
Sbjct  452   FIMLYKAISIGGAFFLFAGFATVAWVFFFACFPETRGRTLEDMEVLFGNFISWRSVLK--  509

Query  381   DAKK-----ANNNSQLQMGT  337
             D KK       N+ Q+QMGT
Sbjct  510   DGKKEEEVHGGNDGQIQMGT  529



>gb|EPS69995.1| sugar transport protein [Genlisea aurea]
Length=530

 Score =   439 bits (1130),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 214/315 (68%), Positives = 257/315 (82%), Gaps = 1/315 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVMQGRLGDARRVL KTSDS EE+ +RLADIKEAAGIP+HC+D++V V
Sbjct  205   VGVLAMPESPRWLVMQGRLGDARRVLDKTSDSIEESKLRLADIKEAAGIPDHCNDDIVVV  264

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +++   E  VWR+LF+ PTPAV HIL+   GIH FQQASGID+VVLY P IF KAGI ++
Sbjct  265   SRQHHGE-GVWRDLFLRPTPAVRHILMCAAGIHFFQQASGIDSVVLYSPDIFGKAGITNN  323

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             + KL+ T+A+GFTKTVFILVATF LDK GRRPLLL+SV GM+ +L  LG+ LTVI  S  
Sbjct  324   SSKLIVTMAVGFTKTVFILVATFFLDKIGRRPLLLSSVAGMILSLMGLGLGLTVIARSDH  383

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WAVA+ I   L+YVA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+S
Sbjct  384   KLVWAVALCITSVLSYVAFFSIGMGPITWVYSSEIFPLQLRAQGCSVGVAVNRVTSGVIS  443

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SLYKAISIGG+FFLY  +A V WVFF++L+PETQG+TLEE E+LFGTFF+WRS +R
Sbjct  444   MTFLSLYKAISIGGTFFLYGGVAMVAWVFFYSLLPETQGRTLEEMESLFGTFFKWRSTRR  503

Query  387   EVDAKKANNNSQLQM  343
              ++  K      +QM
Sbjct  504   ALEENKKFGGKHVQM  518



>emb|CAP58707.1| putative polyol transported protein 2 [Hevea brasiliensis]
Length=547

 Score =   440 bits (1131),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 219/299 (73%), Positives = 252/299 (84%), Gaps = 1/299 (0%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VLAMPESPRWLV+QGRLGDA+RVL KTSDS EE+  RLADIKEAAGIP+ C+D+VV +TK
Sbjct  213   VLAMPESPRWLVLQGRLGDAKRVLDKTSDSKEESQARLADIKEAAGIPQECNDDVVQMTK  272

Query  1101  KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTD  922
             K   E  VWREL + PTP+V HIL+  +GIH FQQASGIDAVVLY PRIFEKAGIKSDTD
Sbjct  273   KSHGE-GVWRELLLHPTPSVRHILVCAIGIHFFQQASGIDAVVLYSPRIFEKAGIKSDTD  331

Query  921   KLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKV  742
             KLL T+A+GF KT+FILVATF LD+ GRRPLLL+SV GMV +LA LG SLT+IDHSHEK+
Sbjct  332   KLLATVAVGFVKTIFILVATFLLDRIGRRPLLLSSVAGMVFSLATLGFSLTIIDHSHEKL  391

Query  741   PWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMT  562
              WA+A+ IAM L YVA FSIG GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+S T
Sbjct  392   TWAIALCIAMVLLYVATFSIGMGPITWVYSSEIFPLRLRAQGASMGVAVNRVTSGVISTT  451

Query  561   FISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQRE  385
             FISLYK I+IGG+FFL+AAIAAV W FFFT +PETQG+TLE+ E LFG F +WRS  +E
Sbjct  452   FISLYKGITIGGAFFLFAAIAAVAWTFFFTCLPETQGRTLEDMEILFGHFIKWRSALKE  510



>ref|XP_009344435.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=526

 Score =   439 bits (1128),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 213/319 (67%), Positives = 252/319 (79%), Gaps = 8/319 (3%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VL MPESPRWLVMQGRLGDA++VL +TS+S EE  +RL DIKEAAGIP H +D++V V
Sbjct  209   VGVLFMPESPRWLVMQGRLGDAKKVLQRTSESKEECQLRLDDIKEAAGIPLHLNDDIVQV  268

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             TK R   + VW+EL + PTPAV HILI  VGIH+F+QASGID VVLY PRIFEKAGI S 
Sbjct  269   TK-RSHGEGVWKELILHPTPAVRHILIAAVGIHIFEQASGIDTVVLYSPRIFEKAGITSS  327

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLL T+A+GFTKTVFILVATF LDKFGRRPLLLTSVGGM+ +L  LG+ LT++DH   
Sbjct  328   NHKLLATVAVGFTKTVFILVATFFLDKFGRRPLLLTSVGGMIFSLMFLGVGLTIVDHHKG  387

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
              VPWAV + +AM    VA FSIG GPITWVYSSEIFPLKLRA G S+G   NRVTSG+VS
Sbjct  388   SVPWAVGLCMAMVYFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSIGVACNRVTSGIVS  447

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR----  400
             MTFISLYKAI+IGG+FFLYA I+A  W+FF+T++PETQG+TLE+ E LFG +FRWR    
Sbjct  448   MTFISLYKAITIGGAFFLYAGISAAAWMFFYTMLPETQGRTLEDMEVLFGKYFRWRKANA  507

Query  399   --SRQREVDAKKANNNSQL  349
                 +++VD    NNN+Q+
Sbjct  508   MLKERKQVDGDD-NNNAQV  525



>gb|AGG19155.1| sorbitol transporter [Pyrus pyrifolia]
Length=535

 Score =   439 bits (1128),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 220/329 (67%), Positives = 254/329 (77%), Gaps = 8/329 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVMQGRLGDA RVL KTSDS EE+ +RLADIKEAAGIPEHC D+VV V
Sbjct  208   VGVLAMPESPRWLVMQGRLGDATRVLDKTSDSKEESRLRLADIKEAAGIPEHCTDDVVQV  267

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+   +D VW+EL + PTPA+ HILI  +GIH FQQASGIDAVVLY PRIFEKAGI +D
Sbjct  268   AKRSKGQD-VWKELLLHPTPAIRHILICAIGIHFFQQASGIDAVVLYSPRIFEKAGITND  326

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLLCT+A+GF KTVFILVATF +DK GRRPLLL SV GM+ +L  LG+ LT+ID +H 
Sbjct  327   DKKLLCTVAVGFVKTVFILVATFFVDKVGRRPLLLASVAGMILSLIGLGLGLTIIDQNHG  386

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             ++ WA  + I M L YVA FSIG GPITWVYSSEIFPLKLRA GCSLG  +NRV SGV+S
Sbjct  387   RIMWAAVLCITMVLLYVAFFSIGMGPITWVYSSEIFPLKLRAQGCSLGVAMNRVVSGVLS  446

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFISLY+AI+IGG+FFLYAAIA V WVFFF ++PET G+TLE+ E LFG F +WR    
Sbjct  447   MTFISLYEAITIGGAFFLYAAIATVAWVFFFIMLPETHGRTLEDMEVLFGKFHKWRKANA  506

Query  387   EVDAKK-------ANNNSQLQMGTLQAAN  322
              +  KK         NN Q+Q+GT    N
Sbjct  507   LLKQKKNLSHGDGNTNNGQVQLGTKGQVN  535



>ref|XP_008387369.1| PREDICTED: putative polyol transporter 1 isoform X2 [Malus domestica]
Length=535

 Score =   439 bits (1128),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 221/329 (67%), Positives = 255/329 (78%), Gaps = 8/329 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVMQGRLGDA RVL KTSDS EE+ +RLADIKEAAGIPEHC D+VV V
Sbjct  208   VGVLAMPESPRWLVMQGRLGDATRVLDKTSDSKEESMLRLADIKEAAGIPEHCTDDVVQV  267

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+   +D VW+EL + PTPAV HILI  VGIH FQQASGIDAVVLY PRIFEKAGI + 
Sbjct  268   PKRSQGQD-VWKELLLHPTPAVRHILICAVGIHFFQQASGIDAVVLYSPRIFEKAGITNS  326

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLLCT+A+GF KTVFILVATF +DK GRRPLLL SV GM+ +L  LG+ LT+ID +HE
Sbjct  327   DKKLLCTVAVGFVKTVFILVATFFVDKVGRRPLLLASVAGMILSLTGLGLGLTIIDQNHE  386

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             ++ WA  + + M L YVA FSIG GPITWVYSSEIFPLKLRA GCS+G  +NRV SGV+S
Sbjct  387   RILWAAVLCLTMVLLYVAFFSIGMGPITWVYSSEIFPLKLRAQGCSIGVAMNRVVSGVLS  446

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFISLY AI+IGG+FFLYAAIA+V WVFFFT++PET G+TLE+ E LFG F +WR    
Sbjct  447   MTFISLYDAITIGGAFFLYAAIASVAWVFFFTMLPETHGRTLEDMEVLFGKFHKWRKANA  506

Query  387   EVDAKK-------ANNNSQLQMGTLQAAN  322
              +  KK         NN Q+Q+GT    N
Sbjct  507   LLKQKKNASHGDGNANNGQVQLGTRGQVN  535



>gb|ACD68477.1| plasma membrane mannitol transporter [Arachis hypogaea]
Length=434

 Score =   435 bits (1118),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 210/317 (66%), Positives = 254/317 (80%), Gaps = 4/317 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVM+GRLGDAR+VL KTSD+ EEA  RL+DIK+AAGIPEHC+D+VV V
Sbjct  121   VGVLAMPESPRWLVMRGRLGDARKVLNKTSDTKEEAQERLSDIKKAAGIPEHCNDDVVQV  180

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+   E  VW+ELF+ PTPAV HILI  +GIH FQ + GIDAVVLY PRIFEKAGI SD
Sbjct  181   AKQNTGE-GVWKELFLYPTPAVRHILIAALGIHFFQNSVGIDAVVLYSPRIFEKAGITSD  239

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             TDKLL T+A+GF KT+FILVATF LD+ GRRPLLL+SVGGM+ ++  LG+SLT+I HS +
Sbjct  240   TDKLLATVAVGFVKTLFILVATFMLDRVGRRPLLLSSVGGMILSVLTLGISLTIITHSDK  299

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WAV ++IA  L+YVA FSIGAGPITWVYSSEIFPL+LRA G ++G  +NRVTSGV+S
Sbjct  300   KLMWAVGLSIATVLSYVATFSIGAGPITWVYSSEIFPLRLRAQGAAMGVVVNRVTSGVIS  359

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SL KAISIGG+FFL+  IA VGW+FF+T++PET+GKTLE+ E  FG F   R+   
Sbjct  360   MTFLSLSKAISIGGAFFLFGGIATVGWIFFYTMLPETRGKTLEDMEGSFGQF---RANPA  416

Query  387   EVDAKKANNNSQLQMGT  337
                     N  Q+Q+GT
Sbjct  417   GTKGVDNGNKGQVQLGT  433



>ref|XP_009375627.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=535

 Score =   438 bits (1127),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 220/329 (67%), Positives = 254/329 (77%), Gaps = 8/329 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVMQGRLGDA RVL KTSDS EE+ +RLADIKEAAGIPEHC D+VV V
Sbjct  208   VGVLAMPESPRWLVMQGRLGDATRVLDKTSDSKEESMLRLADIKEAAGIPEHCTDDVVQV  267

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+   +D VW+EL + PTPA+ HILI  +GIH FQQASGIDAVVLY PRIFEKAGI +D
Sbjct  268   AKRSKGQD-VWKELLLHPTPAIRHILICAIGIHFFQQASGIDAVVLYSPRIFEKAGITND  326

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLLCT+A+GF KTVFILVATF +DK GRRPLLL SV GM+ +L  LG+ LT+ID +H 
Sbjct  327   DKKLLCTVAVGFVKTVFILVATFFVDKVGRRPLLLASVAGMILSLIGLGLGLTIIDQNHG  386

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             ++ WA  + I M L YVA FSIG GPITWVYSSEIFPLKLRA GCSLG  +NRV SGV+S
Sbjct  387   RIMWAAVLCITMVLLYVAFFSIGMGPITWVYSSEIFPLKLRAQGCSLGVAMNRVVSGVLS  446

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFISLY+AI+IGG+FFLYAAIA V WVFFF ++PET G+TLE+ E LFG F +WR    
Sbjct  447   MTFISLYEAITIGGAFFLYAAIATVAWVFFFIMLPETHGRTLEDMEVLFGKFHKWRKANA  506

Query  387   EVDAKK-------ANNNSQLQMGTLQAAN  322
              +  KK         NN Q+Q+GT    N
Sbjct  507   LLKQKKNLSHGDGNTNNGQVQLGTKGQVN  535



>ref|XP_009344433.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=537

 Score =   438 bits (1126),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 212/330 (64%), Positives = 254/330 (77%), Gaps = 9/330 (3%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDA RVL KTSDS EE+ +RLADIKEAAGIPEHC D+VV V
Sbjct  209   LGVLAMPESPRWLVMQGRLGDATRVLNKTSDSKEESLLRLADIKEAAGIPEHCTDDVVQV  268

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+   +D VW+EL + PTPAV HILI  VGIH FQQASGIDA+VLY PR+FEKAGI + 
Sbjct  269   PKRSKGQD-VWKELLLHPTPAVRHILICAVGIHFFQQASGIDAIVLYSPRVFEKAGITNS  327

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH-  751
               KLLCT+A+G  KT+FILVATF LD+ GRRPLLL+SV GM+ +L  LG+ LT+ID  H 
Sbjct  328   DHKLLCTVAVGLAKTIFILVATFLLDRVGRRPLLLSSVAGMIFSLGALGVGLTIIDQHHG  387

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
              K+ W  A+ + M +AY A FSIG GPITWVYSSEIFPLKLRA GCS+G  +NRV SG++
Sbjct  388   AKMTWTTALCLTMVIAYAALFSIGLGPITWVYSSEIFPLKLRAQGCSMGVAMNRVVSGIL  447

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR---  400
             SMTFISLYKAI++GG+FFLY  IAAV WVFF+T+ PETQG+TLE+ E LFG F +WR   
Sbjct  448   SMTFISLYKAITMGGAFFLYGGIAAVAWVFFYTMYPETQGRTLEDMEVLFGKFHKWREAN  507

Query  399   ---SRQREVDAKKANNNS-QLQMGTLQAAN  322
                  + +VD    NN +  +++GT   AN
Sbjct  508   AMLETKTQVDHGDGNNGTGAVELGTKGPAN  537



>ref|XP_009375628.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=537

 Score =   438 bits (1126),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 213/330 (65%), Positives = 254/330 (77%), Gaps = 9/330 (3%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDA RVL KTSDS EE+ +RLADIKEAAGIPEHC D+VV V
Sbjct  209   LGVLAMPESPRWLVMQGRLGDATRVLNKTSDSKEESLLRLADIKEAAGIPEHCTDDVVQV  268

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+   +D VW+EL + PTPAV HILI  VGIH FQQASGIDA+VLY PR+FEKAGI + 
Sbjct  269   PKRSKGQD-VWKELLLHPTPAVRHILICAVGIHFFQQASGIDAIVLYSPRVFEKAGITNS  327

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH-  751
               KLLCT+A+G  KT+FILVATF LD+ GRRPLLL+SV GM+ +L  LG+ LT+ID  H 
Sbjct  328   DHKLLCTVAVGLAKTIFILVATFLLDRVGRRPLLLSSVAGMIFSLGALGVGLTIIDQHHG  387

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
              K+ W  A+ + M +AY A FSIG GPITWVYSSEIFPLKLRA GCS+G  +NRV SGV+
Sbjct  388   AKMTWTTALCLTMVIAYAALFSIGLGPITWVYSSEIFPLKLRAQGCSMGVAMNRVVSGVL  447

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR---  400
             SMTFISLYKAI++GG+FFLY  IAAV WVFF+T+ PETQG+TLE+ E LFG F +WR   
Sbjct  448   SMTFISLYKAITMGGAFFLYGGIAAVAWVFFYTMYPETQGRTLEDMEVLFGKFHKWREAN  507

Query  399   ---SRQREVDAKKANNNS-QLQMGTLQAAN  322
                  + +VD    NN +  +++GT   AN
Sbjct  508   AMLETKTQVDHGDGNNGTGAVELGTKGPAN  537



>gb|ACB86853.1| mannitol transporter [Citrus sinensis]
Length=535

 Score =   438 bits (1126),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 222/329 (67%), Positives = 258/329 (78%), Gaps = 10/329 (3%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVMQGRL DA++VL KTSDS EE+ +RLADIKEAAGIPE C+D+VV V
Sbjct  210   VGVLAMPESPRWLVMQGRLADAKKVLDKTSDSKEESMLRLADIKEAAGIPEDCNDDVVQV  269

Query  1107  TK-KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
              K  RG+   VW+EL + P PAV HI++  VGIH FQQASGID+VVLY PRIFEKAGI S
Sbjct  270   PKINRGE--GVWKELLVRPAPAVRHIIVAAVGIHFFQQASGIDSVVLYSPRIFEKAGITS  327

Query  930   DTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH  751
               +KLL T+A+GF KT FILVATF LDK GRRPLLL+SV GM+ +LA L +SLTVID SH
Sbjct  328   KNEKLLATVAVGFVKTTFILVATFLLDKIGRRPLLLSSVAGMIASLATLAISLTVIDQSH  387

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             +KV WAV +AI+  L+YVA FSIG GPIT VYSSEI PLKLRA G S+G  +NRVTSGVV
Sbjct  388   KKVIWAVGLAISTVLSYVAFFSIGMGPITLVYSSEILPLKLRAQGASIGIMVNRVTSGVV  447

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRW-RSR  394
             SMTF+SL KAI+IGGSFFLYA+IA+V WVFF+T +PETQGKTLEE  ALFG  FRW R  
Sbjct  448   SMTFLSLSKAITIGGSFFLYASIASVAWVFFYTCLPETQGKTLEEMGALFGN-FRWLRDS  506

Query  393   QREVDAKKAN-----NNSQLQMGTLQAAN  322
             +RE    KAN     + S +Q+G +   N
Sbjct  507   KREKRRNKANEINGDSASNVQLGPVSNGN  535



>ref|XP_006423216.1| hypothetical protein CICLE_v10028174mg [Citrus clementina]
 gb|ESR36456.1| hypothetical protein CICLE_v10028174mg [Citrus clementina]
Length=535

 Score =   437 bits (1125),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 222/329 (67%), Positives = 258/329 (78%), Gaps = 10/329 (3%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V  LAMPESPRWLVMQGRL DA++VL KTSDS EE+ +RLADIKEAAGIPE C+D+VV V
Sbjct  210   VGALAMPESPRWLVMQGRLADAKKVLDKTSDSKEESMLRLADIKEAAGIPEDCNDDVVQV  269

Query  1107  TK-KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
              K  RG+   VW+EL + PTPAV HI++  VGIH FQQASGID+VVLY PRIFEKAGI S
Sbjct  270   PKINRGE--GVWKELLVRPTPAVRHIIVAAVGIHFFQQASGIDSVVLYSPRIFEKAGITS  327

Query  930   DTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH  751
               +KLL T+A+GF KT FILVATF LDK GRRPLLL+SV GM+ +LA L +SLTVID SH
Sbjct  328   KNEKLLATVAVGFVKTTFILVATFLLDKIGRRPLLLSSVAGMIASLATLAISLTVIDQSH  387

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             +KV WAV +AI+  L+YVA FSIG GPIT VYSSEI PLKLRA G S+G  +NRVTSGVV
Sbjct  388   KKVIWAVGLAISTVLSYVAFFSIGMGPITLVYSSEILPLKLRAQGASIGIMVNRVTSGVV  447

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRW-RSR  394
             SMTF+SL KAI+IGGSFFLYA+IA+V WVFF+T +PETQGKTLEE  ALFG  FRW R  
Sbjct  448   SMTFLSLSKAITIGGSFFLYASIASVAWVFFYTCLPETQGKTLEEMGALFGN-FRWLRDS  506

Query  393   QREVDAKKAN-----NNSQLQMGTLQAAN  322
             +RE    KAN     + S +Q+G +   N
Sbjct  507   KREKRRNKANEINGDSASNVQLGPVSNGN  535



>ref|XP_003541068.1| PREDICTED: polyol transporter 5-like [Glycine max]
Length=523

 Score =   437 bits (1123),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 214/319 (67%), Positives = 257/319 (81%), Gaps = 6/319 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVM+GRLG+AR+VL KTSDS EEA +RLA+IK+AAGIPE C+D+VV V
Sbjct  205   VGVLAMPESPRWLVMRGRLGEARKVLNKTSDSREEAQLRLAEIKQAAGIPESCNDDVVQV  264

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             TK R   + VW+ELF+ PTP + HI+I  +GIH FQQASG+DAVVLY PRIFEKAGIK D
Sbjct  265   TK-RSTGEGVWKELFLYPTPPIRHIVIAALGIHFFQQASGVDAVVLYSPRIFEKAGIKDD  323

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             T KLL T+A+GF KTVFIL ATFTLD+ GRRPLLL+SVGGMV +L  L +SLT+I HS  
Sbjct  324   THKLLATVAVGFVKTVFILAATFTLDRVGRRPLLLSSVGGMVLSLLTLAISLTIIGHSER  383

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WAVA++IAM LAYVA FSIGAGPITWVYSSEIFPL+LRA G + G  +NR TSGVVS
Sbjct  384   KLMWAVALSIAMVLAYVATFSIGAGPITWVYSSEIFPLRLRAQGAAAGVVVNRTTSGVVS  443

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SL +AI+IGG+FFLY  IA +GW+FF+TL+PET+GKTLE+ E  FGTF   RS+  
Sbjct  444   MTFLSLSEAITIGGAFFLYCGIATLGWIFFYTLLPETRGKTLEDMEGSFGTF---RSKSN  500

Query  387   EVDAKKANNN--SQLQMGT  337
                  +  N   +Q+Q+GT
Sbjct  501   ATKGVENGNGQVAQVQLGT  519



>gb|KHN25361.1| Polyol transporter 5 [Glycine soja]
Length=521

 Score =   436 bits (1121),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 213/319 (67%), Positives = 258/319 (81%), Gaps = 6/319 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             ++VLAMPESPRWLVM+GRLG+AR+VL KTSDS EEA +RLA+IK+AAGIPE C+D+VV V
Sbjct  203   LTVLAMPESPRWLVMRGRLGEARKVLNKTSDSREEAQLRLAEIKQAAGIPESCNDDVVQV  262

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             TK R   + VW+ELF+ PTP + HI+I  +GIH FQQASG+DAVVLY PRIFEKAGIK D
Sbjct  263   TK-RSTGEGVWKELFLYPTPPIRHIVIAALGIHFFQQASGVDAVVLYSPRIFEKAGIKDD  321

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             T KLL T+A+GF KTVFIL ATFTLD+ GRRPLLL+SVGGMV +L  L +SLT+I HS  
Sbjct  322   THKLLATVAVGFVKTVFILAATFTLDRVGRRPLLLSSVGGMVLSLLTLAISLTIIGHSER  381

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WAVA++IAM LAYVA FSIGAGPITWVYSSEIFPL+LRA G + G  +NR TSGVVS
Sbjct  382   KLMWAVALSIAMVLAYVATFSIGAGPITWVYSSEIFPLRLRAQGAAAGVVVNRTTSGVVS  441

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SL +AI+IGG+FFLY  IA +GW+FF+TL+PET+GKTLE+ E  FGTF   RS+  
Sbjct  442   MTFLSLSEAITIGGAFFLYCGIATLGWIFFYTLLPETRGKTLEDMEGSFGTF---RSKSN  498

Query  387   EVDAKKANNN--SQLQMGT  337
                  +  N   +Q+Q+GT
Sbjct  499   ATKGVENGNGQVAQVQLGT  517



>gb|KEH30427.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=333

 Score =   429 bits (1103),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 208/318 (65%), Positives = 254/318 (80%), Gaps = 4/318 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVM+GRLGDA +VL KTSDS EEA +RLA+IK+AAGIPE C+D+VV V
Sbjct  15    VGVLAMPESPRWLVMRGRLGDAIKVLNKTSDSKEEAQLRLAEIKQAAGIPEDCNDDVVEV  74

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               K   E  VW+ELF+ PTPAV HI+I  +GIH FQQASG+DAVVLY P IF+KAGI  D
Sbjct  75    KVKNTGE-GVWKELFLYPTPAVRHIVIAALGIHFFQQASGVDAVVLYSPTIFKKAGINGD  133

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             T  L+ TIA+GF KT+FILVATF LD++GRRPLLLTSVGGMV +L  L +SLT+IDHS+ 
Sbjct  134   THLLIATIAVGFVKTLFILVATFMLDRYGRRPLLLTSVGGMVVSLLTLAVSLTIIDHSNT  193

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WA+ ++IA  L+YVA FSIGAGPITWVYSSEIFPL+LRA G + G  +NRVTSGV+S
Sbjct  194   KLNWAIGLSIATVLSYVATFSIGAGPITWVYSSEIFPLRLRAQGAACGVVVNRVTSGVIS  253

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SL K I+IGG+FFL+  IA +GW+FF+ ++PETQGKTLEE EA FG    WR  + 
Sbjct  254   MTFLSLSKGITIGGAFFLFGGIATIGWIFFYIMLPETQGKTLEEMEASFGKI--WRKSKN  311

Query  387   EVDAKKANNN-SQLQMGT  337
               +A+K N   +Q+Q+GT
Sbjct  312   TKEAEKDNAQVAQVQLGT  329



>ref|NP_001280902.1| putative polyol transporter 1 [Malus domestica]
 dbj|BAD42343.1| sorbitol transporter [Malus domestica]
Length=526

 Score =   436 bits (1120),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 213/319 (67%), Positives = 249/319 (78%), Gaps = 8/319 (3%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VL MPESPRWLVMQGRLGDA++VL +TS+S EE  +RL DIKEAAGIP H +D++V V
Sbjct  209   VGVLFMPESPRWLVMQGRLGDAKKVLQRTSESKEECQLRLDDIKEAAGIPPHLNDDIVQV  268

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             TK    E  VW+EL + PTPAV HILI  VGIH F+QASGID VVLY PRIF KAGI S 
Sbjct  269   TKSSHGE-GVWKELILHPTPAVRHILIAAVGIHFFEQASGIDTVVLYSPRIFAKAGITSS  327

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLL T+A+GFTKTVFILVATF LDKFGRRPLLLTSVGGMV +L  LG+ LT++DH   
Sbjct  328   NHKLLATVAVGFTKTVFILVATFFLDKFGRRPLLLTSVGGMVFSLMFLGVGLTIVDHHKG  387

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
              VPWA+ + +AM    VA FSIG GPITWVYSSEIFPLKLRA G S+G   NRVTSGVVS
Sbjct  388   SVPWAIGLCMAMVYFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSIGVACNRVTSGVVS  447

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR----  400
             MTFISLYKAI+IGG+FFLYA I+A  W+FF+T++PETQG+TLE+TE LFG + RWR    
Sbjct  448   MTFISLYKAITIGGAFFLYAGISAAAWIFFYTMLPETQGRTLEDTEVLFGKYHRWRKANA  507

Query  399   --SRQREVDAKKANNNSQL  349
                 +++VD    NNN+Q+
Sbjct  508   MLKERKQVDGDD-NNNAQV  525



>ref|XP_008387377.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=520

 Score =   435 bits (1118),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 206/312 (66%), Positives = 252/312 (81%), Gaps = 1/312 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVMQGRLGDAR+VL KTS + EEA +RL +IKEAAGIP+  ++++V V
Sbjct  208   VGVLAMPESPRWLVMQGRLGDARKVLNKTSCTHEEAQLRLDEIKEAAGIPKESNEDIVQV  267

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +KK   E  VW++L + PTPAV HILI GVGIH FQQ SGID+VVLY PRIFEKAGI S 
Sbjct  268   SKKSKGE-GVWKDLIVRPTPAVRHILIAGVGIHFFQQISGIDSVVLYSPRIFEKAGITSY  326

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
              DKLL T+A+G  KT+FILVATF LDKFGRRPLLLTSVGGM+ +L LLG+ LTV+DHSH 
Sbjct  327   NDKLLATVAVGVVKTIFILVATFMLDKFGRRPLLLTSVGGMIFSLTLLGVGLTVVDHSHG  386

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KV WAVA+ IAM +  VA FSIG GP+TWVYSSEI+PL+LRA GC++G  +NRV SGV+S
Sbjct  387   KVQWAVALCIAMVMFNVAFFSIGLGPVTWVYSSEIYPLQLRAQGCAMGVAMNRVMSGVIS  446

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFISLYKAI+IGG+FFLYA  +++ ++FF+T++PETQG+TLE+ E LFG + +WR    
Sbjct  447   MTFISLYKAITIGGAFFLYAGTSSIAFIFFYTMLPETQGRTLEDMELLFGKYHKWRQANA  506

Query  387   EVDAKKANNNSQ  352
              +  K+A   SQ
Sbjct  507   MLKKKEAAEKSQ  518



>ref|XP_009375822.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=520

 Score =   434 bits (1116),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 204/312 (65%), Positives = 253/312 (81%), Gaps = 1/312 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VL MPESPRWLVMQGRLGDAR+VL KTS + EEA +RL +IKEAAGIP+  ++++V V
Sbjct  208   VGVLGMPESPRWLVMQGRLGDARKVLNKTSSTHEEAELRLDEIKEAAGIPKESNEDIVQV  267

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +KK   E  VW++LF+ PTPAV HILI GVGIH FQQ SGID+VVLY PRIFEKAGI S 
Sbjct  268   SKKSKGE-GVWKDLFLRPTPAVRHILIVGVGIHFFQQVSGIDSVVLYSPRIFEKAGITSY  326

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
              DKLL T+A+G  KT+FILVATF LDKFGRRPLLLTSVGGM+ +L LLG+ LTV++HSH 
Sbjct  327   NDKLLATVAVGVVKTLFILVATFMLDKFGRRPLLLTSVGGMIFSLMLLGVGLTVVEHSHS  386

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KV WA+A+ IAM L+ VA FSIG GPITWVYSSEI+PL+LRA GC++G  +NR+ SGV+S
Sbjct  387   KVQWAIALCIAMVLSNVAFFSIGLGPITWVYSSEIYPLQLRAQGCAMGVAMNRLMSGVIS  446

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFISLYKAI+IGG+FFLYA  +++ ++FF+T++PETQG++LE+ E LFG + +WR    
Sbjct  447   MTFISLYKAITIGGAFFLYAGTSSIAFMFFYTMLPETQGRSLEDMELLFGKYHKWRQANA  506

Query  387   EVDAKKANNNSQ  352
              +  K+A   SQ
Sbjct  507   MLKKKEAAEKSQ  518



>gb|EYU37769.1| hypothetical protein MIMGU_mgv1a005015mg [Erythranthe guttata]
Length=500

 Score =   433 bits (1114),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 204/310 (66%), Positives = 248/310 (80%), Gaps = 1/310 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VL MPESPRWLVMQGRLGDA++VL K S+SPEEA +RL +IKEAAGIPE   D+VV V
Sbjct  186   LGVLFMPESPRWLVMQGRLGDAKKVLGKISNSPEEASIRLIEIKEAAGIPESSHDDVVPV  245

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               KR   + VWREL ISPTPAV HIL+  +GIH FQQASGID+VVLY P IFEKAGIKSD
Sbjct  246   -PKRNHGEGVWRELLISPTPAVRHILLCAIGIHFFQQASGIDSVVLYSPVIFEKAGIKSD  304

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             +DKLL T+A+GFTKTVFILVATF LD+ GRRP++L+S+GGM+ ++  L   LTVID +  
Sbjct  305   SDKLLATVAVGFTKTVFILVATFLLDRVGRRPMVLSSMGGMIVSIMCLATGLTVIDQADH  364

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WA+A+  A  + YVA FSIG GPI WVYSSE FPL+LRA GCS+G  +NR  S ++S
Sbjct  365   KIMWAIALCTASIMFYVAFFSIGMGPIAWVYSSETFPLRLRAQGCSMGVALNRCISALIS  424

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFI+LYK I+IGG+F+LY AI+ V W+FFFTL+PETQGKTLEE E+LFGTFFRWR+  R
Sbjct  425   MTFITLYKGITIGGAFYLYGAISIVAWLFFFTLLPETQGKTLEEMESLFGTFFRWRTTLR  484

Query  387   EVDAKKANNN  358
             E++ +K   N
Sbjct  485   ELNERKREKN  494



>gb|AAZ80876.1| putative sorbitol transporter, partial [Nicotiana langsdorffii 
x Nicotiana sanderae]
Length=312

 Score =   426 bits (1095),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 218/310 (70%), Positives = 250/310 (81%), Gaps = 9/310 (3%)
 Frame = -3

Query  1233  LGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTKKRGDEDSVWRELFISP  1054
             LGDARRVL KTSDS EEA +RLADIK+AAGIPEHC+D++V V  KR   D+VWREL  SP
Sbjct  1     LGDARRVLNKTSDSLEEAQLRLADIKQAAGIPEHCNDDIVEV-PKRPKGDNVWRELIFSP  59

Query  1053  TPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTDKLLCTIAIGFTKTVFI  874
             TPAV HIL+TGVGIH FQQASGIDAVVLY PRIFEKAGIK+D +KLL T+A+GF KT+FI
Sbjct  60    TPAVRHILLTGVGIHFFQQASGIDAVVLYSPRIFEKAGIKTDRNKLLATVAVGFVKTIFI  119

Query  873   LVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWAVAMAIAMTLAYVA  694
             LVATF LDK GRR LLLTSV GMV +L LL   LT+ID S +KV WA+A++I M LAYVA
Sbjct  120   LVATFMLDKSGRRKLLLTSVAGMVLSLMLLATGLTIIDQSEQKVIWAIALSITMVLAYVA  179

Query  693   AFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFISLYKAISIGGSFFL  514
              FSIG GPITWVYSSEIFPL+LRATGCS+G  +NRVTSGVVSMTF++L K I+IGG+FFL
Sbjct  180   LFSIGMGPITWVYSSEIFPLRLRATGCSIGVAVNRVTSGVVSMTFLTLVKRITIGGAFFL  239

Query  513   YAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVD--------AKKANNN  358
             Y  +AA  +VFFFTLMPETQGKTLEE EALFGTF+ WR   RE+          K +N+N
Sbjct  240   YFGLAAAAFVFFFTLMPETQGKTLEEMEALFGTFWNWRKTARELKEAKITEKTEKNSNDN  299

Query  357   SQLQMGTLQA  328
              Q+QMGT  A
Sbjct  300   GQIQMGTAPA  309



>ref|XP_003631630.1| PREDICTED: polyol transporter 5 [Vitis vinifera]
 gb|ADP37154.1| putative polyol/monosaccharide transporter [Vitis vinifera]
Length=528

 Score =   433 bits (1114),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 214/319 (67%), Positives = 251/319 (79%), Gaps = 6/319 (2%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             V+AMPESPRWLVMQG+LG A+RVL KTSDS EE+ +RLADIK AAGIPE C D+VV V  
Sbjct  210   VIAMPESPRWLVMQGQLGLAKRVLDKTSDSKEESQLRLADIKAAAGIPEECTDDVVAV-P  268

Query  1101  KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTD  922
             KR   + VWREL I PTP+V  ILI  VGIH FQQASGIDAVVLY PRIFEKAGIK D  
Sbjct  269   KRSHGEGVWRELLIFPTPSVRRILIAAVGIHFFQQASGIDAVVLYSPRIFEKAGIKDDEH  328

Query  921   KLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKV  742
              LL T+A+GF KT FILVATF LD+ GRRPLLLTSV GM+ +LA LGM LTVIDHS  K+
Sbjct  329   ILLATVAVGFVKTCFILVATFLLDRVGRRPLLLTSVAGMIFSLAALGMGLTVIDHSDTKL  388

Query  741   PWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMT  562
              WAVA+++   L+YVA FSIG GPITWVYSSEIFPL+LRA GCS+G G+NRVTSGV+SMT
Sbjct  389   IWAVALSLCTVLSYVAFFSIGMGPITWVYSSEIFPLRLRAQGCSIGVGVNRVTSGVLSMT  448

Query  561   FISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV  382
             FISLYKAI+IGG+FFLY+ +A VGW+FF+T +PETQG+TLE+ E LF T   W  ++   
Sbjct  449   FISLYKAITIGGAFFLYSGVALVGWIFFYTWLPETQGRTLEDMEILF-TNSSWNKKKSST  507

Query  381   DAKKANNNS----QLQMGT  337
             +    N+N     Q+Q+GT
Sbjct  508   NDTSGNSNDHINGQIQLGT  526



>gb|AGY96955.1| polyol transporter 1 [Vitis vinifera]
Length=528

 Score =   433 bits (1114),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 214/319 (67%), Positives = 251/319 (79%), Gaps = 6/319 (2%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             V+AMPESPRWLVMQG+LG A+RVL KTSDS EE+ +RLADIK AAGIPE C D+VV V  
Sbjct  210   VIAMPESPRWLVMQGQLGLAKRVLDKTSDSKEESQLRLADIKAAAGIPEECTDDVVAV-P  268

Query  1101  KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTD  922
             KR   + VWREL I PTP+V  ILI  VGIH FQQASGIDAVVLY PRIFEKAGIK D  
Sbjct  269   KRSHGEGVWRELLIFPTPSVRRILIAAVGIHFFQQASGIDAVVLYSPRIFEKAGIKDDDH  328

Query  921   KLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKV  742
              LL T+A+GF KT FILVATF LD+ GRRPLLLTSV GM+ +LA LGM LTVIDHS  K+
Sbjct  329   ILLATVAVGFVKTCFILVATFLLDRVGRRPLLLTSVAGMIFSLAALGMGLTVIDHSDTKL  388

Query  741   PWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMT  562
              WAVA+++   L+YVA FSIG GPITWVYSSEIFPL+LRA GCS+G G+NRVTSGV+SMT
Sbjct  389   IWAVALSLCTVLSYVAFFSIGMGPITWVYSSEIFPLRLRAQGCSIGVGVNRVTSGVLSMT  448

Query  561   FISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV  382
             FISLYKAI+IGG+FFLY+ +A VGW+FF+T +PETQG+TLE+ E LF T   W  ++   
Sbjct  449   FISLYKAITIGGAFFLYSGVALVGWIFFYTWLPETQGRTLEDMEILF-TNSSWNKKKSST  507

Query  381   DAKKANNNS----QLQMGT  337
             +    N+N     Q+Q+GT
Sbjct  508   NDTSGNSNDHINGQIQLGT  526



>ref|XP_008246181.1| PREDICTED: polyol transporter 5-like, partial [Prunus mume]
Length=359

 Score =   427 bits (1098),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 203/309 (66%), Positives = 244/309 (79%), Gaps = 1/309 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVMQGRLGDA+RVL KTS S EEA +RL DIKEAAGIP H +D+VV+V
Sbjct  41    VGVLAMPESPRWLVMQGRLGDAKRVLDKTSTSKEEAQLRLDDIKEAAGIPMHLNDDVVSV  100

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             TK+   E  VWR+L + PTPAVLHILI  +GIH FQQ +GID+VVLY PRIF KAGI S 
Sbjct  101   TKQSHGE-GVWRQLILHPTPAVLHILIAALGIHFFQQVTGIDSVVLYSPRIFAKAGITSY  159

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
                LL T+A+GF KT+FI +ATF LD+ GRRPLLLTS+GGM+ +LA LG +LT++DH   
Sbjct  160   EHTLLATVAVGFIKTIFIFIATFLLDRVGRRPLLLTSMGGMILSLACLGAALTIVDHHDS  219

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
              +PWAVA+ I M L  VA FSIG GPITWVYSSEIFPLKLRA G SLG  +NRV SG++S
Sbjct  220   TIPWAVALCITMVLFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSLGVAVNRVISGIIS  279

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SLYKAI+IGG+FFLYA I  + WVFF+T++PETQG+TLEE E LFG + +WR    
Sbjct  280   MTFLSLYKAITIGGAFFLYAGIGVLAWVFFYTMLPETQGRTLEEMEVLFGKYHKWRQANA  339

Query  387   EVDAKKANN  361
              + +KK ++
Sbjct  340   MLKSKKVDH  348



>ref|XP_008387376.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=520

 Score =   433 bits (1113),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 205/312 (66%), Positives = 251/312 (80%), Gaps = 1/312 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VL MPESPRWLVMQGRLGDAR+VL KTS + EEA +RL +IKEAAGIP+  ++++V V
Sbjct  208   VGVLXMPESPRWLVMQGRLGDARKVLNKTSCTHEEAQLRLDEIKEAAGIPKESNEDIVQV  267

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +KK   E  VW++L + PTPAV HILI GVGIH FQQ SGID+VVLY PRIFEKAGI S 
Sbjct  268   SKKSKGE-GVWKDLIVRPTPAVRHILIXGVGIHFFQQISGIDSVVLYSPRIFEKAGITSY  326

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
              DKLL T+A+G  KT+FILVATF LDKFGRRPLLLTSVGGM+ +L LLG+ LTV+DHSH 
Sbjct  327   NDKLLATVAVGVVKTIFILVATFMLDKFGRRPLLLTSVGGMIFSLTLLGVGLTVVDHSHG  386

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KV WAVA+ IAM +  VA FSIG GP+TWVYSSEI+PL+LRA GC++G  +NRV SGV+S
Sbjct  387   KVQWAVALCIAMVMFNVAFFSIGLGPVTWVYSSEIYPLQLRAQGCAMGVAMNRVMSGVIS  446

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFISLYKAI+IGG+FFLYA  +++ ++FF+T++PETQG+TLE+ E LFG + +WR    
Sbjct  447   MTFISLYKAITIGGAFFLYAGTSSIAFIFFYTMLPETQGRTLEDMELLFGKYHKWRQANA  506

Query  387   EVDAKKANNNSQ  352
              +  K+A   SQ
Sbjct  507   MLKKKEAAEKSQ  518



>ref|XP_012069681.1| PREDICTED: putative polyol transporter 1 [Jatropha curcas]
 gb|KDP46230.1| hypothetical protein JCGZ_10070 [Jatropha curcas]
Length=542

 Score =   433 bits (1114),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 206/319 (65%), Positives = 251/319 (79%), Gaps = 5/319 (2%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VL MPESPRWL++QGRLG+A+RVL +TSDS E +  RLADIKEAAGIP+ C+D++V V K
Sbjct  216   VLVMPESPRWLILQGRLGEAKRVLDRTSDSKEGSEARLADIKEAAGIPKDCNDDIVQVQK  275

Query  1101  KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTD  922
             +   E  VWREL + PTP+V HIL+  +GIH FQQASGIDAVVLY PRIFEKAGI SD  
Sbjct  276   QSHGE-GVWRELLLHPTPSVRHILVCAIGIHFFQQASGIDAVVLYSPRIFEKAGITSDNK  334

Query  921   KLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKV  742
             KLL T+A+GF KT+FILVATF LD+ GRRPLLL SV GM+ +LA LG SLT+IDHSH+K+
Sbjct  335   KLLATVAVGFVKTMFILVATFFLDRIGRRPLLLASVAGMIFSLATLGFSLTIIDHSHDKL  394

Query  741   PWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMT  562
              WA+ + I M LAYVA FSIG GPITWVYSSE+FPL+LRA G S+G  +  VTSGV+S T
Sbjct  395   TWAIVLCITMVLAYVAFFSIGMGPITWVYSSEVFPLRLRAQGASMGVAVGGVTSGVISTT  454

Query  561   FISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV  382
             FISLYK I+IGG+FFL+AAIA   W FFFT +PET+G+TLE+ E  FG+F  WRS  +E 
Sbjct  455   FISLYKGITIGGAFFLFAAIATGAWTFFFTCLPETRGRTLEDMEVRFGSFINWRSALKEE  514

Query  381   DAKK----ANNNSQLQMGT  337
             + KK    + N+ Q+Q+GT
Sbjct  515   NLKKKAASSENDDQIQLGT  533



>ref|XP_006487181.1| PREDICTED: polyol transporter 5-like [Citrus sinensis]
Length=539

 Score =   433 bits (1113),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 222/333 (67%), Positives = 258/333 (77%), Gaps = 14/333 (4%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V  LAMPESPRWLVMQGRL DA++VL KTSDS EE+ +RLADIKEAAGIPE C+D+VV V
Sbjct  210   VGALAMPESPRWLVMQGRLADAKKVLDKTSDSKEESMLRLADIKEAAGIPEDCNDDVVQV  269

Query  1107  TK-KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
              K  RG+   VW+EL + PTPAV HI++  VGIH FQQASGID+VVLY PRIFEKAGI S
Sbjct  270   PKINRGE--GVWKELLVRPTPAVRHIIVAAVGIHFFQQASGIDSVVLYSPRIFEKAGITS  327

Query  930   DTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH  751
               +KLL T+A+GF KT FILVATF LDK GRRPLLL+SV GM+ +LA L +SLTVID SH
Sbjct  328   KNEKLLATVAVGFVKTTFILVATFLLDKIGRRPLLLSSVAGMIASLATLAISLTVIDQSH  387

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSL----GTGINRVT  583
             +KV WAV +AI+  L+YVA FSIG GPIT VYSSEI PLKLRA G S+    G  +NRVT
Sbjct  388   KKVIWAVGLAISTVLSYVAFFSIGMGPITLVYSSEILPLKLRAQGASIGIMVGVMVNRVT  447

Query  582   SGVVSMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRW  403
             SGVVSMTF+SL KAI+IGGSFFLYA+IA+V WVFF+T +PETQGKTLEE  ALFG  FRW
Sbjct  448   SGVVSMTFLSLSKAITIGGSFFLYASIASVAWVFFYTCLPETQGKTLEEMGALFGN-FRW  506

Query  402   -RSRQREVDAKKAN-----NNSQLQMGTLQAAN  322
              R  +RE    KAN     + S +Q+G +   N
Sbjct  507   LRDSKREKRRNKANEINGDSASNVQLGPVSNGN  539



>ref|XP_008387373.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=526

 Score =   432 bits (1111),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 211/319 (66%), Positives = 250/319 (78%), Gaps = 8/319 (3%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VL MPESPRWLVMQGRLGDA++VL +TS+S EE  +RL DIKEAAGIP H +D++V V
Sbjct  209   VGVLFMPESPRWLVMQGRLGDAKKVLQRTSESKEECQLRLDDIKEAAGIPPHLNDDIVQV  268

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             TK R   + VW+EL + PTPAV HILI  VGIH+F+QASGID VVLY PRIFEKAGI S 
Sbjct  269   TK-RSHGEGVWKELILHPTPAVRHILIAAVGIHIFEQASGIDTVVLYSPRIFEKAGITSS  327

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLL T+A+GFTKTVFILVATF LDKFGRRPLLLTSVGGMV +L  LG+ LT++DH   
Sbjct  328   NHKLLATVAVGFTKTVFILVATFFLDKFGRRPLLLTSVGGMVFSLMFLGVGLTIVDHHKG  387

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
              VPWAV + +AM    VA FSIG GPITWVYSSEIFPLKLRA G S+G   NRVTSG+VS
Sbjct  388   SVPWAVGLCMAMIYFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSIGVACNRVTSGIVS  447

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR----  400
             MTFISLYKAI+IGG+FFLYA I+A  W+FF+T++PETQG+ LE+ E LFG + RWR    
Sbjct  448   MTFISLYKAITIGGAFFLYAGISAAAWMFFYTMLPETQGRPLEDMEVLFGKYHRWRKADA  507

Query  399   --SRQREVDAKKANNNSQL  349
                 +++VD    N+N+Q+
Sbjct  508   MLKERKQVDGDD-NDNAQV  525



>ref|XP_009336961.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=526

 Score =   431 bits (1109),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 210/318 (66%), Positives = 247/318 (78%), Gaps = 6/318 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VL MPESPRWLVMQGRLGDA++VL +TS+S EE  +R+ DIKEAAGIP H +D++V V
Sbjct  209   VGVLFMPESPRWLVMQGRLGDAKKVLQRTSESKEECQLRIDDIKEAAGIPPHLNDDIVQV  268

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             T+ R   + VW+EL + PTPAV HILI  VGIH+F+QASGID VVLY PRIF+KAGI S 
Sbjct  269   TR-RSHGEGVWKELILHPTPAVRHILIAAVGIHIFEQASGIDTVVLYSPRIFDKAGITSS  327

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLL TIA+GFTKTVFILVATF LDKFGRRPLLLTSV GMV +L  LG+ LT++DH   
Sbjct  328   NHKLLATIAVGFTKTVFILVATFFLDKFGRRPLLLTSVAGMVFSLTFLGVGLTIVDHHKG  387

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
              VPWA+ + +AM    VA FSIG GPITWVYSSEIFPLKLRA G S+G   NRVTSGVVS
Sbjct  388   SVPWAIGLCLAMVYFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSIGVACNRVTSGVVS  447

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
              TFISLYKAI+IGG+FFLYA I+A  W+FF+TL+PETQG+TLE+ E LFG F RWR    
Sbjct  448   TTFISLYKAITIGGAFFLYAGISAAAWIFFYTLLPETQGRTLEDMEVLFGKFHRWRKANA  507

Query  387   EVDAKKA-----NNNSQL  349
              +  +K      NNN+Q+
Sbjct  508   MLKERKQVHGDDNNNAQV  525



>ref|XP_009378956.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=530

 Score =   432 bits (1110),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 207/310 (67%), Positives = 246/310 (79%), Gaps = 1/310 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDA+RVL KTS S EE+ +RL +IKEAAGIP+   DEVV V
Sbjct  211   LGVLAMPESPRWLVMQGRLGDAKRVLNKTSSSEEESQLRLDEIKEAAGIPKDSKDEVVQV  270

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +K R   + +W+EL I PTPAV HILI  +GIH FQQ SGID+VVLY PRIFE AGI S 
Sbjct  271   SK-RSQGEGIWKELLIRPTPAVRHILIAALGIHFFQQLSGIDSVVLYSPRIFENAGITSY  329

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
              DKLL T+A+GF KT+ ILVATF +D+FGRR LLL+SVGGMV +  LLG+ LTVID SH 
Sbjct  330   NDKLLATVAVGFVKTIAILVATFQVDRFGRRILLLSSVGGMVISFILLGVGLTVIDQSHN  389

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KVPWAV + IAM L  VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+S
Sbjct  390   KVPWAVGLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVIS  449

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFISLYKAI+IGG+FFLYA IAA+ WVFF+TL PETQG++LE+ E LFG + +W+    
Sbjct  450   MTFISLYKAITIGGAFFLYAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWKEANA  509

Query  387   EVDAKKANNN  358
              ++  K  ++
Sbjct  510   MLNKTKQADH  519



>ref|XP_009345075.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=538

 Score =   432 bits (1110),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 208/322 (65%), Positives = 248/322 (77%), Gaps = 9/322 (3%)
 Frame = -3

Query  1290  GVSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVT  1111
             GV VLAMPESPRWLVMQGRLGDA RVL KTSDS EE+ +RLADIKEAAGIPE+C D+VV 
Sbjct  208   GVGVLAMPESPRWLVMQGRLGDATRVLNKTSDSKEESLLRLADIKEAAGIPEYCTDDVVQ  267

Query  1110  VTKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
             V K+   +D VW+ELF+ PTPAV HILI  VGIH FQQASGIDAVVLY PRIFEKAGI +
Sbjct  268   VVKRSQGQD-VWKELFLRPTPAVRHILICAVGIHFFQQASGIDAVVLYSPRIFEKAGITN  326

Query  930   DTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH  751
                KLLCT+A+G  KT+FILVATF +D+ GRRPLLLTSV GMV +L  L + LT+ID  H
Sbjct  327   SDHKLLCTVAVGLAKTIFILVATFLIDRIGRRPLLLTSVAGMVLSLGSLAVGLTIIDQHH  386

Query  750   -EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGV  574
               K+ W  A+ + M LAY A FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRV SGV
Sbjct  387   GAKMTWTTALCLTMVLAYAAFFSIGLGPITWVYSSEIFPLRLRAQGCSIGVAMNRVVSGV  446

Query  573   VSMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSR  394
             +SMTFISLYKAI++GG+FF Y  IA V W+FF+T++PETQG+TLE+ E LFG F +W+  
Sbjct  447   LSMTFISLYKAITMGGAFFFYGGIATVAWLFFYTMLPETQGRTLEDMEVLFGKFHKWKEA  506

Query  393   QREVDAK-------KANNNSQL  349
               +++ +         NN S +
Sbjct  507   NAQLETRAQVDHGGDGNNKSGM  528



>ref|XP_008236795.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=538

 Score =   431 bits (1108),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 225/331 (68%), Positives = 261/331 (79%), Gaps = 10/331 (3%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDAR+VL KTSDS EE+ +RL DIKEAAGIPEHC+D++V V
Sbjct  209   IGVLAMPESPRWLVMQGRLGDARKVLDKTSDSLEESKLRLGDIKEAAGIPEHCNDDIVEV  268

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              KKR     VW+EL + PTPAV HIL+  VG+H FQQASGIDAVVLY PRIFEKAGI + 
Sbjct  269   -KKRSQGQDVWKELLLHPTPAVRHILMCAVGLHFFQQASGIDAVVLYSPRIFEKAGITNA  327

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
                LLCT+A+GF KTVFILVATF LD+ GRRPLLLTSV GMV TLALLG+ LT+IDH HE
Sbjct  328   DKILLCTVAVGFVKTVFILVATFMLDRLGRRPLLLTSVAGMVVTLALLGLGLTIIDHHHE  387

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             ++ WAV + + M LAYVA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRV SGV+S
Sbjct  388   RIMWAVVLCLTMVLAYVAFFSIGMGPITWVYSSEIFPLQLRAQGCSIGVAVNRVVSGVLS  447

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFISLYKAI+IGG+FFL+AAIAAVGW FFFT++PETQG+TLE+ E LFG F+RWR    
Sbjct  448   MTFISLYKAITIGGAFFLFAAIAAVGWTFFFTMLPETQGRTLEDMEVLFGKFYRWRKANA  507

Query  387   EVDAKKANNNS---------QLQMGTLQAAN  322
              +  KK              Q+Q+GT   AN
Sbjct  508   LLKQKKQGERGDGNNNPNNPQIQLGTKGVAN  538



>gb|KEH30425.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=472

 Score =   428 bits (1101),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 208/318 (65%), Positives = 254/318 (80%), Gaps = 4/318 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVM+GRLGDA +VL KTSDS EEA +RLA+IK+AAGIPE C+D+VV V
Sbjct  154   VGVLAMPESPRWLVMRGRLGDAIKVLNKTSDSKEEAQLRLAEIKQAAGIPEDCNDDVVEV  213

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               K   E  VW+ELF+ PTPAV HI+I  +GIH FQQASG+DAVVLY P IF+KAGI  D
Sbjct  214   KVKNTGE-GVWKELFLYPTPAVRHIVIAALGIHFFQQASGVDAVVLYSPTIFKKAGINGD  272

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             T  L+ TIA+GF KT+FILVATF LD++GRRPLLLTSVGGMV +L  L +SLT+IDHS+ 
Sbjct  273   THLLIATIAVGFVKTLFILVATFMLDRYGRRPLLLTSVGGMVVSLLTLAVSLTIIDHSNT  332

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WA+ ++IA  L+YVA FSIGAGPITWVYSSEIFPL+LRA G + G  +NRVTSGV+S
Sbjct  333   KLNWAIGLSIATVLSYVATFSIGAGPITWVYSSEIFPLRLRAQGAACGVVVNRVTSGVIS  392

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SL K I+IGG+FFL+  IA +GW+FF+ ++PETQGKTLEE EA FG    WR  + 
Sbjct  393   MTFLSLSKGITIGGAFFLFGGIATIGWIFFYIMLPETQGKTLEEMEASFGKI--WRKSKN  450

Query  387   EVDAKKANNN-SQLQMGT  337
               +A+K N   +Q+Q+GT
Sbjct  451   TKEAEKDNAQVAQVQLGT  468



>dbj|BAM66295.1| sorbitol transporter, partial [Pyrus pyrifolia]
Length=454

 Score =   427 bits (1098),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 212/296 (72%), Positives = 242/296 (82%), Gaps = 1/296 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVMQGRLGDA RVL KTSDS EE+ +RLADIKEAAGIPEHC D+VV V
Sbjct  159   VGVLAMPESPRWLVMQGRLGDATRVLDKTSDSKEESRLRLADIKEAAGIPEHCTDDVVQV  218

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+   +D VW+EL + PTPA+ HILI  +GIH FQQASGIDAVVLY PRIFEKAGI +D
Sbjct  219   AKRSKGQD-VWKELLLHPTPAIRHILICAIGIHFFQQASGIDAVVLYSPRIFEKAGITND  277

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLLCT+A+GF KTVFILVATF +DK GRRPLLL SV GM+ +L  LG+ LT+ID +H 
Sbjct  278   DKKLLCTVAVGFVKTVFILVATFFVDKVGRRPLLLASVAGMILSLIGLGLGLTIIDQNHG  337

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             ++ WA  + I M L YVA FSIG GPITWVYSSEIFPLKLRA GCSLG  +NRV SGV+S
Sbjct  338   RIMWAAVLCITMVLLYVAFFSIGMGPITWVYSSEIFPLKLRAQGCSLGVAMNRVVSGVLS  397

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR  400
             MTFISLY+AI+IGG+FFLYAAIA V WVFFF ++PET G+TLE+ E LFG F RWR
Sbjct  398   MTFISLYEAITIGGAFFLYAAIATVAWVFFFIMLPETHGRTLEDMEVLFGKFHRWR  453



>ref|XP_009344431.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
 ref|XP_009344432.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=535

 Score =   430 bits (1106),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 216/329 (66%), Positives = 253/329 (77%), Gaps = 8/329 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVMQGRLGDA RVL KTSDS EE+ +RLADIKEAAGIPEHC D+VV V
Sbjct  208   VGVLAMPESPRWLVMQGRLGDATRVLDKTSDSKEESRLRLADIKEAAGIPEHCTDDVVQV  267

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+   +D VW+EL + PTPA+ HILI  +GIH FQQASGIDAVVLY PRIF+KAGI +D
Sbjct  268   AKRSKGQD-VWKELLLHPTPAIRHILICAIGIHFFQQASGIDAVVLYSPRIFKKAGITND  326

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
                LLCT+A+GF KTVFILVATF +DK GRRPLLL SV GM+ +L  LG+ LT+I  ++ 
Sbjct  327   DKILLCTVAVGFVKTVFILVATFFVDKVGRRPLLLASVAGMILSLIGLGLGLTIIGQNNG  386

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             ++ WA  + I M L YVA FSIG GPITWVYSSEIFPLKLRA GCS+G  +NRV SGV+S
Sbjct  387   RIMWAAVLCITMVLLYVAFFSIGMGPITWVYSSEIFPLKLRAQGCSMGVAMNRVVSGVLS  446

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFISLYKAI+IGG+FFLYAAIA+V WVFFF ++PET G+TLE+ E LFG F +WR    
Sbjct  447   MTFISLYKAITIGGAFFLYAAIASVAWVFFFIMLPETHGRTLEDMEVLFGKFHKWRKANA  506

Query  387   EVDAKK-------ANNNSQLQMGTLQAAN  322
              +  KK         NN Q+Q+GT    N
Sbjct  507   LLKQKKNVSHGDGNTNNGQVQLGTKGQVN  535



>ref|XP_010065405.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
 gb|KCW62856.1| hypothetical protein EUGRSUZ_G00450 [Eucalyptus grandis]
Length=535

 Score =   430 bits (1106),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 203/304 (67%), Positives = 243/304 (80%), Gaps = 1/304 (0%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VLAMPESPRWL+MQGRLGDA+ VL +TSDS EEA +RLADIKEAAGIPE C+D+V+ VTK
Sbjct  215   VLAMPESPRWLIMQGRLGDAKTVLARTSDSKEEAALRLADIKEAAGIPEECNDDVIKVTK  274

Query  1101  KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTD  922
              R   + VWR+L + PTP+V HILI  VGIH FQQASGIDAVVLY PRIFEK GI S   
Sbjct  275   -RSTGEGVWRDLLLHPTPSVRHILICAVGIHFFQQASGIDAVVLYSPRIFEKVGITSSNK  333

Query  921   KLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKV  742
             KL+ TIA+G  KT+ ILVATF LD+ GRRPLLL+SVGGM+ +L  LG+ LT+I+HS  K+
Sbjct  334   KLVATIAVGVVKTMLILVATFLLDRIGRRPLLLSSVGGMIISLGSLGVCLTIINHSQTKL  393

Query  741   PWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMT  562
              WAV M IA  L+YVA FSIG GPITWVYSSEIFPL+LRA GC++G  +NRVTSGV +M+
Sbjct  394   MWAVVMCIASVLSYVAFFSIGMGPITWVYSSEIFPLRLRAQGCAIGVAMNRVTSGVSAMS  453

Query  561   FISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV  382
             FISLY AISIGG+FFL+ A+A   W+FF+ LMPETQG+TLEE    FG + +WRS  RE+
Sbjct  454   FISLYDAISIGGAFFLFMAVACAAWLFFYILMPETQGRTLEEMGQFFGNYTKWRSVAREI  513

Query  381   DAKK  370
             D ++
Sbjct  514   DIQR  517



>ref|XP_009342008.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   430 bits (1105),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 203/310 (65%), Positives = 246/310 (79%), Gaps = 1/310 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDA+RVL +TS S EE+ +RL +IKEAAGIP+  +DEVV V
Sbjct  208   LGVLAMPESPRWLVMQGRLGDAKRVLNRTSSSEEESQLRLDEIKEAAGIPKDSNDEVVQV  267

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +K R   + +W+EL I PTPAV HILI  +GIH FQQ SG D+VVLY PRIFEKAGI S 
Sbjct  268   SK-RSQGEGIWKELLIRPTPAVRHILIAALGIHFFQQVSGTDSVVLYSPRIFEKAGITSY  326

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
              DKLL T+A+GF KT+ ILVATF +D+FGRR LLL+SVGGM  +  LLG+ LTV+D SH 
Sbjct  327   NDKLLATVAVGFVKTIAILVATFQVDRFGRRVLLLSSVGGMAVSFTLLGVGLTVVDQSHS  386

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KVPWAV + IAM L  VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR+TSGV+S
Sbjct  387   KVPWAVGLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRLTSGVIS  446

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFISLYKA++IGG+FFLYA IAA+ WVFF+TL PETQG++LE+ E LFG + +WR    
Sbjct  447   MTFISLYKAVTIGGAFFLYAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANA  506

Query  387   EVDAKKANNN  358
              ++  K  ++
Sbjct  507   MLNKTKQADH  516



>ref|XP_009350912.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   430 bits (1105),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 203/310 (65%), Positives = 247/310 (80%), Gaps = 1/310 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDA+RVL +TS S EE+ +RL +IKEAAGIP+  +DEVV V
Sbjct  208   LGVLAMPESPRWLVMQGRLGDAKRVLNRTSSSEEESQLRLDEIKEAAGIPKDSNDEVVQV  267

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +K R   + +W+EL + PTPAV HILI  +GIH FQQ SG D+VVLY PRIFEKAGI S 
Sbjct  268   SK-RSQGEGIWKELLLRPTPAVRHILIAALGIHFFQQVSGTDSVVLYSPRIFEKAGITSY  326

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
              DKLL T+A+GF KT+ ILVATF +D+FGRR LLL+SVGGMV +  LLG+ LTV+D SH 
Sbjct  327   NDKLLATVAVGFVKTIAILVATFQVDRFGRRVLLLSSVGGMVVSFTLLGVGLTVVDQSHS  386

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KVPWAV + IAM L  VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR+TSGV+S
Sbjct  387   KVPWAVGLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRLTSGVIS  446

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFISLYKA++IGG+FFLYA IAA+ WVFF+TL PETQG++LE+ E LFG + +WR    
Sbjct  447   MTFISLYKAVTIGGAFFLYAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANA  506

Query  387   EVDAKKANNN  358
              ++  K  ++
Sbjct  507   MLNKTKQADH  516



>gb|KEH30426.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=522

 Score =   429 bits (1103),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 208/318 (65%), Positives = 254/318 (80%), Gaps = 4/318 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVM+GRLGDA +VL KTSDS EEA +RLA+IK+AAGIPE C+D+VV V
Sbjct  204   VGVLAMPESPRWLVMRGRLGDAIKVLNKTSDSKEEAQLRLAEIKQAAGIPEDCNDDVVEV  263

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               K   E  VW+ELF+ PTPAV HI+I  +GIH FQQASG+DAVVLY P IF+KAGI  D
Sbjct  264   KVKNTGE-GVWKELFLYPTPAVRHIVIAALGIHFFQQASGVDAVVLYSPTIFKKAGINGD  322

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             T  L+ TIA+GF KT+FILVATF LD++GRRPLLLTSVGGMV +L  L +SLT+IDHS+ 
Sbjct  323   THLLIATIAVGFVKTLFILVATFMLDRYGRRPLLLTSVGGMVVSLLTLAVSLTIIDHSNT  382

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WA+ ++IA  L+YVA FSIGAGPITWVYSSEIFPL+LRA G + G  +NRVTSGV+S
Sbjct  383   KLNWAIGLSIATVLSYVATFSIGAGPITWVYSSEIFPLRLRAQGAACGVVVNRVTSGVIS  442

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SL K I+IGG+FFL+  IA +GW+FF+ ++PETQGKTLEE EA FG    WR  + 
Sbjct  443   MTFLSLSKGITIGGAFFLFGGIATIGWIFFYIMLPETQGKTLEEMEASFGKI--WRKSKN  500

Query  387   EVDAKKANNN-SQLQMGT  337
               +A+K N   +Q+Q+GT
Sbjct  501   TKEAEKDNAQVAQVQLGT  518



>ref|XP_010065409.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
 gb|KCW62859.1| hypothetical protein EUGRSUZ_G00453 [Eucalyptus grandis]
Length=535

 Score =   429 bits (1104),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 202/304 (66%), Positives = 245/304 (81%), Gaps = 1/304 (0%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VLAMPESPRWL+MQGRLGDA+ VL +TSDS EEA +RLADIKEAAGIPE C+D+VV VTK
Sbjct  215   VLAMPESPRWLIMQGRLGDAKTVLARTSDSKEEAALRLADIKEAAGIPEECNDDVVKVTK  274

Query  1101  KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTD  922
              R   + VWR+L + PTP+V HILI  VGIH FQQASGIDAVVLY PRIF+K GI SD  
Sbjct  275   -RSTGEGVWRDLLLHPTPSVRHILICAVGIHFFQQASGIDAVVLYSPRIFKKVGITSDNK  333

Query  921   KLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKV  742
              L+ TI +G  KT+FILVATF LD+ GRRPLLL+SVGGM+ +L  LG+ LT+I+HS  K+
Sbjct  334   MLVATIGVGVVKTLFILVATFLLDRIGRRPLLLSSVGGMIISLGSLGVCLTIINHSQTKL  393

Query  741   PWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMT  562
              WAV + IA  L+YVA FSIG GPITWVYSSEIFPL+LRA GC++G  +NRVTSGV++M+
Sbjct  394   MWAVVVCIASVLSYVAFFSIGMGPITWVYSSEIFPLRLRAQGCAIGVAMNRVTSGVLAMS  453

Query  561   FISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV  382
             FISLY+AISIGG+FFL+ A+A   W+FF+ LMPETQG+TLEE    FG + +WRS  RE+
Sbjct  454   FISLYEAISIGGAFFLFMAVACAAWLFFYILMPETQGRTLEEMGQFFGNYTKWRSVAREI  513

Query  381   DAKK  370
             D ++
Sbjct  514   DIQR  517



>gb|AAY88181.2| mannitol transporter 1 [Olea europaea]
Length=480

 Score =   427 bits (1099),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 206/314 (66%), Positives = 250/314 (80%), Gaps = 7/314 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VL MPESPRWLVM+GRLG+AR+VL KTSDS EE+ +RL+DIK+AAGIPE C+D++V +
Sbjct  166   IGVLGMPESPRWLVMKGRLGEARQVLDKTSDSKEESRLRLSDIKQAAGIPEECNDDIVVM  225

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+R DE +VW+EL + PTP+V H  I GVG+H FQQ+SGIDAVVLY PRIFEKAGI S 
Sbjct  226   PKRRNDE-AVWKELLLHPTPSVRHAFIAGVGLHFFQQSSGIDAVVLYSPRIFEKAGITST  284

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLL TIA+G +KT+FILVATF LD+ GRRPLLLTS+GGM+ +L LLG SL VI HS  
Sbjct  285   DLKLLATIAVGISKTLFILVATFLLDRIGRRPLLLTSMGGMIISLTLLGTSLAVIGHSDH  344

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
              V WAVA+AI   LAYV  FSIG GPI WVYSSE+FPL+LRA GCS+G  +NR TSG++S
Sbjct  345   TVHWAVALAIFGVLAYVGTFSIGLGPIAWVYSSEVFPLRLRAQGCSIGVAVNRGTSGIIS  404

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS---  397
             MTF+SLYKAISI G+F+L+AAIA V W+F FTL+PETQG++LEE   LFGT+F WR    
Sbjct  405   MTFLSLYKAISIAGAFYLFAAIAGVAWIFIFTLLPETQGRSLEEMGLLFGTYFGWRKTLK  464

Query  396   --RQREV-DAKKAN  364
               + RE  +AK AN
Sbjct  465   GLKNREAEEAKNAN  478



>ref|XP_008368693.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=353

 Score =   422 bits (1086),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 204/316 (65%), Positives = 245/316 (78%), Gaps = 7/316 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDA+RVL KTS S EE+ +RL +IKE  GIP+   DEVV V
Sbjct  34    LGVLAMPESPRWLVMQGRLGDAKRVLNKTSSSEEESQLRLDEIKEXXGIPKDSKDEVVQV  93

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +K+   E  +W+EL + PTPAV HILI  +GIH FQQ SG D+VVLY PRIFEKAGI S 
Sbjct  94    SKRSXGE-GIWKELLLRPTPAVRHILIAALGIHFFQQLSGTDSVVLYSPRIFEKAGITSY  152

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
              DKLL T+A+GF KT+ ILVATF +D+FGRR LLL+SVGGMV +  LLG+ LTV+D SH 
Sbjct  153   NDKLLATVAVGFVKTIAILVATFQVDRFGRRILLLSSVGGMVVSFTLLGVGLTVVDQSHS  212

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KVPWAV + IAM L  VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR TSGV+S
Sbjct  213   KVPWAVGLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRXTSGVIS  272

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR----  400
             MTFISLYKAI+IGG+FFLYA IAA+ WVFF+TL PETQG++LE+ E LFG + +WR    
Sbjct  273   MTFISLYKAITIGGAFFLYAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANA  332

Query  399   --SRQREVDAKKANNN  358
               ++  + D    ++N
Sbjct  333   MLNKTNQADHGLGDDN  348



>ref|XP_011078883.1| PREDICTED: polyol transporter 5-like isoform X1 [Sesamum indicum]
Length=526

 Score =   429 bits (1102),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 203/312 (65%), Positives = 251/312 (80%), Gaps = 2/312 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLV+QGRL DA++VL +TSDSP+EA +RLADIK+AAG+PE+C D+VV+V
Sbjct  214   IGVLAMPESPRWLVLQGRLRDAQKVLDRTSDSPQEAQLRLADIKQAAGLPENCGDDVVSV  273

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               KR   + VW++L + PTP V HILI G+GIH FQQASGIDAVV+Y PRI+EKAGI++D
Sbjct  274   -PKRSRGEGVWKDLLLRPTPTVRHILIAGLGIHFFQQASGIDAVVMYSPRIYEKAGIRND  332

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SH  751
             +DKLL TIA+G +KT+FILVATF +DK GRR LLLTS GG+  +L  L   LT+IDH   
Sbjct  333   SDKLLATIAVGVSKTMFILVATFLVDKVGRRVLLLTSCGGLAASLFGLATGLTLIDHYDD  392

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             +K+ WAV + +A +LA VA FSIG GPI WVYSSEIFPL+LRA GCS+G   NR TSGVV
Sbjct  393   QKLTWAVVLCVATSLACVAFFSIGMGPIAWVYSSEIFPLRLRAQGCSMGVAANRFTSGVV  452

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
              MTFISLYKAI+IGG+FFL+  +A + W+FF+TL+PETQG+ LEE EALFG+FFRWRS  
Sbjct  453   LMTFISLYKAITIGGAFFLFTGVAVIAWIFFYTLLPETQGRNLEEIEALFGSFFRWRSTM  512

Query  390   REVDAKKANNNS  355
             RE+  KK   +S
Sbjct  513   RELKRKKLEQDS  524



>ref|XP_008345143.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=527

 Score =   429 bits (1102),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 206/310 (66%), Positives = 245/310 (79%), Gaps = 1/310 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDA+RVL KTS S EE+ +RL +IKE AGIP+   DEVV V
Sbjct  208   LGVLAMPESPRWLVMQGRLGDAKRVLNKTSTSEEESQLRLDEIKEVAGIPKDSKDEVVQV  267

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +K R   + +W+EL + PTPAV HILI  +GIH FQQ SG D+VVLY PRIFEKAGI S 
Sbjct  268   SK-RSQGEGIWKELLLRPTPAVRHILIAALGIHFFQQLSGTDSVVLYSPRIFEKAGISSY  326

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
              DKLL T+A+GF KT+ ILVATF +D+FGRR LLL+SVGGMV +  LLG+ LTVID SH 
Sbjct  327   NDKLLATVAVGFVKTIAILVATFQVDRFGRRILLLSSVGGMVVSFTLLGVGLTVIDQSHS  386

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KVPWAV + IAM L  VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+S
Sbjct  387   KVPWAVGLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVIS  446

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFISLYKAI+IGG+FFLYA IAA+ WVFF+TL PETQG++LE+ E LFG + +WR    
Sbjct  447   MTFISLYKAITIGGAFFLYAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANA  506

Query  387   EVDAKKANNN  358
              ++  K  ++
Sbjct  507   LLNKTKQADH  516



>ref|XP_011078884.1| PREDICTED: polyol transporter 5-like isoform X2 [Sesamum indicum]
Length=524

 Score =   428 bits (1101),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 203/312 (65%), Positives = 251/312 (80%), Gaps = 2/312 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLV+QGRL DA++VL +TSDSP+EA +RLADIK+AAG+PE+C D+VV+V
Sbjct  212   IGVLAMPESPRWLVLQGRLRDAQKVLDRTSDSPQEAQLRLADIKQAAGLPENCGDDVVSV  271

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               KR   + VW++L + PTP V HILI G+GIH FQQASGIDAVV+Y PRI+EKAGI++D
Sbjct  272   -PKRSRGEGVWKDLLLRPTPTVRHILIAGLGIHFFQQASGIDAVVMYSPRIYEKAGIRND  330

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SH  751
             +DKLL TIA+G +KT+FILVATF +DK GRR LLLTS GG+  +L  L   LT+IDH   
Sbjct  331   SDKLLATIAVGVSKTMFILVATFLVDKVGRRVLLLTSCGGLAASLFGLATGLTLIDHYDD  390

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             +K+ WAV + +A +LA VA FSIG GPI WVYSSEIFPL+LRA GCS+G   NR TSGVV
Sbjct  391   QKLTWAVVLCVATSLACVAFFSIGMGPIAWVYSSEIFPLRLRAQGCSMGVAANRFTSGVV  450

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
              MTFISLYKAI+IGG+FFL+  +A + W+FF+TL+PETQG+ LEE EALFG+FFRWRS  
Sbjct  451   LMTFISLYKAITIGGAFFLFTGVAVIAWIFFYTLLPETQGRNLEEIEALFGSFFRWRSTM  510

Query  390   REVDAKKANNNS  355
             RE+  KK   +S
Sbjct  511   RELKRKKLEQDS  522



>ref|XP_009342010.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score =   428 bits (1101),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 202/310 (65%), Positives = 246/310 (79%), Gaps = 1/310 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDA+RVL +TS S EE+ +RL +IKEAAGIP+  +DEVV V
Sbjct  210   LGVLAMPESPRWLVMQGRLGDAKRVLNRTSSSEEESQLRLDEIKEAAGIPKDSNDEVVQV  269

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +K R   + +W+EL + PTPAV HILI  +GIH FQQ SG D+VVLY PRIFEKAGI S 
Sbjct  270   SK-RSQGEGIWKELLLRPTPAVRHILIAALGIHFFQQVSGTDSVVLYSPRIFEKAGITSY  328

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
              DKLL T+A+GF KT+ ILVATF +D+FGRR LLL+SVGGM  +  LLG+ LTV+D SH 
Sbjct  329   NDKLLATVAVGFVKTIAILVATFQVDRFGRRVLLLSSVGGMAVSFTLLGVGLTVVDQSHS  388

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KVPWAV + IAM L  VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR+TSGV+S
Sbjct  389   KVPWAVGLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRLTSGVIS  448

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFISLYKA++IGG+FFLYA IAA+ WVFF+TL PETQG++LE+ E LFG + +WR    
Sbjct  449   MTFISLYKAVTIGGAFFLYAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANA  508

Query  387   EVDAKKANNN  358
              ++  K  ++
Sbjct  509   MLNKTKQADH  518



>ref|XP_008393068.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=538

 Score =   428 bits (1101),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 211/331 (64%), Positives = 250/331 (76%), Gaps = 11/331 (3%)
 Frame = -3

Query  1290  GVSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVT  1111
             GV VLAMPESPRWLVMQGRLGDA RVL KTSDS EE+ +RL DIKEAAGIPE+C D+VV 
Sbjct  208   GVGVLAMPESPRWLVMQGRLGDATRVLNKTSDSKEESLLRLGDIKEAAGIPEYCTDDVVQ  267

Query  1110  VTKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
             V K+   +D VW+ELF+ PTPAV HILI  VGIH FQQASGIDAVVLY PRIFE+AGI +
Sbjct  268   VVKRSQGQD-VWKELFLRPTPAVRHILICAVGIHFFQQASGIDAVVLYSPRIFEEAGITN  326

Query  930   DTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HS  754
                KLLCT+A+G  KT+FILVA F +D+ GRRPLLLTSV GMV +L  L + LT+ID H 
Sbjct  327   SDHKLLCTVAVGLAKTIFILVAMFLIDRIGRRPLLLTSVAGMVLSLGSLAVGLTIIDRHQ  386

Query  753   HEKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGV  574
               K+ W  A+ + M LAY A FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRV SGV
Sbjct  387   GAKMTWTTALCLTMVLAYAAFFSIGLGPITWVYSSEIFPLRLRAQGCSIGVAMNRVVSGV  446

Query  573   VSMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR--  400
             +SMTFISLYKAI++GG+FF YA IA V WVFF+T++PETQG+TLE+ E LFG F +W+  
Sbjct  447   LSMTFISLYKAITMGGAFFFYAGIATVAWVFFYTMLPETQGRTLEDMEVLFGKFHKWKEV  506

Query  399   ----SRQREVDAKKANNNSQLQMGTLQAANK  319
                   + +VD     NN   + G +Q   K
Sbjct  507   NALLETKTQVDHGGDGNN---RSGMIQLETK  534



>ref|XP_008236773.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
 ref|XP_008236774.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
Length=528

 Score =   427 bits (1099),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 203/309 (66%), Positives = 244/309 (79%), Gaps = 1/309 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVMQGRLGDA+RVL KTS S EEA +RL DIKEAAGIP H +D+VV+V
Sbjct  210   VGVLAMPESPRWLVMQGRLGDAKRVLDKTSTSKEEAQLRLDDIKEAAGIPMHLNDDVVSV  269

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             TK+   E  VWR+L + PTPAVLHILI  +GIH FQQ +GID+VVLY PRIF KAGI S 
Sbjct  270   TKQSHGE-GVWRQLILHPTPAVLHILIAALGIHFFQQVTGIDSVVLYSPRIFAKAGITSY  328

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
                LL T+A+GF KT+FI +ATF LD+ GRRPLLLTS+GGM+ +LA LG +LT++DH   
Sbjct  329   EHTLLATVAVGFIKTIFIFIATFLLDRVGRRPLLLTSMGGMILSLACLGAALTIVDHHDS  388

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
              +PWAVA+ I M L  VA FSIG GPITWVYSSEIFPLKLRA G SLG  +NRV SG++S
Sbjct  389   TIPWAVALCITMVLFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSLGVAVNRVISGIIS  448

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SLYKAI+IGG+FFLYA I  + WVFF+T++PETQG+TLEE E LFG + +WR    
Sbjct  449   MTFLSLYKAITIGGAFFLYAGIGVLAWVFFYTMLPETQGRTLEEMEVLFGKYHKWRQANA  508

Query  387   EVDAKKANN  361
              + +KK ++
Sbjct  509   MLKSKKVDH  517



>gb|KHN39768.1| Polyol transporter 5 [Glycine soja]
Length=523

 Score =   427 bits (1098),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 214/319 (67%), Positives = 256/319 (80%), Gaps = 6/319 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVM+GRLG+AR+VL KTSDS EEA +RLA+IK+AAGIPE C+D+VV V
Sbjct  205   VGVLAMPESPRWLVMRGRLGEARKVLNKTSDSKEEAQLRLAEIKQAAGIPESCNDDVVQV  264

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+   E  VW+ELF+ PTPA+ HI+I  +GIH FQQASG+DAVVLY PRIFEKAGI +D
Sbjct  265   NKQSNGE-GVWKELFLYPTPAIRHIVIAALGIHFFQQASGVDAVVLYSPRIFEKAGITND  323

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             T KLL T+A+GF KTVFIL ATFTLD+ GRRPLLL+SVGGMV +L  L +SLTVIDHS  
Sbjct  324   THKLLATVAVGFVKTVFILAATFTLDRVGRRPLLLSSVGGMVLSLLTLAISLTVIDHSER  383

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WAV  +IAM LAYVA FSIGAGPITWVYSSEIFPL+LRA G + G  +NR TS VVS
Sbjct  384   KLMWAVGSSIAMVLAYVATFSIGAGPITWVYSSEIFPLRLRAQGAAAGVAVNRTTSAVVS  443

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SL +AI+IGG+FFLY  IA VGW+FF+T++PET+GKTLE+ E  FGTF   RS+  
Sbjct  444   MTFLSLTRAITIGGAFFLYCGIATVGWIFFYTVLPETRGKTLEDMEGSFGTF---RSKSN  500

Query  387   EVDAKKANNN--SQLQMGT  337
                A +  N   +Q+Q+GT
Sbjct  501   ASKAVENENGQVAQVQLGT  519



>ref|XP_008368694.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=485

 Score =   426 bits (1095),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 203/310 (65%), Positives = 244/310 (79%), Gaps = 1/310 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDA+RVL KTS S EE+ +RL +IKE  GIP+   DEVV V
Sbjct  166   LGVLAMPESPRWLVMQGRLGDAKRVLNKTSSSEEESQLRLDEIKEVVGIPKDSKDEVVQV  225

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +K+   E  +W+EL + PTPAV HILI  +GIH FQQ SG D+VVLY PRIFEKAGI S 
Sbjct  226   SKRSXGE-GIWKELLLRPTPAVRHILIAALGIHFFQQLSGTDSVVLYSPRIFEKAGITSY  284

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
              DKLL T+A+GF KT+ ILVATF +D+FGRR LLL+SVGGMV +  LLG+ LTV+D SH 
Sbjct  285   NDKLLATVAVGFVKTIAILVATFQVDRFGRRILLLSSVGGMVVSFTLLGVGLTVVDQSHS  344

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KVPWAV + IAM L  VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR+TSGV+S
Sbjct  345   KVPWAVGLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRLTSGVIS  404

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFISLYKAI+IGG+FFLYA IAA+ WVFF+TL PETQG++LE+ E LFG + +WR    
Sbjct  405   MTFISLYKAITIGGAFFLYAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANA  464

Query  387   EVDAKKANNN  358
              ++  K  ++
Sbjct  465   MLNKTKQADH  474



>ref|XP_009345072.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=523

 Score =   426 bits (1096),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 208/315 (66%), Positives = 244/315 (77%), Gaps = 7/315 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VL MPESPRWLVMQGRLGDAR+VL +TS+S EE  +RL DIKEAAGIP H +D++V V
Sbjct  209   IGVLFMPESPRWLVMQGRLGDARKVLQRTSESKEECQLRLDDIKEAAGIPPHLNDDIVQV  268

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             TK R   + VW+EL + PTPAV HILI  +GIH+ +QASGID VVLY PRIFEKAGI S 
Sbjct  269   TK-RSRGEGVWKELILHPTPAVRHILIAAIGIHILEQASGIDTVVLYSPRIFEKAGITSA  327

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLL TIA+G TKTVFILVATF LDKFGRRPLLLTSV GMV +L  LG+ LT++DH   
Sbjct  328   NHKLLATIAVGGTKTVFILVATFFLDKFGRRPLLLTSVAGMVFSLLFLGVGLTIVDHHKG  387

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
              VPWAV + +AM    VA FSIG GPITWVYSSEIFPLKLRA G S+G   NRVTSG+VS
Sbjct  388   SVPWAVGLCMAMVYFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSIGVACNRVTSGIVS  447

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR----  400
             MTFISLYKAI+IGG+FFLY+ I+A  WVFF+T++PETQG+TLE+ E LFG + RWR    
Sbjct  448   MTFISLYKAITIGGAFFLYSGISAAAWVFFYTMLPETQGRTLEDMEVLFGKYHRWRKANA  507

Query  399   --SRQREVDAKKANN  361
                 +++VD    NN
Sbjct  508   MLKERKQVDGDDNNN  522



>ref|XP_009350914.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score =   426 bits (1096),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 203/310 (65%), Positives = 244/310 (79%), Gaps = 1/310 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDA+RVL +TS S EE+ +RL +IKEAAGIP+  +DEVV V
Sbjct  210   LGVLAMPESPRWLVMQGRLGDAKRVLNRTSSSEEESQLRLDEIKEAAGIPKDSNDEVVQV  269

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +K R   + +W+EL I PTPAV HILI  +GIH FQQ SG D+VVLY PRIFEKAGI S 
Sbjct  270   SK-RSQGEGIWKELLIRPTPAVRHILIAALGIHFFQQVSGTDSVVLYSPRIFEKAGITSY  328

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
              DKLL T+A+GF KT+ ILVATF +D+FGRR LLL+SVGGMV +  LLG+ LTV+D SH 
Sbjct  329   NDKLLATVAVGFVKTIAILVATFQVDRFGRRVLLLSSVGGMVVSFTLLGVGLTVVDQSHS  388

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KV WAV + IAM L  VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR TSGV+S
Sbjct  389   KVSWAVGLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRFTSGVIS  448

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFISLYK I+IGG+FFLYA IAA+ WVFF+TL PETQG++LE+ E LFG + +WR    
Sbjct  449   MTFISLYKTITIGGAFFLYAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANA  508

Query  387   EVDAKKANNN  358
              ++  K  ++
Sbjct  509   MLNKSKQADH  518



>ref|NP_001281038.1| polyol transporter 5-like [Malus domestica]
 gb|AAO88965.1| sorbitol transporter [Malus domestica]
Length=481

 Score =   424 bits (1090),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 207/316 (66%), Positives = 248/316 (78%), Gaps = 2/316 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVMQGRLGDA+RVL KTS+S EE  +RL DIKEAAGIP+  +D+VV V
Sbjct  166   VGVLAMPESPRWLVMQGRLGDAKRVLQKTSESIEECQLRLDDIKEAAGIPKESNDDVVQV  225

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +K R   + VW+EL + PTPAV HILI  +GIH F+Q+SGID+VVLY PRIFEKAGI S 
Sbjct  226   SK-RSHGEGVWKELLLHPTPAVRHILIAALGIHFFEQSSGIDSVVLYSPRIFEKAGITSY  284

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLL T+A+G  KT+ ILVAT  LDKFGRRPLLLTSV GMV +L+ LG SLT++D  H 
Sbjct  285   DHKLLATVAVGVVKTICILVATVFLDKFGRRPLLLTSVAGMVFSLSCLGASLTIVDQQHG  344

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WA+ + I M L  VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+S
Sbjct  345   KIMWAIVLCITMVLLNVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVIS  404

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFISLYKAI+IGG+FFLYA IAAVGWVFF+ L PETQG+TLE+ E LFG + +WR    
Sbjct  405   MTFISLYKAITIGGAFFLYAGIAAVGWVFFYMLYPETQGRTLEDMEVLFGKYHKWREANA  464

Query  387   EVD-AKKANNNSQLQM  343
              +  AK+ + + + Q+
Sbjct  465   LLQKAKQVDGDDKGQV  480



>ref|NP_001236592.1| sorbitol-like transporter [Glycine max]
 emb|CAD91337.1| sorbitol-like transporter [Glycine max]
Length=523

 Score =   426 bits (1094),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 213/317 (67%), Positives = 255/317 (80%), Gaps = 6/317 (2%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VLAMPESPRWLVM+GRLG+AR+VL KTSDS EEA +RLA+IK+AAGIPE C+D+VV V K
Sbjct  207   VLAMPESPRWLVMRGRLGEARKVLNKTSDSKEEAQLRLAEIKQAAGIPESCNDDVVQVNK  266

Query  1101  KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTD  922
             +   E  VW+ELF+ PTPA+ HI+I  +GIH FQQASG+DAVVLY PRIFEKAGI +DT 
Sbjct  267   QSNGE-GVWKELFLYPTPAIRHIVIAALGIHFFQQASGVDAVVLYSPRIFEKAGITNDTH  325

Query  921   KLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKV  742
             KLL T+A+GF KTVFIL ATFTLD+ GRRPLLL+SVGGMV +L  L +SLTVIDHS  K+
Sbjct  326   KLLATVAVGFVKTVFILAATFTLDRVGRRPLLLSSVGGMVLSLLTLAISLTVIDHSERKL  385

Query  741   PWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMT  562
              WAV  +IAM LAYVA FSIGAGPITWVYSSEIFPL+LRA G + G  +NR TS VVSMT
Sbjct  386   MWAVGSSIAMVLAYVATFSIGAGPITWVYSSEIFPLRLRAQGAAAGVAVNRTTSAVVSMT  445

Query  561   FISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV  382
             F+SL +AI+IGG+FFLY  IA VGW+FF+T++PET+GKTLE+ E  FGTF   RS+    
Sbjct  446   FLSLTRAITIGGAFFLYCGIATVGWIFFYTVLPETRGKTLEDMEGSFGTF---RSKSNAS  502

Query  381   DAKKANNN--SQLQMGT  337
              A +  N   +Q+Q+GT
Sbjct  503   KAVENENGQVAQVQLGT  519



>ref|XP_009345071.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   425 bits (1093),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 206/320 (64%), Positives = 248/320 (78%), Gaps = 9/320 (3%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDA+RVL KTS+S EE  +RL DIKEAAGIP+  +D++V V
Sbjct  211   IGVLAMPESPRWLVMQGRLGDAKRVLQKTSESIEECQLRLDDIKEAAGIPKQSNDDIVQV  270

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +K R   + VW+EL + PTPAV HILI  +GIH F+Q+SGID+VVLY PRIFEKAGI S 
Sbjct  271   SK-RSHGEGVWKELLVHPTPAVRHILIAALGIHFFEQSSGIDSVVLYSPRIFEKAGITSY  329

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLL T+A+G  KT+ ILVAT  LDKFGRRPLLLTSV GMV +L  LG  LT++D  H 
Sbjct  330   DQKLLATVAVGVVKTICILVATVFLDKFGRRPLLLTSVAGMVFSLTCLGAGLTIVDQHHG  389

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WA+ + I M L  VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+S
Sbjct  390   KITWAIVLCITMVLLNVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVIS  449

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR----  400
             MTFISLYKAI+IGG+FFLYA IAAVGWVFF+TL PETQG+TLE+ E LFG + +WR    
Sbjct  450   MTFISLYKAITIGGAFFLYAGIAAVGWVFFYTLYPETQGRTLEDMEVLFGKYHKWREANA  509

Query  399   --SRQREVDAKKANNNSQLQ  346
                + ++VD +  +N  Q+ 
Sbjct  510   MLKKTKQVDGE--DNKGQIH  527



>ref|NP_001289249.1| polyol transporter 5-like [Pyrus x bretschneideri]
 ref|XP_009375824.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
 gb|AFM91103.1| sorbitol transporter [Pyrus x bretschneideri]
Length=526

 Score =   424 bits (1091),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 207/316 (66%), Positives = 248/316 (78%), Gaps = 2/316 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVMQGRLGDA+RVL KTS+S EE  +RL DIKEAAGIP+  +D+VV V
Sbjct  211   VGVLAMPESPRWLVMQGRLGDAKRVLQKTSESIEECQLRLDDIKEAAGIPKESNDDVVQV  270

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +K R   + VW+EL + PTPAV HILI  +GIH F+Q+SGID+VVLY PRIFEKAGI S 
Sbjct  271   SK-RSHGEGVWKELLLHPTPAVRHILIAALGIHFFEQSSGIDSVVLYSPRIFEKAGITSY  329

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLL T+A+G  KT+ ILVAT  LDKFGRRPLLLTSV GMV +L+ LG  LT++D  H 
Sbjct  330   DHKLLATVAVGVVKTICILVATVFLDKFGRRPLLLTSVAGMVFSLSCLGAGLTIVDQQHG  389

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WA+ + I M L  VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+S
Sbjct  390   KIMWAIVLCITMVLLNVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVIS  449

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFISLYKAI+IGG+FFLYA IAAVGWVFF+ L PETQG+TLE+ E LFG + +WR    
Sbjct  450   MTFISLYKAITIGGAFFLYAGIAAVGWVFFYMLYPETQGRTLEDMEVLFGKYHKWREANA  509

Query  387   EV-DAKKANNNSQLQM  343
              +  AK+A+ + + Q+
Sbjct  510   LLKKAKQADGDDKGQV  525



>ref|XP_004300990.1| PREDICTED: polyol transporter 5-like [Fragaria vesca subsp. vesca]
Length=530

 Score =   424 bits (1090),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 202/316 (64%), Positives = 245/316 (78%), Gaps = 6/316 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + V+AMPESPRWLVMQGRL DA+RVL +TSDS EE+ +RLADIKEAA IPEHC+D+VV V
Sbjct  209   LGVIAMPESPRWLVMQGRLADAKRVLDRTSDSTEESKLRLADIKEAARIPEHCNDDVVEV  268

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K    ED VW+EL + PTPAV HILI  VG+H FQQASGIDAVVLY PRIF+ AGI + 
Sbjct  269   PKNSHGED-VWKELILRPTPAVRHILIAAVGLHFFQQASGIDAVVLYSPRIFKYAGITAK  327

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
                LL TIA+G  KTV ILVATF LD+ GRRPLLL+S+ GM+ +L  LG  LT++DH+ E
Sbjct  328   NKLLLATIAVGSVKTVVILVATFLLDRIGRRPLLLSSMAGMIASLVCLGFGLTIVDHNDE  387

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KV WA+ ++I M L YVA FSIG GP+TWVY+SEIFPLKLRA G S+G  +NRV SG++S
Sbjct  388   KVMWAIVLSITMVLFYVAFFSIGMGPVTWVYTSEIFPLKLRAQGFSIGVAVNRVASGILS  447

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS---  397
             MTFISLYKAI+IGG+FFLYA I  VGWVFF+T++PET+G+TLE+ E LFG F RW+    
Sbjct  448   MTFISLYKAITIGGAFFLYAGIGVVGWVFFYTMLPETKGRTLEDIEVLFGKFHRWKETNA  507

Query  396   --RQREVDAKKANNNS  355
               + + VD     NN+
Sbjct  508   FLKNKRVDPNNNGNNT  523



>ref|XP_009342009.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score =   424 bits (1090),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 201/310 (65%), Positives = 244/310 (79%), Gaps = 1/310 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDA+RVL +TS S EE+ +RL +IKEAAGIP+  ++EVV +
Sbjct  210   LGVLAMPESPRWLVMQGRLGDAKRVLNRTSSSEEESQLRLDEIKEAAGIPKDSNEEVVQI  269

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +K R   + +W+EL I PTPAV HILI  +GIH FQQ SG D+VVLY PRIFEKAGI S 
Sbjct  270   SK-RSQGEGIWKELLIRPTPAVRHILIAALGIHFFQQVSGTDSVVLYSPRIFEKAGITSY  328

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
              DKLL T+A+GF KT+ ILVATF +D+FGRR LLL+SVGGMV +  LLG+ LTV+D SH 
Sbjct  329   NDKLLATVAVGFVKTIAILVATFQVDRFGRRVLLLSSVGGMVVSFTLLGVGLTVVDQSHS  388

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KV WAV + IAM L  VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NR TSGV+S
Sbjct  389   KVSWAVGLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRFTSGVIS  448

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFISLYK I+IGG+FFLYA IAA+ WVFF+TL PETQG++LE+ E LFG + +WR    
Sbjct  449   MTFISLYKTITIGGAFFLYAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANA  508

Query  387   EVDAKKANNN  358
              ++  K  ++
Sbjct  509   MLNKSKQADH  518



>gb|AGG19156.1| sorbitol transporter [Pyrus pyrifolia]
Length=491

 Score =   422 bits (1085),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 199/307 (65%), Positives = 242/307 (79%), Gaps = 2/307 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDAR+VL KTSDS EE+ +RLADIKEAAGIPE C+D++V V
Sbjct  166   IGVLAMPESPRWLVMQGRLGDARQVLDKTSDSKEESMLRLADIKEAAGIPEDCNDDIVQV  225

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             T     E  VW+ELF+ PTP VLHILI  +G H FQQASGIDA+VLY PR+FEKAGI S 
Sbjct  226   TGHSHGE-GVWKELFVHPTPTVLHILIAALGFHFFQQASGIDALVLYSPRVFEKAGITSS  284

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSH  751
                LLCT+ +G +KTVF LVATF LD+ GRRPLLLTS+ GMV +L  LG SLT++D H  
Sbjct  285   DQLLLCTVGVGLSKTVFTLVATFFLDRVGRRPLLLTSMAGMVVSLVCLGTSLTIVDQHEG  344

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
              ++ WAV + +   LA+V  FS G GPI WVYSSEIFPL+LRA GC +G  +NRV SG++
Sbjct  345   ARMTWAVVLCLFCVLAFVGFFSTGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRVMSGIL  404

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
             SMTFISLYKAI++GG+FFLYAAI AVGW+FFFT++PETQG+TLE+ E LFG F +WR   
Sbjct  405   SMTFISLYKAITMGGAFFLYAAIGAVGWIFFFTMLPETQGRTLEDMEVLFGKFHKWRKAN  464

Query  390   REVDAKK  370
             + ++ K+
Sbjct  465   KLLEKKR  471



>ref|XP_008236797.1| PREDICTED: putative polyol transporter 2 [Prunus mume]
Length=531

 Score =   424 bits (1089),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 203/307 (66%), Positives = 241/307 (79%), Gaps = 1/307 (0%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VLAMPESPRWLVM+GRLGDA+RVL KTS S EEA +RL DIKEAAGIP H +D+ V V K
Sbjct  214   VLAMPESPRWLVMKGRLGDAKRVLNKTSSSKEEAQLRLDDIKEAAGIPMHLNDDFVEVPK  273

Query  1101  KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTD  922
             +   E SVW++L + PTPAV HILI  +GIH F+QASGID+VVLY PRIFEKAGI+S   
Sbjct  274   QSHGE-SVWKQLILHPTPAVRHILIAALGIHFFEQASGIDSVVLYSPRIFEKAGIQSYNH  332

Query  921   KLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKV  742
             KLL TIA+G  KT+FILVATF +D+ GRRPLLL S+GGMV +L  LG SLTVID SH  V
Sbjct  333   KLLATIAVGVVKTLFILVATFLIDRIGRRPLLLISMGGMVFSLGFLGASLTVIDQSHGTV  392

Query  741   PWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMT  562
             PWA+ + I M L  VA FSIG GP+TWVY+SEIFPLKLRA GCSLG  INRVTSG++SMT
Sbjct  393   PWAIGLCITMVLFNVAFFSIGLGPVTWVYTSEIFPLKLRAQGCSLGVAINRVTSGIISMT  452

Query  561   FISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV  382
             FISLYKAI+IGG+FFLYA +  VGW+FF+T++PET G+TLEE E LFG + +W+     +
Sbjct  453   FISLYKAITIGGAFFLYAGVGVVGWIFFYTMLPETHGRTLEEMEVLFGKYHKWKEANAML  512

Query  381   DAKKANN  361
                K  +
Sbjct  513   KNGKQGD  519



>ref|XP_004148857.1| PREDICTED: polyol transporter 5-like [Cucumis sativus]
 gb|KGN61777.1| hypothetical protein Csa_2G245410 [Cucumis sativus]
Length=533

 Score =   423 bits (1087),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 205/313 (65%), Positives = 248/313 (79%), Gaps = 1/313 (0%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VL MPESPRWLV+QGRLG+A++VL +TSDS EEA +RLADIK+AAGIPE C+D++V+V K
Sbjct  213   VLIMPESPRWLVLQGRLGEAKKVLDRTSDSKEEALIRLADIKQAAGIPEECNDDIVSVAK  272

Query  1101  KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTD  922
             K    + VW+EL I PT AV HILI GVGIH FQQASGIDAVVLY PRIFEKAGI S   
Sbjct  273   KSTHGEGVWKELLIHPTAAVRHILIAGVGIHFFQQASGIDAVVLYSPRIFEKAGITSANQ  332

Query  921   KLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKV  742
             KLL T+A+GF KT+FILVATF LD+ GRRPLLLTSV GM+ +L  LG++LTVI+ + +K+
Sbjct  333   KLLATVAVGFVKTIFILVATFLLDRIGRRPLLLTSVLGMIISLGTLGLALTVINQTDKKL  392

Query  741   PWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMT  562
              WAV + I+M L YVA+FSIG GPITWVYSSEIFPLKLRA G S+G  +NRVTSGV+SM+
Sbjct  393   MWAVVLCISMVLTYVASFSIGMGPITWVYSSEIFPLKLRAQGTSMGVAVNRVTSGVISMS  452

Query  561   FISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV  382
             F+SL KAI+ GG+FFL+AAIA V W FF+T +PETQGKTLEE E LFG   R +S     
Sbjct  453   FLSLSKAITTGGAFFLFAAIAIVAWFFFYTALPETQGKTLEEMETLFG-HIRCKSAAASA  511

Query  381   DAKKANNNSQLQM  343
               +K N +  +Q+
Sbjct  512   GTEKDNGSGGVQL  524



>ref|XP_009344434.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
Length=491

 Score =   421 bits (1083),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 198/307 (64%), Positives = 242/307 (79%), Gaps = 2/307 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDAR+VL +TSDS EE+ +RLADIKEAAGIPE C+D++V V
Sbjct  166   IGVLAMPESPRWLVMQGRLGDARQVLDRTSDSKEESMLRLADIKEAAGIPEDCNDDIVQV  225

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             T     E  VW+ELF+ PTP VLHILI  +G H FQQASGIDA+VLY PR+FEKAGI S 
Sbjct  226   TGHSHGE-GVWKELFVHPTPTVLHILIAALGFHFFQQASGIDALVLYSPRVFEKAGITSS  284

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSH  751
                LLCT+ +G +KTVF LVATF LD+ GRRPLLLTS+ GMV +L  LG SLT++D H  
Sbjct  285   DQLLLCTVGVGLSKTVFTLVATFFLDRVGRRPLLLTSMAGMVVSLVCLGTSLTIVDQHEG  344

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
              ++ WAV + +   LA+V  FS G GPI WVYSSEIFPL+LRA GC +G  +NRV SG++
Sbjct  345   ARMTWAVVLCLFCVLAFVGFFSTGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRVMSGIL  404

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
             SMTFISLYKAI++GG+FFLYAAI AVGW+FFFT++PETQG+TLE+ E LFG F +WR   
Sbjct  405   SMTFISLYKAITMGGAFFLYAAIGAVGWIFFFTMLPETQGRTLEDMEVLFGKFHKWRKAN  464

Query  390   REVDAKK  370
             + ++ K+
Sbjct  465   KLLEKKR  471



>ref|XP_009375629.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
Length=491

 Score =   421 bits (1082),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 198/307 (64%), Positives = 242/307 (79%), Gaps = 2/307 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDAR+VL KTSDS EE+ +RLADI+EAAGIPE C+D++V V
Sbjct  166   IGVLAMPESPRWLVMQGRLGDARQVLDKTSDSKEESMLRLADIQEAAGIPEDCNDDIVQV  225

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             T     E  VW+ELF+ PTP VLHILI  +G H FQQASGIDA+VLY PR+FEKAGI S 
Sbjct  226   TGHSHGE-GVWKELFVHPTPTVLHILIAALGFHFFQQASGIDALVLYSPRVFEKAGITSS  284

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSH  751
                LLCT+ +G +KTVF LVATF LD+ GRRPLLLTS+ GMV +L  LG SLT++D H  
Sbjct  285   DQLLLCTVGVGLSKTVFTLVATFFLDRVGRRPLLLTSMAGMVVSLVCLGTSLTIVDQHEG  344

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
              ++ WAV + +   LA+V  FS G GPI WVYSSEIFPL+LRA GC +G  +NRV SG++
Sbjct  345   ARMTWAVVLCLFCVLAFVGFFSTGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRVMSGIL  404

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
             SMTFISLYKAI++GG+FFLYAAI AVGW+FFFT++PETQG+TLE+ E LFG F +WR   
Sbjct  405   SMTFISLYKAITMGGAFFLYAAIGAVGWIFFFTMLPETQGRTLEDMEVLFGKFHKWRKAN  464

Query  390   REVDAKK  370
             + ++ K+
Sbjct  465   KLLEKKR  471



>ref|XP_010254895.1| PREDICTED: polyol transporter 5-like [Nelumbo nucifera]
Length=531

 Score =   422 bits (1086),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 202/314 (64%), Positives = 242/314 (77%), Gaps = 2/314 (1%)
 Frame = -3

Query  1290  GVSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVT  1111
             G  V+ MPESPRWLVMQGRLG+ARRVL KTS+S EEA  RLADIKEAAGIP  C+DEV+ 
Sbjct  200   GFGVMGMPESPRWLVMQGRLGEARRVLNKTSESKEEAEFRLADIKEAAGIPAECNDEVIQ  259

Query  1110  VTKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
             V K R   + VW+EL + P+P+V  ILI  +GIH FQQ+SGID+VVLY PRIFEKAGI +
Sbjct  260   VAK-RSHGEGVWKELLLRPSPSVRRILIAAIGIHFFQQSSGIDSVVLYSPRIFEKAGITN  318

Query  930   DTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH  751
                KL  T+A+GF KT FILVATF LD+ GRRPLLL+SV GM+ +L  L   LTVI++S 
Sbjct  319   RNKKLGATVAVGFVKTCFILVATFLLDRVGRRPLLLSSVAGMIVSLVGLATGLTVIENSD  378

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             +K+PWA+ + I M L +VA+FSIG GPITWVYSSEIFPL+LRA G ++G  +NRVTSGV+
Sbjct  379   KKLPWAIVLCIMMVLTFVASFSIGLGPITWVYSSEIFPLRLRAQGAAVGVAVNRVTSGVL  438

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
             +MTFISLYKAI+IGG+FFLY  +A V W FFFT +PETQG+ LEETE LFG  FRWRS  
Sbjct  439   AMTFISLYKAITIGGAFFLYGGVATVAWFFFFTFLPETQGRALEETEELFGN-FRWRSAL  497

Query  390   REVDAKKANNNSQL  349
              +    K  N SQL
Sbjct  498   TKKKMNKNQNQSQL  511



>dbj|BAM66296.1| sorbitol transporter, partial [Pyrus pyrifolia]
 dbj|BAM66297.1| sorbitol transporter, partial [Pyrus pyrifolia]
Length=454

 Score =   419 bits (1078),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 207/296 (70%), Positives = 240/296 (81%), Gaps = 1/296 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDA RVL KTSDS EE+ +RLADIKEAAGIPEHC D+VV V
Sbjct  159   LGVLAMPESPRWLVMQGRLGDATRVLNKTSDSKEESLLRLADIKEAAGIPEHCTDDVVQV  218

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+   +D VW+EL + PTPAV HILI  VGIH FQQASGIDA+VLY PR+FEKAGI + 
Sbjct  219   PKRSKGQD-VWKELLLHPTPAVRHILICAVGIHFFQQASGIDAIVLYSPRVFEKAGITNS  277

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLLCT+A+G  KT+FILVATF LD+ GRRPLLL SV GM+ +L  LG+ LT+ID +H 
Sbjct  278   DHKLLCTVAVGLAKTIFILVATFLLDRVGRRPLLLASVAGMILSLIGLGLGLTIIDQNHG  337

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             ++ WA  + I M L YVA FSIG GPITWVYSSEIFPLKLRA GCSLG  +NRV SGV+S
Sbjct  338   RIMWAAVLCITMVLLYVAFFSIGMGPITWVYSSEIFPLKLRAQGCSLGVAMNRVVSGVLS  397

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR  400
             MTFISLY+AI+IGG+FFLYAAIA V WVFFF ++PET G+TLE+ E LFG + RWR
Sbjct  398   MTFISLYEAITIGGAFFLYAAIATVAWVFFFIMLPETHGRTLEDMEVLFGKYHRWR  453



>gb|AAL85876.2|AF480069_1 mannitol transporter [Apium graveolens Dulce Group]
 gb|ABH03025.1| mannitol transporter MaT2 [Apium graveolens]
Length=524

 Score =   422 bits (1085),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 204/314 (65%), Positives = 248/314 (79%), Gaps = 7/314 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VL MPESPRWLVM+GRLG+AR+VL KTSDS EE+ +RL+DIK+AAGIPE C+D++V +
Sbjct  210   IGVLGMPESPRWLVMKGRLGEARQVLDKTSDSKEESRLRLSDIKQAAGIPEECNDDIVVM  269

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+R DE +VW+EL + PTP+V H  I GVG+H FQQ+SGIDA  LY PRIFEKAGI S 
Sbjct  270   PKRRNDE-AVWKELLLHPTPSVRHAFIAGVGLHFFQQSSGIDAGGLYSPRIFEKAGITST  328

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLL TIA+G +KT+FILVATF LD+ GRRPLLLTS+GGM+ +L LLG SL VIDHS  
Sbjct  329   DLKLLATIAVGISKTLFILVATFLLDRIGRRPLLLTSMGGMIISLTLLGTSLAVIDHSDH  388

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
              V WAVA+AI   LAYV  FSIG GPI W YSSE+FPL+LRA GCS+G  +NR TSG++S
Sbjct  389   TVHWAVALAIFGVLAYVGTFSIGLGPIAWGYSSEVFPLRLRAQGCSIGVAVNRGTSGIIS  448

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS---  397
             MTF+SLYKAISI G+F+L+AAIA V W+F FTL+PETQG++LEE   LFGT+F WR    
Sbjct  449   MTFLSLYKAISIAGAFYLFAAIAGVAWIFIFTLLPETQGRSLEEMGLLFGTYFGWRKTLK  508

Query  396   --RQREV-DAKKAN  364
               + RE  +AK AN
Sbjct  509   GLKNREAEEAKNAN  522



>emb|CAP58706.1| putative polyol transporter protein 1 [Hevea brasiliensis]
 emb|CAN88842.1| polyols transporter 1 [Hevea brasiliensis]
Length=525

 Score =   422 bits (1085),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 215/317 (68%), Positives = 253/317 (80%), Gaps = 3/317 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VL MPESPRWLV+QGRLGDA+RVL +TSDS EEA  RLADIK AAGIP+ C+D+VV V
Sbjct  210   VIVLVMPESPRWLVLQGRLGDAKRVLDRTSDSKEEAQARLADIKAAAGIPQDCNDDVVQV  269

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              KK   E  VWRELF+ PTP+V HIL   +G+H F QASGIDAVVLY PRIFEKAGI SD
Sbjct  270   EKKSHGE-GVWRELFLHPTPSVRHILACVIGMHFFHQASGIDAVVLYSPRIFEKAGITSD  328

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
              DKLL T+A+GF KTVFILVATF LD+ GRRPLLL+SVGGM+ +LA LG +LT+IDHSHE
Sbjct  329   NDKLLATVAVGFVKTVFILVATFLLDRIGRRPLLLSSVGGMIFSLATLGFALTIIDHSHE  388

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WA+A+ IAM LA VA FSIG GPI WVY++EI PL+LRA G S+G  +NRVTSGV+S
Sbjct  389   KLTWAIALCIAMVLANVAFFSIGLGPIAWVYTTEIIPLRLRAQGASMGAAVNRVTSGVIS  448

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS--R  394
              TFISLYK I+IGG+FFL+AAIAAV W FFFT +PETQG+TLE+ E LFG F +WRS  +
Sbjct  449   TTFISLYKGITIGGAFFLFAAIAAVAWSFFFTCLPETQGRTLEDMEVLFGHFIKWRSALK  508

Query  393   QREVDAKKANNNSQLQM  343
             + E   K   +N Q Q+
Sbjct  509   KHEEGNKDGESNGQTQL  525



>ref|XP_006349557.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=519

 Score =   422 bits (1084),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 196/315 (62%), Positives = 242/315 (77%), Gaps = 0/315 (0%)
 Frame = -3

Query  1290  GVSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVT  1111
             G+ VLAMPESPRWLVMQGRLGDA++VL +TSD+ EE+  RLADIKEAAGIP+ C D++V+
Sbjct  191   GIGVLAMPESPRWLVMQGRLGDAKKVLDRTSDTLEESKTRLADIKEAAGIPQDCQDDIVS  250

Query  1110  VTKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
             VT++      VWRELF+ PTP VLHILI  +GIH FQQASGIDAVVLY PRI+EKAGI  
Sbjct  251   VTRESSHGSGVWRELFLHPTPTVLHILIAAIGIHFFQQASGIDAVVLYSPRIYEKAGITK  310

Query  930   DTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH  751
              + +LL TIA+G  KT F LVATF +DK GRR LLL+S GGM+ +L  L   LT+IDHS 
Sbjct  311   PSYRLLATIAVGCMKTFFTLVATFLVDKIGRRILLLSSCGGMILSLLALATGLTIIDHSD  370

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
               + WA+ + +  T + VA FSIG GP+ WVYSSEIFPL+LRA GCS+G  +NR  SG +
Sbjct  371   HTLKWAIVVCVCATYSTVAFFSIGMGPLAWVYSSEIFPLRLRAQGCSIGVAVNRAVSGGI  430

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
              MTFISLYKAISIGG+FFLYA +A+V W+FF+TL+PET+G+TLEE E LFGTFF+WRS  
Sbjct  431   LMTFISLYKAISIGGAFFLYAGVASVAWIFFYTLLPETKGRTLEEMEPLFGTFFKWRSTM  490

Query  390   REVDAKKANNNSQLQ  346
             +E+   +   +  L 
Sbjct  491   KELKKNRVEGDDMLS  505



>ref|XP_007199793.1| hypothetical protein PRUPE_ppa004456mg [Prunus persica]
 gb|EMJ00992.1| hypothetical protein PRUPE_ppa004456mg [Prunus persica]
Length=509

 Score =   421 bits (1082),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 200/307 (65%), Positives = 241/307 (79%), Gaps = 1/307 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VL MPESPRWLVMQGRLGDA+ VL KTSDS EEA +RLADIKEAAGIPEHC ++VV V
Sbjct  201   VGVLTMPESPRWLVMQGRLGDAKHVLDKTSDSLEEAQLRLADIKEAAGIPEHCTEDVVQV  260

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K    E+ VW+EL + PTP V HIL+  +G H FQQ SGIDA+VLY PRIFEKAGI   
Sbjct  261   PKHSHGEE-VWKELLLHPTPPVRHILMAAIGFHFFQQLSGIDALVLYSPRIFEKAGITDS  319

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             +  LL T+A+GF+KTVF L+A   LD+ GRRPLLLTSV GM+ +L  LG SLT++DH +E
Sbjct  320   STLLLATVAVGFSKTVFTLIAIGFLDRVGRRPLLLTSVAGMIASLLCLGTSLTIVDHENE  379

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WA  + + M LAYV  FSIG GPI WVYSSEIFPLKLRA GCS+GT +NR+ SGV++
Sbjct  380   KMMWATVVCLTMVLAYVGFFSIGMGPIAWVYSSEIFPLKLRAQGCSMGTAVNRIMSGVLT  439

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFI+LYKAI++GG+FFLY AIA VGWVFF+T++PETQG+TLE+ E LFG F+RWR    
Sbjct  440   MTFITLYKAITMGGTFFLYGAIATVGWVFFYTMLPETQGRTLEDMEVLFGKFWRWREGYA  499

Query  387   EVDAKKA  367
              +  K+A
Sbjct  500   LLRNKRA  506



>gb|AAO39267.1|AF482011_1 sorbitol transporter [Prunus cerasus]
Length=509

 Score =   421 bits (1082),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 201/307 (65%), Positives = 242/307 (79%), Gaps = 1/307 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VL+MPESPRWLVMQGRLG+A++VL KTSDS EEA +RLADIKEAAGIPEHC ++VV V
Sbjct  201   VGVLSMPESPRWLVMQGRLGEAKQVLDKTSDSLEEAQLRLADIKEAAGIPEHCVEDVVQV  260

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K    E+ VW+EL + PTP V HILI  +G H FQQ SGIDA+VLY PRIFEKAGI   
Sbjct  261   PKHSHGEE-VWKELLLHPTPPVRHILIAAIGFHFFQQLSGIDALVLYSPRIFEKAGITDS  319

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             +  LL T+A+GF+KT+F LVA   LD+ GRRPLLLTSV GM+ +L  LG SLT++DH  E
Sbjct  320   STLLLATVAVGFSKTIFTLVAIGFLDRVGRRPLLLTSVAGMIASLLCLGTSLTIVDHETE  379

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WA  + + M LAYV  FSIG GPI WVYSSEIFPLKLRA GCS+GT +NR+ SGV+S
Sbjct  380   KMMWASVLCLTMVLAYVGFFSIGMGPIAWVYSSEIFPLKLRAQGCSMGTAVNRIMSGVLS  439

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             M+FISLYKAI++GG+FFLYA IA VGWVFF+T++PETQG+TLE+ E LFG F+RWR    
Sbjct  440   MSFISLYKAITMGGTFFLYAGIATVGWVFFYTMLPETQGRTLEDMEVLFGKFWRWREGYA  499

Query  387   EVDAKKA  367
              +  K+A
Sbjct  500   LLRNKRA  506



>ref|XP_007200667.1| hypothetical protein PRUPE_ppa015294mg [Prunus persica]
 gb|EMJ01866.1| hypothetical protein PRUPE_ppa015294mg [Prunus persica]
Length=538

 Score =   422 bits (1084),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 206/324 (64%), Positives = 249/324 (77%), Gaps = 6/324 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVM+GRLGDA++VL KTS S EEA +RL DIKEAAGIP H +D++V V
Sbjct  209   VGVLAMPESPRWLVMKGRLGDAKQVLNKTSASKEEAQLRLEDIKEAAGIPMHLNDDIVEV  268

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+   E SVW++L + PTPAV HILI  +GIH F+QASGID+VVLY PRIFEKAGI+S 
Sbjct  269   PKQSHGE-SVWKQLILHPTPAVRHILIAALGIHFFEQASGIDSVVLYSPRIFEKAGIQSY  327

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLL TIA+G  KT+FILVATF LD+ GRRPLLL S+GGMV +L  LG SLTVID S  
Sbjct  328   NHKLLATIAVGVVKTLFILVATFLLDRIGRRPLLLISMGGMVFSLGFLGASLTVIDQSQG  387

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
              V WAV + I M L  VA FSIG GP+TWVY+SEIFPLKLRA GCS+G  INRVTSG++S
Sbjct  388   TVTWAVGLCITMVLFNVAFFSIGLGPVTWVYTSEIFPLKLRAQGCSMGVAINRVTSGIIS  447

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS---  397
             MTFISLYKAI+IGG+FFLYA +  V W+FF+T++PETQG+TLEE E LFG + +W+    
Sbjct  448   MTFISLYKAITIGGAFFLYAGVGVVAWIFFYTMLPETQGRTLEEMEVLFGKYHKWKEANA  507

Query  396   --RQREVDAKKANNNSQLQMGTLQ  331
               ++R+   K+  +N    +  LQ
Sbjct  508   MLKKRKQGKKRDVHNFFFLLNYLQ  531



>ref|XP_007200254.1| hypothetical protein PRUPE_ppa015090mg [Prunus persica]
 ref|XP_007200263.1| hypothetical protein PRUPE_ppa014975mg [Prunus persica]
 gb|EMJ01453.1| hypothetical protein PRUPE_ppa015090mg [Prunus persica]
 gb|EMJ01462.1| hypothetical protein PRUPE_ppa014975mg [Prunus persica]
Length=527

 Score =   421 bits (1083),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 205/309 (66%), Positives = 242/309 (78%), Gaps = 2/309 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVMQGRLGDA+RVL KTS S EEA +RL DIKEAAGIP H +D+VV V
Sbjct  210   VGVLAMPESPRWLVMQGRLGDAKRVLDKTSTSKEEAQLRLEDIKEAAGIPMHLNDDVVPV  269

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             TK+   E  VWR+L I PTPAVLHILI  +GIH FQQ +GID+VVLY PRIF KAGI S 
Sbjct  270   TKQSHGE-GVWRQL-IHPTPAVLHILIAALGIHFFQQVTGIDSVVLYSPRIFAKAGITSY  327

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
                LL T+A+GF KT+FI +ATF LD+ GRRPLLLTS+GGM+ +L  LG +LT+ID+   
Sbjct  328   EHTLLATVAVGFVKTIFIFIATFLLDRVGRRPLLLTSMGGMIFSLVCLGAALTIIDNHDS  387

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+PWAVA+ I M L  VA FSIG GPITWVYSSEIFPLKLRA G SLG  +NRV SG+VS
Sbjct  388   KIPWAVALCIIMVLFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSLGVAVNRVISGIVS  447

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SLYKAI+IGG+FFLYA I  + WVFF+T++PETQG+TLEE E LFG + +WR    
Sbjct  448   MTFLSLYKAITIGGAFFLYAGIGVLAWVFFYTMLPETQGRTLEEMEVLFGKYHKWRQANA  507

Query  387   EVDAKKANN  361
              +  KK ++
Sbjct  508   MLKTKKVDH  516



>ref|XP_007200117.1| hypothetical protein PRUPE_ppa018884mg [Prunus persica]
 gb|EMJ01316.1| hypothetical protein PRUPE_ppa018884mg [Prunus persica]
Length=527

 Score =   421 bits (1082),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 205/309 (66%), Positives = 242/309 (78%), Gaps = 2/309 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVMQGRLGDA+RVL KTS S EEA +RL DIKEAAGIP H +D+VV V
Sbjct  210   VGVLAMPESPRWLVMQGRLGDAKRVLDKTSTSKEEAQLRLEDIKEAAGIPMHLNDDVVPV  269

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             TK+   E  VWR+L I PTPAVLHILI  +GIH FQQ +GID+VVLY PRIF KAGI S 
Sbjct  270   TKQSHGE-GVWRQL-IHPTPAVLHILIAALGIHFFQQVTGIDSVVLYSPRIFAKAGITSY  327

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
                LL T+A+GF KT+FI +ATF LD+ GRRPLLLTS+GGM+ +L  LG +LT+ID+   
Sbjct  328   EHTLLATVAVGFVKTIFIFIATFLLDRVGRRPLLLTSMGGMIFSLVCLGAALTIIDNHDS  387

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+PWAVA+ I M L  VA FSIG GPITWVYSSEIFPLKLRA G SLG  +NRV SG+VS
Sbjct  388   KIPWAVALCIIMVLFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSLGVAVNRVISGIVS  447

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SLYKAI+IGG+FFLYA I  + WVFF+T++PETQG+TLEE E LFG + +WR    
Sbjct  448   MTFLSLYKAITIGGAFFLYAGIGVLAWVFFYTMLPETQGRTLEEMEVLFGKYHKWRQANA  507

Query  387   EVDAKKANN  361
              +  KK ++
Sbjct  508   MLKTKKVDH  516



>ref|XP_009375838.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=528

 Score =   421 bits (1082),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 202/316 (64%), Positives = 247/316 (78%), Gaps = 7/316 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDA+RVL +TS S EE+ +RL +IK AAG+P +  +EVV V
Sbjct  209   LGVLAMPESPRWLVMQGRLGDAKRVLNRTSSSEEESQLRLDEIKAAAGLPNNSKEEVVQV  268

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +K R   + +W+EL + PTPAV HILI  +GIH FQQ SG D+VVLY PRIFEKAGI S 
Sbjct  269   SK-RSQGEGIWKELLLRPTPAVRHILIAALGIHFFQQLSGTDSVVLYSPRIFEKAGITSY  327

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
              DKLL T+A+GF KT  ILVATF +D+FGRR LLL+SVGGMV +  LLG+ LTV+D S  
Sbjct  328   NDKLLATVAVGFVKTTAILVATFQVDRFGRRILLLSSVGGMVVSFTLLGVGLTVVDQSPS  387

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KVPWA+ + IAM L  VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+S
Sbjct  388   KVPWAIGLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVIS  447

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR----  400
             MTFISLYKAI+IGG+FFLYA IAA+ WVFF+TL PETQG++LE+ E LFG + +WR    
Sbjct  448   MTFISLYKAITIGGAFFLYAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWREANA  507

Query  399   --SRQREVDAKKANNN  358
               ++ ++ D   A++N
Sbjct  508   MLNKTKQADHGFADHN  523



>ref|XP_008236796.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=509

 Score =   420 bits (1080),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 199/307 (65%), Positives = 240/307 (78%), Gaps = 1/307 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VL MPESPRWLVMQGRLGDA+ VL KTSDS EEA +RLADIKEAAGIPEHC +++V V
Sbjct  201   VGVLTMPESPRWLVMQGRLGDAKHVLDKTSDSVEEAQLRLADIKEAAGIPEHCTEDIVQV  260

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K    E+ VW+EL + PTP V HILI  VG H FQQ SGIDA+VLY PRIFE AGI   
Sbjct  261   PKHSHGEE-VWKELLLHPTPPVRHILIAAVGFHFFQQMSGIDALVLYSPRIFEAAGITDS  319

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             +  LL T+A+GF+KT+F L+A   LD+ GRRPLLLTSV GM+ +L  LG SLT++DH +E
Sbjct  320   STLLLATVAVGFSKTIFTLIAIGFLDRVGRRPLLLTSVAGMIASLLCLGTSLTIVDHENE  379

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WA  + + M LAYV  FSIG GPI WVYSSEIFPLKLRA GCS+GT +NR+ SGV++
Sbjct  380   KMMWASVLCLTMVLAYVGFFSIGMGPIAWVYSSEIFPLKLRAQGCSMGTAVNRIMSGVLT  439

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFI+LYKAI++GG+FFLY AIA VGWVFF+T++PETQG+TLE+ E LFG F+RWR    
Sbjct  440   MTFITLYKAITMGGTFFLYGAIATVGWVFFYTMLPETQGRTLEDMEVLFGKFWRWREGYA  499

Query  387   EVDAKKA  367
              +  K+A
Sbjct  500   LLRNKRA  506



>ref|XP_007200033.1| hypothetical protein PRUPE_ppa024323mg [Prunus persica]
 gb|EMJ01232.1| hypothetical protein PRUPE_ppa024323mg [Prunus persica]
Length=534

 Score =   421 bits (1082),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 205/309 (66%), Positives = 242/309 (78%), Gaps = 2/309 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVMQGRLGDA+RVL KTS S EEA +RL DIKEAAGIP H +D+VV V
Sbjct  210   VGVLAMPESPRWLVMQGRLGDAKRVLDKTSTSKEEAQLRLEDIKEAAGIPMHLNDDVVPV  269

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             TK+   E  VWR+L I PTPAVLHILI  +GIH FQQ +GID+VVLY PRIF KAGI S 
Sbjct  270   TKQSHGE-GVWRQL-IHPTPAVLHILIAALGIHFFQQVTGIDSVVLYSPRIFAKAGITSY  327

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
                LL T+A+GF KT+FI +ATF LD+ GRRPLLLTS+GGM+ +L  LG +LT+ID+   
Sbjct  328   EHTLLATVAVGFVKTIFIFIATFLLDRVGRRPLLLTSMGGMIFSLVCLGAALTIIDNHDS  387

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+PWAVA+ I M L  VA FSIG GPITWVYSSEIFPLKLRA G SLG  +NRV SG+VS
Sbjct  388   KIPWAVALCIIMVLFNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSLGVAVNRVISGIVS  447

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SLYKAI+IGG+FFLYA I  + WVFF+T++PETQG+TLEE E LFG + +WR    
Sbjct  448   MTFLSLYKAITIGGAFFLYAGIGVLAWVFFYTMLPETQGRTLEEMEVLFGKYHKWRQANA  507

Query  387   EVDAKKANN  361
              +  KK ++
Sbjct  508   MLKTKKVDH  516



>ref|XP_008387375.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=520

 Score =   420 bits (1080),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 204/316 (65%), Positives = 243/316 (77%), Gaps = 7/316 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLG A+RVL KTS S EE+ +RL +IK AAGIP+   DEVV V
Sbjct  201   LGVLAMPESPRWLVMQGRLGXAKRVLNKTSSSEEESQLRLDEIKXAAGIPKDSXDEVVQV  260

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +K R   + +W EL + PTPAV HILI  +GIH FQQ SG D+VVLY PRIFEKAGI S 
Sbjct  261   SK-RSQGEGIWXELLLRPTPAVRHILIAALGIHFFQQVSGTDSVVLYSPRIFEKAGITSY  319

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
              DKLL T+A+GF KT+ ILVATF +D+FGRR LLL+SVGGMV +  LLG  LTV+D SH 
Sbjct  320   NDKLLATVAVGFVKTIAILVATFQVDRFGRRILLLSSVGGMVVSFTLLGXGLTVVDQSHS  379

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KVPWAV + IAM L  VA FSIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+S
Sbjct  380   KVPWAVGLCIAMVLFIVAFFSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVIS  439

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR----  400
             MTFISLYKAI+IGG+FFLYA IAA+ WVFF+TL PETQG++LE+ E LFG + +W     
Sbjct  440   MTFISLYKAITIGGAFFLYAGIAALSWVFFYTLYPETQGRSLEDMEVLFGKYHKWXEANX  499

Query  399   --SRQREVDAKKANNN  358
                + ++ D    ++N
Sbjct  500   MLKKTKQADHXFGDDN  515



>ref|XP_008236860.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
Length=525

 Score =   420 bits (1080),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 203/312 (65%), Positives = 244/312 (78%), Gaps = 1/312 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVMQGRLGDA+RVL KTS S +EA +RL DIKEAAGI +  DD+VV V
Sbjct  209   VGVLAMPESPRWLVMQGRLGDAKRVLDKTSASKDEAQLRLDDIKEAAGIAKELDDDVVPV  268

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              KK   E  VW++L + PTPAV HILI  +GIH F+QASGID+VVLY PRIF+KAGIKS 
Sbjct  269   PKKSRGE-GVWKDLILHPTPAVRHILIAALGIHFFEQASGIDSVVLYSPRIFQKAGIKSY  327

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLL T+A+GF KT+ ILVATF LD+FGRRPLLL+SV GM+ +L  LG+ LT+ID  H+
Sbjct  328   DHKLLATVAVGFVKTIAILVATFFLDRFGRRPLLLSSVAGMIFSLVCLGVGLTIIDQHHD  387

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
              VPWA+A+ I M L  VA FSIG GPITWVYSSEIFPLKLRA G S+G  +NR+TSGV+S
Sbjct  388   TVPWAIALCITMVLLNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSMGVAVNRITSGVIS  447

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SLYKAI+IGGSFFLYA IAAV WVFF+ L+PET+G+TLE+ E LFG + +W+    
Sbjct  448   MTFLSLYKAITIGGSFFLYAGIAAVSWVFFYMLLPETRGRTLEDIEVLFGKYHKWKKANA  507

Query  387   EVDAKKANNNSQ  352
              +   K  +  +
Sbjct  508   LLKQSKQGDGEE  519



>emb|CAJ29291.1| putative polyol transporter protein 4 [Lotus japonicus]
Length=519

 Score =   420 bits (1079),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 211/312 (68%), Positives = 248/312 (79%), Gaps = 1/312 (0%)
 Frame = -3

Query  1290  GVSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVT  1111
             GV VLAMPESPRWLVM+GRLGDA +VL KTSDSPEEA +RLADIK AAGIPE C D+VV 
Sbjct  206   GVGVLAMPESPRWLVMRGRLGDAIKVLNKTSDSPEEAQLRLADIKRAAGIPESCTDDVVE  265

Query  1110  VTKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
             V+K R   + VW+ELF+ PTPA+ HI+I  +GIH FQQASGIDAVVLY P IFEKAGIKS
Sbjct  266   VSK-RSTGEGVWKELFLYPTPAIRHIVIAALGIHFFQQASGIDAVVLYSPTIFEKAGIKS  324

Query  930   DTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH  751
             DTDKLL T+A+GF KT FILVATF LD+ GRRPLLLTSVGGMV +L  LG SLT+ID S 
Sbjct  325   DTDKLLATVAVGFVKTCFILVATFMLDRIGRRPLLLTSVGGMVLSLLTLGTSLTIIDRSD  384

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
              KV WAV ++IA  L+YVA FSIGAGPITWVYSSEIFPL+LRA GC++G  +NRVTSGV+
Sbjct  385   TKVTWAVGLSIATVLSYVATFSIGAGPITWVYSSEIFPLRLRAQGCAMGVVVNRVTSGVI  444

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
             SMTF+SL K I+IGG+FFL+  IA  GW+FF+T++PET+GKTLE+ E  FG         
Sbjct  445   SMTFLSLSKGITIGGAFFLFGGIAICGWIFFYTMLPETRGKTLEDMEGSFGQSKSKIKGN  504

Query  390   REVDAKKANNNS  355
             + V   K N+ +
Sbjct  505   KGVGNGKDNDQA  516



>ref|XP_008359575.1| PREDICTED: LOW QUALITY PROTEIN: polyol transporter 5-like [Malus 
domestica]
Length=527

 Score =   420 bits (1079),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 202/306 (66%), Positives = 240/306 (78%), Gaps = 1/306 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             +SVLAMPESPRWLVMQGRLGDA+RVL KTS S EE+ +RL +IKEAAGIP+   DEVV V
Sbjct  208   LSVLAMPESPRWLVMQGRLGDAKRVLNKTSSSEEESQLRLDEIKEAAGIPKDSKDEVVQV  267

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +K R   + +W+EL I PT A  HILI  +GIH FQQ SG  +VVLY PRIFEKAGI S 
Sbjct  268   SK-RSQGEGIWKELLICPTQAARHILIVALGIHFFQQLSGTHSVVLYSPRIFEKAGITSY  326

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
              DKLL T+A+GF KT+ ILVATF +D+FGRR LLL+SVGGMV +  LLG+ LTV+D SH 
Sbjct  327   NDKLLATVAVGFVKTIAILVATFQVDRFGRRILLLSSVGGMVVSFTLLGVGLTVVDQSHS  386

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KVPWAV + IAM L  VA FSIG GPITWVYSSEIF L+LRA GCS+G  +NR+TSGV+S
Sbjct  387   KVPWAVGLCIAMVLFIVAFFSIGLGPITWVYSSEIFSLQLRAQGCSMGEAVNRMTSGVIS  446

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFISLYKAI+IGG+FFLYA IAA+ WVFF+TL PET G++LE+ E LFG + +WR    
Sbjct  447   MTFISLYKAITIGGAFFLYAGIAALSWVFFYTLYPETXGRSLEDMEVLFGKYHKWREANA  506

Query  387   EVDAKK  370
              ++  K
Sbjct  507   MLNKTK  512



>ref|NP_001281036.1| polyol transporter 5-like [Malus domestica]
 dbj|BAD42344.1| sorbitol transporter [Malus domestica]
Length=491

 Score =   418 bits (1074),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 195/307 (64%), Positives = 241/307 (79%), Gaps = 2/307 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDAR+VL KTSDS EE+ +RLADIKEAAGIPE C+D++V V
Sbjct  166   IGVLAMPESPRWLVMQGRLGDARQVLDKTSDSKEESMLRLADIKEAAGIPEDCNDDIVQV  225

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             T     E  VW+ELF+ PTP VLHI+I  +G H FQQASGIDA+VLY PR+FEKAGI + 
Sbjct  226   TGHSHGE-GVWKELFVHPTPTVLHIVIAALGFHFFQQASGIDALVLYSPRVFEKAGITNS  284

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSH  751
                LLCT+ +G +KTVF  VATF LD+ GRRPL+LTS+ GMV +L  LG SLT++D H  
Sbjct  285   NQLLLCTVGVGLSKTVFTFVATFFLDRVGRRPLVLTSMAGMVASLVCLGTSLTIVDQHEG  344

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
              ++ WAV + +   LA+V  FS G GPI WVYSSEIFPL+LRA GC +G  +NRV SGV+
Sbjct  345   ARMTWAVVLCLCCVLAFVGFFSTGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRVMSGVL  404

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
             SMTFISLYKAI++GG+FFLYAAI AVGW+FFFT++PETQG+TLE+ E LFG F +WR   
Sbjct  405   SMTFISLYKAITMGGAFFLYAAIGAVGWIFFFTMLPETQGRTLEDMEVLFGKFHKWRKAN  464

Query  390   REVDAKK  370
             + ++ ++
Sbjct  465   KLLEKER  471



>ref|XP_008361285.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=527

 Score =   419 bits (1076),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 203/320 (63%), Positives = 246/320 (77%), Gaps = 9/320 (3%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDA+RVL KTS+S EE  +RL DIK AAGIP+  +D++V V
Sbjct  211   IGVLAMPESPRWLVMQGRLGDAKRVLQKTSESIEECQLRLDDIKGAAGIPKQSNDDIVQV  270

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +K R   + VW+EL + PTPAV HILI  +GIH F+Q+SGID+VVLY PRIFEKAGI S 
Sbjct  271   SK-RSHGEGVWKELLVHPTPAVRHILIAALGIHFFEQSSGIDSVVLYSPRIFEKAGITSY  329

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLL T+A+G  KT+ ILVAT  LDKFGRRPLLLTSV GMV +L  LG  LT++D  H 
Sbjct  330   DQKLLATVAVGVVKTICILVATVFLDKFGRRPLLLTSVAGMVLSLTCLGAGLTIVDQHHG  389

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WA+ + I M L  VA  SIG GPITWVYSSEIFPL+LRA GCS+G  +NRVTSGV+S
Sbjct  390   KITWAIVLCITMVLLNVAFXSIGLGPITWVYSSEIFPLQLRAQGCSMGVAVNRVTSGVIS  449

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR----  400
             MTFISLYKAI+IGG+FFLYA IAA+GWVFF+TL PETQG+TLE+ E LFG + +WR    
Sbjct  450   MTFISLYKAITIGGAFFLYAGIAALGWVFFYTLYPETQGRTLEDMEVLFGKYHKWREANA  509

Query  399   --SRQREVDAKKANNNSQLQ  346
                + ++VD +  +N  Q+ 
Sbjct  510   MLKKTKQVDGE--DNKGQIH  527



>emb|CDP10064.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   418 bits (1075),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 202/314 (64%), Positives = 247/314 (79%), Gaps = 1/314 (0%)
 Frame = -3

Query  1290  GVSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVT  1111
             G+ VLAMPESPRWLVMQGRL DAR+VL +TS+S +E+H RLADIKEAAGIP  C+++VV 
Sbjct  205   GLGVLAMPESPRWLVMQGRLADARKVLDRTSESLQESHDRLADIKEAAGIPAECNEDVVE  264

Query  1110  VTKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
             V +++     VW+ELFI PTP VLHILI G+G+H FQQASGID+VV+Y PRIFEKAGI S
Sbjct  265   VPRRKKGGAGVWKELFIHPTPKVLHILIAGIGVHFFQQASGIDSVVMYSPRIFEKAGITS  324

Query  930   DTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-S  754
                KLLCTIA+G TKT+FIL++T  LD+ GRR LL+ S  G+V +L  L + LTVIDH  
Sbjct  325   TNGKLLCTIAVGVTKTIFILISTCYLDRVGRRVLLIASSAGLVASLWGLAIGLTVIDHYP  384

Query  753   HEKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGV  574
              +K+ WA+ ++   TL+ VA FS G GPI WVYSSEIFPLKLRA G S+   INRVTSG+
Sbjct  385   GQKLTWAIGISFFCTLSSVATFSSGMGPIAWVYSSEIFPLKLRAQGNSIAVAINRVTSGI  444

Query  573   VSMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSR  394
             + MTFISLYKAI+IGGSFF Y AIA  G++FF TL+PET+G++LEETE LFGTFFRWRSR
Sbjct  445   ILMTFISLYKAITIGGSFFFYGAIAFAGFLFFCTLLPETKGRSLEETEELFGTFFRWRSR  504

Query  393   QREVDAKKANNNSQ  352
              REV+++K  N   
Sbjct  505   AREVESRKWENEKN  518



>ref|XP_006384498.1| hypothetical protein POPTR_0004s15900g [Populus trichocarpa]
 gb|ERP62295.1| hypothetical protein POPTR_0004s15900g [Populus trichocarpa]
Length=503

 Score =   417 bits (1073),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 203/292 (70%), Positives = 236/292 (81%), Gaps = 1/292 (0%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             V+ MPESPRWLVMQGRLGDAR+VL KTSD+ EE+  RL+DIKEAAGIP+ C+D+ V V K
Sbjct  213   VIGMPESPRWLVMQGRLGDARKVLDKTSDTKEESQQRLSDIKEAAGIPQDCNDDAVRVQK  272

Query  1101  KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTD  922
             K   E  VW+ELFI PT  V HIL+  +GIH FQQASGIDAVVLY   IFEKAGI S  D
Sbjct  273   KSHGE-GVWKELFIHPTRPVRHILLCVIGIHFFQQASGIDAVVLYSTNIFEKAGITSSND  331

Query  921   KLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKV  742
             KLL T+A+GFTKT+FILVATF LD+ GRRPLLL+SVGGMV +LA LG  LT+IDHSHEK+
Sbjct  332   KLLATVAVGFTKTLFILVATFFLDRIGRRPLLLSSVGGMVLSLATLGFGLTIIDHSHEKL  391

Query  741   PWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMT  562
             PWAVA++IAM LA+VA FSIG GPI  VYSSEIFPL+LRA G  +G  +NRVTSGV++ T
Sbjct  392   PWAVALSIAMVLAFVAFFSIGMGPIAGVYSSEIFPLRLRAQGIGMGVAVNRVTSGVITTT  451

Query  561   FISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFR  406
             FI LYKAISIGG+FFL+A IA V WVFFF   PET+G+TLE+ E LFG F +
Sbjct  452   FIMLYKAISIGGAFFLFAGIATVAWVFFFACYPETRGRTLEDMEVLFGNFIK  503



>ref|XP_007042751.1| Polyol/monosaccharide transporter 5, putative [Theobroma cacao]
 gb|EOX98582.1| Polyol/monosaccharide transporter 5, putative [Theobroma cacao]
Length=532

 Score =   418 bits (1075),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 203/319 (64%), Positives = 245/319 (77%), Gaps = 2/319 (1%)
 Frame = -3

Query  1290  GVSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVT  1111
             GV VLAMPESPRWLVMQGRLG+A+RVL K+ DS EEA +RL DIKEA GIP    D+VV 
Sbjct  209   GVGVLAMPESPRWLVMQGRLGEAKRVLDKSLDSKEEAQLRLNDIKEAVGIPASSTDDVVQ  268

Query  1110  VTKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
             V K+   E  VWREL + PTPA+ H+LI  +GI  FQQ+SGI+AVVLY PRIFEKAGI S
Sbjct  269   VQKQSHGE-GVWRELLVYPTPAIRHVLICIIGIQFFQQSSGIEAVVLYSPRIFEKAGITS  327

Query  930   DTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH  751
               DKLL T+A+GF KT+FILVATF LD+ GRRPLLL+SVGGMV +LA +  SLT+IDHS 
Sbjct  328   SNDKLLATVAVGFVKTIFILVATFLLDRIGRRPLLLSSVGGMVASLAAIAFSLTIIDHSE  387

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             EK+ WA+ + I M LA+VA FSIG GPI  VY+SEIFPL+LRA G S+   +NRVTSGV 
Sbjct  388   EKLVWAIGLCITMVLAFVAFFSIGMGPIAGVYTSEIFPLRLRAQGVSMAVAVNRVTSGVT  447

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
             +MTFISLY AI+IGG+FFL+A IAA+GWVFF+T +PET+GKTLEE E LFG    WR   
Sbjct  448   AMTFISLYNAITIGGAFFLFAGIAAMGWVFFYTCVPETRGKTLEEMEGLFGKLVGWREEA  507

Query  390   REVDAKKANNNS-QLQMGT  337
             +++ +      S Q+Q+G 
Sbjct  508   KKMKSTVMEEESRQVQLGN  526



>ref|XP_006349565.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=518

 Score =   417 bits (1071),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 199/311 (64%), Positives = 241/311 (77%), Gaps = 1/311 (0%)
 Frame = -3

Query  1290  GVSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHC-DDEVV  1114
             GV VLAMPESPRWLVMQGRLGDA++VL +TSD+ EE+  RLADIKEAAGIP+ C DD++V
Sbjct  204   GVGVLAMPESPRWLVMQGRLGDAKKVLDRTSDTLEESKTRLADIKEAAGIPQDCQDDDIV  263

Query  1113  TVTKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIK  934
             +VT++  +   VWR+LFI PTP VLHILI GVGIH FQQASGIDAVVLY PRI+EKAGI 
Sbjct  264   SVTRESSNGSGVWRDLFIHPTPTVLHILIVGVGIHFFQQASGIDAVVLYSPRIYEKAGIT  323

Query  933   SDTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS  754
               + +LL TIA+G  KT F LVATF +DK GRR LLL+S GGM+ +L  L   LT+IDHS
Sbjct  324   KPSYRLLATIAVGCMKTFFTLVATFFVDKIGRRILLLSSCGGMILSLLALATGLTIIDHS  383

Query  753   HEKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGV  574
                + WA+ + +  T + VA FSIG GP+ WVYSSEIFPL+LRA GCS+G  +NR  SG 
Sbjct  384   DHTLKWAIVVCVCATYSTVAFFSIGMGPLAWVYSSEIFPLRLRAQGCSIGVAVNRAVSGG  443

Query  573   VSMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSR  394
             + MTFISLYKAISIGG+FFLY  IA V W+FF+TL+PET+G+TLEE E LFGTFF+WRS 
Sbjct  444   ILMTFISLYKAISIGGAFFLYTGIAIVAWIFFYTLLPETKGRTLEEMEPLFGTFFKWRST  503

Query  393   QREVDAKKANN  361
              +E+   +   
Sbjct  504   MKELKRSRVEG  514



>ref|XP_007199207.1| hypothetical protein PRUPE_ppa021762mg [Prunus persica]
 gb|EMJ00406.1| hypothetical protein PRUPE_ppa021762mg [Prunus persica]
Length=528

 Score =   417 bits (1072),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 206/321 (64%), Positives = 248/321 (77%), Gaps = 12/321 (4%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDA+RVL KTS S EEA +RL DIKEAAGI +  DD+VV V
Sbjct  209   LGVLAMPESPRWLVMQGRLGDAKRVLDKTSASKEEAQLRLDDIKEAAGIAKELDDDVVPV  268

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             TKK   E  VW++L + PTPAV HILI  +GIH F+QASGID+VVLY PRIF+KAGIKS 
Sbjct  269   TKKSHGE-GVWKDLIVHPTPAVRHILIAALGIHFFEQASGIDSVVLYSPRIFQKAGIKSY  327

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLL T+ +GF KT+ ILVATF LD+FGRR LLL+SV GM+ +LA LG+ LT+ID+  E
Sbjct  328   DHKLLATVGVGFVKTIAILVATFFLDRFGRRKLLLSSVAGMIFSLACLGVGLTIIDNHKE  387

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
              VPWA+A+ I M L  VA FSIG GPITWVYSSEIFPLKLRA G S+G  +NR+TSGV+S
Sbjct  388   TVPWAIALCITMVLLNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSMGVAVNRITSGVIS  447

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR----  400
             MTF+SLYKAI+IGGSFFLYA IAA+ WVFF+ L+PET+G+TLE+ E LFG + RW+    
Sbjct  448   MTFLSLYKAITIGGSFFLYAGIAALSWVFFYMLLPETRGRTLEDIEVLFGKYHRWKKANA  507

Query  399   -------SRQREVDAKKANNN  358
                    ++Q + D  K+  N
Sbjct  508   VLKQTKQTKQGDGDENKSQVN  528



>gb|AIU41385.1| sorbitol transporter 1 [Prunus salicina]
Length=509

 Score =   416 bits (1069),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 198/307 (64%), Positives = 238/307 (78%), Gaps = 1/307 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VL MPESPRWLVMQGRLGDA+ VL KTSDS EEA +RLADIKEAAGIPEHC ++VV V
Sbjct  201   VGVLTMPESPRWLVMQGRLGDAKHVLDKTSDSLEEAQLRLADIKEAAGIPEHCTEDVVQV  260

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K    E+ VW+EL + PTP V HILI  VG H FQQ SGIDA+VLY PRIF  +GI   
Sbjct  261   PKHSHGEE-VWKELLLHPTPPVRHILIAAVGFHFFQQMSGIDALVLYSPRIFRASGITDS  319

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             +  LL T+A+GF+KT+F L+A   LD+ GRRPLLLTSV GM+ +L  LG SLT++DH  E
Sbjct  320   STLLLATVAVGFSKTIFTLIAIGFLDRVGRRPLLLTSVAGMIASLLCLGTSLTIVDHEKE  379

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WA  + + M LAYV  FSIG GPI WVYSSEIFPLKLRA GCS+GT +NR+ SGV++
Sbjct  380   KMMWASVVCLTMVLAYVGFFSIGMGPIAWVYSSEIFPLKLRAQGCSMGTAVNRIMSGVLT  439

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFI+LYKAI++GG+FFLY AIA VGWVFF+T++PETQG+TLE+ E LFG F+RWR    
Sbjct  440   MTFITLYKAITMGGTFFLYGAIATVGWVFFYTMLPETQGRTLEDMEVLFGKFWRWREGYA  499

Query  387   EVDAKKA  367
              +  K+A
Sbjct  500   LLRNKRA  506



>ref|XP_007131851.1| hypothetical protein PHAVU_011G046700g [Phaseolus vulgaris]
 gb|ESW03845.1| hypothetical protein PHAVU_011G046700g [Phaseolus vulgaris]
Length=518

 Score =   416 bits (1068),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 202/317 (64%), Positives = 247/317 (78%), Gaps = 4/317 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVM+GRLG+A +VL KTSDS EEA +RLA+IK+AAGIPE C+D+VV V
Sbjct  202   LGVLAMPESPRWLVMRGRLGEATKVLNKTSDSKEEAQLRLAEIKQAAGIPESCNDDVVQV  261

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+   E  VW+ELF+ PTP + HILI+ +GIH FQQASG+DAVVLY P IFEKAGI  D
Sbjct  262   AKQSTGE-GVWKELFLYPTPTIRHILISAIGIHFFQQASGVDAVVLYSPTIFEKAGITDD  320

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             T KLL T+A+G  KT+FILVATF LD+ GRRPLLL+SVGGMV +L  L +SLT+ID S  
Sbjct  321   TQKLLATVAVGTVKTLFILVATFMLDRVGRRPLLLSSVGGMVLSLLTLAISLTIIDRSES  380

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WA+ ++I M L YVA FSIGAGPITWVYSSEIFPL+LRA G + G  +NR TSGV+S
Sbjct  381   KLMWAIGLSITMVLVYVATFSIGAGPITWVYSSEIFPLRLRAQGAAAGVVVNRTTSGVIS  440

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SL KAI+IGG+FFLY  IA VGW+FFF ++PET+GKTLE+ E  FGTF   R++  
Sbjct  441   MTFLSLTKAITIGGAFFLYCGIAVVGWLFFFIVLPETRGKTLEDMEGSFGTF---RAKSN  497

Query  387   EVDAKKANNNSQLQMGT  337
                  +     Q+Q+GT
Sbjct  498   NGVENENAKVPQVQLGT  514



>ref|XP_004500821.1| PREDICTED: polyol transporter 5-like [Cicer arietinum]
Length=517

 Score =   415 bits (1067),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 201/312 (64%), Positives = 246/312 (79%), Gaps = 2/312 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVM+GRLGDA +VL KTSDS +EA +RL +IK AAGIPE C+D+VV+V
Sbjct  206   VGVLAMPESPRWLVMKGRLGDAIKVLNKTSDSEQEARLRLIEIKAAAGIPESCNDDVVSV  265

Query  1107  TK-KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
              K   G+  +VW++LF+ PTPAV HI+I  +GIH FQQASGIDAVVLY P IF KAG++S
Sbjct  266   NKTNEGEGTTVWKDLFLYPTPAVRHIVIAALGIHFFQQASGIDAVVLYSPTIFRKAGLES  325

Query  930   DTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH  751
             DT++LL T+A+G  KTVFILVATF LD+ GRRPLLL+SVGGMV +L  L +SLTV+DHSH
Sbjct  326   DTEQLLATVAVGLCKTVFILVATFLLDRVGRRPLLLSSVGGMVISLLTLAVSLTVVDHSH  385

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
              +  WAV ++I   L+YVA FSIGAGPITWVYSSEIFPL+LRA G S G  +NRVTSG++
Sbjct  386   VRKMWAVGLSIVSVLSYVATFSIGAGPITWVYSSEIFPLRLRAQGASAGVVVNRVTSGII  445

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTF-FRWRSR  394
             SMTF+SL   ISIGG+FFL+  IAA GW+FF+ L+PETQGKTLEE E  FG F  +  ++
Sbjct  446   SMTFLSLSDKISIGGAFFLFGGIAACGWIFFYALLPETQGKTLEEMEGSFGKFGVKLSTK  505

Query  393   QREVDAKKANNN  358
                 + +  NNN
Sbjct  506   NDNGEIQFTNNN  517



>ref|XP_003607077.1| Sorbitol-like transporter [Medicago truncatula]
 gb|AES89274.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=520

 Score =   414 bits (1065),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 200/314 (64%), Positives = 247/314 (79%), Gaps = 4/314 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             ++VLAMPESPRWLV +GRLG+A++VL K SDS EEA +RLADIKE  GIP  CDD+ V+V
Sbjct  201   MAVLAMPESPRWLVAKGRLGEAKKVLYKISDSKEEAQLRLADIKEITGIPLDCDDDFVSV  260

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             TK +G    VW+ELF+ PTPAV HI I  +GIH F QA+GIDAVVLY PRIFEKAGIKSD
Sbjct  261   TKVQGK--GVWKELFLHPTPAVRHIFIASLGIHFFAQATGIDAVVLYSPRIFEKAGIKSD  318

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             T+KLL T+A+GF KT+F+LVATF LD+ GRR LLLTSVGG++ +L  L +SLT+ID+S  
Sbjct  319   TNKLLATVAVGFVKTMFVLVATFLLDRVGRRVLLLTSVGGLIISLLTLAISLTIIDNSSA  378

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
              + WA++++IA  L+Y A FSIG+GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+S
Sbjct  379   TLTWAISLSIAAVLSYAATFSIGSGPITWVYSSEIFPLRLRAQGVSIGAVVNRVTSGVIS  438

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SL  AI+IGG+FFL+A IA V W+F +T++PETQGKTLEE E  FG F  WR  + 
Sbjct  439   MTFLSLSNAITIGGAFFLFAGIAIVAWIFHYTMLPETQGKTLEEIEGSFGNF--WRKPKA  496

Query  387   EVDAKKANNNSQLQ  346
                A+ AN   QL 
Sbjct  497   SATAEGANGKIQLS  510



>ref|XP_010068107.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
Length=487

 Score =   413 bits (1061),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 201/313 (64%), Positives = 239/313 (76%), Gaps = 4/313 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAM ESPRWL+M GRL DA+RVL +TS+S +EA +RLADIKEAAGIP  C D+VV V
Sbjct  166   LGVLAMSESPRWLIMHGRLADAKRVLDRTSNSKDEAALRLADIKEAAGIPAECFDDVVKV  225

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             TK R   + VWR+L + PTP+V HILI  VGIH FQQASGIDAVVLY P IFEKAGI S 
Sbjct  226   TK-RSTGEGVWRDLLLHPTPSVRHILICAVGIHFFQQASGIDAVVLYSPSIFEKAGITSS  284

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLL TIA+GF KT+FILV+TF LD+ GRRPLLL+SVGGM+ +LA L   LT+ID SH 
Sbjct  285   DKKLLATIAVGFVKTIFILVSTFLLDRVGRRPLLLSSVGGMIVSLATLATCLTIIDRSHT  344

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
              + WAVAM IA  L +VA FSIG GPI WVYSSEIFPL+LRA GC++G  INRV SGV+ 
Sbjct  345   TLKWAVAMCIASVLFFVAFFSIGLGPIAWVYSSEIFPLRLRAQGCAIGVAINRVASGVLV  404

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SL KAI+IGG+FFLY  I    WVFF+ LMPETQG+TLEE +  FG + +WRS  R
Sbjct  405   MTFLSLSKAITIGGAFFLYTGIVCASWVFFYVLMPETQGRTLEEIDQFFGKYTKWRSTAR  464

Query  387   EVDAKKAN---NN  358
             E++ ++     NN
Sbjct  465   ELEMRRNKAVVNN  477



>ref|XP_007135989.1| hypothetical protein PHAVU_009G008900g [Phaseolus vulgaris]
 gb|ESW07983.1| hypothetical protein PHAVU_009G008900g [Phaseolus vulgaris]
Length=514

 Score =   414 bits (1063),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 195/315 (62%), Positives = 248/315 (79%), Gaps = 3/315 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVM+GRL +A +VL K SDSP+EA +RLADIK AAGIPE+C+ +VV V
Sbjct  201   VGVLAMPESPRWLVMRGRLAEATKVLNKISDSPQEAQLRLADIKAAAGIPENCNADVVEV  260

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               +    D VW+EL + PTPAV HILI  +G+H FQQASGIDAVVLY P IF+KAG++SD
Sbjct  261   ANQNSGGDGVWKELLLYPTPAVRHILIAALGLHFFQQASGIDAVVLYSPEIFKKAGLESD  320

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
              ++LL T+A+GF KTVFILVATF LD+ GRRPLLLTSVGGMV +L  L +SLTVI+ S  
Sbjct  321   GEQLLATVAVGFAKTVFILVATFLLDRVGRRPLLLTSVGGMVFSLLTLAVSLTVIERSRA  380

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             ++ WA+ ++IA  L+YV+ FS+GAGPITWVYSSEIFPL+LRA G ++G  +NRVTSGV+S
Sbjct  381   ELKWAIGLSIATVLSYVSTFSVGAGPITWVYSSEIFPLRLRAQGAAMGVVVNRVTSGVIS  440

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SL   I+IGG+FF++  IA  GW+FFFT++PETQGKTLEETE  FG F  W   + 
Sbjct  441   MTFLSLSNKITIGGAFFIFGGIAMCGWIFFFTMLPETQGKTLEETEECFGKFGSWSHSKG  500

Query  387   EVDAKKANNNSQLQM  343
                 K  +N++++++
Sbjct  501   N---KDTHNSAEIEL  512



>ref|XP_009345073.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
Length=491

 Score =   412 bits (1060),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 193/307 (63%), Positives = 241/307 (79%), Gaps = 2/307 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVMQGRLG+A++VL +TSDS EE+ +RLADIKEAAGIPE C+D++V V
Sbjct  166   VGVLAMPESPRWLVMQGRLGEAKQVLDRTSDSKEESMLRLADIKEAAGIPEECNDDIVQV  225

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +     E  VW+ELF+ PTP V HI+I  +G H FQQASGIDA+VLY PR+FEKAGI + 
Sbjct  226   SGHSHGE-GVWKELFVRPTPTVRHIVIAALGFHFFQQASGIDALVLYSPRVFEKAGITNS  284

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSH  751
                LLCT+ +G +KTVF LVATF LD+ GRRPLLLTS+ GMV +L  LG SLT++D H  
Sbjct  285   DQLLLCTVGVGLSKTVFTLVATFFLDRVGRRPLLLTSMAGMVGSLVCLGTSLTIVDQHEG  344

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
              ++ WAV + +   LAYV  FSIG GPI WVYSSEIFPL+LRA GC +G  +NR+ SG++
Sbjct  345   VRMTWAVVLCLCCVLAYVGFFSIGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRLMSGIL  404

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
             SMTFI+LYKAI++GG+FFLYAAI  VGW+FFFT++PETQG+TLE+ E LFG F +WR   
Sbjct  405   SMTFITLYKAITMGGTFFLYAAIGIVGWIFFFTMLPETQGRTLEDMEVLFGKFHKWRKAN  464

Query  390   REVDAKK  370
             + ++ KK
Sbjct  465   KLLEKKK  471



>ref|XP_010527590.1| PREDICTED: polyol transporter 5-like [Tarenaya hassleriana]
Length=519

 Score =   414 bits (1063),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 200/302 (66%), Positives = 239/302 (79%), Gaps = 2/302 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVMQGRLG+AR VL KTSDS +EA +RL+DIK AAGIP  C+D++V V
Sbjct  208   VGVLAMPESPRWLVMQGRLGEARSVLYKTSDSHDEAELRLSDIKLAAGIPADCNDDIVKV  267

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              KK    + VW+EL + PTPAV  +LI  +GIH FQQASGIDAVVLY PRIF+ AG+KSD
Sbjct  268   EKKNSHGEGVWKELLLRPTPAVRRVLIAAIGIHFFQQASGIDAVVLYSPRIFKSAGLKSD  327

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-H  751
               +LL T+A+GF KTVFILVATF LD+ GRRPLLL+SVGGMV +L  LGMSLTV+DH+  
Sbjct  328   NQQLLATVAVGFVKTVFILVATFFLDRIGRRPLLLSSVGGMVLSLLTLGMSLTVVDHTVD  387

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             +KV WAV ++I   + YVA FSIGAGPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+
Sbjct  388   KKVMWAVVLSITTVMTYVATFSIGAGPITWVYSSEIFPLRLRAQGASMGVIVNRVTSGVI  447

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
             SMTF+SL KAI+ GG+FFL+  IA V WVFF+T +PETQGK LEE + LF   F WR  +
Sbjct  448   SMTFLSLSKAITTGGAFFLFGGIATVAWVFFYTFLPETQGKMLEEMDELFEK-FNWRDSK  506

Query  390   RE  385
              +
Sbjct  507   SK  508



>gb|KCW62858.1| hypothetical protein EUGRSUZ_G00452 [Eucalyptus grandis]
Length=529

 Score =   414 bits (1063),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 199/306 (65%), Positives = 237/306 (77%), Gaps = 1/306 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAM ESPRWL+M GRL DA+RVL +TS+S +EA +RLADIKEAAGIP  C D+VV V
Sbjct  202   LGVLAMSESPRWLIMHGRLADAKRVLDRTSNSKDEAALRLADIKEAAGIPAECFDDVVKV  261

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             TK R   + VWR+L + PTP+V HILI  VGIH FQQASGIDAVVLY P IFEKAGI S 
Sbjct  262   TK-RSTGEGVWRDLLLHPTPSVRHILICAVGIHFFQQASGIDAVVLYSPSIFEKAGITSS  320

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLL TIA+GF KT+FILV+TF LD+ GRRPLLL+SVGGM+ +LA L   LT+ID SH 
Sbjct  321   DKKLLATIAVGFVKTIFILVSTFLLDRVGRRPLLLSSVGGMIVSLATLATCLTIIDRSHT  380

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
              + WAVAM IA  L +VA FSIG GPI WVYSSEIFPL+LRA GC++G  INRV SGV+ 
Sbjct  381   TLKWAVAMCIASVLFFVAFFSIGLGPIAWVYSSEIFPLRLRAQGCAIGVAINRVASGVLV  440

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SL KAI+IGG+FFLY  I    WVFF+ LMPETQG+TLEE +  FG + +WRS  R
Sbjct  441   MTFLSLSKAITIGGAFFLYTGIVCASWVFFYVLMPETQGRTLEEIDQFFGKYTKWRSTAR  500

Query  387   EVDAKK  370
             E++ ++
Sbjct  501   ELEMRR  506



>ref|XP_003603886.1| Mannitol transporter [Medicago truncatula]
 gb|AES74137.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=514

 Score =   412 bits (1060),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 200/293 (68%), Positives = 239/293 (82%), Gaps = 1/293 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVM+GRLGDA  VL KTS+S +EA +RL++IK AAGIPE+C D+VV+V
Sbjct  202   VGVLAMPESPRWLVMKGRLGDAIIVLNKTSNSEQEAQLRLSEIKAAAGIPENCTDDVVSV  261

Query  1107  TKKRGDE-DSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
              K    E ++VW+ELFI PTPAV HI+I  +GIH FQQASGIDAVVLY P IF KAG++S
Sbjct  262   KKTNEREGNTVWKELFIYPTPAVRHIVIAALGIHFFQQASGIDAVVLYSPTIFRKAGLES  321

Query  930   DTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH  751
             DT++LL T+A+G  KTVFILVATF LD+ GRRPLLL+SVGGMV +L  L +SLTV+DHS 
Sbjct  322   DTEQLLATVAVGLAKTVFILVATFLLDRVGRRPLLLSSVGGMVISLLTLAVSLTVVDHSR  381

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
              +  WAV ++IA  L+YVA FSIGAGPITWVYSSEIFPL+LRA G S G  +NRVTSG++
Sbjct  382   VRQMWAVGLSIASVLSYVATFSIGAGPITWVYSSEIFPLRLRAQGASAGVVVNRVTSGII  441

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTF  412
             SMTF+SL   ISIGG+FFL+  IAA GW+FF+TL+PETQGKTLEE E  FG F
Sbjct  442   SMTFLSLSDKISIGGAFFLFGGIAACGWIFFYTLLPETQGKTLEEMEGTFGKF  494



>gb|AAO88964.1| sorbitol transporter [Malus domestica]
Length=491

 Score =   410 bits (1055),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 194/307 (63%), Positives = 237/307 (77%), Gaps = 2/307 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVMQGRLG+A+RVL +TSDS EE+ +RLADIKEAAGIPE C+D++V V
Sbjct  166   VGVLAMPESPRWLVMQGRLGEAKRVLDRTSDSKEESMLRLADIKEAAGIPEECNDDIVQV  225

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +     E  VW+EL + PTP V HILI  +G H FQQASGIDA+VLY PR+F KAGI S 
Sbjct  226   SGHSHGE-GVWKELLVHPTPTVRHILIAAIGFHFFQQASGIDALVLYSPRVFAKAGITST  284

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSH  751
                LLCT+ +G +KTVF LVATF LD+ GRRPLLLTS+ GMV  L  LG SLT++D H  
Sbjct  285   NQLLLCTVGVGLSKTVFTLVATFFLDRVGRRPLLLTSMAGMVGALVCLGTSLTIVDQHEG  344

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
              ++ WAV + +   LAYV  FS G GPI WVYSSEIFPL+LRA GC +G  +NR+ SG++
Sbjct  345   VRMTWAVILCLCCVLAYVGFFSSGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRLMSGIL  404

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
             SMTFISLYKAI++GG+FFLYAAI  VGW+FFFT++PETQG+TLE+ E LFG F +WR   
Sbjct  405   SMTFISLYKAITMGGTFFLYAAIGTVGWIFFFTMLPETQGRTLEDMEVLFGKFHKWRKAN  464

Query  390   REVDAKK  370
             + ++ KK
Sbjct  465   KLLEKKK  471



>ref|XP_008245305.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=511

 Score =   410 bits (1054),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 204/318 (64%), Positives = 243/318 (76%), Gaps = 9/318 (3%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLA+PESPRWLVMQGRLGDA+RVL KTS S EEA + L  IKEAAGI +  DD+VV V
Sbjct  195   IGVLAVPESPRWLVMQGRLGDAKRVLDKTSASKEEAQLTLDGIKEAAGIAKELDDDVVPV  254

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +KK  D + VW++L + PTPAV HILI  +GIH FQQASGID+V  Y PRIFEKAGIKS 
Sbjct  255   SKKS-DGEGVWKDLILHPTPAVRHILIAALGIHFFQQASGIDSVFQYSPRIFEKAGIKSY  313

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLL T+AIGF KT+ ILVATF LD+FGRR LLL+SV GM+ +L  LG+ LT+IDH   
Sbjct  314   DHKLLATVAIGFVKTIAILVATFLLDRFGRRRLLLSSVAGMIFSLVCLGVGLTIIDHHRG  373

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
              VPWA+A+ I M L  V  FSIG GPITWVYSSEIFPLKLRA G S+G  +NR+TSGV+S
Sbjct  374   TVPWAIALCITMVLFNVVFFSIGLGPITWVYSSEIFPLKLRAQGASMGVAVNRITSGVIS  433

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR----  400
             MTF+SLYKAI+IGGSFFLYA IAAV WVFF+ L+PET+G+TLE+ E LFG + RW+    
Sbjct  434   MTFLSLYKAITIGGSFFLYAGIAAVSWVFFYMLLPETRGRTLEDIEVLFGKYHRWKKANA  493

Query  399   ----SRQREVDAKKANNN  358
                 S+Q + D  K+  N
Sbjct  494   VLKQSKQGDGDENKSQVN  511



>ref|XP_011088360.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=522

 Score =   410 bits (1055),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 194/312 (62%), Positives = 239/312 (77%), Gaps = 1/312 (0%)
 Frame = -3

Query  1272  MPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTKKRG  1093
             MPESPRWL+MQGRL +A+ VL +TSDS EE   RLADIK+AAGIP+HC+D+VV V K+  
Sbjct  206   MPESPRWLIMQGRLREAKLVLERTSDSSEEVKSRLADIKQAAGIPDHCNDDVVAVPKQHH  265

Query  1092  DEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTDKLL  913
              E  VWRELF+ PTP+VLHI++   GIH FQ ASGI+ VVLY P IFEKAGI +DT KLL
Sbjct  266   GE-GVWRELFLHPTPSVLHIMLCATGIHFFQIASGIETVVLYSPEIFEKAGITNDTHKLL  324

Query  912   CTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVPWA  733
              T+A+GF K +FILVATFTLDK GRRPL+LTS+GG    L +L   LT I +S  ++ WA
Sbjct  325   ATMAVGFVKLMFILVATFTLDKIGRRPLILTSIGGCCVCLLVLATGLTFIQNSDHRLVWA  384

Query  732   VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTFIS  553
             +A+ +   L +VA F +G GPITWVYSSEIFPL+LRA GC+L    NRVTS +++MTFIS
Sbjct  385   IALCLVAILCFVAIFGMGMGPITWVYSSEIFPLRLRAQGCALAIASNRVTSALLTMTFIS  444

Query  552   LYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREVDAK  373
             LYKAI++ G+FFLYA  AAV WVFF+TL PET+GKTLEE  +LFGTFF+WRS  R ++ K
Sbjct  445   LYKAITLAGAFFLYAGFAAVAWVFFYTLYPETKGKTLEEMGSLFGTFFKWRSTVRALEEK  504

Query  372   KANNNSQLQMGT  337
             K + N  +Q G 
Sbjct  505   KGDYNGHVQTGN  516



>gb|ABX71752.1| mannitol transporter [Apium graveolens]
Length=524

 Score =   409 bits (1052),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 195/307 (64%), Positives = 246/307 (80%), Gaps = 1/307 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VL MPESPRWLVM+G+LG+ARRVL KTS+S EEA  RL DIKEAAGIPE C+D+VV V
Sbjct  209   IGVLYMPESPRWLVMRGQLGEARRVLEKTSESKEEARQRLEDIKEAAGIPEECNDDVVEV  268

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               KR  +D+VW+ELF+ PTPAV H  ITG+GIH FQ ASG+DAVVLY PRIFEKAG+KSD
Sbjct  269   -PKRSKDDAVWKELFLHPTPAVRHAAITGIGIHFFQMASGVDAVVLYSPRIFEKAGLKSD  327

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLL TI +G  KT+F+L++TF LDK GRRPL+L+S+GGMV  L +L  SL+VI+HSH+
Sbjct  328   NHKLLATIGVGVCKTIFVLISTFLLDKVGRRPLMLSSMGGMVIALLVLSGSLSVINHSHQ  387

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
              VPWAVA+AI     +V+ FS G GPI WVYSSE+FPL+LRA GCS+G  +NR  SG++ 
Sbjct  388   TVPWAVALAIISVYGFVSVFSSGMGPIAWVYSSEVFPLRLRAQGCSIGVAVNRGVSGIIG  447

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFIS+YKA++IGG+FF++A +AA+GWVF FT+ PETQG+ LEE E LFG++F WR   +
Sbjct  448   MTFISMYKALTIGGAFFVFAVVAAIGWVFMFTMFPETQGRNLEEIEVLFGSYFGWRKTLK  507

Query  387   EVDAKKA  367
             ++  K+A
Sbjct  508   DLKKKEA  514



>gb|AAT06053.2| sorbitol transporter [Malus domestica]
Length=533

 Score =   409 bits (1052),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 194/307 (63%), Positives = 237/307 (77%), Gaps = 2/307 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVMQGRLG+A+RVL +TSDS EE+ +RLADIKEAAGIPE C+D++V V
Sbjct  208   VGVLAMPESPRWLVMQGRLGEAKRVLDRTSDSKEESMLRLADIKEAAGIPEECNDDIVQV  267

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +     E  VW+EL + PTP V HILI  +G H FQQASGIDA+VLY PR+F KAGI S 
Sbjct  268   SGHSHGE-GVWKELLVHPTPTVRHILIAAIGFHFFQQASGIDALVLYSPRVFAKAGITST  326

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSH  751
                LLCT+ +G +KTVF LVATF LD+ GRRPLLLTS+ GMV  L  LG SLT++D H  
Sbjct  327   NQLLLCTVGVGLSKTVFTLVATFFLDRVGRRPLLLTSMAGMVGALVCLGTSLTMVDQHEG  386

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
              ++ WAV + +   LAYV  FS G GPI WVYSSEIFPL+LRA GC +G  +NR+ SG++
Sbjct  387   VRMTWAVILCLCCVLAYVGFFSSGIGPIAWVYSSEIFPLRLRAQGCGMGVAVNRLMSGIL  446

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
             SMTFISLYKAI++GG+FFLYAAI  VGW+FFFT++PETQG+TLE+ E LFG F +WR   
Sbjct  447   SMTFISLYKAITMGGTFFLYAAIGTVGWIFFFTMLPETQGRTLEDMEVLFGKFHKWRKAN  506

Query  390   REVDAKK  370
             + ++ KK
Sbjct  507   KLLEKKK  513



>ref|XP_008245258.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=511

 Score =   408 bits (1048),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/319 (64%), Positives = 245/319 (77%), Gaps = 7/319 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLA+PESPRWLVMQGRLGDA+RVL KTS S EEA + L +IKEAAGI +  DD+VV V
Sbjct  195   IGVLAVPESPRWLVMQGRLGDAKRVLDKTSASKEEAQLTLDNIKEAAGIAKELDDDVVPV  254

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             ++K   E  VW++L + PTPAV HIL   +GIH F+QASGID+VVLY PRIF+KAGIKS 
Sbjct  255   SEKSHGE-GVWKDLILHPTPAVRHILTAALGIHFFEQASGIDSVVLYSPRIFQKAGIKSY  313

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLL T+A+GF KT+ ILVATF LD+FGRRPLLL+SV GM+ +L  LG+ LT+IDH  +
Sbjct  314   DHKLLATVAVGFVKTIAILVATFFLDRFGRRPLLLSSVAGMIFSLVCLGVGLTIIDHHSD  373

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
              VPWA+A+ I M L  VA FSIG GPITWVYSSEIFPLKLRA G S+G  +NR+TSGV+S
Sbjct  374   TVPWAIALCITMVLLNVAFFSIGLGPITWVYSSEIFPLKLRAQGVSMGVAVNRITSGVIS  433

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRS---  397
             MTF+SLYKAI+IGG+FFLYA I A+ WVFF+ L+PET+G+TLEETE LFG + R      
Sbjct  434   MTFLSLYKAITIGGAFFLYAGIGALSWVFFYMLLPETRGRTLEETEVLFGKYHRLEKANA  493

Query  396   --RQREVDAKKANNNSQLQ  346
               RQRE       N SQ+ 
Sbjct  494   VLRQRE-QGFGDENKSQVN  511



>ref|XP_010028575.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
Length=544

 Score =   408 bits (1049),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 209/324 (65%), Positives = 258/324 (80%), Gaps = 7/324 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDA+RVL +TSDSPEEA++RLADIK AAGIP+ C+D+VV V
Sbjct  212   IGVLAMPESPRWLVMQGRLGDAKRVLQRTSDSPEEANLRLADIKAAAGIPDTCNDDVVAV  271

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             T+++   + VWREL + PTPAV H+LI  VGIH FQQ+SGIDAVVLY PRIFEKAG+ S 
Sbjct  272   TRRKSHGEGVWRELLVYPTPAVRHVLIAAVGIHFFQQSSGIDAVVLYSPRIFEKAGVTSS  331

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLL TIA+GF KTVFILV+TF LD+ GRRPLLLTSV GM+ +L  LG  LT+IDHS+E
Sbjct  332   DHKLLATIAVGFCKTVFILVSTFFLDRVGRRPLLLTSVAGMIISLTALGCGLTIIDHSNE  391

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WA+ + IAMTL +VA+FS+G GPI WVYSSEIFPL+LRA G S+G  +NR TSG+++
Sbjct  392   KLMWAIGLCIAMTLTFVASFSMGLGPIAWVYSSEIFPLRLRAQGASIGVAVNRATSGLIT  451

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SL KAI+IGG+FFL+AA+AAV W FFFT++PETQG+TLE+ + LFG+   WRS  R
Sbjct  452   MTFLSLSKAITIGGAFFLFAAVAAVAWAFFFTVLPETQGRTLEDMQVLFGSLTGWRSVAR  511

Query  387   -------EVDAKKANNNSQLQMGT  337
                    E D K+    S + +GT
Sbjct  512   KLKMEVVEEDGKRDGGGSHVPLGT  535



>ref|NP_188513.1| polyol transporter 5 [Arabidopsis thaliana]
 sp|Q8VZ80.2|PLT5_ARATH RecName: Full=Polyol transporter 5; AltName: Full=Protein POLYOL 
TRANSPORTER 5; Short=AtPLT5; AltName: Full=Sugar-proton 
symporter PLT5 [Arabidopsis thaliana]
 dbj|BAB01812.1| sugar transporter protein [Arabidopsis thaliana]
 gb|AEE76153.1| polyol transporter 5 [Arabidopsis thaliana]
Length=539

 Score =   408 bits (1048),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 195/319 (61%), Positives = 248/319 (78%), Gaps = 3/319 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDA+RVL KTSDSP EA +RL DIK AAGIP  C D+VV V
Sbjct  210   IGVLAMPESPRWLVMQGRLGDAKRVLDKTSDSPTEATLRLEDIKHAAGIPADCHDDVVQV  269

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +++    + VWREL I PTPAV  ++I  +GIH FQQASGIDAVVL+ PRIF+ AG+K+D
Sbjct  270   SRRNSHGEGVWRELLIRPTPAVRRVMIAAIGIHFFQQASGIDAVVLFSPRIFKTAGLKTD  329

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               +LL T+A+G  KT FILVATF LD+ GRRPLLLTSVGGMV +LA LG SLT+ID S +
Sbjct  330   HQQLLATVAVGVVKTSFILVATFLLDRIGRRPLLLTSVGGMVLSLAALGTSLTIIDQSEK  389

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KV WAV +AIA  + YVA FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+S
Sbjct  390   KVMWAVVVAIATVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVIS  449

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             ++F+ + KA++ GG+F+L+  IA V WVFF+T +PETQG+ LE+ + LF + FRWR  + 
Sbjct  450   ISFLPMSKAMTTGGAFYLFGGIATVAWVFFYTFLPETQGRMLEDMDELF-SGFRWRDSKS  508

Query  387   EV--DAKKANNNSQLQMGT  337
             +   + +K   N ++++G+
Sbjct  509   KPKGNPEKTVPNPEVEIGS  527



>gb|AAN07021.1| putative mannitol transporter [Orobanche ramosa]
Length=519

 Score =   407 bits (1045),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 192/311 (62%), Positives = 237/311 (76%), Gaps = 1/311 (0%)
 Frame = -3

Query  1290  GVSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVT  1111
             G++V+ MPESPRWLVMQGRLGDA++VL +TSDSP+EA +RLADI EAAG+PE C D+VV 
Sbjct  205   GLAVIVMPESPRWLVMQGRLGDAKKVLDRTSDSPQEAQLRLADIMEAAGLPEDCHDDVVP  264

Query  1110  VTKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
             V K+      VW+EL + PT  VLHI I  VG   FQQASGIDAVV+Y PRI+EKAGI S
Sbjct  265   VLKQDRGGGGVWKELIVHPTKPVLHITIAAVGCQFFQQASGIDAVVMYSPRIYEKAGITS  324

Query  930   DTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-S  754
             D  KLL TIA+G  KTVFILV TF +D+ GRR LLLTS GG+V ++  L   LTVIDH  
Sbjct  325   DEKKLLATIAVGLCKTVFILVTTFMVDRIGRRVLLLTSCGGLVLSMLTLATGLTVIDHYG  384

Query  753   HEKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGV  574
              ++ PW V + +  T + VA FS+G GPI WVYSSEIFPLKLRA GC LG  INR T+GV
Sbjct  385   ADRFPWVVVLCVLTTYSSVAFFSMGMGPIAWVYSSEIFPLKLRAQGCGLGVAINRATNGV  444

Query  573   VSMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSR  394
             + M+FISLY AI+IGG+F+L++ I  V W+FFFTL+PET+G+TLE+ E LFGTFF+WR+ 
Sbjct  445   ILMSFISLYNAITIGGAFYLFSGIGIVTWIFFFTLLPETRGRTLEDMEVLFGTFFKWRTT  504

Query  393   QREVDAKKANN  361
              RE+  K+A +
Sbjct  505   MRELHKKEAED  515



>ref|XP_010909852.1| PREDICTED: putative polyol transporter 1 [Elaeis guineensis]
Length=520

 Score =   406 bits (1044),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 196/292 (67%), Positives = 238/292 (82%), Gaps = 2/292 (1%)
 Frame = -3

Query  1290  GVSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVT  1111
             GV VLAMPESPRWLVMQG++G A+ VL KTS++PEEA  RL DIK  AGIP  C+D+VV 
Sbjct  208   GVGVLAMPESPRWLVMQGQIGAAKEVLAKTSETPEEAEERLLDIKNVAGIPADCNDDVVA  267

Query  1110  VTKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
             V K+   E  VW+ELF+ PTP+V  +L++ +GIH FQQASGID+VVLY PR+F+KAGI++
Sbjct  268   VQKQSHGE-GVWKELFLRPTPSVRRVLLSAIGIHFFQQASGIDSVVLYSPRVFKKAGIEN  326

Query  930   DTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-  754
             +   L  T+A+GFTKT+FILVATF LD+ GRRPLLL+S GGM+ +LA LG  LTVIDH  
Sbjct  327   NNKLLGTTVAVGFTKTLFILVATFMLDRVGRRPLLLSSTGGMIVSLASLGFGLTVIDHHP  386

Query  753   HEKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGV  574
             H ++PWA+ ++IA  LAYVA FSIG GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV
Sbjct  387   HGQLPWAIGLSIASILAYVAFFSIGLGPITWVYSSEIFPLRLRAQGASVGVVVNRVTSGV  446

Query  573   VSMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
             ++MTFISLYKAI+IGGSFFLYA +AAV WVFFFT + ET+GKTLEE E LFG
Sbjct  447   ITMTFISLYKAITIGGSFFLYAGVAAVAWVFFFTYLKETRGKTLEEMENLFG  498



>ref|XP_002885281.1| ATPLT5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61540.1| ATPLT5 [Arabidopsis lyrata subsp. lyrata]
Length=538

 Score =   407 bits (1045),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 195/319 (61%), Positives = 246/319 (77%), Gaps = 3/319 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLG+A+RVL KTSDSP E+ +RL DIK AAGIP  C D+VV V
Sbjct  210   LGVLAMPESPRWLVMQGRLGEAKRVLDKTSDSPTESALRLEDIKHAAGIPADCHDDVVQV  269

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +K+    + VWREL I PTPAV  ++I  +GIH FQQASGIDAVVL+ PRIF+ AG+K+D
Sbjct  270   SKRNSHGEGVWRELLIRPTPAVRRVMIAAIGIHFFQQASGIDAVVLFSPRIFKTAGLKTD  329

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               +LL T+A+G  KT FILVATF LD+ GRRPLLLTSVGGMV +LA LG SLT+ID S +
Sbjct  330   HQQLLATVAVGVVKTSFILVATFLLDRIGRRPLLLTSVGGMVLSLAALGTSLTIIDQSEK  389

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KV WAV +AIA  + YVA FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+S
Sbjct  390   KVMWAVVVAIATVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVIS  449

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             M F+ L K I+ GG+F+L+  IA V WVFF+T +PETQG+ LE+ + LF + FRWR  + 
Sbjct  450   MAFLPLSKGITTGGAFYLFGGIATVAWVFFYTFLPETQGRMLEDMDELF-SGFRWRDSKN  508

Query  387   --EVDAKKANNNSQLQMGT  337
               + + +   +N ++++G+
Sbjct  509   KPKSNPEMTVSNPEVEIGS  527



>gb|KJB12315.1| hypothetical protein B456_002G011400 [Gossypium raimondii]
Length=536

 Score =   406 bits (1044),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 204/319 (64%), Positives = 243/319 (76%), Gaps = 3/319 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWL+MQGRLG+A+ VL KTSD+ EEA  RL+DIK AAGIPE C D++V V
Sbjct  211   IGVLAMPESPRWLIMQGRLGEAKTVLDKTSDTKEEARGRLSDIKAAAGIPEDCTDDIVQV  270

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+   E  VW+ELF+ PTP V H+LI  +GIH FQQA G+D+VVLY PRIFEKAGI S 
Sbjct  271   QKQTHGE-GVWKELFLHPTPVVRHVLICAIGIHFFQQAIGLDSVVLYSPRIFEKAGITSS  329

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLL TIAIG +KT+FILVATF LDK GRRPLLL S GGMV  LA LG SLT+I HS  
Sbjct  330   DHKLLATIAIGLSKTIFILVATFLLDKIGRRPLLLISSGGMVVILATLGFSLTIIGHSDN  389

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WAV + I M L+ VA FSIG GPI WVYS+EIFPL+LRA G S+G  +NRVTSGV+S
Sbjct  390   KITWAVGLCITMVLSSVAVFSIGMGPIAWVYSTEIFPLRLRAQGASIGVAVNRVTSGVIS  449

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             M+FISLY+AI+IGG+FFLYA +A V + FFFT +PETQGKTLEE E LFG    WR   +
Sbjct  450   MSFISLYEAITIGGAFFLYAGVALVAFFFFFTFLPETQGKTLEEMEWLFGKLVGWREEAQ  509

Query  387   EVDAKKANN--NSQLQMGT  337
             ++  K+  N  N Q+Q+G 
Sbjct  510   KLKRKRKMNEANHQIQLGN  528



>emb|CDX95491.1| BnaC01g33830D [Brassica napus]
Length=531

 Score =   406 bits (1043),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 190/317 (60%), Positives = 250/317 (79%), Gaps = 2/317 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLV+QGRLG+A+RVL KTSDSP EA +RL +IKEAAGIP  C D+VV V
Sbjct  210   IGVLAMPESPRWLVIQGRLGEAKRVLDKTSDSPSEAALRLEEIKEAAGIPADCHDDVVQV  269

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             ++K      VW+EL I PTPAV  ++I  +GIH FQQA+GIDAVVL+ PRIF+ AG+K+D
Sbjct  270   SRKTSHGSGVWKELLIRPTPAVRRVMIAAMGIHFFQQATGIDAVVLFSPRIFKTAGLKTD  329

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               +LL T+A+G  KT FILVATF +D+ GRRPLLLTSVGGM+ +LA LG SLT+IDH+ +
Sbjct  330   HQQLLATVAVGVVKTSFILVATFLIDRVGRRPLLLTSVGGMILSLAALGTSLTIIDHTEK  389

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KV WA+ ++I   + YVA FSIGAGPITWVY+SEIFPL+LR+ G S+   +NRVTSGV+S
Sbjct  390   KVTWALVLSITTVMTYVATFSIGAGPITWVYTSEIFPLRLRSQGSSMAVVVNRVTSGVIS  449

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR-SRQ  391
             MTF+ L KA++ GG+F+L+  IA V WVFF+T +PETQG++LE+ + LF + FRWR S+ 
Sbjct  450   MTFLLLSKAMTTGGAFYLFGGIATVAWVFFYTFLPETQGRSLEDMDELF-SGFRWRDSKS  508

Query  390   REVDAKKANNNSQLQMG  340
             +  + K +++N Q+++G
Sbjct  509   KPKNNKNSSSNPQVEIG  525



>emb|CAD58709.1| polyol transporter [Plantago major]
 emb|CAR82415.1| polyol transporter [Plantago major]
Length=529

 Score =   406 bits (1043),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 195/312 (63%), Positives = 241/312 (77%), Gaps = 2/312 (1%)
 Frame = -3

Query  1290  GVSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVT  1111
             GV VL MPESPRWLV+QGRLGDA++VL KTSDS EE+ +RLADIKEAAG+P  C DE+V 
Sbjct  216   GVGVLYMPESPRWLVLQGRLGDAKKVLDKTSDSLEESKLRLADIKEAAGVPLDCHDEIVQ  275

Query  1110  VTKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
             V +KR     VW+EL + PT  VLHILI GVGIH FQQ  GID+VVLY PRI+EKAGIK+
Sbjct  276   V-QKRSQGQGVWKELLLHPTKPVLHILICGVGIHFFQQGIGIDSVVLYSPRIYEKAGIKN  334

Query  930   DTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH  751
              +DKLL TIA+G +KT FIL+ TF +D+FGRRPLLLTS  G+  ++  LG SLT+ID + 
Sbjct  335   TSDKLLATIAVGVSKTFFILITTFFVDRFGRRPLLLTSCAGVALSMFALGTSLTIIDRNP  394

Query  750   E-KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGV  574
             +  +   +  A+ +T+A V  FS+G GPI WVYSSEIFPLKLRA GCS+G  +NR  SGV
Sbjct  395   DGNIKGLLIFAVILTMAIVGFFSMGLGPIAWVYSSEIFPLKLRAQGCSMGVAMNRFMSGV  454

Query  573   VSMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSR  394
             + M+FISLYKAI+IGG+FFL+  I  V ++FF+TL PETQG+TLEE E LFGTFF WR+R
Sbjct  455   ILMSFISLYKAITIGGAFFLFGGITTVAFIFFYTLFPETQGRTLEEMEELFGTFFSWRTR  514

Query  393   QREVDAKKANNN  358
              +E+DAKK   +
Sbjct  515   MKELDAKKKTGS  526



>ref|XP_009112300.1| PREDICTED: polyol transporter 5 [Brassica rapa]
 emb|CDY18552.1| BnaA01g26430D [Brassica napus]
Length=529

 Score =   405 bits (1040),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 189/317 (60%), Positives = 250/317 (79%), Gaps = 2/317 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLV+QGRLG+A+RVL +TSDSP EA +RL +IKEAAGIP  C DEVV V
Sbjct  210   IGVLAMPESPRWLVIQGRLGEAKRVLDRTSDSPSEAALRLEEIKEAAGIPADCHDEVVQV  269

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             ++K      VW+EL I PTPAV  ++I  +GIH FQQA+GIDAVVL+ PRIF+ AG+K+D
Sbjct  270   SRKTSHGSGVWKELLIRPTPAVRRVMIAAMGIHFFQQATGIDAVVLFSPRIFKTAGLKTD  329

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               +LL T+A+G  KT FILVATF +D+ GRRPLLLTSVGGM+ +LA LG SLT+IDH+ +
Sbjct  330   HQQLLATVAVGIVKTSFILVATFLIDRVGRRPLLLTSVGGMILSLAALGTSLTIIDHTEK  389

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KV WA+ ++I   + YVA FSIGAGPITWVY+SEIFPL+LR+ G S+   +NRVTSGV+S
Sbjct  390   KVTWALVLSITTVMTYVATFSIGAGPITWVYTSEIFPLRLRSQGSSMAVVVNRVTSGVIS  449

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR-SRQ  391
             MTF+ L +A++ GG+F+L+  IA V WVFF+T +PETQG++LE+ + LF + FRWR S+ 
Sbjct  450   MTFLLLSEAMTTGGAFYLFGGIATVAWVFFYTFLPETQGRSLEDMDELF-SGFRWRDSKS  508

Query  390   REVDAKKANNNSQLQMG  340
             +  + K +++N Q+++G
Sbjct  509   KPKNNKNSSSNPQVEIG  525



>gb|AAG43998.1|AF215837_1 mannitol transporter [Apium graveolens Dulce Group]
Length=513

 Score =   404 bits (1038),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 193/305 (63%), Positives = 238/305 (78%), Gaps = 1/305 (0%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VL MPESPRWLVMQGRLG+AR VL KTS S EEAH RL+DIKEAAGI + C+D+VV V K
Sbjct  200   VLYMPESPRWLVMQGRLGEARTVLEKTSTSKEEAHQRLSDIKEAAGIDKDCNDDVVQVPK  259

Query  1101  KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTD  922
             +  DE +VW+EL + PT  V H  ITG+GIH FQQA GIDAVVLY PRIFEKAGIKS++ 
Sbjct  260   RTKDE-AVWKELILHPTKPVRHAAITGIGIHFFQQACGIDAVVLYSPRIFEKAGIKSNSK  318

Query  921   KLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKV  742
             KLL TIA+G  KTVFIL++TF LDK GRRPL+LTS+GGMV  L +L  SLTVI+ SH   
Sbjct  319   KLLATIAVGVCKTVFILISTFQLDKIGRRPLMLTSMGGMVIALFVLAGSLTVINKSHHTG  378

Query  741   PWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMT  562
              WA  +AI    A+V+ FS G GPI WVYSSE+FPL+LRA GCS+G  +NR  SG++ MT
Sbjct  379   HWAGGLAIFTVYAFVSIFSSGMGPIAWVYSSEVFPLRLRAQGCSIGVAVNRGMSGIIGMT  438

Query  561   FISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV  382
             FIS+YKA++IGG+F L+A +A++GWVF +T+ PETQG+ LEE E LFG++F WR   +++
Sbjct  439   FISMYKAMTIGGAFLLFAVVASIGWVFMYTMFPETQGRNLEEIELLFGSYFGWRKTLKDL  498

Query  381   DAKKA  367
              AK+A
Sbjct  499   KAKEA  503



>gb|EYU20732.1| hypothetical protein MIMGU_mgv1a026176mg [Erythranthe guttata]
Length=509

 Score =   403 bits (1036),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 195/315 (62%), Positives = 246/315 (78%), Gaps = 5/315 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPE--HCDDEVV  1114
             V V+AMPESPRWLV+QGRL  A +VL KTS+SP+EA  RL +IK+AAG+PE  + +D+VV
Sbjct  195   VGVVAMPESPRWLVLQGRLKGAYKVLNKTSESPQEAQSRLDEIKQAAGLPESSNTEDDVV  254

Query  1113  TVTKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIK  934
             +V  KR     VW+EL + PTP V HILI G+GI  FQQASGIDAVV+Y PRI+EKAG++
Sbjct  255   SV-PKRNRGAGVWKELLLRPTPTVRHILIAGLGIQFFQQASGIDAVVMYSPRIYEKAGMR  313

Query  933   SDTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS  754
             +D+DKLL TIA+G +KT+FILVATF +D+ GRR LLLTS GG+  +L  L   LTVID +
Sbjct  314   NDSDKLLATIAVGISKTMFILVATFLVDRVGRRTLLLTSCGGLAASLFGLATGLTVIDQN  373

Query  753   --HEKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTS  580
                +K+ WAVA+ +AM+L+ VA FSIG GPI WVYSSEI+PL+LRA GCS+G   NR  S
Sbjct  374   DDEQKLTWAVALCVAMSLSSVAFFSIGMGPIAWVYSSEIYPLRLRAQGCSMGVAANRFMS  433

Query  579   GVVSMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR  400
             GVV MTFISLY+ I+IGG+FFL+  IA V W+FF+TL+PET+G+TLEE E LFGTFF WR
Sbjct  434   GVVLMTFISLYETITIGGAFFLFTGIAVVAWIFFYTLLPETKGRTLEEMEDLFGTFFNWR  493

Query  399   SRQREVDAKKANNNS  355
             S  +E++ KK  NN+
Sbjct  494   STSKELNIKKEANNT  508



>ref|XP_010507195.1| PREDICTED: polyol transporter 5 [Camelina sativa]
Length=534

 Score =   404 bits (1038),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 196/325 (60%), Positives = 249/325 (77%), Gaps = 7/325 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLG+A+RVL KTSDS  E+ +RL DIK AAGIP  C D+VV V
Sbjct  211   IGVLAMPESPRWLVMQGRLGEAKRVLDKTSDSLAESALRLEDIKHAAGIPADCHDDVVQV  270

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             ++K    + VWREL I PTPAV  ++I  +GIH FQQASGIDAVVL+ PRIF+ AG+K+D
Sbjct  271   SRKNSHGEGVWRELLIRPTPAVRRVMIAAIGIHFFQQASGIDAVVLFSPRIFKTAGLKTD  330

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               +LL T+A+G  KT+FILVATF LD+ GRRPLLLTSVGGMV +L  LG SLT+IDHS +
Sbjct  331   HQQLLATVAVGVVKTLFILVATFLLDRIGRRPLLLTSVGGMVLSLMALGTSLTIIDHSEK  390

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KV WAV +AIA  + YVA FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+S
Sbjct  391   KVMWAVVLAIATVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVIS  450

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+ + K ++ GG+F+L+  IA V W+FF+T +PETQG+ LE+ E LF + FRWR  + 
Sbjct  451   MTFLPMSKKMTTGGAFYLFGGIATVAWLFFYTFLPETQGRMLEDMEELF-SGFRWRDSKN  509

Query  387   EV--DAKKANNNSQLQMGTLQAANK  319
             +   + +K   N ++++    A+NK
Sbjct  510   KPKGNPEKTIANPEVEI----ASNK  530



>ref|XP_010465998.1| PREDICTED: polyol transporter 5-like [Camelina sativa]
Length=534

 Score =   404 bits (1038),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 191/301 (63%), Positives = 236/301 (78%), Gaps = 1/301 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLG+A+RVL KTSDS  E+ +RL DIK AAGIP  C D+VV V
Sbjct  211   IGVLAMPESPRWLVMQGRLGEAKRVLDKTSDSLAESALRLEDIKHAAGIPADCHDDVVQV  270

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             ++K    + VWREL I P PAV  ++I  +GIH FQQASGIDAVVL+ PRIFEKAG+K+D
Sbjct  271   SRKNSHGEGVWRELLIRPIPAVRRVMIAAIGIHFFQQASGIDAVVLFSPRIFEKAGLKTD  330

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               +LL T+A+G  KT+FILVATF LD+ GRRPLLLTSVGGMV +L  LG SLT+IDH+ +
Sbjct  331   HQQLLATVAVGVVKTLFILVATFLLDRIGRRPLLLTSVGGMVISLIALGTSLTIIDHTKK  390

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KV WAV +AIA  + YVA FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+S
Sbjct  391   KVTWAVVLAIATVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVIS  450

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+ + K ++ GG+F+L+  IA V W+FF+T +PETQG+ LE+ E LF   FRWR  + 
Sbjct  451   MTFLPMSKKMTTGGAFYLFGGIATVAWLFFYTFLPETQGRMLEDMEELFNG-FRWRDSKN  509

Query  387   E  385
             +
Sbjct  510   K  510



>ref|XP_006577924.1| PREDICTED: polyol transporter 5-like [Glycine max]
Length=509

 Score =   402 bits (1034),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 204/313 (65%), Positives = 246/313 (79%), Gaps = 6/313 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVM+GRLG+A +VL KTSDS EEA  RLADIK AAGIPE C D+VV V
Sbjct  201   LGVLAMPESPRWLVMRGRLGEATKVLNKTSDSKEEAQQRLADIKAAAGIPESCTDDVVQV  260

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             T  R     VW+E F+ PTPAV HILI  +GIH FQQASGIDAVVLY P IF+KAG++SD
Sbjct  261   TN-RNHGGGVWKEFFLYPTPAVRHILIAALGIHFFQQASGIDAVVLYSPEIFKKAGLESD  319

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
              ++LL T+A+GF KTVFILVATF LD+ GRRPLLLTSVGGMV +L  LG+SLTVIDHS  
Sbjct  320   GEQLLATVAVGFAKTVFILVATFLLDRVGRRPLLLTSVGGMVFSLLTLGLSLTVIDHSRA  379

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
              + WA+ ++I M L+YV+ FS+GAGPITWVYSSEIFPL+LRA G ++G  +NRVTSGV+S
Sbjct  380   VLKWAIGLSIGMVLSYVSTFSVGAGPITWVYSSEIFPLRLRAQGAAMGVVVNRVTSGVIS  439

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SL   I+IGG+FFL+  IA  GW+FF+T++PETQGKTLEE E  FG F  W S+ +
Sbjct  440   MTFLSLSNKITIGGAFFLFGGIAMCGWIFFYTMLPETQGKTLEEMEGSFGKFASW-SKGK  498

Query  387   EVDAKKANNNSQL  349
             + D    N + QL
Sbjct  499   DGD----NGDIQL  507



>emb|CDY61985.1| BnaC03g73840D [Brassica napus]
Length=530

 Score =   403 bits (1036),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 191/316 (60%), Positives = 248/316 (78%), Gaps = 5/316 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLG+A+RVL KTSDSP EA +RL DIKEAAGIP  C D+VV V
Sbjct  216   IGVLAMPESPRWLVMQGRLGEAKRVLDKTSDSPAEASLRLEDIKEAAGIPADCHDDVVQV  275

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +++    + VW+EL + PTPAV  ++I  +GIH FQQASGIDAVVL+ PRIF+ AG+++D
Sbjct  276   SRRNSHGEGVWKELLLRPTPAVRRVMIAAIGIHFFQQASGIDAVVLFSPRIFKTAGLETD  335

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
              ++LL T+A+G  KT FILVATF LD+ GRRPLLLTSVGGMV +LA+LG SLTVI+ S +
Sbjct  336   HEQLLATVAVGVVKTSFILVATFLLDRVGRRPLLLTSVGGMVLSLAVLGTSLTVINQSDK  395

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KV WAV ++IA  + YVA FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+S
Sbjct  396   KVMWAVVLSIATVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVIS  455

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+ + K ++ GG+F+L+  IA V WVFF+T + ETQG+ LE+ + LF + FRWR  + 
Sbjct  456   MTFLPMSKGMTTGGAFYLFGGIATVAWVFFYTFLRETQGRMLEDMDELF-SGFRWRDSKN  514

Query  387   EVDAKKANNNSQLQMG  340
                 K + +N+++++G
Sbjct  515   ----KNSGSNTEVEIG  526



>gb|KJB12316.1| hypothetical protein B456_002G011500 [Gossypium raimondii]
Length=533

 Score =   403 bits (1036),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 207/324 (64%), Positives = 245/324 (76%), Gaps = 7/324 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWL+MQGRLG+A+ VL KTSD+ EEA  RL+DIK AAGIPE C D +V V
Sbjct  211   VGVLAMPESPRWLIMQGRLGEAKTVLDKTSDTKEEARGRLSDIKAAAGIPEDCTDGIVQV  270

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+   E  VWREL + PTPAV H+LI  +GIH FQQA G+++VVLY PRIFEKAGI S 
Sbjct  271   QKQTHGE-GVWRELILHPTPAVRHVLICAIGIHFFQQAIGLESVVLYSPRIFEKAGITSS  329

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               KLL T+A+GF+KT FILVATF LDK GRRPLLL S GGMV  LA LG+SLTVI HS +
Sbjct  330   DHKLLATMAVGFSKTTFILVATFLLDKIGRRPLLLISSGGMVVILATLGLSLTVIGHSDK  389

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K  WAV + I M L+ VA FSIG GPITWVYS+EIFPL+LRA G SLG  +NRV SGV+S
Sbjct  390   KQTWAVGLCITMVLSSVAVFSIGMGPITWVYSTEIFPLRLRAQGASLGVAVNRVMSGVIS  449

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             M+FISLYKAI+IGG+FFLYA +A V + FFFT +PET+GKTLEE E LFG    WR   +
Sbjct  450   MSFISLYKAITIGGAFFLYAGVALVAFFFFFTFLPETRGKTLEEMEGLFGKLVGWREEAK  509

Query  387   EVDAKK--AN----NNSQLQMGTL  334
             ++  K+  AN     N Q+Q+G +
Sbjct  510   KMKRKRNEANGDGIGNDQIQLGKI  533



>ref|XP_008791366.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=507

 Score =   402 bits (1033),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 193/290 (67%), Positives = 236/290 (81%), Gaps = 2/290 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             ++VLAMPESPRWLVMQGRLG A+RVL KTSD+PEEA +RL +IKEAAGIPE+C+DEVV V
Sbjct  187   IAVLAMPESPRWLVMQGRLGAAKRVLAKTSDAPEEAQLRLLEIKEAAGIPENCNDEVVAV  246

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +KK   E  VW+EL + PTP+V  ILI  +G+  FQQASGID+VVLY PR+FEKAGIKSD
Sbjct  247   SKKSHGE-GVWKELLLRPTPSVRRILIAAIGLQFFQQASGIDSVVLYSPRVFEKAGIKSD  305

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-H  751
             ++ L  T+A+GF KT  +LVATF LD+ GRRPLLL+S GGMV +L +L   L+VI+H  H
Sbjct  306   SNSLGATVAVGFMKTASVLVATFLLDRVGRRPLLLSSAGGMVISLVILASCLSVIEHHPH  365

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             EK+ WA AM+IA  L +V +FSIG GPI WVY+SEIFPL+LRA G SLGTG NR+ SGVV
Sbjct  366   EKLTWAAAMSIATVLTFVGSFSIGLGPIAWVYTSEIFPLRLRAQGVSLGTGTNRILSGVV  425

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALF  421
             +MTFISLYKAI+I GSFFLYA IAA GW+FF+  +PET+G++LE+  ALF
Sbjct  426   TMTFISLYKAITIAGSFFLYAGIAAAGWLFFYFFLPETRGRSLEDMGALF  475



>gb|KJB12318.1| hypothetical protein B456_002G011700 [Gossypium raimondii]
Length=525

 Score =   402 bits (1033),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 195/311 (63%), Positives = 241/311 (77%), Gaps = 5/311 (2%)
 Frame = -3

Query  1284  SVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVT  1105
             +VL MPESPRWLVMQG+LG+A+ VL KT D+ EEA +RL DIKEAAGIP+    +VV V 
Sbjct  209   AVLVMPESPRWLVMQGKLGEAKVVLEKTLDTKEEAQLRLNDIKEAAGIPQDSTGDVVVV-  267

Query  1104  KKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDT  925
             +K+ + + VWREL + PTP V HILI  VGIH FQQ+SG+DAVV+Y PRIFEKAGI S  
Sbjct  268   QKQTNSNGVWRELLLHPTPTVKHILICTVGIHFFQQSSGVDAVVVYSPRIFEKAGITSSN  327

Query  924   DKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEK  745
             ++LL T+A+G  KT+FILVATF LDK GRR LLL S GGMV +LA LG SLT+I+HS  K
Sbjct  328   EQLLTTVAVGICKTIFILVATFLLDKSGRRALLLISTGGMVVSLATLGFSLTIINHSEAK  387

Query  744   VPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSM  565
             + WA+A+ I M L++ A F+IG GPI  +Y+SEIFPLKLRA G SLG  +NRVTSG++SM
Sbjct  388   LTWAIALCITMVLSFAAFFAIGMGPIAGIYTSEIFPLKLRAQGISLGVAVNRVTSGIISM  447

Query  564   TFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQRE  385
             TF+SLY+AI+IGG+FFL+A IAAVGW+FF   +PET+GKTLEETE LFG    W    RE
Sbjct  448   TFLSLYQAITIGGAFFLFAGIAAVGWLFFNICLPETRGKTLEETERLFGNLVGW----RE  503

Query  384   VDAKKANNNSQ  352
             VD K   +N++
Sbjct  504   VDKKMKEDNTK  514



>ref|XP_007131850.1| hypothetical protein PHAVU_011G046600g [Phaseolus vulgaris]
 gb|ESW03844.1| hypothetical protein PHAVU_011G046600g [Phaseolus vulgaris]
Length=510

 Score =   401 bits (1030),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 193/313 (62%), Positives = 243/313 (78%), Gaps = 7/313 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VL MPESPRWLVM+GRLG+AR VL KTSDS EEA  RLADIK+AAGIPE C+D+VV V
Sbjct  202   VGVLVMPESPRWLVMKGRLGEARIVLNKTSDSKEEAQQRLADIKQAAGIPESCNDDVVQV  261

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             TK+    ++VW+ELF+ PTPA+ HILI  +GI+ FQQASG+DAVVLY PRIFEKAG+  D
Sbjct  262   TKQS-SGNNVWKELFLYPTPAIRHILIAALGIYCFQQASGVDAVVLYSPRIFEKAGMTDD  320

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             T KLL T+A+GF KT FILVATF +D+ GRRP+LL+SVGGMV +  +LG+  T+I+ S  
Sbjct  321   THKLLATVAVGFVKTTFILVATFMMDRVGRRPMLLSSVGGMVVSFLILGIVFTIIEQSES  380

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K  WA+ ++I M L +VA FSIGAGPITWVYS+EIFPL+LRA G + G  +NR+TSGV++
Sbjct  381   KPMWAIGLSITMVLVFVATFSIGAGPITWVYSAEIFPLRLRAQGVAAGVVVNRITSGVIT  440

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SL KAI++GG+FFLY  IAA G +FF+  +PET+GKTLE+ EA FG F    ++  
Sbjct  441   MTFLSLTKAITVGGTFFLYCGIAATGGLFFYIALPETRGKTLEDMEASFGNFNLKSNKGL  500

Query  387   EVDAKKANNNSQL  349
             E      N N++L
Sbjct  501   E------NGNAKL  507



>ref|XP_008800418.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=528

 Score =   401 bits (1031),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 190/290 (66%), Positives = 235/290 (81%), Gaps = 2/290 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             ++VLAMPESPRWLVMQGRLG+A+RVL KTSD+PEEA +RL +IKEAAGIPE+C+DEVV V
Sbjct  208   IAVLAMPESPRWLVMQGRLGEAKRVLAKTSDTPEEAQLRLLEIKEAAGIPENCNDEVVAV  267

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +KK   E  VW++L + PTP+V  ILI  +G+  FQQASGID+VVLY PR+FE AG+KSD
Sbjct  268   SKKNHGE-GVWKDLLLRPTPSVRRILIAAIGLQFFQQASGIDSVVLYSPRVFEMAGLKSD  326

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SH  751
             T+ L  T+A+GF KT  ILVATF LD+ GRRPLLL+S GGMV +L +L  SL+VI+H  H
Sbjct  327   TNSLGATVAVGFMKTAAILVATFLLDRVGRRPLLLSSAGGMVISLVILASSLSVIEHHPH  386

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             EK+ WA AM+IA  L +V +FSIG GPI WVY+SEIFPL+LRA G SLGT  NR+ SGV+
Sbjct  387   EKLTWAAAMSIASVLTFVGSFSIGLGPIAWVYTSEIFPLRLRAQGASLGTATNRIVSGVI  446

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALF  421
             +MTFISLYK I+I GSFFLYA IAA GW+FF+  +PET+G++LE+ E LF
Sbjct  447   TMTFISLYKTITIAGSFFLYAGIAAAGWIFFYFFLPETRGRSLEDMEVLF  496



>ref|XP_009135601.1| PREDICTED: polyol transporter 5 [Brassica rapa]
Length=532

 Score =   401 bits (1031),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 189/296 (64%), Positives = 237/296 (80%), Gaps = 1/296 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRW VMQGRLG+A+RVL KTSDSP EA +RL DIKEAAGIP  C D+VV V
Sbjct  216   IGVLAMPESPRWFVMQGRLGEAKRVLDKTSDSPAEASLRLEDIKEAAGIPADCHDDVVQV  275

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +++    + VW+EL + PTPAV  ++I  +GIH FQQASGIDAVVL+ PRIF+ AG+++D
Sbjct  276   SRRNSHGEGVWKELLLRPTPAVRRVMIAAIGIHFFQQASGIDAVVLFSPRIFKTAGLETD  335

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
              ++LL T+A+G  KT FILVATF LD+ GRRPLLLTSVGGMV +LA+LG SLTVID S +
Sbjct  336   HEQLLATVAVGIVKTSFILVATFLLDRVGRRPLLLTSVGGMVISLAVLGTSLTVIDQSDK  395

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KV WAV ++IA  + YVA FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+S
Sbjct  396   KVMWAVVLSIATVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVIS  455

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR  400
             MTF+ + K ++ GG+F+L+  IA V WVFF+T +PETQG+ LE+ + LF + FRWR
Sbjct  456   MTFLPMSKGMTTGGAFYLFGGIATVAWVFFYTFLPETQGRMLEDMDELF-SGFRWR  510



>ref|XP_009407915.1| PREDICTED: putative polyol transporter 1 [Musa acuminata subsp. 
malaccensis]
Length=520

 Score =   400 bits (1028),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 203/325 (62%), Positives = 256/325 (79%), Gaps = 12/325 (4%)
 Frame = -3

Query  1290  GVSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVT  1111
             G+ VLAMPESPRWL+MQGRL +AR+VL KTSD+PEEA +RL+DIK AAGIPE CDD+VV 
Sbjct  202   GLGVLAMPESPRWLIMQGRLAEARKVLEKTSDTPEEAKLRLSDIKIAAGIPEDCDDDVVP  261

Query  1110  VTKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
             + KK      VW++L + PTP+V  +LI  VG+H FQQASGID+VVLY P++FEKAGI+ 
Sbjct  262   MPKKT-RSRGVWKDLLVRPTPSVRRVLIAAVGLHFFQQASGIDSVVLYSPKVFEKAGIQG  320

Query  930   DTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH  751
             +T  L  T+A+GFTKT+FILVATF LD+ GRRPLLLTS  GM+ +LA LG+ LT  +H  
Sbjct  321   NTKLLGTTVAVGFTKTLFILVATFLLDRVGRRPLLLTSFAGMILSLAGLGLGLTAAEHHT  380

Query  750   E-KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGV  574
             +  +PWAV ++IA  LAYVA FSIGAGPITWVYSSEIFPL+LRA G S+G  +NRVTSGV
Sbjct  381   DGHLPWAVGLSIACVLAYVAFFSIGAGPITWVYSSEIFPLRLRAVGASIGVAVNRVTSGV  440

Query  573   VSMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSR  394
             ++MTFISLYKAIS+GGSFFLY  IAAV WVFFFT +PET+G+TLE+ E LFG       +
Sbjct  441   ITMTFISLYKAISLGGSFFLYGGIAAVAWVFFFTYLPETRGRTLEDMEELFG-------K  493

Query  393   QREVDAKKANNNSQLQMGTLQAANK  319
             ++EVD K+    ++++M  + A+N+
Sbjct  494   EKEVD-KQTKEENRVEM--VNASNR  515



>gb|KFK30307.1| hypothetical protein AALP_AA7G244900 [Arabis alpina]
Length=526

 Score =   400 bits (1028),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 189/296 (64%), Positives = 235/296 (79%), Gaps = 1/296 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLG+A++VL KTSDSP EA +RL DIKEAAGIP  C D+VV V
Sbjct  210   LGVLAMPESPRWLVMQGRLGEAKKVLDKTSDSPSEAALRLEDIKEAAGIPADCHDDVVQV  269

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             ++K    + VWREL I P PAV  ++I  +GIH FQQASGIDAVVL+ PRIF+ AG+K+D
Sbjct  270   SRKNSHGEGVWRELLIRPIPAVRRVMIAAMGIHFFQQASGIDAVVLFSPRIFKAAGLKTD  329

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               +LL T+A+G  KT FILVATFTLD+FGRRPLLLTSVGGMV +LA LG SLT+ID + +
Sbjct  330   HQQLLATVAVGIVKTSFILVATFTLDRFGRRPLLLTSVGGMVLSLAALGTSLTIIDQTEK  389

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             KV WAV ++I   + YVA FSIGAGPITWVY+SEIFPL+LR+ G S+G  +NRVTSGV+S
Sbjct  390   KVMWAVVLSITTVMTYVATFSIGAGPITWVYTSEIFPLRLRSQGSSMGVVVNRVTSGVIS  449

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR  400
             + FI L + I+ GG+F+L+  +A V W+FF+T +PET+G+TLE+   LFG  FRWR
Sbjct  450   IGFIPLSEGITTGGAFYLFCGVATVAWIFFYTFLPETRGRTLEDMGELFGN-FRWR  504



>ref|XP_010487804.1| PREDICTED: polyol transporter 5-like [Camelina sativa]
Length=535

 Score =   400 bits (1028),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 190/298 (64%), Positives = 235/298 (79%), Gaps = 1/298 (0%)
 Frame = -3

Query  1278  LAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTKK  1099
             LAMPESPRWLVMQGRLG+A+RVL KTSDS  E+ +RL DIK AAGIP  C D+VV V++K
Sbjct  214   LAMPESPRWLVMQGRLGEAKRVLDKTSDSLAESALRLEDIKHAAGIPADCHDDVVQVSRK  273

Query  1098  RGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTDK  919
                 + VWREL I PTPAV  ++I  +GIH FQQASGIDAVVL+ PRIF+ AG+K+D  +
Sbjct  274   NSHGEGVWRELLIRPTPAVRRVMIAAIGIHFFQQASGIDAVVLFSPRIFKTAGLKTDHQQ  333

Query  918   LLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKVP  739
             LL T+A+G  KT+FILVATF LD+ GRRPLLLTSVGGMV +L  LG SLT+IDHS +KV 
Sbjct  334   LLATVAVGVVKTLFILVATFLLDRIGRRPLLLTSVGGMVLSLLALGTSLTIIDHSEKKVM  393

Query  738   WAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMTF  559
             WAV +AIA  + YVA FSIGAGPITWVYSSEIFPL+LR+ G S+G  +NRVTSGV+SMTF
Sbjct  394   WAVVLAIATVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVISMTF  453

Query  558   ISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQRE  385
             + + K ++ GG+F+L+  IA V W+FF+T +PETQG+ LE+ E LF + FRWR  + +
Sbjct  454   LPMSKKMTTGGAFYLFGGIATVAWLFFYTFLPETQGRMLEDMEELF-SGFRWRDSKNK  510



>ref|XP_008775333.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=528

 Score =   399 bits (1026),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 190/290 (66%), Positives = 236/290 (81%), Gaps = 2/290 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             ++VLAMPESPRWLVMQGRLG+A+RVL KTSD+PEEA +RL +IKEAAGIPE+C+DEVV V
Sbjct  208   IAVLAMPESPRWLVMQGRLGEAKRVLAKTSDTPEEAQLRLLEIKEAAGIPENCNDEVVAV  267

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             ++K   E  VW+EL + PTP+V  ILI  +G+  FQQASGID+VVLY PR+FEKAG+KSD
Sbjct  268   SEKSHGE-GVWKELLLRPTPSVRRILIAAIGLQFFQQASGIDSVVLYSPRVFEKAGLKSD  326

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SH  751
             ++ L  T+A+GF KT  ILVATF LD+ GRRPLLL+S GGMV +L +L   L+VI+H  H
Sbjct  327   SNSLGATVAVGFMKTAAILVATFLLDRVGRRPLLLSSAGGMVISLVILASCLSVIEHHPH  386

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             EK+ WA AM+IA  L +V +FSIG GPI WVY+SEIFPL+LRA G SLGT  NR+ SGVV
Sbjct  387   EKLTWAAAMSIATVLTFVGSFSIGLGPIAWVYTSEIFPLRLRAQGASLGTATNRILSGVV  446

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALF  421
             +MTFISLYKAI+I GSFFLY+ IAA GW+FF+  +PET+G++LE+ E LF
Sbjct  447   TMTFISLYKAITIAGSFFLYSGIAAAGWLFFYFFLPETRGRSLEDMEVLF  496



>ref|XP_006406559.1| hypothetical protein EUTSA_v10020495mg [Eutrema salsugineum]
 gb|ESQ48012.1| hypothetical protein EUTSA_v10020495mg [Eutrema salsugineum]
Length=529

 Score =   399 bits (1025),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 189/317 (60%), Positives = 242/317 (76%), Gaps = 2/317 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRL +A+RVL KTSDSP EA +RL DIKEAAGIP  C D++V V
Sbjct  210   IGVLAMPESPRWLVMQGRLREAKRVLDKTSDSPSEAALRLEDIKEAAGIPADCHDDIVQV  269

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             ++K    + VWREL I PTPAV  ++I  +GIH FQQASGIDAVVL+ PRIF+ AG+K+D
Sbjct  270   SRKNSHGEGVWRELLIRPTPAVRRVMIAAIGIHFFQQASGIDAVVLFSPRIFKTAGLKTD  329

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               +LL T+A+G  KT FILVATF LD+ GRRPLLLTSVGGMV +LA LG SLT+IDH  E
Sbjct  330   HQQLLATVAVGIVKTSFILVATFLLDRVGRRPLLLTSVGGMVLSLATLGTSLTIIDHQTE  389

Query  747   -KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
              K  W + ++I+M + YVA FSIGAGPITWVYSSEIFPL+LR+ G S    +NRVTSGV+
Sbjct  390   KKAMWVLVLSISMVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSFAVVVNRVTSGVI  449

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
             SM F+ L + I+ GG+F+L+  IA V W FF+T +PETQG+ LE+ + LF + FRWR  +
Sbjct  450   SMGFLPLTEGITTGGAFYLFCGIATVAWFFFYTFLPETQGRMLEDMDELF-SGFRWRDSK  508

Query  390   REVDAKKANNNSQLQMG  340
              +   + +++N ++++G
Sbjct  509   SKPKNRSSSSNPEVEIG  525



>ref|XP_008800420.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=526

 Score =   398 bits (1023),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 188/291 (65%), Positives = 234/291 (80%), Gaps = 2/291 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             ++VLAMPESPRWLVMQGRLG+A RVL KTSD+PEEA +RL +IKEAAGIPE+C+DEVV  
Sbjct  208   IAVLAMPESPRWLVMQGRLGEAERVLAKTSDTPEEAQLRLLEIKEAAGIPENCNDEVVAE  267

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +KK   E  VW++L + PTP+V  ILI  +G+  FQQASGID+VVLY PR+FEKAG+KSD
Sbjct  268   SKKNHGE-GVWKDLLLRPTPSVRRILIAAIGLQFFQQASGIDSVVLYSPRVFEKAGLKSD  326

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SH  751
             ++ L  T+A+GF KT  ILVATF LD+ GRRPLLL+S GGMV +L +L  SL+VI+H  H
Sbjct  327   SNSLGATVAVGFMKTAAILVATFLLDRVGRRPLLLSSAGGMVISLVILASSLSVIEHHPH  386

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             EK+ WA AM+I+  L +V +FSIG GPI WVY+SEIFPL+LRA G SLGT  NR+ SGV+
Sbjct  387   EKLTWAAAMSISTVLTFVGSFSIGLGPIAWVYTSEIFPLRLRAQGASLGTATNRIVSGVI  446

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
             SMTFISLYK I+I GS+F YA IAA GW+FF+  +PET+G++LE+ E LFG
Sbjct  447   SMTFISLYKTITIAGSYFFYAGIAAAGWLFFYFFLPETRGRSLEDMEVLFG  497



>ref|XP_002467638.1| hypothetical protein SORBIDRAFT_01g031360 [Sorghum bicolor]
 gb|EER94636.1| hypothetical protein SORBIDRAFT_01g031360 [Sorghum bicolor]
Length=535

 Score =   397 bits (1021),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 200/318 (63%), Positives = 241/318 (76%), Gaps = 4/318 (1%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VL MPESPRWLVM+GRL DA+ VL KTSD+PEEA MRLADIKEAAGIP   D +VV V K
Sbjct  209   VLGMPESPRWLVMKGRLADAKVVLGKTSDTPEEAAMRLADIKEAAGIPADLDGDVVAVPK  268

Query  1101  KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTD  922
             + G E+ VW+EL +SPTPAV  +L++ +GIH FQQ+SGID+VVLY PR+F+ AGI +D +
Sbjct  269   RTGGEERVWKELILSPTPAVRRVLLSAIGIHFFQQSSGIDSVVLYSPRVFQSAGI-ADKN  327

Query  921   KLL-CTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-  748
             KLL  T A+G TKTVFILVATFTLD+FGRRPLLLTS GGMV +L  LG  LTVI H  E 
Sbjct  328   KLLGTTCAVGVTKTVFILVATFTLDRFGRRPLLLTSTGGMVVSLVGLGFGLTVIGHHPEG  387

Query  747   -KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
               +PWA+ + IA  L  VA FSIG GPITWVYSSEIFPL LRA GC+LG G+NRVTSGV+
Sbjct  388   TTIPWAIGVCIASILGVVAFFSIGLGPITWVYSSEIFPLHLRALGCALGVGVNRVTSGVI  447

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
             SMTF+SL K I+IGGSFFLYA +A + WVFFFT +PET+G+TLE+   LFG         
Sbjct  448   SMTFLSLSKGITIGGSFFLYAGVATLAWVFFFTYLPETRGRTLEQMGDLFGIPNMAGDSD  507

Query  390   REVDAKKANNNSQLQMGT  337
             ++   K+    S ++M +
Sbjct  508   QQSPEKEKTTLSNVEMSS  525



>ref|XP_010905472.1| PREDICTED: polyol transporter 5-like [Elaeis guineensis]
Length=525

 Score =   397 bits (1020),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 188/290 (65%), Positives = 233/290 (80%), Gaps = 2/290 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             ++VLAMPESPRWLVMQGRLG+A+RVL KTSD+PEEA +R   IKEAAGIPE+CDD+VV V
Sbjct  205   IAVLAMPESPRWLVMQGRLGEAKRVLAKTSDTPEEAQLRFLAIKEAAGIPENCDDDVVAV  264

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +KK   E  VW+EL + PTP+V  ILI G+G+  FQQASGID+VVLY PR+FEKAG+K D
Sbjct  265   SKKSHGE-GVWKELLLRPTPSVRRILIAGIGLQFFQQASGIDSVVLYSPRVFEKAGLKRD  323

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SH  751
             ++ L  T+A+GF KT  ILVATF +D+ GRRPLLL S GGMV +L +L  +L +I H  H
Sbjct  324   SNSLGATVAVGFMKTASILVATFLVDRVGRRPLLLCSAGGMVISLVILASNLCIIQHHPH  383

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             EK+ WA A++I+  L +V +FSIG GPI WVY+SEIFPL+LRA G SLGT  NRV SGV+
Sbjct  384   EKLTWAAAISISTVLTFVGSFSIGLGPIAWVYTSEIFPLRLRAQGVSLGTATNRVMSGVI  443

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALF  421
             +MTFISLYKAI+I GSFFLYA IAAVGW+FF+  +PET+G++LEE E +F
Sbjct  444   TMTFISLYKAITIAGSFFLYAGIAAVGWLFFYFFLPETRGRSLEEMEVIF  493



>ref|XP_010690917.1| PREDICTED: polyol transporter 5 isoform X2 [Beta vulgaris subsp. 
vulgaris]
 gb|AAB68029.1| putative sugar transporter; member of major facilitative superfamily; 
integral membrane protein [Beta vulgaris]
Length=545

 Score =   396 bits (1018),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 192/327 (59%), Positives = 240/327 (73%), Gaps = 12/327 (4%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDA++VL + SDSPEEA +RL++IK+ AGIP  CD+++  V
Sbjct  211   IGVLAMPESPRWLVMQGRLGDAKKVLNRISDSPEEAQLRLSEIKQTAGIPAECDEDIYKV  270

Query  1107  TK-KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
              K K    ++VW+ELF +PTPAV   +I G+GIH FQQASGIDAVVLY PRIF+ AGI +
Sbjct  271   EKTKIKSGNAVWKELFFNPTPAVRRAVIAGIGIHFFQQASGIDAVVLYSPRIFQSAGITN  330

Query  930   DTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH  751
                +LL T+A+G  KT+FILVATF LDK+GRRPLLLTSVGGM+  +  L MSLTVIDHSH
Sbjct  331   ARKQLLATVAVGVVKTLFILVATFQLDKYGRRPLLLTSVGGMIIAILTLAMSLTVIDHSH  390

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
              K+ WA+A+ I M  A VA+FSIG GPITWVYSSE+FPL+LRA G S+G  +NRV SGV+
Sbjct  391   HKITWAIALCITMVCAVVASFSIGLGPITWVYSSEVFPLRLRAQGTSMGVAVNRVVSGVI  450

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR---  400
             S+ F+ L   I+ GG+FFL+  IA + W FF T +PET+G+TLE    LF   FRWR   
Sbjct  451   SIFFLPLSHKITTGGAFFLFGGIAIIAWFFFLTFLPETRGRTLENMHELFED-FRWRESF  509

Query  399   ----SRQREVDAKK---ANNNSQLQMG  340
                 S   E   +K    N+ SQ+Q+G
Sbjct  510   PGNKSNNDENSTRKQSNGNDKSQVQLG  536



>ref|XP_010690916.1| PREDICTED: polyol transporter 5 isoform X1 [Beta vulgaris subsp. 
vulgaris]
 gb|AAB68028.1| putative sugar transporter; member of major facilitative superfamily; 
integral membrane protein [Beta vulgaris]
Length=549

 Score =   396 bits (1017),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 192/327 (59%), Positives = 240/327 (73%), Gaps = 12/327 (4%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDA++VL + SDSPEEA +RL++IK+ AGIP  CD+++  V
Sbjct  211   IGVLAMPESPRWLVMQGRLGDAKKVLNRISDSPEEAQLRLSEIKQTAGIPAECDEDIYKV  270

Query  1107  TK-KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
              K K    ++VW+ELF +PTPAV   +I G+GIH FQQASGIDAVVLY PRIF+ AGI +
Sbjct  271   EKTKIKSGNAVWKELFFNPTPAVRRAVIAGIGIHFFQQASGIDAVVLYSPRIFQSAGITN  330

Query  930   DTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH  751
                +LL T+A+G  KT+FILVATF LDK+GRRPLLLTSVGGM+  +  L MSLTVIDHSH
Sbjct  331   ARKQLLATVAVGVVKTLFILVATFQLDKYGRRPLLLTSVGGMIIAILTLAMSLTVIDHSH  390

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
              K+ WA+A+ I M  A VA+FSIG GPITWVYSSE+FPL+LRA G S+G  +NRV SGV+
Sbjct  391   HKITWAIALCITMVCAVVASFSIGLGPITWVYSSEVFPLRLRAQGTSMGVAVNRVVSGVI  450

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR---  400
             S+ F+ L   I+ GG+FFL+  IA + W FF T +PET+G+TLE    LF   FRWR   
Sbjct  451   SIFFLPLSHKITTGGAFFLFGGIAIIAWFFFLTFLPETRGRTLENMHELFED-FRWRESF  509

Query  399   ----SRQREVDAKK---ANNNSQLQMG  340
                 S   E   +K    N+ SQ+Q+G
Sbjct  510   PGNKSNNDENSTRKQSNGNDKSQVQLG  536



>ref|XP_004148312.2| PREDICTED: polyol transporter 5-like [Cucumis sativus]
 gb|KGN44323.1| Sugar transporter [Cucumis sativus]
Length=516

 Score =   394 bits (1012),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 196/318 (62%), Positives = 239/318 (75%), Gaps = 1/318 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VL MPESPRWLVMQG++G A++VL KTSDS +E+  RLADIK AA IP     +VVT+
Sbjct  197   VVVLVMPESPRWLVMQGQVGKAKKVLDKTSDSIQESEQRLADIKSAAKIPLDSTADVVTI  256

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+      VW++LF+ PTP+V H+LI  VG+H FQQASGID+VVLY PRIFE AGIKSD
Sbjct  257   PKQATHGKDVWKDLFLHPTPSVRHVLIAAVGLHFFQQASGIDSVVLYSPRIFENAGIKSD  316

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSH  751
             ++KLL T+A+GF+KTVFILVATF LD+ GRRPLLLTSV G + +L  LG+ LTVI+ H  
Sbjct  317   SEKLLATVAVGFSKTVFILVATFLLDRVGRRPLLLTSVAGKMVSLVTLGLGLTVIEQHED  376

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
              K+ WAV + IAM L  VA FSIG GPI WVYSSEIFPLKLRA G S+G  +NRVTSGV+
Sbjct  377   VKLTWAVGLCIAMVLCDVAFFSIGMGPIAWVYSSEIFPLKLRAQGASVGVIVNRVTSGVI  436

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
             +MTF+SL KAI+IGG+FFLYA IAA+  VFF+ + PETQGKTLE+ E LFG      S+ 
Sbjct  437   TMTFLSLTKAITIGGAFFLYAGIAAISLVFFYVVFPETQGKTLEDMEGLFGNLLWKFSKH  496

Query  390   REVDAKKANNNSQLQMGT  337
             R        + +QLQ+ T
Sbjct  497   RHFHKNDVGDVAQLQLHT  514



>ref|XP_008447049.1| PREDICTED: polyol transporter 5 [Cucumis melo]
Length=516

 Score =   394 bits (1012),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 194/318 (61%), Positives = 239/318 (75%), Gaps = 1/318 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VL MPESPRWLVMQG++G A++VL KTSDS +E+  RLADIK AA IP     ++V +
Sbjct  197   VVVLVMPESPRWLVMQGQVGKAKKVLDKTSDSIQESQQRLADIKSAAKIPLDSTADIVPI  256

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+      VW++LF+ PTP+V H+LI  VG+H FQQASGID+VVLY PRIFE AGIKSD
Sbjct  257   PKQTTHGKGVWKDLFLHPTPSVRHVLIAAVGLHFFQQASGIDSVVLYSPRIFENAGIKSD  316

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             ++KLL T+A+GF+KTVFILVATF LD+ GRRPLLLTSV G + +L  LG  LTVI  + E
Sbjct  317   SEKLLATVAVGFSKTVFILVATFLLDRVGRRPLLLTSVAGKMVSLVTLGFGLTVIQQNEE  376

Query  747   -KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
              K+ WAV + IAM L  VA FSIG GPI WVYSSEIFPLKLRA G S+G  +NRVTSGV+
Sbjct  377   VKLRWAVGLCIAMVLCDVAFFSIGMGPIAWVYSSEIFPLKLRAQGASVGVIVNRVTSGVI  436

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
             +MTF+SL KAI+IGG+FFLYA IAA+ W+FF+ + PETQGKTLE+ E LFG+     S+ 
Sbjct  437   TMTFLSLTKAITIGGAFFLYAGIAAISWLFFYVVFPETQGKTLEDMEGLFGSLLWKFSKD  496

Query  390   REVDAKKANNNSQLQMGT  337
              ++D        QLQ+ T
Sbjct  497   GKIDKNDVGVTRQLQLHT  514



>tpg|DAA45950.1| TPA: hypothetical protein ZEAMMB73_850316 [Zea mays]
Length=519

 Score =   394 bits (1012),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 196/291 (67%), Positives = 232/291 (80%), Gaps = 4/291 (1%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VL MPESPRWLVM+GRL DA+ VL KTSD+PEEA +RLADIKEAAGIP   D +VV V K
Sbjct  209   VLGMPESPRWLVMKGRLADAKVVLGKTSDTPEEAALRLADIKEAAGIPADLDGDVVAVPK  268

Query  1101  KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTD  922
             + G E+ VW+EL +SPTPAV  IL++ +GIH FQQ+SGID+VVLY PR+F+ AGI +D +
Sbjct  269   RTGGEERVWKELILSPTPAVRRILLSALGIHFFQQSSGIDSVVLYSPRVFQSAGI-ADKN  327

Query  921   KLL-CTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-  748
             KLL  T A+G TKT+FILVATFTLD+FGRRPLLL S GGMV +L  LG  LTVI H  E 
Sbjct  328   KLLGTTCAVGVTKTLFILVATFTLDRFGRRPLLLASTGGMVVSLVGLGFGLTVIGHHQEG  387

Query  747   -KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
               +PWA+ + IA  L  VA FSIG GPITWVYSSEIFPL LRA GC+LG G+NRVTSGV+
Sbjct  388   TTIPWAIGVCIASILGVVAFFSIGLGPITWVYSSEIFPLHLRALGCALGVGLNRVTSGVI  447

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
             SMTF+SL K I+IGGSFFLYA IA++ WVFFFT +PET+G+TLE+   LFG
Sbjct  448   SMTFLSLSKGITIGGSFFLYAGIASLAWVFFFTYLPETRGRTLEQMGGLFG  498



>ref|XP_008653287.1| PREDICTED: polyol transporter 5-like [Zea mays]
 tpg|DAA63325.1| TPA: hypothetical protein ZEAMMB73_442702 [Zea mays]
Length=513

 Score =   393 bits (1010),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 194/290 (67%), Positives = 231/290 (80%), Gaps = 2/290 (1%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VL MPESPRWLVM+GRL DA+ VL KTSD+PEEA  RLADIK AAGIP+  D +VV V K
Sbjct  197   VLGMPESPRWLVMKGRLADAKVVLGKTSDTPEEAAERLADIKAAAGIPQELDGDVVAVPK  256

Query  1101  KRGDEDS-VWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDT  925
             KR  E++ VW+EL +SPTPA+  IL++G+GIH FQQASGIDAVVLY PR+F+ AGI SD 
Sbjct  257   KRDSEEARVWKELILSPTPAMRRILLSGIGIHFFQQASGIDAVVLYSPRVFKAAGITSDN  316

Query  924   DKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH-E  748
               L  T A+G TKT+FILVATF LD+ GRRPLLL+SVGGM+ +L  L   LTVI H   E
Sbjct  317   QLLGTTCAVGVTKTLFILVATFLLDRVGRRPLLLSSVGGMIFSLVGLAAGLTVIGHYQDE  376

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+PWA+ +AIA T+AYVA FSIG GPITWVYSSE+FPL +RA GC+LG   NR+TSGV+S
Sbjct  377   KIPWAIGVAIASTMAYVAFFSIGLGPITWVYSSEVFPLHVRAMGCALGVASNRLTSGVIS  436

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
             MTFISL KAI+IGG+FFLYA +A + WVFFFT +PET+G+TLE    LFG
Sbjct  437   MTFISLSKAITIGGAFFLYAGVAVLAWVFFFTFLPETRGRTLEAMSKLFG  486



>gb|EAZ04480.1| hypothetical protein OsI_26629 [Oryza sativa Indica Group]
Length=510

 Score =   393 bits (1009),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 194/290 (67%), Positives = 231/290 (80%), Gaps = 2/290 (1%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VL MPESPRWLVM+GRL DA+ VL KTSD+ EEA  RLADIK AAGIPE  D +VVTV K
Sbjct  197   VLGMPESPRWLVMKGRLADAKVVLEKTSDTAEEAAERLADIKAAAGIPEELDGDVVTVPK  256

Query  1101  K-RGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDT  925
             +  G+E  VW+EL +SPTPA+  IL++G+GIH FQQASGID+VVLY PR+F+ AGI  D 
Sbjct  257   RGSGNEKRVWKELILSPTPAMRRILLSGIGIHFFQQASGIDSVVLYSPRVFKSAGITDDN  316

Query  924   DKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVI-DHSHE  748
               L  T A+G TKT+FILVATF LD+ GRRPLLL+S GGM+ +L  LG  LTV+  H   
Sbjct  317   HLLGTTCAVGVTKTLFILVATFFLDRVGRRPLLLSSTGGMILSLIGLGAGLTVVGQHPDA  376

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+PWA+ ++IA TLAYVA FSIG GPITWVYSSEIFPL++RA GCSLG   NRVTSGV+S
Sbjct  377   KIPWAIGLSIASTLAYVAFFSIGLGPITWVYSSEIFPLQVRALGCSLGVAANRVTSGVIS  436

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
             MTF+SL KAI+IGGSFFLY+ IAA+ WVFF+T +PET+G+TLEE   LFG
Sbjct  437   MTFLSLSKAITIGGSFFLYSGIAALAWVFFYTYLPETRGRTLEEMSKLFG  486



>ref|XP_003562817.1| PREDICTED: polyol transporter 5-like [Brachypodium distachyon]
Length=513

 Score =   393 bits (1009),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 195/316 (62%), Positives = 240/316 (76%), Gaps = 4/316 (1%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VL MPESPRWLVM+GRL DA+ VL KTSD+PEEA  RLADIK+AAGIP+  D ++V V K
Sbjct  197   VLGMPESPRWLVMKGRLADAKVVLAKTSDTPEEAAERLADIKDAAGIPQDLDGDIVEVPK  256

Query  1101  KRGDEDS-VWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDT  925
             K G E+  VW+EL +SPT A+ HILI+G+GIH FQQASGIDAVVLY PR+F+ AGI ++ 
Sbjct  257   KGGSEEKRVWKELILSPTSAMRHILISGIGIHFFQQASGIDAVVLYSPRVFKSAGITNEN  316

Query  924   DKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSHE  748
               L  T A+G TKTVFILVATF LD+ GRRPLLL+S GGM+ +L  L   LTV+  H  E
Sbjct  317   RLLGTTCAVGVTKTVFILVATFLLDRVGRRPLLLSSTGGMIVSLVGLAAGLTVVSRHPDE  376

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             ++PWA+A+ I   LAYVA FSIG GPITWVYSSEIFPL +RA GCSLG   NR+TSGV+S
Sbjct  377   QIPWAIALCILCILAYVAFFSIGLGPITWVYSSEIFPLHVRALGCSLGVAANRLTSGVIS  436

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTFISL KAI+IGG+FFL+A IA++ WVFFFT +PET+G+TLE+  ALFG       +Q+
Sbjct  437   MTFISLSKAITIGGAFFLFAGIASLAWVFFFTYLPETRGRTLEDMSALFGN--TATHKQQ  494

Query  387   EVDAKKANNNSQLQMG  340
               +        +++MG
Sbjct  495   GSNGADDGKEKKVEMG  510



>dbj|BAC83310.1| putative sorbitol transporter [Oryza sativa Japonica Group]
 gb|EAZ40438.1| hypothetical protein OsJ_24893 [Oryza sativa Japonica Group]
Length=510

 Score =   392 bits (1008),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 194/290 (67%), Positives = 231/290 (80%), Gaps = 2/290 (1%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VL MPESPRWLVM+GRL DA+ VL KTSD+ EEA  RLADIK AAGIPE  D +VVTV K
Sbjct  197   VLGMPESPRWLVMKGRLADAKVVLEKTSDTAEEAAERLADIKAAAGIPEELDGDVVTVPK  256

Query  1101  K-RGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDT  925
             +  G+E  VW+EL +SPTPA+  IL++G+GIH FQQASGID+VVLY PR+F+ AGI  D 
Sbjct  257   RGSGNEKRVWKELILSPTPAMRRILLSGIGIHFFQQASGIDSVVLYSPRVFKSAGITDDK  316

Query  924   DKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVI-DHSHE  748
               L  T A+G TKT+FILVATF LD+ GRRPLLL+S GGM+ +L  LG  LTV+  H   
Sbjct  317   HLLGTTCAVGVTKTLFILVATFFLDRVGRRPLLLSSTGGMILSLIGLGAGLTVVGQHPDA  376

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+PWA+ ++IA TLAYVA FSIG GPITWVYSSEIFPL++RA GCSLG   NRVTSGV+S
Sbjct  377   KIPWAIGLSIASTLAYVAFFSIGLGPITWVYSSEIFPLQVRALGCSLGVAANRVTSGVIS  436

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
             MTF+SL KAI+IGGSFFLY+ IAA+ WVFF+T +PET+G+TLEE   LFG
Sbjct  437   MTFLSLSKAITIGGSFFLYSGIAALAWVFFYTYLPETRGRTLEEMSKLFG  486



>emb|CAR82417.1| polyol transporter [Plantago major]
Length=348

 Score =   385 bits (990),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 188/312 (60%), Positives = 233/312 (75%), Gaps = 2/312 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + V+ MPESPRWLV+QGRLGDARRVL KTSDS EE+ +RLADIKEAAGIPE C+D+ V V
Sbjct  36    IGVIYMPESPRWLVLQGRLGDARRVLDKTSDSLEESKLRLADIKEAAGIPEDCNDDFVQV  95

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              +K      VWREL + PT  VLHILI GVGIH FQQ  GID+VVLY PRI+++AGI   
Sbjct  96    -QKHSQGQGVWRELLLHPTKPVLHILICGVGIHFFQQGIGIDSVVLYSPRIYDRAGITDT  154

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             +DKLL TIA+G +KT FIL+ TF +D+FGRR LLL S  G+  ++  LG  LT+ID + +
Sbjct  155   SDKLLATIAVGISKTFFILITTFYVDRFGRRFLLLVSCAGVALSMFALGTVLTIIDRNPD  214

Query  747   -KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
              K    + + + +T+  V  FS+G GPI WVYSSEIFPLKLRA GC LG  +NR  SGV+
Sbjct  215   AKQTGVLVLVVLLTMVIVGFFSMGLGPIAWVYSSEIFPLKLRAQGCGLGVAMNRFMSGVI  274

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
              M+FISLYK I+IGGSFFL+  I  +GW+FFFTL PET+G+TLEE E LFGTFF+WR+  
Sbjct  275   LMSFISLYKEITIGGSFFLFGGITTLGWIFFFTLFPETRGRTLEEMEGLFGTFFKWRTTM  334

Query  390   REVDAKKANNNS  355
             +E+DAKK +   
Sbjct  335   KELDAKKRSGTD  346



>ref|XP_006657888.1| PREDICTED: polyol transporter 5-like [Oryza brachyantha]
Length=510

 Score =   391 bits (1004),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 194/290 (67%), Positives = 230/290 (79%), Gaps = 2/290 (1%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VL MPESPRWLVM+GRL DA+ VL KTSD+PEEA  RLADIK AAGIPE  D +VVTV K
Sbjct  197   VLGMPESPRWLVMKGRLADAKVVLEKTSDTPEEAADRLADIKAAAGIPEELDGDVVTVPK  256

Query  1101  K-RGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDT  925
             +  G+E  VW+EL +SPTPA+  IL++G+GIH FQ ASGIDAVVLY PR+F+ AGI  D 
Sbjct  257   RGSGEEMRVWKELILSPTPAMRRILLSGLGIHFFQHASGIDAVVLYSPRVFKSAGITDDN  316

Query  924   DKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVI-DHSHE  748
               L  T A+G TKT+FILVATF LD+ GRRPLLL+S GGM+ +L  LG  LTV+  H   
Sbjct  317   QLLGTTCAVGVTKTLFILVATFFLDRIGRRPLLLSSTGGMILSLIGLGAGLTVVGQHPDA  376

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+PWA+ ++IA TLAYVA FSIG GPITWVYSSEIFPL++RA GC+LG   NRVTSGV+S
Sbjct  377   KIPWAIGLSIASTLAYVAFFSIGLGPITWVYSSEIFPLQVRALGCALGVASNRVTSGVIS  436

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
             MTF+SL  AI+IGGSFFLYA IAA+ WVFF+T +PET+G+TLEE   LFG
Sbjct  437   MTFLSLSNAITIGGSFFLYAGIAALAWVFFYTYLPETRGRTLEEMSKLFG  486



>ref|XP_006297395.1| hypothetical protein CARUB_v10013420mg [Capsella rubella]
 gb|EOA30293.1| hypothetical protein CARUB_v10013420mg [Capsella rubella]
Length=536

 Score =   391 bits (1005),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/326 (60%), Positives = 244/326 (75%), Gaps = 8/326 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVMQGRLG+A+RVL KTSDSP E+ +RL DIK AAGIP  C D+VV V
Sbjct  209   VGVLAMPESPRWLVMQGRLGEAKRVLDKTSDSPAESALRLEDIKHAAGIPADCHDDVVQV  268

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +++    + VWREL I P PAV  ++I  +GIH FQQASGIDAVVL+ PRIF+ AG+K+D
Sbjct  269   SRRNSHGEGVWRELLIKPIPAVRRVMIAALGIHFFQQASGIDAVVLFSPRIFKTAGLKTD  328

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               +LL T+A+G  KT FILVATF LD+ GRRPLLLTSVGGMV +L  LG SLT+I  S E
Sbjct  329   HQQLLATVAVGVVKTSFILVATFLLDRIGRRPLLLTSVGGMVLSLMGLGTSLTIIGQSGE  388

Query  747   -KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
              KV WAV +AI   + YVA FSIGAGPITWVYSSEIFPL+LR+ G SLG  +NRVTSGV+
Sbjct  389   KKVMWAVVVAITTVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSLGVVVNRVTSGVI  448

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
             SMTF+ +   ++ GG+F+L+  IA V WVFF+T +PETQGK LE+ + LF + FRWR  +
Sbjct  449   SMTFLPMSDGMTTGGAFYLFGGIATVAWVFFYTFLPETQGKMLEDMDELF-SGFRWRDSK  507

Query  390   REV--DAKKANNNSQLQMGTLQAANK  319
              +   + +K   N ++++    A+NK
Sbjct  508   NKPKGNPEKTIPNPEVEI----ASNK  529



>ref|NP_001060108.1| Os07g0582400 [Oryza sativa Japonica Group]
 gb|AAL14615.1|AF416867_1 putative sugar transporter [Oryza sativa]
 dbj|BAF22022.1| Os07g0582400 [Oryza sativa Japonica Group]
Length=577

 Score =   392 bits (1008),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 194/290 (67%), Positives = 231/290 (80%), Gaps = 2/290 (1%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VL MPESPRWLVM+GRL DA+ VL KTSD+ EEA  RLADIK AAGIPE  D +VVTV K
Sbjct  264   VLGMPESPRWLVMKGRLADAKVVLEKTSDTAEEAAERLADIKAAAGIPEELDGDVVTVPK  323

Query  1101  K-RGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDT  925
             +  G+E  VW+EL +SPTPA+  IL++G+GIH FQQASGID+VVLY PR+F+ AGI  D 
Sbjct  324   RGSGNEKRVWKELILSPTPAMRRILLSGIGIHFFQQASGIDSVVLYSPRVFKSAGITDDK  383

Query  924   DKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVI-DHSHE  748
               L  T A+G TKT+FILVATF LD+ GRRPLLL+S GGM+ +L  LG  LTV+  H   
Sbjct  384   HLLGTTCAVGVTKTLFILVATFFLDRVGRRPLLLSSTGGMILSLIGLGAGLTVVGQHPDA  443

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+PWA+ ++IA TLAYVA FSIG GPITWVYSSEIFPL++RA GCSLG   NRVTSGV+S
Sbjct  444   KIPWAIGLSIASTLAYVAFFSIGLGPITWVYSSEIFPLQVRALGCSLGVAANRVTSGVIS  503

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
             MTF+SL KAI+IGGSFFLY+ IAA+ WVFF+T +PET+G+TLEE   LFG
Sbjct  504   MTFLSLSKAITIGGSFFLYSGIAALAWVFFYTYLPETRGRTLEEMSKLFG  553



>ref|XP_003540961.2| PREDICTED: polyol transporter 5-like [Glycine max]
Length=531

 Score =   391 bits (1004),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 200/318 (63%), Positives = 249/318 (78%), Gaps = 6/318 (2%)
 Frame = -3

Query  1290  GVSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVT  1111
             GV+VLAMPESPRWLV +GRLG+A+RVL K S+S EEA +RLADIK+ AGIP+ CDD+VV 
Sbjct  211   GVAVLAMPESPRWLVAKGRLGEAKRVLYKISESEEEARLRLADIKDTAGIPQDCDDDVVL  270

Query  1110  VTKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
             V+K+      VWRELF+ PTPAV HI I  +GIH F QA+GIDAVVLY PRIFEKAGIKS
Sbjct  271   VSKQTHGH-GVWRELFLHPTPAVRHIFIASLGIHFFAQATGIDAVVLYSPRIFEKAGIKS  329

Query  930   DTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH  751
             D  +LL T+A+GF KTV ILVATF LD+ GRR LLL SV G++ +L  LG+SLTV+DHS 
Sbjct  330   DNYRLLATVAVGFVKTVSILVATFFLDRAGRRVLLLCSVSGLILSLLTLGLSLTVVDHSQ  389

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
               + WAV ++IA  L+YVA FSIG+GPITWVYSSEIFPL+LRA G ++G  +NRVTSGV+
Sbjct  390   TTLNWAVGLSIAAVLSYVATFSIGSGPITWVYSSEIFPLRLRAQGVAIGAAVNRVTSGVI  449

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
             +MTF+SL KAI+IGG+FFL+A +AAV W+F +TL+PET+GKTLEE E  FG F R    +
Sbjct  450   AMTFLSLQKAITIGGAFFLFAGVAAVAWIFHYTLLPETRGKTLEEIEKSFGNFCRKPKAE  509

Query  390   REVDAKKANNNSQLQMGT  337
               +D     +N ++Q+ T
Sbjct  510   EGLD-----DNVEIQLKT  522



>ref|XP_002460923.1| hypothetical protein SORBIDRAFT_02g037570 [Sorghum bicolor]
 gb|EER97444.1| hypothetical protein SORBIDRAFT_02g037570 [Sorghum bicolor]
Length=510

 Score =   390 bits (1001),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 193/290 (67%), Positives = 230/290 (79%), Gaps = 2/290 (1%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VL MPESPRWLVM+GRL DA+ VL KTSD+PEEA  RLADIK AAGIP+  D +VV V K
Sbjct  197   VLGMPESPRWLVMKGRLADAKVVLGKTSDTPEEAAERLADIKAAAGIPQELDGDVVAVPK  256

Query  1101  KRGD-EDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDT  925
             K+   E  VW+EL +SPTPA+  IL++G+GIH FQQASGIDAVVLY PR+F+ AGI SD 
Sbjct  257   KQNSGEARVWKELILSPTPAMRRILLSGLGIHFFQQASGIDAVVLYSPRVFKAAGITSDN  316

Query  924   DKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-  748
               L  T A+G TKT+FILVATF LD+ GRRPLLL+SVGGM+ +L  L   LTVI+H  + 
Sbjct  317   QLLGTTCAVGVTKTLFILVATFLLDRVGRRPLLLSSVGGMIISLVGLAAGLTVIEHHPDG  376

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+PWA+ +AIA T+AYVA FSIG GPITWVYSSE+FPL +RA GC+LG   NRVTSGV+S
Sbjct  377   KIPWAIGVAIASTMAYVAFFSIGMGPITWVYSSEVFPLHVRALGCALGVASNRVTSGVIS  436

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
             MTFISL KAI+IGG+FFLYA +A + WVFFFT +PET+G+TLE    LFG
Sbjct  437   MTFISLTKAITIGGAFFLYAGVAVLAWVFFFTFLPETRGRTLEAMHKLFG  486



>ref|XP_004958137.1| PREDICTED: polyol transporter 5-like [Setaria italica]
Length=515

 Score =   390 bits (1001),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 193/290 (67%), Positives = 230/290 (79%), Gaps = 2/290 (1%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VL MPESPRWLVM+GRL DA+ VL KTSD+PEEA  RLADIK AAGIP   D +VVTV K
Sbjct  197   VLGMPESPRWLVMKGRLADAKVVLGKTSDTPEEAAERLADIKAAAGIPAELDGDVVTVPK  256

Query  1101  K-RGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDT  925
             + + +E  VW+EL +SPTPA+  IL++G+GIH FQQASGIDAVVLY PR+F+ AGI SD 
Sbjct  257   REKSEEARVWKELILSPTPAMRRILLSGIGIHFFQQASGIDAVVLYSPRVFKSAGITSDN  316

Query  924   DKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-  748
               L  T A+G TKT+FILVATF LDK GRRPLLL+SVGGM+ +L  L   LTVI H  + 
Sbjct  317   QVLGTTCAVGVTKTLFILVATFLLDKVGRRPLLLSSVGGMIFSLVGLATGLTVIGHYPDA  376

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+PWA+A++IA T+AYVA FSIG GPITWVYSSEIFPL++RA GC+LG   NRVTSGV+S
Sbjct  377   KIPWAIAVSIASTMAYVAFFSIGLGPITWVYSSEIFPLQVRAMGCALGVATNRVTSGVIS  436

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
             MTFISL  AI+IGG+FFLY  IA + WVFFF+ +PET+G+TLE    LFG
Sbjct  437   MTFISLSNAITIGGAFFLYGGIAVLAWVFFFSFLPETRGRTLESMSKLFG  486



>ref|XP_010254894.1| PREDICTED: polyol transporter 5-like [Nelumbo nucifera]
Length=504

 Score =   389 bits (998),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 191/295 (65%), Positives = 229/295 (78%), Gaps = 4/295 (1%)
 Frame = -3

Query  1284  SVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVT  1105
             +VL MPESPRWLVMQGRLG+ARR+LLKTSDS EEA MRLADIKE AGIPE C DEVV V 
Sbjct  206   AVLTMPESPRWLVMQGRLGEARRILLKTSDSKEEAEMRLADIKEMAGIPESCTDEVVVV-  264

Query  1104  KKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDT  925
             +KR   + VWREL + P+P V  +L+  VGIHLFQQASGIDAVVLY PRIFEKAGIK  +
Sbjct  265   EKRSHGEGVWRELLLRPSPTVRRVLVAAVGIHLFQQASGIDAVVLYSPRIFEKAGIKKKS  324

Query  924   DKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEK  745
               L  T+ +G +KT FILVATF LD+ GRRPLLL+SVGGM+ +L  L   LT+++HS EK
Sbjct  325   SLLGATVCVGISKTSFILVATFLLDRMGRRPLLLSSVGGMILSLLGLASGLTIVNHSEEK  384

Query  744   VPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSM  565
             V WA+A+ I   L +VA+FSIG GPI WVYSSEIFPL+LRA G SL  G+NR+ SG++  
Sbjct  385   VGWAIALCILTVLTFVASFSIGLGPIAWVYSSEIFPLRLRAQGGSLAAGVNRMMSGIIVT  444

Query  564   TFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR  400
             TF+SLYKAI+I GSFF++A IA V WVF +  +PET+G+TLEE E LF    +WR
Sbjct  445   TFLSLYKAITIEGSFFMFAGIATVTWVFIYVFLPETRGRTLEEMEVLFS---KWR  496



>gb|KHN25431.1| Polyol transporter 5 [Glycine soja]
Length=518

 Score =   389 bits (1000),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 199/318 (63%), Positives = 248/318 (78%), Gaps = 6/318 (2%)
 Frame = -3

Query  1290  GVSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVT  1111
             GV+VLAMPESPRWLV +GRLG+A+RVL K S+S EEA +RLADIK+ AGIP+ CDD+VV 
Sbjct  198   GVAVLAMPESPRWLVAKGRLGEAKRVLYKISESEEEARLRLADIKDTAGIPQDCDDDVVL  257

Query  1110  VTKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
             V+K+      VWRELF+ PTPAV HI I  +GIH F QA+GIDAVVLY PRIFEKAGIKS
Sbjct  258   VSKQTHGH-GVWRELFLHPTPAVRHIFIASLGIHFFAQATGIDAVVLYSPRIFEKAGIKS  316

Query  930   DTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH  751
             D  +LL T+A+GF KTV ILVATF LD+ GRR LLL SV G++ +L  LG+SLTV+DHS 
Sbjct  317   DNYRLLATVAVGFVKTVSILVATFFLDRAGRRVLLLCSVSGLILSLLTLGLSLTVVDHSQ  376

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
               + WAV ++IA  L+YVA FSIG+GPITWVYSSEIFPL+LRA G ++G  +NRVTSGV+
Sbjct  377   TTLNWAVGLSIAAVLSYVATFSIGSGPITWVYSSEIFPLRLRAQGVAIGAAVNRVTSGVI  436

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
             +MTF+SL  AI+IGG+FFL+A +AAV W+F +TL+PET+GKTLEE E  FG F R    +
Sbjct  437   AMTFLSLQNAITIGGAFFLFAGVAAVAWIFHYTLLPETRGKTLEEIEKSFGNFCRKPKAE  496

Query  390   REVDAKKANNNSQLQMGT  337
               +D     +N ++Q+ T
Sbjct  497   EGLD-----DNVEIQLKT  509



>ref|XP_007131852.1| hypothetical protein PHAVU_011G046800g [Phaseolus vulgaris]
 gb|ESW03846.1| hypothetical protein PHAVU_011G046800g [Phaseolus vulgaris]
Length=519

 Score =   388 bits (997),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 196/319 (61%), Positives = 251/319 (79%), Gaps = 2/319 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVM+GRLG+A++VL KTSD+ EEA  RLA+IKEAAGIPE+ + EVV V
Sbjct  200   VGVLAMPESPRWLVMRGRLGEAKKVLNKTSDTKEEAQQRLAEIKEAAGIPENEEGEVVEV  259

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +K R   + VW+ELF+  TPA+ H+L+  +GIH FQQASG+DAVVLY P IFEKAGI SD
Sbjct  260   SK-RNRGEGVWKELFLDSTPAIRHMLMATLGIHFFQQASGVDAVVLYSPTIFEKAGITSD  318

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             T KLL T+ +GF KT+FILVATF LD+ GRRPLLL+S GGM+ +L  L +SLTVI  S +
Sbjct  319   TYKLLATVGVGFVKTMFILVATFMLDRLGRRPLLLSSFGGMLLSLLTLAVSLTVIHESKK  378

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K  W + +++ M L+YVA+FSIGAGP+TWVYSSEIFPL+LRA G ++G  +NR TSGV+S
Sbjct  379   KPIWVIGLSMVMVLSYVASFSIGAGPVTWVYSSEIFPLRLRAQGMAVGVVVNRTTSGVLS  438

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             +TF+SL KAI+IGG+FFLY+AIAA GW+F +T++PET+GKTLEE +  FG F+   +  +
Sbjct  439   ITFLSLSKAITIGGAFFLYSAIAAFGWLFIYTVLPETRGKTLEEMDTSFGKFWVKSTTTK  498

Query  387   EVDAKKANNNSQLQMGTLQ  331
              V+ + A    QLQ GT+ 
Sbjct  499   PVNNRHA-QVPQLQQGTIH  516



>gb|AEX55225.1| sugar transporter [Allium sativum]
Length=522

 Score =   388 bits (996),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 190/315 (60%), Positives = 237/315 (75%), Gaps = 8/315 (3%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VL MPESPRWLVMQGRL DA++VL +TSDSPEEA  RLA+IKEAA I   C+++VV V
Sbjct  203   VGVLGMPESPRWLVMQGRLADAKKVLDRTSDSPEEAAARLAEIKEAAQISVECNEDVVDV  262

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+R   D VWREL + P+P VL ILIT VG+H FQQASGID+VVLY PR+F+KAGI S+
Sbjct  263   PKRR-KGDGVWRELLLHPSPGVLKILITAVGMHFFQQASGIDSVVLYSPRVFKKAGITSE  321

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSH  751
                L  T+A+GFTKT+FILVAT  LD+ GRRPLLLT   GM+ +LA LG  LTV+D H +
Sbjct  322   NALLGATVAVGFTKTIFILVATVLLDRVGRRPLLLTGTAGMILSLASLGFGLTVVDRHPN  381

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             E++ WA+ + IA  L YVA FSIG GPITWVY+SE+FPL+LRA G ++G  +NR TSGV+
Sbjct  382   ERLEWAIVVCIASILIYVAFFSIGLGPITWVYTSEVFPLRLRAQGAAIGVAVNRTTSGVL  441

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
             +MTFISLYKAI+IGG+FFLY  +A + W+FFFT +PET+GKTLEE E  FG       R 
Sbjct  442   TMTFISLYKAITIGGAFFLYGGVALIAWIFFFTYLPETRGKTLEEMEEFFGV------RG  495

Query  390   REVDAKKANNNSQLQ  346
             +++  +K     +L 
Sbjct  496   KDLTDRKQGAGVELS  510



>ref|XP_008795608.1| PREDICTED: putative polyol transporter 1 [Phoenix dactylifera]
Length=522

 Score =   388 bits (996),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 198/294 (67%), Positives = 237/294 (81%), Gaps = 4/294 (1%)
 Frame = -3

Query  1290  GVSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVT  1111
             GV VLAMPESPRWLVMQG+LG A++VL KTSD+PEEA  RL DIK+ AGIP  C+D+VV 
Sbjct  208   GVGVLAMPESPRWLVMQGQLGLAKKVLAKTSDTPEEAEERLLDIKKVAGIPADCNDDVVA  267

Query  1110  VTKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
             V K+   E  VW+ELF+ PTP+V  +LI+ +GIH FQQASGID+VVLY P++FEKAGI  
Sbjct  268   VQKQSHGE-GVWKELFLRPTPSVRRVLISAIGIHFFQQASGIDSVVLYSPKVFEKAGIH-  325

Query  930   DTDKLL-CTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS  754
             D D LL  T+A+GFTKT+FILVATF LD+ GRRPLLL+S GGM+ +LA LG+ LT++DH 
Sbjct  326   DKDTLLGATVAVGFTKTLFILVATFLLDRVGRRPLLLSSTGGMILSLAGLGLGLTIVDHH  385

Query  753   -HEKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSG  577
              +  +PWA+ + IA  LAYVA FSIG GPITWVYSSEIFPL+LRA G S G  +NRVTSG
Sbjct  386   PNGHLPWALGLCIASILAYVAFFSIGLGPITWVYSSEIFPLRLRAQGASAGVVVNRVTSG  445

Query  576   VVSMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGT  415
             V++MTFISLYKAI+IGGSFFLYA +AA  WVFFFT + ET+GKTLEE E LFG 
Sbjct  446   VITMTFISLYKAITIGGSFFLYAGVAAAAWVFFFTYLKETRGKTLEEMENLFGN  499



>ref|XP_009395604.1| PREDICTED: putative polyol transporter 1 [Musa acuminata subsp. 
malaccensis]
Length=561

 Score =   389 bits (999),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 198/314 (63%), Positives = 240/314 (76%), Gaps = 11/314 (4%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLVMQGRLG+A+RVL KTSD+PEEA +RLADIK AAGIPE C+D+VV  
Sbjct  248   VGVLAMPESPRWLVMQGRLGEAKRVLDKTSDTPEEAQLRLADIKAAAGIPEGCNDDVVPA  307

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              KK   E  VW+EL I PTP V  +L+T +GI+ FQQASGID+VVLY PR+FEKAGI   
Sbjct  308   PKKSHGE-GVWKELLIRPTPGVRRVLLTAIGINFFQQASGIDSVVLYSPRVFEKAGIHDK  366

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
                L  T+A+GFTKT+FILVATF +D+ GRRPLLL+S GGM+ +LA LG+ LT IDH  +
Sbjct  367   NKLLATTVAVGFTKTLFILVATFLVDRIGRRPLLLSSTGGMILSLAALGLGLTQIDHHPD  426

Query  747   -KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
              ++ WA+ + I   LAYVA FSIG GP+TWVY SEI PL+LRA G S+G  +NRVTSGV+
Sbjct  427   GQLRWAIGLCIVSILAYVAFFSIGLGPVTWVYCSEILPLRLRAQGASIGVAVNRVTSGVI  486

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
             +MTFISLYKAI+IGGSFFLY  IA   WVFFFT +PET+G+TLE+ E LFGT        
Sbjct  487   TMTFISLYKAITIGGSFFLYGGIALAAWVFFFTYLPETRGRTLEDMEELFGT--------  538

Query  390   REVDAKKANNNSQL  349
              + DA++A N  Q+
Sbjct  539   -KKDAEEAPNGVQM  551



>ref|XP_007131748.1| hypothetical protein PHAVU_011G038700g [Phaseolus vulgaris]
 gb|ESW03742.1| hypothetical protein PHAVU_011G038700g [Phaseolus vulgaris]
Length=495

 Score =   387 bits (993),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 189/314 (60%), Positives = 239/314 (76%), Gaps = 4/314 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V+VLAMPESPRWLV QGRLG+A+R+L K SDS EEA +RLADIK+ AGIP+ CDD+VV V
Sbjct  176   VAVLAMPESPRWLVAQGRLGEAKRILHKISDSEEEARLRLADIKDTAGIPQDCDDDVVLV  235

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             TK R     VW+ELF+ P+ AV HI I  +GIH F QA+GIDAVVLY PRIF+ AGIKSD
Sbjct  236   TK-RSHGQGVWKELFLHPSRAVCHIFIASLGIHFFAQATGIDAVVLYSPRIFQNAGIKSD  294

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
                LL T+A+GF KT  +LVATF LD+ GRR LLL SV G++ +L  LG+ LTV+ HS  
Sbjct  295   NYLLLATVAVGFVKTASVLVATFLLDRAGRRVLLLCSVSGLILSLVTLGVCLTVVGHSGS  354

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
              + WA+ ++IA  LAY + FSIG+GPITWVYSSEIFPL+LRA G ++G  +NRVTSGV+S
Sbjct  355   TLTWAIGLSIAAVLAYASTFSIGSGPITWVYSSEIFPLRLRAQGVAIGAVVNRVTSGVIS  414

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SL KAI+ GG+FFL+A +A   W+F +T++PET+GKTLEE E  FG F  WR+ + 
Sbjct  415   MTFLSLCKAITTGGAFFLFAGVAVAAWIFHYTMLPETRGKTLEEIEGSFGNF--WRNPKP  472

Query  387   EVDAKKANNNSQLQ  346
             +     AN ++QL+
Sbjct  473   K-GLHCANGDAQLR  485



>emb|CAD58710.1| polyol transporter [Plantago major]
Length=530

 Score =   387 bits (995),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 188/307 (61%), Positives = 232/307 (76%), Gaps = 2/307 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + V+ MPESPRWLV+QGRLGDARRVL KTSDS EE+ +RLADIKEAAGIPE C+D+ V V
Sbjct  218   IGVIYMPESPRWLVLQGRLGDARRVLDKTSDSLEESKLRLADIKEAAGIPEDCNDDFVQV  277

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              +K      VWREL + PT  VLHILI GVGIH FQQ  GID+VVLY PRI+++AGI   
Sbjct  278   -QKHSQGQGVWRELLLHPTKPVLHILICGVGIHFFQQGIGIDSVVLYSPRIYDRAGITDT  336

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             +DKLL TIA+G +KT FIL+ TF +D+FGRR LLL S  G+  ++  LG  LT+ID + +
Sbjct  337   SDKLLATIAVGISKTFFILITTFYVDRFGRRFLLLVSCAGVALSMFALGTVLTIIDRNPD  396

Query  747   -KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
              K    + + + +T+  V  FS+G GPI WVYSSEIFPLKLRA GC LG  +NR  SGV+
Sbjct  397   AKQTGVLVLVVLLTMVIVGFFSMGLGPIAWVYSSEIFPLKLRAQGCGLGVAMNRFMSGVI  456

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
              M+FISLYK I+IGGSFFL+  I  +GW+FFFTL PET+G+TLEE E LFGTFF+WR+  
Sbjct  457   LMSFISLYKEITIGGSFFLFGGITTLGWIFFFTLFPETRGRTLEEMEGLFGTFFKWRTTM  516

Query  390   REVDAKK  370
             +E+DAKK
Sbjct  517   KELDAKK  523



>ref|XP_004983901.1| PREDICTED: polyol transporter 5-like isoform X1 [Setaria italica]
Length=535

 Score =   387 bits (994),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 200/316 (63%), Positives = 239/316 (76%), Gaps = 6/316 (2%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEV-VTVT  1105
             VL MPESPRWLVM+GRL DAR VL KTSDSPEEA +RLADIK AAGIP   D +V V+VT
Sbjct  209   VLGMPESPRWLVMKGRLADARVVLDKTSDSPEEAALRLADIKAAAGIPADLDGDVDVSVT  268

Query  1104  KKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDT  925
             K+ G E  VW+EL +SP P V  +L++ +GIH FQQ+SGID+VVLY PR+F+ AGI +D 
Sbjct  269   KRTGGEVRVWKELILSPAPGVRRVLLSALGIHFFQQSSGIDSVVLYSPRVFQSAGI-ADK  327

Query  924   DKLL-CTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             +KLL  T A+G TKT+FILVATFTLD FGRRPLLLTS GGMV +L  LG+ LTVI H  E
Sbjct  328   NKLLGTTCAVGATKTLFILVATFTLDHFGRRPLLLTSTGGMVVSLVGLGLGLTVIGHHPE  387

Query  747   --KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGV  574
                +PWAV + IA  L  VA FSIG GPI WVYSSEIFPL LRA GC+LG G+NRVTSGV
Sbjct  388   GTTIPWAVGVCIASILGVVAFFSIGLGPIAWVYSSEIFPLHLRALGCALGVGLNRVTSGV  447

Query  573   VSMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGT-FFRWRS  397
             +SMTF+SL K I+IGGSFFLYA IA++ WVFFFT + ET+G+TLE+   LFG       S
Sbjct  448   ISMTFLSLSKGITIGGSFFLYAGIASLAWVFFFTYLKETRGRTLEQMGELFGIPNMAGDS  507

Query  396   RQREVDAKKANNNSQL  349
              Q++   +K  NN ++
Sbjct  508   YQQQQSPEKERNNVEM  523



>ref|XP_010527594.1| PREDICTED: polyol transporter 5-like isoform X4 [Tarenaya hassleriana]
Length=526

 Score =   385 bits (990),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 188/324 (58%), Positives = 237/324 (73%), Gaps = 9/324 (3%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + V AMPESPRWLVMQGRLGDA+RVL +TSDS  EA +RLADIK  AGIP+ C+D++V V
Sbjct  201   IGVFAMPESPRWLVMQGRLGDAKRVLYRTSDSNSEADLRLADIKFVAGIPQDCNDDIVQV  260

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+      VW+EL + PTPAV  +L+   GIH FQQASGIDAVVLY PRIF+ AG+ SD
Sbjct  261   EKRNSHGKGVWKELLVRPTPAVRRVLVAAFGIHFFQQASGIDAVVLYSPRIFKTAGLNSD  320

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-H  751
               +LL T+AIG  KT  ILV+TF LD+ GRRPLLL+SVGGMV +L  L MSLTVIDH   
Sbjct  321   KQQLLATVAIGTVKTTSILVSTFLLDRIGRRPLLLSSVGGMVISLLTLAMSLTVIDHRPD  380

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             +K+ WA+ +++A  + YVA FS G GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+
Sbjct  381   KKMIWALGLSLATAITYVATFSTGLGPITWVYSSEIFPLRLRAQGMSMGLIVNRVTSGVI  440

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
             +MTF+SL KAI+ GG+FFL+  +A   W+FF+T +PET+GK LEE + LF   FRWR   
Sbjct  441   AMTFLSLTKAITTGGAFFLFGGLAMAAWMFFYTFLPETKGKMLEEMDELFDN-FRWR---  496

Query  390   REVDAKKANNNSQLQMGTLQAANK  319
                   K   + +++M T ++  K
Sbjct  497   ----GSKTKEHMEVEMTTERSPEK  516



>ref|XP_009396401.1| PREDICTED: polyol transporter 5-like [Musa acuminata subsp. malaccensis]
Length=513

 Score =   384 bits (986),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 197/313 (63%), Positives = 237/313 (76%), Gaps = 2/313 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDARRVL  TSD+PEEA +RL DIK AAGIPE C+D+VV  
Sbjct  200   LGVLAMPESPRWLVMQGRLGDARRVLDMTSDTPEEAQLRLDDIKAAAGIPEGCNDDVVPA  259

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              KK      VWREL + PTPAV  +L+T VGIH FQQASGID+VVLY PR+F+KAGI   
Sbjct  260   PKKN-QGGRVWRELLLRPTPAVRRVLLTAVGIHFFQQASGIDSVVLYSPRVFQKAGIHDK  318

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
                L  T+A+G TKT+FILVATF LD+ GRRPLLL+S GGM+ +LA LG+ LT+IDH  +
Sbjct  319   NKLLGTTVAVGVTKTLFILVATFLLDRIGRRPLLLSSTGGMILSLAGLGLGLTLIDHHPD  378

Query  747   -KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
              ++ WAV + IA  L YVA FSIG GPITWVYSSEI PL+LRA G S+   +NRVTSGV+
Sbjct  379   GQLRWAVGLCIASILGYVAFFSIGLGPITWVYSSEILPLRLRAQGASIAVAVNRVTSGVI  438

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
             +MTFISLYKAI+IGGSFFLY  IAA+ WVFFF  +PET+G+TLE+ E LFGT    +   
Sbjct  439   TMTFISLYKAITIGGSFFLYGGIAALAWVFFFACLPETRGRTLEDMEDLFGTRNDTKETT  498

Query  390   REVDAKKANNNSQ  352
               V+   A+  ++
Sbjct  499   NGVEMANASQGNE  511



>ref|XP_010527591.1| PREDICTED: polyol transporter 5-like isoform X1 [Tarenaya hassleriana]
Length=537

 Score =   384 bits (987),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 186/303 (61%), Positives = 231/303 (76%), Gaps = 3/303 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + V AMPESPRWLVMQGRLGDA+RVL +TSDS  EA +RLADIK  AGIP+ C+D++V V
Sbjct  201   IGVFAMPESPRWLVMQGRLGDAKRVLYRTSDSNSEADLRLADIKFVAGIPQDCNDDIVQV  260

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+      VW+EL + PTPAV  +L+   GIH FQQASGIDAVVLY PRIF+ AG+ SD
Sbjct  261   EKRNSHGKGVWKELLVRPTPAVRRVLVAAFGIHFFQQASGIDAVVLYSPRIFKTAGLNSD  320

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-H  751
               +LL T+AIG  KT  ILV+TF LD+ GRRPLLL+SVGGMV +L  L MSLTVIDH   
Sbjct  321   KQQLLATVAIGTVKTTSILVSTFLLDRIGRRPLLLSSVGGMVISLLTLAMSLTVIDHRPD  380

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             +K+ WA+ +++A  + YVA FS G GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+
Sbjct  381   KKMIWALGLSLATAITYVATFSTGLGPITWVYSSEIFPLRLRAQGMSMGLIVNRVTSGVI  440

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR-SR  394
             +MTF+SL KAI+ GG+FFL+  +A   W+FF+T +PET+GK LEE + LF   FRWR S+
Sbjct  441   AMTFLSLTKAITTGGAFFLFGGLAMAAWMFFYTFLPETKGKMLEEMDELFDN-FRWRGSK  499

Query  393   QRE  385
              +E
Sbjct  500   TKE  502



>ref|XP_010527593.1| PREDICTED: polyol transporter 5-like isoform X3 [Tarenaya hassleriana]
Length=528

 Score =   384 bits (986),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 186/303 (61%), Positives = 231/303 (76%), Gaps = 3/303 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + V AMPESPRWLVMQGRLGDA+RVL +TSDS  EA +RLADIK  AGIP+ C+D++V V
Sbjct  201   IGVFAMPESPRWLVMQGRLGDAKRVLYRTSDSNSEADLRLADIKFVAGIPQDCNDDIVQV  260

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+      VW+EL + PTPAV  +L+   GIH FQQASGIDAVVLY PRIF+ AG+ SD
Sbjct  261   EKRNSHGKGVWKELLVRPTPAVRRVLVAAFGIHFFQQASGIDAVVLYSPRIFKTAGLNSD  320

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-H  751
               +LL T+AIG  KT  ILV+TF LD+ GRRPLLL+SVGGMV +L  L MSLTVIDH   
Sbjct  321   KQQLLATVAIGTVKTTSILVSTFLLDRIGRRPLLLSSVGGMVISLLTLAMSLTVIDHRPD  380

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             +K+ WA+ +++A  + YVA FS G GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+
Sbjct  381   KKMIWALGLSLATAITYVATFSTGLGPITWVYSSEIFPLRLRAQGMSMGLIVNRVTSGVI  440

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR-SR  394
             +MTF+SL KAI+ GG+FFL+  +A   W+FF+T +PET+GK LEE + LF   FRWR S+
Sbjct  441   AMTFLSLTKAITTGGAFFLFGGLAMAAWMFFYTFLPETKGKMLEEMDELFDN-FRWRGSK  499

Query  393   QRE  385
              +E
Sbjct  500   TKE  502



>ref|XP_010527592.1| PREDICTED: polyol transporter 5-like isoform X2 [Tarenaya hassleriana]
Length=532

 Score =   384 bits (985),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 186/303 (61%), Positives = 231/303 (76%), Gaps = 3/303 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + V AMPESPRWLVMQGRLGDA+RVL +TSDS  EA +RLADIK  AGIP+ C+D++V V
Sbjct  201   IGVFAMPESPRWLVMQGRLGDAKRVLYRTSDSNSEADLRLADIKFVAGIPQDCNDDIVQV  260

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+      VW+EL + PTPAV  +L+   GIH FQQASGIDAVVLY PRIF+ AG+ SD
Sbjct  261   EKRNSHGKGVWKELLVRPTPAVRRVLVAAFGIHFFQQASGIDAVVLYSPRIFKTAGLNSD  320

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-H  751
               +LL T+AIG  KT  ILV+TF LD+ GRRPLLL+SVGGMV +L  L MSLTVIDH   
Sbjct  321   KQQLLATVAIGTVKTTSILVSTFLLDRIGRRPLLLSSVGGMVISLLTLAMSLTVIDHRPD  380

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             +K+ WA+ +++A  + YVA FS G GPITWVYSSEIFPL+LRA G S+G  +NRVTSGV+
Sbjct  381   KKMIWALGLSLATAITYVATFSTGLGPITWVYSSEIFPLRLRAQGMSMGLIVNRVTSGVI  440

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR-SR  394
             +MTF+SL KAI+ GG+FFL+  +A   W+FF+T +PET+GK LEE + LF   FRWR S+
Sbjct  441   AMTFLSLTKAITTGGAFFLFGGLAMAAWMFFYTFLPETKGKMLEEMDELFDN-FRWRGSK  499

Query  393   QRE  385
              +E
Sbjct  500   TKE  502



>ref|NP_001045505.2| Os01g0966900 [Oryza sativa Japonica Group]
 dbj|BAD88259.1| putative sorbitol transporter [Oryza sativa Japonica Group]
 gb|EAZ14958.1| hypothetical protein OsJ_04892 [Oryza sativa Japonica Group]
 dbj|BAF07419.2| Os01g0966900 [Oryza sativa Japonica Group]
Length=479

 Score =   380 bits (975),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 189/288 (66%), Positives = 229/288 (80%), Gaps = 2/288 (1%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VLAMPESPRWLVM+GRL DA+ VL +TSD+ EEA  RLA+IKEA  IP   D +VV V K
Sbjct  145   VLAMPESPRWLVMKGRLADAKVVLGETSDTAEEAATRLAEIKEAVAIPADLDGDVVAVPK  204

Query  1101  KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTD  922
             + G E  VW+EL +SPTPAV  +L++ +GIH FQQ+SGIDAVVLY PR+F+ AGI +D +
Sbjct  205   RAGGERRVWKELILSPTPAVRRVLLSALGIHFFQQSSGIDAVVLYSPRVFQSAGI-TDKN  263

Query  921   KLL-CTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEK  745
             KLL  T A+G TKT+FILVATFTLD+FGRRPLLL S GGM+ TL  LG+ LTVI      
Sbjct  264   KLLGTTCAVGVTKTLFILVATFTLDRFGRRPLLLASAGGMIATLVTLGLGLTVIGEDATG  323

Query  744   VPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSM  565
               WA+A++IA  LA+VA FSIG GPITWVYSSEIFPL LRA GC+LG G+NRVTSGV+SM
Sbjct  324   GGWAIAVSIASILAFVAFFSIGLGPITWVYSSEIFPLHLRALGCALGVGLNRVTSGVISM  383

Query  564   TFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALF  421
             TF+SL KAI+IGGSFFLYA +A++ W+FFFT +PET+G+TLE+   LF
Sbjct  384   TFLSLSKAITIGGSFFLYAGVASLAWLFFFTYLPETRGRTLEQMGELF  431



>ref|XP_009407903.1| PREDICTED: polyol transporter 5-like [Musa acuminata subsp. malaccensis]
Length=507

 Score =   380 bits (976),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 186/302 (62%), Positives = 228/302 (75%), Gaps = 2/302 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLG+A+ +L KTSD+P EA +RL++IKEAAGIPE C DEVV V
Sbjct  187   LGVLAMPESPRWLVMQGRLGEAKAILAKTSDTPAEAELRLSEIKEAAGIPEGCTDEVVPV  246

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               +R   + VW+EL I+PTP V   L+  +G+  FQQASGID+VVLYGP IFEKAG+K  
Sbjct  247   -PERSHGEGVWKELLITPTPPVRRTLLAALGLQFFQQASGIDSVVLYGPTIFEKAGLKGK  305

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDH-SH  751
             T++L  T+A+GFTKT FILVATF LD+ GRRPLLL+S  GM+ +L  L   L  IDH   
Sbjct  306   TERLGATVAVGFTKTSFILVATFLLDRVGRRPLLLSSAAGMIASLITLASVLLTIDHHPG  365

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             EK+ WAVA+ IA  L +V +FSIG GPI WVYSSEIFPL+LRA G SLG  +NR+ SG V
Sbjct  366   EKLTWAVALCIATVLTFVGSFSIGLGPIAWVYSSEIFPLRLRAQGASLGASMNRLMSGAV  425

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
             +M+F+SLYKAISI GSF+LYA IAA GWVFF+  +PET+G+ LEE E LFG   +   + 
Sbjct  426   TMSFLSLYKAISISGSFYLYAGIAAAGWVFFYVFLPETRGRNLEEMEELFGKASKSSEKA  485

Query  390   RE  385
              E
Sbjct  486   EE  487



>dbj|BAJ85302.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=546

 Score =   381 bits (979),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 191/316 (60%), Positives = 235/316 (74%), Gaps = 4/316 (1%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VL MPESPRWLVM+GRL DA+ VL KTSD+PEEA  RLADIK AAGIP   D +VVTV K
Sbjct  228   VLGMPESPRWLVMKGRLADAKVVLAKTSDTPEEAAERLADIKTAAGIPLDLDGDVVTVPK  287

Query  1101  KRG--DEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              +G  +E  VW++L +SPT A+ HILI G+GIH FQQ+SGIDAVVLY PR+F+ A I  D
Sbjct  288   NKGSSEEKRVWKDLILSPTSAMRHILIAGIGIHFFQQSSGIDAVVLYSPRVFKSADITGD  347

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSH  751
                L  T+A+G TKTVFILVATF LD+ GRRPLLLTS GGM+ +L  L   LTV+  H  
Sbjct  348   NRLLGTTVAVGATKTVFILVATFLLDRIGRRPLLLTSTGGMIVSLVGLATGLTVVSRHPD  407

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             EK+ WA+ + I   +AYVA FSIG GPITWVYSSEIFPL +RA GCSLG  +NR+TSGV+
Sbjct  408   EKITWAIVLCIFCIMAYVAFFSIGLGPITWVYSSEIFPLHVRALGCSLGVAVNRLTSGVI  467

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
             SMTFISL KA++IGG+FFL+A IA+  WVFFF  +PET+G+TLE+  +LFG+    +   
Sbjct  468   SMTFISLSKAMTIGGAFFLFAGIASFAWVFFFAYLPETRGRTLEDMSSLFGSTATRKQGA  527

Query  390   REVDAKKANNNSQLQM  343
              E D   A  + +++M
Sbjct  528   TEAD-DDAGKDKKVEM  542



>gb|EMT15230.1| Polyol transporter 5 [Aegilops tauschii]
Length=524

 Score =   380 bits (977),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 191/316 (60%), Positives = 233/316 (74%), Gaps = 4/316 (1%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VL MPESPRWLVM+GRL DA+ VL KTSD+PEEA  RLADIK AAGIP   D +VV V K
Sbjct  206   VLGMPESPRWLVMKGRLADAKVVLAKTSDTPEEAAERLADIKTAAGIPLDLDGDVVAVPK  265

Query  1101  KRG--DEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              +G  +E  VW++L +SPT A+ HILI G+GIH FQQ+SGIDAVVLY PR+F+ AGI  D
Sbjct  266   NKGSSEEKRVWKDLILSPTKAMRHILIAGIGIHFFQQSSGIDAVVLYSPRVFKSAGITGD  325

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSH  751
                L  T+A+G TKTVFILVATF LD+ GRRPLLL+S GGM+ +L  L   LTVI  H  
Sbjct  326   NRLLGTTVAVGATKTVFILVATFLLDRIGRRPLLLSSTGGMIVSLVGLATGLTVISRHPD  385

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             EK+ WA+ + I   +AYVA FSIG GPITWVYSSEIFPL +RA GCSLG  +NR+TSGV+
Sbjct  386   EKITWAIVLCIFCIMAYVAFFSIGLGPITWVYSSEIFPLHVRALGCSLGVAVNRLTSGVI  445

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
             SMTFISL KA++IGG+FFL+A IA+  WVFFF  +PET+G+TLE+  +LFG     +   
Sbjct  446   SMTFISLSKAMTIGGAFFLFAGIASFAWVFFFAYLPETRGRTLEDMSSLFGNTATHKQGA  505

Query  390   REVDAKKANNNSQLQM  343
              E D   A    +++M
Sbjct  506   AEAD-DDAGKEKKVEM  520



>gb|EYU42629.1| hypothetical protein MIMGU_mgv1a0059092mg, partial [Erythranthe 
guttata]
Length=275

 Score =   371 bits (953),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 175/266 (66%), Positives = 214/266 (80%), Gaps = 1/266 (0%)
 Frame = -3

Query  1140  PEHCDDEVVTVTKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGP  961
             PEHCD++VV V+KK      VWR+L + PTPAV HILI  VGIH FQQASGID+VVLY P
Sbjct  4     PEHCDEDVVAVSKK-SQGGGVWRDLLLHPTPAVRHILICAVGIHFFQQASGIDSVVLYSP  62

Query  960   RIFEKAGIKSDTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLG  781
              IFEKAGI   TDKLL T+A+GFTKT+FILVATF LDK GRRPLLL+SV GM+ +L  L 
Sbjct  63    EIFEKAGIAKTTDKLLATMAVGFTKTLFILVATFLLDKIGRRPLLLSSVAGMIVSLLGLA  122

Query  780   MSLTVIDHSHEKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGT  601
             + LTVI+H+  K+ WA+A+ I  TL+YV+ FSIG GPITWVYSSEIFPL+LRA GC++G 
Sbjct  123   IGLTVIEHAEHKLIWAIALCIGSTLSYVSFFSIGMGPITWVYSSEIFPLRLRAQGCAMGV  182

Query  600   GINRVTSGVVSMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALF  421
              +NRVTSGV+SMTF+SL +AI+IGG+FFLYA +AA+  VFF+TL PETQGKTLEE E+LF
Sbjct  183   ALNRVTSGVISMTFLSLNRAITIGGAFFLYAGVAAIALVFFYTLYPETQGKTLEEMESLF  242

Query  420   GTFFRWRSRQREVDAKKANNNSQLQM  343
             GTF +WRS  R ++ KK+  N Q+Q+
Sbjct  243   GTFSKWRSTLRTLNEKKSEKNGQIQL  268



>gb|EAY88906.1| hypothetical protein OsI_10385 [Oryza sativa Indica Group]
Length=521

 Score =   380 bits (975),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 190/295 (64%), Positives = 225/295 (76%), Gaps = 5/295 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDE---V  1117
             V VLAMPESPRWLVMQGR+GDARRVL KTSDSP EA  RLADIK A GIPE   DE   V
Sbjct  199   VGVLAMPESPRWLVMQGRIGDARRVLEKTSDSPAEAEERLADIKNAVGIPEGISDEDEVV  258

Query  1116  VTVTKKRGDE-DSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAG  940
               V K RG   + VWR+L + PTPAV  ILI  +G+  FQQASGIDAVVLY PR+F+ AG
Sbjct  259   AVVHKSRGSHGEGVWRDLLLRPTPAVRRILIACLGLQFFQQASGIDAVVLYSPRVFDNAG  318

Query  939   IKSDTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID  760
             + SD+D +  ++A+G +KT+FILVATF LD+ GRRPLLLTS GGMV +L  L  +L +I+
Sbjct  319   LHSDSDSIGASVAVGASKTLFILVATFLLDRVGRRPLLLTSAGGMVISLVTLASALHMIE  378

Query  759   HSHEKVPWA-VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVT  583
             H  E    A V ++IAM L +VA+FSIG GPI WVYSSEIFPL+LRA GC+LGT +NRV 
Sbjct  379   HRSEGQATALVGLSIAMVLVFVASFSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRVV  438

Query  582   SGVVSMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
             SG VSM+FISLYKAI+  GSF+LYA IAA GWVF F  +PETQG++LE+T  LFG
Sbjct  439   SGAVSMSFISLYKAITFAGSFYLYAGIAAAGWVFMFFFLPETQGRSLEDTVKLFG  493



>gb|EEE58504.1| hypothetical protein OsJ_09775 [Oryza sativa Japonica Group]
Length=521

 Score =   379 bits (973),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 190/295 (64%), Positives = 225/295 (76%), Gaps = 5/295 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDE---V  1117
             V VLAMPESPRWLVMQGR+GDARRVL KTSDSP EA  RLADIK A GIPE   DE   V
Sbjct  199   VGVLAMPESPRWLVMQGRIGDARRVLEKTSDSPAEAEERLADIKNAVGIPEGISDEDEVV  258

Query  1116  VTVTKKRGDE-DSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAG  940
               V K RG   + VWR+L + PTPAV  ILI  +G+  FQQASGIDAVVLY PR+F+ AG
Sbjct  259   AVVHKSRGSHGEGVWRDLLLRPTPAVRRILIACLGLQFFQQASGIDAVVLYSPRVFDNAG  318

Query  939   IKSDTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID  760
             + SD+D +  ++A+G +KT+FILVATF LD+ GRRPLLLTS GGMV +L  L  +L +I+
Sbjct  319   LHSDSDSIGASVAVGASKTLFILVATFLLDRVGRRPLLLTSAGGMVISLVTLASALHMIE  378

Query  759   HSHEKVPWA-VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVT  583
             H  E    A V ++IAM L +VA+FSIG GPI WVYSSEIFPL+LRA GC+LGT +NRV 
Sbjct  379   HRPEGQATALVGLSIAMVLVFVASFSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRVV  438

Query  582   SGVVSMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
             SG VSM+FISLYKAI+  GSF+LYA IAA GWVF F  +PETQG++LE+T  LFG
Sbjct  439   SGAVSMSFISLYKAITFAGSFYLYAGIAAAGWVFMFFFLPETQGRSLEDTVKLFG  493



>gb|EMS55536.1| Polyol transporter 5 [Triticum urartu]
Length=515

 Score =   378 bits (971),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 186/291 (64%), Positives = 225/291 (77%), Gaps = 3/291 (1%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VL MPESPRWLVM+GRL DA+ VL KTSD+PEEA  RLADIK AAGIP   D +VV V K
Sbjct  197   VLGMPESPRWLVMKGRLADAKVVLAKTSDTPEEAAERLADIKTAAGIPLDLDGDVVAVPK  256

Query  1101  KRG--DEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              +G  +E  VW++L +SPT A+ HILI G+GIH FQQ+SGIDAVVLY PR+F+ AGI  D
Sbjct  257   NKGSSEEKRVWKDLILSPTKAMRHILIAGIGIHFFQQSSGIDAVVLYSPRVFKSAGITGD  316

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSH  751
                L  T+A+G TKTVFILVATF LD+ GRRPLLL+S GGM+ +L  L   LTVI  H  
Sbjct  317   NRLLGTTVAVGATKTVFILVATFLLDRIGRRPLLLSSTGGMIVSLVGLATGLTVISRHPD  376

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             EK+ WA+ + I   +AYVA FSIG GP+TWVYSSEIFPL +RA GCSLG  +NR+TSGV+
Sbjct  377   EKITWAIVLCIFCIMAYVAFFSIGLGPVTWVYSSEIFPLHVRALGCSLGVAVNRLTSGVI  436

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
             SMTFISL KA++IGG+FFL+A IA+  WVFFF  +PET+G+TLE+  +LFG
Sbjct  437   SMTFISLSKAMTIGGAFFLFAGIASFAWVFFFAYLPETRGRTLEDMSSLFG  487



>gb|ABF94465.1| Sugar transporter family protein, expressed [Oryza sativa Japonica 
Group]
Length=553

 Score =   378 bits (971),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 190/295 (64%), Positives = 225/295 (76%), Gaps = 5/295 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDE---V  1117
             V VLAMPESPRWLVMQGR+GDARRVL KTSDSP EA  RLADIK A GIPE   DE   V
Sbjct  231   VGVLAMPESPRWLVMQGRIGDARRVLEKTSDSPAEAEERLADIKNAVGIPEGISDEDEVV  290

Query  1116  VTVTKKRGDE-DSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAG  940
               V K RG   + VWR+L + PTPAV  ILI  +G+  FQQASGIDAVVLY PR+F+ AG
Sbjct  291   AVVHKSRGSHGEGVWRDLLLRPTPAVRRILIACLGLQFFQQASGIDAVVLYSPRVFDNAG  350

Query  939   IKSDTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID  760
             + SD+D +  ++A+G +KT+FILVATF LD+ GRRPLLLTS GGMV +L  L  +L +I+
Sbjct  351   LHSDSDSIGASVAVGASKTLFILVATFLLDRVGRRPLLLTSAGGMVISLVTLASALHMIE  410

Query  759   HSHEKVPWA-VAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVT  583
             H  E    A V ++IAM L +VA+FSIG GPI WVYSSEIFPL+LRA GC+LGT +NRV 
Sbjct  411   HRPEGQATALVGLSIAMVLVFVASFSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRVV  470

Query  582   SGVVSMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
             SG VSM+FISLYKAI+  GSF+LYA IAA GWVF F  +PETQG++LE+T  LFG
Sbjct  471   SGAVSMSFISLYKAITFAGSFYLYAGIAAAGWVFMFFFLPETQGRSLEDTVKLFG  525



>ref|XP_008795604.1| PREDICTED: putative polyol transporter 1 [Phoenix dactylifera]
Length=522

 Score =   377 bits (968),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 199/294 (68%), Positives = 233/294 (79%), Gaps = 4/294 (1%)
 Frame = -3

Query  1290  GVSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVT  1111
             GV VLAMPESPRWLVMQG+L  A++VL KTSDSPEEA  RL DIK  AGIP  C D+VV 
Sbjct  208   GVGVLAMPESPRWLVMQGQLRLAKKVLFKTSDSPEEAEERLLDIKNVAGIPADCRDDVVA  267

Query  1110  VTKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
             V K+   E  VW+EL + PTP+V  +LI+ +GIH FQQASGID+VVLY PR+F+KAGI  
Sbjct  268   VQKQSHGE-GVWKELLLRPTPSVRRVLISAIGIHFFQQASGIDSVVLYSPRVFKKAGIH-  325

Query  930   DTDKLL-CTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-H  757
             D D LL  T+A+GFTKT+FILVATF LD+ GRRPLLL+S GGM+ +LA LG+ LTV+D H
Sbjct  326   DKDALLGTTVAVGFTKTLFILVATFQLDRVGRRPLLLSSTGGMIVSLAGLGLGLTVVDRH  385

Query  756   SHEKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSG  577
                ++PWAV + IA  LAYVA FSIG GPIT VY SEIFPL+LRA G S+G  +NRVTSG
Sbjct  386   PDGQLPWAVGLCIASILAYVAFFSIGLGPITSVYCSEIFPLRLRAQGVSVGVVVNRVTSG  445

Query  576   VVSMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGT  415
             V++MTFISLYKAI+IGGSFFLYA IAAV WVFFFT + ET+GKTLEE E LFG 
Sbjct  446   VITMTFISLYKAITIGGSFFLYAGIAAVAWVFFFTYLKETRGKTLEEMENLFGN  499



>ref|XP_010905473.1| PREDICTED: putative polyol transporter 1 [Elaeis guineensis]
Length=523

 Score =   376 bits (965),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 194/294 (66%), Positives = 238/294 (81%), Gaps = 4/294 (1%)
 Frame = -3

Query  1290  GVSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVT  1111
             G+ VLAMPESPRWLVM+G+L  A++VL KTSD+PEEA  RL DIK  AGIP  C+D+VV 
Sbjct  208   GIGVLAMPESPRWLVMRGKLAAAKKVLAKTSDTPEEAEERLLDIKNVAGIPADCNDDVVA  267

Query  1110  VTKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
             V +K+     VW+ELF+ PTP+V  +LI+ +GIH FQQASGID+VVLY PR+F+KAGI  
Sbjct  268   V-QKQSHGKGVWKELFLRPTPSVRRVLISAMGIHFFQQASGIDSVVLYSPRVFQKAGIY-  325

Query  930   DTDKLL-CTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS  754
             D DKLL  T+A+GFTKT+FILVATF LD+ GRRPLLL+S GGM+ +LA LG+ LT+IDH 
Sbjct  326   DKDKLLGTTVAVGFTKTLFILVATFLLDRVGRRPLLLSSQGGMIVSLAGLGLGLTIIDHH  385

Query  753   -HEKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSG  577
              + ++PWA+ + IA  LA+VA FSIG GP+  VY SEIFPL+LRA G S+G  +NRVTSG
Sbjct  386   PNGQLPWAIGLCIASILAFVAFFSIGMGPMPSVYCSEIFPLRLRAQGVSVGVVVNRVTSG  445

Query  576   VVSMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGT  415
             V++MTF+SLYKAI+IGGSFFLYA IAAVGWVFFFT + ET+GKTLEE E LFGT
Sbjct  446   VITMTFLSLYKAITIGGSFFLYAGIAAVGWVFFFTYLKETRGKTLEEMENLFGT  499



>ref|XP_006856084.1| PREDICTED: polyol transporter 5 [Amborella trichopoda]
 gb|ERN17551.1| hypothetical protein AMTR_s00059p00122840 [Amborella trichopoda]
Length=518

 Score =   375 bits (963),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 189/290 (65%), Positives = 231/290 (80%), Gaps = 1/290 (0%)
 Frame = -3

Query  1290  GVSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVT  1111
             GV+VLAMPESPRWLV+QG+LG A++VLLKTSD+PEEA +RL+DIK AAGIPE  DDE+V+
Sbjct  198   GVAVLAMPESPRWLVLQGKLGAAKKVLLKTSDTPEEALLRLSDIKLAAGIPETADDEIVS  257

Query  1110  VTKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
             V K    E  VW+EL + PTPAV  I+I  VGIH FQQASGIDAVVLY PR+F+KAGI  
Sbjct  258   VPKHHHGE-GVWKELLLRPTPAVRRIMIAAVGIHFFQQASGIDAVVLYSPRVFKKAGITD  316

Query  930   DTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH  751
             ++  L  T+A+GFTKT+ IL+ATF LDK GRRPLLLTSVGGM+ +L  LG  LT+I +S 
Sbjct  317   NSQLLGATVAVGFTKTITILIATFMLDKVGRRPLLLTSVGGMIISLCGLGFGLTMITNSD  376

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             EK+ WA+A+ IA  L +V  FSIG GPITWVYSSEIFPL+LRA G S+   +NRV SGV+
Sbjct  377   EKLVWAIAICIATVLLFVTFFSIGMGPITWVYSSEIFPLRLRAQGASIAVAVNRVVSGVL  436

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALF  421
             +M+FISLYKAI+IGGSFFL+A IA+V + FFF  +PET+G+ LEE   LF
Sbjct  437   TMSFISLYKAITIGGSFFLFAGIASVAFCFFFFFLPETKGRNLEEIIELF  486



>ref|XP_002463086.1| hypothetical protein SORBIDRAFT_02g037590 [Sorghum bicolor]
 gb|EER99607.1| hypothetical protein SORBIDRAFT_02g037590 [Sorghum bicolor]
Length=505

 Score =   373 bits (958),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 187/290 (64%), Positives = 225/290 (78%), Gaps = 2/290 (1%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             V  MPESPRWLVM+GRL DAR VL KTS++PEEA  RLADIK AAGIP   D +VV++ K
Sbjct  192   VFVMPESPRWLVMKGRLADARAVLEKTSETPEEAAERLADIKAAAGIPMDLDGDVVSLPK  251

Query  1101  KR-GDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDT  925
             +R G E  VWREL +SPTPA+  IL++ VG+H FQQASGID+VVLY PR+F+ AGI  D 
Sbjct  252   ERNGGEKQVWRELILSPTPAIRRILLSAVGLHFFQQASGIDSVVLYSPRVFKSAGITDDN  311

Query  924   DKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-  748
               L  T A+G TKT+FILVATF LD+ GRRPLLLTS GGM+ +L  LG  LTV+ H  + 
Sbjct  312   KLLGTTCAVGVTKTLFILVATFLLDRAGRRPLLLTSTGGMIVSLVGLGTGLTVVGHHPDA  371

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+PWAVA+ I   LAYV+ FSIG GPI  VY+SEIFPL++RA G ++G   NRVTSGV+S
Sbjct  372   KIPWAVALCILSVLAYVSFFSIGLGPIAGVYTSEIFPLRVRALGFAVGVASNRVTSGVIS  431

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
             MTF+SL KAI+IGGSFFLY+ IAA+ WVFFFT +PET+G+TLEE   LFG
Sbjct  432   MTFLSLSKAITIGGSFFLYSGIAALAWVFFFTYLPETRGRTLEEMGKLFG  481



>ref|XP_004983902.1| PREDICTED: polyol transporter 5-like isoform X2 [Setaria italica]
Length=523

 Score =   372 bits (956),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 194/315 (62%), Positives = 231/315 (73%), Gaps = 16/315 (5%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VL MPESPRWLVM+GRL DAR VL KTSDSPEEA +RLADIK AAGIP   D +V     
Sbjct  209   VLGMPESPRWLVMKGRLADARVVLDKTSDSPEEAALRLADIKAAAGIPADLDGDV-----  263

Query  1101  KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTD  922
                    VW+EL +SP P V  +L++ +GIH FQQ+SGID+VVLY PR+F+ AGI +D +
Sbjct  264   ------RVWKELILSPAPGVRRVLLSALGIHFFQQSSGIDSVVLYSPRVFQSAGI-ADKN  316

Query  921   KLL-CTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-  748
             KLL  T A+G TKT+FILVATFTLD FGRRPLLLTS GGMV +L  LG+ LTVI H  E 
Sbjct  317   KLLGTTCAVGATKTLFILVATFTLDHFGRRPLLLTSTGGMVVSLVGLGLGLTVIGHHPEG  376

Query  747   -KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
               +PWAV + IA  L  VA FSIG GPI WVYSSEIFPL LRA GC+LG G+NRVTSGV+
Sbjct  377   TTIPWAVGVCIASILGVVAFFSIGLGPIAWVYSSEIFPLHLRALGCALGVGLNRVTSGVI  436

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGT-FFRWRSR  394
             SMTF+SL K I+IGGSFFLYA IA++ WVFFFT + ET+G+TLE+   LFG       S 
Sbjct  437   SMTFLSLSKGITIGGSFFLYAGIASLAWVFFFTYLKETRGRTLEQMGELFGIPNMAGDSY  496

Query  393   QREVDAKKANNNSQL  349
             Q++   +K  NN ++
Sbjct  497   QQQQSPEKERNNVEM  511



>ref|XP_010530516.1| PREDICTED: putative polyol transporter 1, partial [Tarenaya hassleriana]
Length=349

 Score =   365 bits (936),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 177/309 (57%), Positives = 231/309 (75%), Gaps = 4/309 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDA +VL KTSD+ +EA +RL +IK A GIP     +V+TV
Sbjct  42    IGVLAMPESPRWLVMQGRLGDAMKVLEKTSDTNDEAVLRLDEIKTAVGIPAEMKGDVITV  101

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               K+   + VWR+L I PTPAV HILI  +GIH FQQASGIDAVVLY P IF KAGIKS 
Sbjct  102   PDKKSHGEGVWRDLLIKPTPAVRHILIACLGIHFFQQASGIDAVVLYSPTIFAKAGIKSK  161

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH-  751
              D+LL T+A+G  KTVFI+V T  +D+FGRR LLL+S+GGM  +LA LG SLTVI+H+  
Sbjct  162   NDQLLATVAVGLVKTVFIVVGTCLVDRFGRRILLLSSMGGMFLSLAALGSSLTVINHNEG  221

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
               V WA+ +++   + +VA FS+GAGP+TWVY SEIFP++LRA G  LG  +NR+ SG +
Sbjct  222   SNVGWAIKLSVTTVMTFVATFSLGAGPVTWVYCSEIFPVRLRAQGAGLGVMLNRLISGTI  281

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
              MTF+SL  A++IGG+F L+A +A V W+FFF ++PETQGK LEE E LFG++    +++
Sbjct  282   GMTFLSLSHALTIGGAFLLFAGVAFVAWLFFFIVLPETQGKPLEEIEKLFGSY---TAKK  338

Query  390   REVDAKKAN  364
             +  D K+++
Sbjct  339   KNDDRKESD  347



>ref|XP_007201628.1| hypothetical protein PRUPE_ppa021469mg [Prunus persica]
 gb|EMJ02827.1| hypothetical protein PRUPE_ppa021469mg [Prunus persica]
Length=490

 Score =   369 bits (948),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 186/318 (58%), Positives = 229/318 (72%), Gaps = 30/318 (9%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLA+PESPRWLVMQGRLGDA+RVL KTS S EEA +RL DIKEAAGI +  DD+VV V
Sbjct  195   IGVLAVPESPRWLVMQGRLGDAKRVLDKTSASKEEAQLRLDDIKEAAGIAKELDDDVVPV  254

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             +KK   E  VW++L + PTPAV HILI  +GIH F+QASGID+VVLY PRIFEKAG+KS 
Sbjct  255   SKKSHGE-GVWKDLILHPTPAVRHILIAALGIHFFEQASGIDSVVLYSPRIFEKAGLKSY  313

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
               +LL T+ +GF KT+ ILVATF LD+FGRR LLL+SV GM+ +L  LG+ LT+IDH  +
Sbjct  314   DQRLLATVGVGFVKTIAILVATFFLDRFGRRWLLLSSVAGMIFSLVCLGVGLTIIDHHRD  373

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
              VPWA+A+ I M                      IFPLKLRA G S+G  +NR TSGV+S
Sbjct  374   TVPWAIALCITMV---------------------IFPLKLRAQGVSMGVAVNRATSGVIS  412

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWR----  400
             MTF+SLYK I+IGG+FFLYA IAA+ WVFF+ L+PET+G+TLEETE LFG + RW+    
Sbjct  413   MTFLSLYKTITIGGAFFLYAGIAALSWVFFYMLLPETRGRTLEETEVLFGKYHRWKKANA  472

Query  399   ----SRQREVDAKKANNN  358
                 S+Q + D  K+  N
Sbjct  473   VLRQSKQGDGDENKSQVN  490



>ref|XP_008795607.1| PREDICTED: polyol transporter 5-like isoform X2 [Phoenix dactylifera]
Length=487

 Score =   369 bits (946),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 195/293 (67%), Positives = 232/293 (79%), Gaps = 4/293 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPES RWLVMQG+LG A++VL KTSD+PEEA  RL DIK+ AGIP  C+D+VV  
Sbjct  174   VGVLAMPESSRWLVMQGQLGLAKKVLAKTSDTPEEAEERLLDIKKVAGIPADCNDDVVAA  233

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+   E  VW+ELF+ PTP+V  +LI+ +GI+ FQQASGI +VVLY PR+F+KAGI  D
Sbjct  234   QKQSHGE-GVWKELFLRPTPSVRRVLISAIGIYFFQQASGIASVVLYSPRVFKKAGIH-D  291

Query  927   TDKLL-CTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HS  754
              D LL  T+A+GFTKT+FILVATF LD+ GRRPLLL+S GGM+ +LA LG+ LTV+D H 
Sbjct  292   KDALLGTTVAVGFTKTLFILVATFLLDRVGRRPLLLSSTGGMIVSLAGLGLGLTVVDRHP  351

Query  753   HEKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGV  574
               ++PWAV   IA  LAYVA FSIG GPIT VY SEIFPL+LRA G S+G  +NRVTSGV
Sbjct  352   DGQLPWAVGFCIASILAYVAFFSIGLGPITSVYCSEIFPLRLRAQGVSVGVVVNRVTSGV  411

Query  573   VSMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGT  415
             ++MTFISLYKAI+IGGSFFLYA IAAV WVFFFT + ET+GKTLEE E LFG 
Sbjct  412   ITMTFISLYKAITIGGSFFLYAGIAAVAWVFFFTYLKETRGKTLEEMENLFGN  464



>ref|NP_001168177.1| uncharacterized protein LOC100381931 [Zea mays]
 gb|ACN27335.1| unknown [Zea mays]
 tpg|DAA63326.1| TPA: hypothetical protein ZEAMMB73_286001 [Zea mays]
Length=510

 Score =   369 bits (947),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 189/290 (65%), Positives = 223/290 (77%), Gaps = 2/290 (1%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             V  MPESPRWLVM+GRL DAR VL KTS SPEEA  RLADIK AAGIP+  D +VVTV K
Sbjct  197   VFCMPESPRWLVMKGRLADARAVLEKTSASPEEAAERLADIKVAAGIPKDLDGDVVTVPK  256

Query  1101  KRGD-EDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDT  925
             +R   E  VW++L +SPTPA+  IL++ VG+H FQQASG D+VVLY P +F  AGI  D 
Sbjct  257   ERNSGEMQVWKDLILSPTPAIRRILLSAVGLHFFQQASGCDSVVLYSPSVFRSAGITGDN  316

Query  924   DKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-  748
               L  T A+G TKT+FILVATF LD+ GRRPLLLTS GGMV +L  LG +LTV+ H  + 
Sbjct  317   KLLGVTCAVGVTKTLFILVATFLLDRVGRRPLLLTSTGGMVISLISLGTALTVVGHHPDA  376

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+P  VA+ IA TLA+VA FSIG GPIT VY+SEIFPL+LRA G ++G   NRVTS V+S
Sbjct  377   KIPSVVALCIASTLAFVAFFSIGLGPITGVYNSEIFPLQLRALGFAVGVACNRVTSAVIS  436

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
             MTF+SL KAI+IGGSFFLY+ IAAVGWVFFFT +PET+G+TLEE   LFG
Sbjct  437   MTFLSLSKAITIGGSFFLYSGIAAVGWVFFFTCLPETRGRTLEEMGKLFG  486



>ref|XP_008795606.1| PREDICTED: polyol transporter 5-like isoform X1 [Phoenix dactylifera]
Length=522

 Score =   369 bits (947),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 195/293 (67%), Positives = 232/293 (79%), Gaps = 4/293 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPES RWLVMQG+LG A++VL KTSD+PEEA  RL DIK+ AGIP  C+D+VV  
Sbjct  209   VGVLAMPESSRWLVMQGQLGLAKKVLAKTSDTPEEAEERLLDIKKVAGIPADCNDDVVAA  268

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K+   E  VW+ELF+ PTP+V  +LI+ +GI+ FQQASGI +VVLY PR+F+KAGI  D
Sbjct  269   QKQSHGE-GVWKELFLRPTPSVRRVLISAIGIYFFQQASGIASVVLYSPRVFKKAGIH-D  326

Query  927   TDKLL-CTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HS  754
              D LL  T+A+GFTKT+FILVATF LD+ GRRPLLL+S GGM+ +LA LG+ LTV+D H 
Sbjct  327   KDALLGTTVAVGFTKTLFILVATFLLDRVGRRPLLLSSTGGMIVSLAGLGLGLTVVDRHP  386

Query  753   HEKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGV  574
               ++PWAV   IA  LAYVA FSIG GPIT VY SEIFPL+LRA G S+G  +NRVTSGV
Sbjct  387   DGQLPWAVGFCIASILAYVAFFSIGLGPITSVYCSEIFPLRLRAQGVSVGVVVNRVTSGV  446

Query  573   VSMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGT  415
             ++MTFISLYKAI+IGGSFFLYA IAAV WVFFFT + ET+GKTLEE E LFG 
Sbjct  447   ITMTFISLYKAITIGGSFFLYAGIAAVAWVFFFTYLKETRGKTLEEMENLFGN  499



>ref|NP_001141158.1| hypothetical protein [Zea mays]
 gb|ACF85577.1| unknown [Zea mays]
 tpg|DAA41235.1| TPA: hypothetical protein ZEAMMB73_633247 [Zea mays]
Length=473

 Score =   367 bits (942),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 189/290 (65%), Positives = 223/290 (77%), Gaps = 2/290 (1%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VL MPESPRWLVM+GRL DAR VL KTS SPEEA  RLADIK AAGIP+  D +VV V K
Sbjct  156   VLWMPESPRWLVMKGRLADARAVLEKTSASPEEAAERLADIKVAAGIPKGLDGDVVAVPK  215

Query  1101  KR-GDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDT  925
             +R G E  VWREL +SPTPA+  IL++ VG+H FQQASG D+VVLY P +F+ AGI  D 
Sbjct  216   ERSGGEMQVWRELILSPTPAIRRILLSAVGLHFFQQASGSDSVVLYSPTVFKSAGITDDN  275

Query  924   DKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-  748
               L  T A+G  KT+FILVATF LD+ GRRPLLLTS GGM+ +L  LG  LTV+ H  + 
Sbjct  276   KLLGVTCAVGVAKTLFILVATFLLDRAGRRPLLLTSTGGMIVSLVGLGTGLTVVGHHPDA  335

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+P AVA+ IA TLAYVA FSIG GP+T VY+SEIFPL++RA G ++G   NRVTS V+S
Sbjct  336   KIPSAVALCIASTLAYVAFFSIGLGPVTGVYNSEIFPLQVRALGFAVGVACNRVTSAVIS  395

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
             MTF+SL K I+IGGSFFLY+ IAAVGWVFFFT +PET+G+TLEE   LFG
Sbjct  396   MTFLSLSKGITIGGSFFLYSGIAAVGWVFFFTCLPETRGRTLEEMGKLFG  445



>emb|CDY72601.1| BnaAnng41630D [Brassica napus]
Length=392

 Score =   363 bits (933),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 174/307 (57%), Positives = 228/307 (74%), Gaps = 1/307 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLV+QGRLGDA +VL KTS++ EEA  RL DIK AAGIPE   D+V+ V
Sbjct  81    IGVLAMPESPRWLVLQGRLGDAFKVLDKTSNTKEEAISRLNDIKRAAGIPEDMTDDVIVV  140

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               ++     VW++L + PTPAV HILI  +GIH  QQASGIDAVVLY P IF+KAG+KS 
Sbjct  141   PNRKSAGKGVWKDLLVRPTPAVRHILIACLGIHFAQQASGIDAVVLYSPTIFQKAGLKSK  200

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-H  751
              D+LL T+A+G  KT+FI+V T  +D+FGRR LLLTS+GGM  +L  LG SLTVID +  
Sbjct  201   NDQLLATVAVGIVKTLFIVVGTCVVDRFGRRALLLTSMGGMFLSLTALGTSLTVIDRNPG  260

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
               + WA+ +++ M + +VA FSIGAGP+TWVY SEIFP++LRA G SLG  +NR+ SG++
Sbjct  261   HTLKWAIVLSVTMVMTFVATFSIGAGPVTWVYCSEIFPVRLRAQGASLGVMLNRLMSGII  320

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
              MTF+SL K ++IGG+F L+A +AA  WVFFFT +PET+G  LEE E+LFG++   + + 
Sbjct  321   GMTFLSLSKGLTIGGAFLLFAGVAAAAWVFFFTFLPETRGIPLEEMESLFGSYTANKKKN  380

Query  390   REVDAKK  370
                + K+
Sbjct  381   VTKEGKE  387



>ref|XP_008667512.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA41234.1| TPA: hypothetical protein ZEAMMB73_633247 [Zea mays]
Length=516

 Score =   368 bits (944),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 189/290 (65%), Positives = 223/290 (77%), Gaps = 2/290 (1%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VL MPESPRWLVM+GRL DAR VL KTS SPEEA  RLADIK AAGIP+  D +VV V K
Sbjct  199   VLWMPESPRWLVMKGRLADARAVLEKTSASPEEAAERLADIKVAAGIPKGLDGDVVAVPK  258

Query  1101  KR-GDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDT  925
             +R G E  VWREL +SPTPA+  IL++ VG+H FQQASG D+VVLY P +F+ AGI  D 
Sbjct  259   ERSGGEMQVWRELILSPTPAIRRILLSAVGLHFFQQASGSDSVVLYSPTVFKSAGITDDN  318

Query  924   DKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-  748
               L  T A+G  KT+FILVATF LD+ GRRPLLLTS GGM+ +L  LG  LTV+ H  + 
Sbjct  319   KLLGVTCAVGVAKTLFILVATFLLDRAGRRPLLLTSTGGMIVSLVGLGTGLTVVGHHPDA  378

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+P AVA+ IA TLAYVA FSIG GP+T VY+SEIFPL++RA G ++G   NRVTS V+S
Sbjct  379   KIPSAVALCIASTLAYVAFFSIGLGPVTGVYNSEIFPLQVRALGFAVGVACNRVTSAVIS  438

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
             MTF+SL K I+IGGSFFLY+ IAAVGWVFFFT +PET+G+TLEE   LFG
Sbjct  439   MTFLSLSKGITIGGSFFLYSGIAAVGWVFFFTCLPETRGRTLEEMGKLFG  488



>ref|XP_006649564.1| PREDICTED: polyol transporter 5-like [Oryza brachyantha]
Length=518

 Score =   368 bits (944),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 185/295 (63%), Positives = 226/295 (77%), Gaps = 5/295 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHC--DDEVV  1114
             + VLAMPESPRWLVMQGR+GDARRVL KTSDSP EA  RLADIK A GIPE    DDEVV
Sbjct  199   LGVLAMPESPRWLVMQGRIGDARRVLEKTSDSPAEAEERLADIKNAVGIPEGISDDDEVV  258

Query  1113  TVTKK-RGDE-DSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAG  940
             T+ +K RG   + VWR+L I PTPAV  ILI  +G+  FQQASGID+VVLY PR+F+KAG
Sbjct  259   TIVRKSRGSHGEGVWRDLLIRPTPAVRRILIACLGLQFFQQASGIDSVVLYSPRVFDKAG  318

Query  939   IKSDTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID  760
             + SD+  +  ++A+G +KT+FILVATF LD+ GRRPLLLTS  GMV +L  L  +L VID
Sbjct  319   LHSDSHSIGASVAVGASKTLFILVATFLLDRVGRRPLLLTSAAGMVISLVTLASALHVID  378

Query  759   HSHE-KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVT  583
                E +    V ++IAM LA+VA+FSIG GPI WVYSSEIFPL+LRA GC+LGT +NR+ 
Sbjct  379   QRPEGQATPLVGLSIAMVLAFVASFSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRIM  438

Query  582   SGVVSMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
             SG +SM+F+SL KAI+  GSF+LYA IA  GWVF F  +PET+G++LE+T  LFG
Sbjct  439   SGAISMSFLSLCKAITFAGSFYLYAGIATAGWVFMFFFLPETRGRSLEDTIVLFG  493



>ref|XP_002460924.1| hypothetical protein SORBIDRAFT_02g037580 [Sorghum bicolor]
 gb|EER97445.1| hypothetical protein SORBIDRAFT_02g037580 [Sorghum bicolor]
Length=510

 Score =   366 bits (940),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 190/311 (61%), Positives = 229/311 (74%), Gaps = 10/311 (3%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             V  MPESPRWLVM+GRL DAR VL KTS SPEEA  RLADIK AAGIP+  D +VVTV K
Sbjct  197   VFCMPESPRWLVMKGRLADARAVLEKTSASPEEAAERLADIKVAAGIPKDLDGDVVTVPK  256

Query  1101  KR-GDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDT  925
             +R G E  VW+ L  SP PA+  IL++GVG+H FQQASG D+VVLY P +F+ AGI  D 
Sbjct  257   ERNGGEMQVWKALIFSPIPAIRRILLSGVGLHFFQQASGSDSVVLYSPSVFKSAGITDDN  316

Query  924   DKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-  748
               L  T A+G +KT+FILVATF LD+ GRRPLLLTS GGM+  L  LG  LTV+ H  + 
Sbjct  317   KLLGVTCAVGVSKTLFILVATFLLDRVGRRPLLLTSAGGMIVALIGLGTGLTVVGHHPDA  376

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+P AVA+ IA TLAYVA FSIG GPIT VY+SEIFPL++RA G ++G   NRVTS V+S
Sbjct  377   KIPSAVALCIASTLAYVAFFSIGLGPITGVYNSEIFPLQVRALGFAVGMACNRVTSAVIS  436

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             MTF+SL K I+IGGSFFLY+ IAAVGWVFFFT +PET+G+TLEE   LFG          
Sbjct  437   MTFLSLSKGITIGGSFFLYSGIAAVGWVFFFTCLPETRGRTLEEMGKLFG--------MP  488

Query  387   EVDAKKANNNS  355
             ++D  +A++ +
Sbjct  489   DIDMAQADDTA  499



>ref|XP_004958138.1| PREDICTED: polyol transporter 5-like [Setaria italica]
Length=509

 Score =   366 bits (940),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 184/289 (64%), Positives = 220/289 (76%), Gaps = 1/289 (0%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             V  MPESPRWLVM+GRL DAR VL KT D+PEEA  RL DIK AAGIP+  D +VVTV K
Sbjct  197   VFGMPESPRWLVMKGRLADARAVLEKTCDTPEEAAERLTDIKAAAGIPKELDGDVVTVPK  256

Query  1101  KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTD  922
             +R  E  VW+EL +SPTPAV  IL++ VG+H FQQASGID+VVLY P +F+ AGI  D  
Sbjct  257   ERNGETQVWKELILSPTPAVRRILLSAVGLHFFQQASGIDSVVLYSPLVFKSAGITDDNK  316

Query  921   KLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-K  745
              L  T A+G TKT+FILVATF LD+ GRRPLLLTS GGMV +L  LG  LTV+ H  + K
Sbjct  317   LLGTTCAVGVTKTLFILVATFLLDRAGRRPLLLTSTGGMVISLIGLGTGLTVVGHHPDAK  376

Query  744   VPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSM  565
             +PWAVA+ I   LAYV+ FSIG GP+  VY+SEIFPL++RA G ++G   NRVTSGV+SM
Sbjct  377   IPWAVALCILSILAYVSFFSIGLGPMASVYTSEIFPLRVRALGFAVGVASNRVTSGVISM  436

Query  564   TFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
             TF+SL KAI+IGGSFFLY+ IA + WVFFFT + ET+G+TLEE   LFG
Sbjct  437   TFLSLSKAITIGGSFFLYSGIAVLAWVFFFTYLRETRGRTLEEMGKLFG  485



>ref|XP_008466959.1| PREDICTED: polyol transporter 5-like, partial [Cucumis melo]
Length=276

 Score =   357 bits (917),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 172/267 (64%), Positives = 208/267 (78%), Gaps = 1/267 (0%)
 Frame = -3

Query  1143  IPEHCDDEVVTVTKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYG  964
             IPE C+D++V+V KK    + VW+EL I PT AV HILI GVGIH FQQASGIDAVVLY 
Sbjct  1     IPEECNDDIVSVAKKSTHGEGVWKELLIHPTAAVRHILIAGVGIHFFQQASGIDAVVLYS  60

Query  963   PRIFEKAGIKSDTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALL  784
             PRIFEKAGI S   KLL T+A+GF KT+FILVATF LD+ GRRPLLLTSV GM+ +L  L
Sbjct  61    PRIFEKAGITSANQKLLATVAVGFVKTIFILVATFLLDRIGRRPLLLTSVLGMIISLGTL  120

Query  783   GMSLTVIDHSHEKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLG  604
             G++LTVI+ + +K+ WAV + I+M L YVA+FSIG GPITWVYSSEIFPLKLRA G S+G
Sbjct  121   GLALTVINQTDKKLMWAVVLCISMVLTYVASFSIGMGPITWVYSSEIFPLKLRAQGTSMG  180

Query  603   TGINRVTSGVVSMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEAL  424
               +NRVTSGV+SM+F+SL KAI+ GG+FFL+AAIA V W FF+T +PETQGKTLEE E L
Sbjct  181   VAVNRVTSGVISMSFLSLSKAITTGGAFFLFAAIAIVAWFFFYTALPETQGKTLEEMEML  240

Query  423   FGTFFRWRSRQREVDAKKANNNSQLQM  343
             FG  FRW+S       +K N +  +Q+
Sbjct  241   FG-HFRWKSAAAPAATEKDNGSGGVQL  266



>ref|XP_008452333.1| PREDICTED: polyol transporter 5-like isoform X2 [Cucumis melo]
Length=516

 Score =   365 bits (937),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/310 (57%), Positives = 228/310 (74%), Gaps = 3/310 (1%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             +L MPESPRWLVMQGRLG+A++VL++TSDS EE+  RL DIK + GIP  C+D+VV + K
Sbjct  208   ILVMPESPRWLVMQGRLGEAKQVLIRTSDSIEESLQRLDDIKTSVGIPASCEDDVVEIPK  267

Query  1101  KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTD  922
             +      VW+E F+ PTPAV HILI  VG+H FQ+ASG +AVVLY PRIFEKAGI S   
Sbjct  268   QISHGSGVWKE-FLHPTPAVRHILIAAVGVHFFQEASGTNAVVLYSPRIFEKAGISSSDQ  326

Query  921   KLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKV  742
             KLL T+A+G  KT FILVAT   D+ GRRPL+L S+GGM+ +L  LG+ LT+I+ S E+ 
Sbjct  327   KLLATVAVGVVKTAFILVATILFDRVGRRPLILMSLGGMIVSLITLGVGLTIIERSKEEG  386

Query  741   PWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMT  562
              W V + ++M L  VA FS+G GP+++V SSE+FPLKLRA G S+G  +N VTSG+VSMT
Sbjct  387   TWLVGLCVSMVLMDVAFFSMGIGPMSYV-SSELFPLKLRAQGMSMGMVVNNVTSGIVSMT  445

Query  561   FISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV  382
             F+SLY+AI+IGG+FFLYAAIA VGWVFF+   PET+G  LE  E LFG    W+   ++ 
Sbjct  446   FLSLYRAITIGGAFFLYAAIAMVGWVFFYVTFPETRGHNLEHVERLFGNLL-WKFSVKKN  504

Query  381   DAKKANNNSQ  352
             D    + NS+
Sbjct  505   DTLDDDENSE  514



>ref|XP_006856085.2| PREDICTED: polyol transporter 5 [Amborella trichopoda]
Length=483

 Score =   364 bits (934),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 184/289 (64%), Positives = 223/289 (77%), Gaps = 1/289 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLV+QGRLG A+++LLKTSDSP+EA  RL++IK AAGIPE+ D EVV+V
Sbjct  166   VGVLAMPESPRWLVLQGRLGAAKKILLKTSDSPDEAQRRLSEIKVAAGIPENADGEVVSV  225

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K    E  VW+EL + PTPAV  +LI  V IH FQQASGIDAVVLY PR+FEKAGIK  
Sbjct  226   PKHHHGE-GVWKELLLRPTPAVRRMLIAAVAIHFFQQASGIDAVVLYSPRVFEKAGIKEK  284

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             +  L  T+ +G TKT FILVATF LD+ GRRPLLL+S+GGM  +L  LG  LT+I HS E
Sbjct  285   SKLLGATVGVGLTKTTFILVATFLLDRLGRRPLLLSSLGGMAVSLFGLGFGLTMIAHSDE  344

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WAV + I   L YVA FSIG GPITWVY+SEIFPL+LRA G S+G  +NRV SGV+ 
Sbjct  345   KLVWAVGLCITTILLYVAFFSIGMGPITWVYTSEIFPLRLRAQGASIGVAVNRVISGVIG  404

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALF  421
             MTFIS+Y AI+IGGSFFLY+ ++ + ++FFF  +PET+G+TLEE   LF
Sbjct  405   MTFISVYNAITIGGSFFLYSGVSLLAFLFFFFFLPETKGRTLEEVVELF  453



>emb|CDP17996.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   365 bits (937),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 193/307 (63%), Positives = 230/307 (75%), Gaps = 1/307 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V  L MPESPRWLV+QG++G ARR+L KTS+S +EA  RLADIK AAGIPE   DEVV V
Sbjct  206   VGGLVMPESPRWLVLQGKVGMARRILEKTSESLQEAQERLADIKGAAGIPEDNHDEVVEV  265

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K R      WRE+FI PT AVLHI I G+G+  FQQASGID+VV+Y P IFE AGIKSD
Sbjct  266   PKDRTSGKGAWREMFIHPTRAVLHITIAGIGLCFFQQASGIDSVVMYSPTIFENAGIKSD  325

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSH  751
               KLL TI++G TKTVFILV+TF LDKFGRR  LLTS  G+V +L  LG  LTVID H +
Sbjct  326   NGKLLATISVGVTKTVFILVSTFYLDKFGRRISLLTSTAGLVCSLVGLGAGLTVIDQHPN  385

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             EK+  A+  +    LA VA FS+G GP+ WVYSSEIFPL+LRA G  L   +NR+ SGV+
Sbjct  386   EKLTGAIGFSFFCVLASVATFSMGLGPVAWVYSSEIFPLRLRALGSGLAASMNRLISGVI  445

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
              MTFISLYKAI+IGG+FFL+  IA V ++FFFTL+PET+G+ LEE E LFGTF +WRS  
Sbjct  446   LMTFISLYKAITIGGAFFLFGGIAFVAFIFFFTLLPETRGRGLEEMEELFGTFCKWRSTV  505

Query  390   REVDAKK  370
             RE++ KK
Sbjct  506   RELEEKK  512



>gb|ERN17552.1| hypothetical protein AMTR_s00059p00123280 [Amborella trichopoda]
Length=513

 Score =   364 bits (934),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 184/289 (64%), Positives = 223/289 (77%), Gaps = 1/289 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V VLAMPESPRWLV+QGRLG A+++LLKTSDSP+EA  RL++IK AAGIPE+ D EVV+V
Sbjct  196   VGVLAMPESPRWLVLQGRLGAAKKILLKTSDSPDEAQRRLSEIKVAAGIPENADGEVVSV  255

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              K    E  VW+EL + PTPAV  +LI  V IH FQQASGIDAVVLY PR+FEKAGIK  
Sbjct  256   PKHHHGE-GVWKELLLRPTPAVRRMLIAAVAIHFFQQASGIDAVVLYSPRVFEKAGIKEK  314

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
             +  L  T+ +G TKT FILVATF LD+ GRRPLLL+S+GGM  +L  LG  LT+I HS E
Sbjct  315   SKLLGATVGVGLTKTTFILVATFLLDRLGRRPLLLSSLGGMAVSLFGLGFGLTMIAHSDE  374

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WAV + I   L YVA FSIG GPITWVY+SEIFPL+LRA G S+G  +NRV SGV+ 
Sbjct  375   KLVWAVGLCITTILLYVAFFSIGMGPITWVYTSEIFPLRLRAQGASIGVAVNRVISGVIG  434

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALF  421
             MTFIS+Y AI+IGGSFFLY+ ++ + ++FFF  +PET+G+TLEE   LF
Sbjct  435   MTFISVYNAITIGGSFFLYSGVSLLAFLFFFFFLPETKGRTLEEVVELF  483



>ref|XP_010442448.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   364 bits (934),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 172/307 (56%), Positives = 230/307 (75%), Gaps = 1/307 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLV+QGR+GDA +VL KTS++ EEA  RL DIK AAGIP+   D+V+ V
Sbjct  200   IGVLAMPESPRWLVLQGRIGDAFKVLDKTSNTKEEAISRLNDIKRAAGIPDDMTDDVIVV  259

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               K+     VW++L + PTP+V HILI  +GIHL QQASGIDAVVLY P IF KAG++S 
Sbjct  260   PNKKTAGKGVWKDLLVRPTPSVRHILIACLGIHLAQQASGIDAVVLYSPTIFSKAGLRSK  319

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-H  751
              D+LL T+A+G  KT+FI+V T  +D+FGRR LLLTS+GGM  +L LLG SLTVID +  
Sbjct  320   NDQLLATVAVGVVKTLFIVVGTCVVDRFGRRALLLTSMGGMFISLTLLGTSLTVIDRNPG  379

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             + + WA+ +++   +++VA FSIGAGP+TWVY SEIFP++LRA G SLG  +NR+ SG++
Sbjct  380   QTIKWAIGLSVTTVMSFVATFSIGAGPVTWVYCSEIFPVRLRAQGVSLGVMLNRLMSGII  439

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
              MTF+SL K ++IGG+F L+A +AA+ WVFFFT +PET+G  LEE E+LFG++   +   
Sbjct  440   GMTFLSLSKGLTIGGAFLLFAGVAAIAWVFFFTFLPETRGVPLEEIESLFGSYSANKKNN  499

Query  390   REVDAKK  370
               +  K+
Sbjct  500   VTIKGKE  506



>ref|XP_008452332.1| PREDICTED: putative polyol transporter 2 isoform X1 [Cucumis 
melo]
Length=546

 Score =   365 bits (936),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 178/310 (57%), Positives = 228/310 (74%), Gaps = 3/310 (1%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             +L MPESPRWLVMQGRLG+A++VL++TSDS EE+  RL DIK + GIP  C+D+VV + K
Sbjct  238   ILVMPESPRWLVMQGRLGEAKQVLIRTSDSIEESLQRLDDIKTSVGIPASCEDDVVEIPK  297

Query  1101  KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTD  922
             +      VW+E F+ PTPAV HILI  VG+H FQ+ASG +AVVLY PRIFEKAGI S   
Sbjct  298   QISHGSGVWKE-FLHPTPAVRHILIAAVGVHFFQEASGTNAVVLYSPRIFEKAGISSSDQ  356

Query  921   KLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKV  742
             KLL T+A+G  KT FILVAT   D+ GRRPL+L S+GGM+ +L  LG+ LT+I+ S E+ 
Sbjct  357   KLLATVAVGVVKTAFILVATILFDRVGRRPLILMSLGGMIVSLITLGVGLTIIERSKEEG  416

Query  741   PWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMT  562
              W V + ++M L  VA FS+G GP+++V SSE+FPLKLRA G S+G  +N VTSG+VSMT
Sbjct  417   TWLVGLCVSMVLMDVAFFSMGIGPMSYV-SSELFPLKLRAQGMSMGMVVNNVTSGIVSMT  475

Query  561   FISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV  382
             F+SLY+AI+IGG+FFLYAAIA VGWVFF+   PET+G  LE  E LFG    W+   ++ 
Sbjct  476   FLSLYRAITIGGAFFLYAAIAMVGWVFFYVTFPETRGHNLEHVERLFGNLL-WKFSVKKN  534

Query  381   DAKKANNNSQ  352
             D    + NS+
Sbjct  535   DTLDDDENSE  544



>ref|XP_009121227.1| PREDICTED: putative polyol transporter 1 [Brassica rapa]
Length=511

 Score =   363 bits (932),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 173/307 (56%), Positives = 228/307 (74%), Gaps = 1/307 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLV+QGR+GDA +VL KTS++ EEA  RL DIK AAGIPE   D+V+ V
Sbjct  200   IGVLAMPESPRWLVLQGRIGDAFKVLDKTSNTKEEAISRLNDIKRAAGIPEDMTDDVIVV  259

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               ++     VW++L + PTPAV HILI  +GIH  QQASGIDAVVLY P IF+KAG+KS 
Sbjct  260   PNRKSAGKGVWKDLLVRPTPAVRHILIACLGIHFAQQASGIDAVVLYSPTIFQKAGLKSK  319

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-H  751
              D+LL T+A+G  KT+FI+V T  +D+FGRR LLLTS+GGM  +L  LG SLTVID +  
Sbjct  320   NDQLLATVAVGIVKTLFIVVGTCVVDRFGRRALLLTSMGGMFLSLTALGTSLTVIDRNPG  379

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
               + WA+ +++ M + +VA FSIGAGP+TWVY SEIFP++LRA G SLG  +NR+ SG++
Sbjct  380   HTLKWAIVLSVTMVMTFVATFSIGAGPVTWVYCSEIFPVRLRAQGASLGVMLNRLMSGII  439

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
              MTF+SL K ++IGG+F L+A +AA  WVFFFT +PET+G  LEE E+LFG++   + + 
Sbjct  440   GMTFLSLSKGLTIGGAFLLFAGVAAAAWVFFFTFLPETRGIPLEEMESLFGSYTANKKKN  499

Query  390   REVDAKK  370
                + K+
Sbjct  500   VTKEGKE  506



>emb|CDY24775.1| BnaA08g15350D [Brassica napus]
Length=506

 Score =   362 bits (930),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 174/310 (56%), Positives = 225/310 (73%), Gaps = 9/310 (3%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + +L MPESPRWLV+QGRLG+A+++L   S+SPEEA +R  DIK AAGI  +C++EVV +
Sbjct  203   LGILKMPESPRWLVLQGRLGEAKKILKLVSNSPEEAELRFKDIKTAAGIDANCEEEVVKM  262

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              KK+   + VW+EL + PTPAV  +L+T +GIH FQ A+GI+AV+LYGP+IF++AGI + 
Sbjct  263   EKKKTHGEGVWKELILRPTPAVRRVLLTALGIHFFQHATGIEAVLLYGPKIFKRAGITAK  322

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
                 L TI +G  KT FIL ATF LDK GRR LLLTSVGGMV  L +LG  LT+  +S  
Sbjct  323   DKLFLVTIGVGIMKTTFILTATFLLDKVGRRKLLLTSVGGMVCALTMLGFGLTMAQNSGG  382

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WA+ ++I    ++VA FSIG GPITWVYSSE+FPLKLRA G SLG  +NRV +  VS
Sbjct  383   KLAWALVLSIVSAYSFVAVFSIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRVMNATVS  442

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             M+F+SL +AI+ GG+FF++A +AAV W FFF LMPET+GK+LEE EALF         QR
Sbjct  443   MSFLSLTRAITTGGAFFMFAGVAAVAWNFFFFLMPETKGKSLEEIEALF---------QR  493

Query  387   EVDAKKANNN  358
             + D K    N
Sbjct  494   DGDNKTKGEN  503



>ref|XP_009109331.1| PREDICTED: probable polyol transporter 6 [Brassica rapa]
Length=506

 Score =   362 bits (930),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 174/310 (56%), Positives = 225/310 (73%), Gaps = 9/310 (3%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + +L MPESPRWLV+QGRLG+A+++L   S+SPEEA +R  DIK AAGI  +C++EVV +
Sbjct  203   LGILKMPESPRWLVLQGRLGEAKKILKLVSNSPEEAELRFKDIKTAAGIDANCEEEVVKM  262

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
              KK+   + VW+EL + PTPAV  +L+T +GIH FQ A+GI+AV+LYGP+IF++AGI + 
Sbjct  263   EKKKTHGEGVWKELILRPTPAVRRVLLTALGIHFFQHATGIEAVLLYGPKIFKRAGITAK  322

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
                 L TI +G  KT FIL ATF LDK GRR LLLTSVGGMV  L +LG  LT+  +S  
Sbjct  323   DKLFLVTIGVGIMKTTFILTATFLLDKVGRRKLLLTSVGGMVCALTMLGFGLTMAQNSGG  382

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WA+ ++I    ++VA FSIG GPITWVYSSE+FPLKLRA G SLG  +NRV +  VS
Sbjct  383   KLAWALVLSIVSAYSFVAVFSIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRVMNATVS  442

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             M+F+SL +AI+ GG+FF++A +AAV W FFF LMPET+GK+LEE EALF         QR
Sbjct  443   MSFLSLTRAITTGGAFFMFAGVAAVAWNFFFFLMPETKGKSLEEIEALF---------QR  493

Query  387   EVDAKKANNN  358
             + D K    N
Sbjct  494   DGDNKTKGEN  503



>ref|XP_004148314.2| PREDICTED: polyol transporter 5-like [Cucumis sativus]
 gb|KGN44327.1| hypothetical protein Csa_7G253820 [Cucumis sativus]
Length=519

 Score =   362 bits (930),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 177/307 (58%), Positives = 226/307 (74%), Gaps = 7/307 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIP------EHCD  1126
             + VL MPESPRWLVM+GR+ DA+R+L +TS S EE+  RL DIK AAGIP      +H  
Sbjct  203   IVVLIMPESPRWLVMKGRISDAKRILDRTSVSIEESQQRLLDIKLAAGIPLNFSGTDHDP  262

Query  1125  DEVVTVTKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEK  946
             + +  ++      +SVW+ELFI PTP V HILI  +G+H FQQASG D VVLY PRIFEK
Sbjct  263   NLIPPLSNSTTKGESVWKELFIHPTPPVRHILIAAIGLHFFQQASGNDGVVLYSPRIFEK  322

Query  945   AGIKSDTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTV  766
             AGI S   KLL T+A+G  KT FILVATF LD+ GRRP +LTSV G   +LA LG SLT+
Sbjct  323   AGITSSDHKLLATVAVGIVKTAFILVATFFLDRMGRRPCILTSVAGQTVSLATLGFSLTI  382

Query  765   IDHSHEKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRV  586
             I++SHEKV WA+ + IAM L+ V+ FSIG GP+  VY+SEIFPL+LRA G S+    NR+
Sbjct  383   INNSHEKVKWAIVLCIAMVLSNVSFFSIGLGPMASVYTSEIFPLRLRALGVSVAIMANRI  442

Query  585   TSGVVSMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFR  406
             TSGVV+MTF+SLY A++IGG+FFL+A I+AV W+FF+ + PET+G+ LE+ E LFG  F 
Sbjct  443   TSGVVTMTFLSLYHAVTIGGAFFLFAGISAVSWLFFYVVFPETRGQNLEDVEKLFGN-FP  501

Query  405   WRSRQRE  385
             WR ++ +
Sbjct  502   WRMKKSK  508



>ref|XP_002884156.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60415.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=511

 Score =   362 bits (929),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 176/310 (57%), Positives = 227/310 (73%), Gaps = 11/310 (4%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLV+QGRLGDA +VL KTS++ EEA  RL DIK AAGIP+   D+V+ V
Sbjct  200   IGVLAMPESPRWLVIQGRLGDAFKVLDKTSNTKEEAISRLNDIKRAAGIPDDMTDDVIVV  259

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               K+     VW++L + PTP+V HILI  +GIH  QQASGIDAVVLY P IF +AG+KS 
Sbjct  260   PNKKSAGKGVWKDLLVRPTPSVRHILIACLGIHFAQQASGIDAVVLYSPTIFSRAGLKSK  319

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-H  751
              D+LL T+A+G  KT+FI+V T  +D+FGRR LLLTS+GGM  +L LLG SLTVID +  
Sbjct  320   NDQLLATVAVGVVKTLFIVVGTCVVDRFGRRALLLTSMGGMFISLTLLGTSLTVIDRNPG  379

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             + + WA+ +A+   + +VA FSIGAGP+TWVY SEIFP++LRA G SLG  +NR+ SG++
Sbjct  380   QTLKWAIGLAVTTVMTFVATFSIGAGPVTWVYCSEIFPVRLRAQGASLGVMLNRLMSGII  439

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
              MTF+SL K ++IGG+F L+A +AA  WVFFFT +PET+G  LEE E+LFG++       
Sbjct  440   GMTFLSLSKGLTIGGAFLLFAGVAAAAWVFFFTFLPETRGVPLEEMESLFGSY-------  492

Query  390   REVDAKKANN  361
                 A K NN
Sbjct  493   ---TANKKNN  499



>emb|CDY46217.1| BnaA07g03530D [Brassica napus]
Length=512

 Score =   362 bits (929),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/307 (56%), Positives = 227/307 (74%), Gaps = 1/307 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLV+QGRLGDA +VL KTS++ EEA  RL DIK AAGIPE   D+V+ V
Sbjct  201   IGVLAMPESPRWLVLQGRLGDAFKVLDKTSNTKEEAISRLNDIKRAAGIPEDMTDDVIVV  260

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               ++     VW++L + PTPAV HILI  +GIH  QQASGIDAVVLY P IF+KAG+KS 
Sbjct  261   PNRKSAGKGVWKDLLVRPTPAVRHILIACLGIHFSQQASGIDAVVLYSPTIFQKAGLKSK  320

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-H  751
              D+LL T+A+G  KT+FI+V T  +D+FGRR LLLTS+GGM  +L  LG SLTVID +  
Sbjct  321   NDQLLATVAVGIVKTLFIVVGTCVVDRFGRRALLLTSMGGMFLSLTALGTSLTVIDRNPG  380

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
               + WA+ +++   + +VA FSIGAGP+TWVY SEIFP++LRA G SLG  +NR+ SG++
Sbjct  381   HTLKWAIGLSVTTVMTFVATFSIGAGPVTWVYCSEIFPVRLRAQGASLGVMLNRLMSGII  440

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
              MTF+SL K ++IGG+F L+A +AA  WVFFFT +PET+G  LEE E+LFG++   + + 
Sbjct  441   GMTFLSLSKGLTIGGAFLLFAGVAAAAWVFFFTFLPETRGMPLEEMESLFGSYTANKKKN  500

Query  390   REVDAKK  370
                + K+
Sbjct  501   VTKEGKE  507



>emb|CDY46218.1| BnaA07g03520D [Brassica napus]
Length=511

 Score =   362 bits (929),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/307 (56%), Positives = 227/307 (74%), Gaps = 1/307 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLV+QGRLGDA +VL KTS++ EEA  RL DIK AAGIP    D+V+ V
Sbjct  200   IGVLAMPESPRWLVLQGRLGDAFKVLDKTSNTKEEAISRLNDIKRAAGIPADMTDDVIVV  259

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               ++     VW++L + PTPAV HILI  +GIH  QQASGIDAVVLY P IF+KAG+KS 
Sbjct  260   PNRKSAGKGVWKDLLVRPTPAVRHILIACLGIHFAQQASGIDAVVLYSPTIFQKAGLKSK  319

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-H  751
              D+LL T+A+G  KT+FI+V T  +D+FGRR LLLTS+GGM  +L  LG SLTVID +  
Sbjct  320   NDQLLATVAVGIVKTLFIVVGTCVVDRFGRRALLLTSMGGMFLSLTALGTSLTVIDRNPG  379

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
               + WA+ +++ M + +VA FSIGAGP+TWVY SEIFP++LRA G SLG  +NR+ SG++
Sbjct  380   HTLKWAIVLSVTMVMTFVATFSIGAGPVTWVYCSEIFPVRLRAQGASLGVMLNRLMSGII  439

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
              MTF+SL K ++IGG+F L+A +AA  WVFFFT +PET+G  LEE E+LFG++   + + 
Sbjct  440   GMTFLSLSKGLTIGGAFLLFAGVAAAAWVFFFTFLPETRGIPLEEMESLFGSYTANKKKN  499

Query  390   REVDAKK  370
                + K+
Sbjct  500   VTKEGKE  506



>emb|CDY35469.1| BnaC03g61910D [Brassica napus]
Length=507

 Score =   362 bits (928),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 173/310 (56%), Positives = 224/310 (72%), Gaps = 9/310 (3%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + +L MPESPRWLV+QGRLG+A+++L   S+SPEEA +R  DIK AAGI  +C+DEVV +
Sbjct  204   LGILKMPESPRWLVLQGRLGEAKKILKLVSNSPEEAEIRFKDIKTAAGIDANCEDEVVKM  263

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               K+   + VW+EL + PTPAV  +L+T +GIH FQ A+GI+AV+LYGP+IF++AGI + 
Sbjct  264   ENKKTHGEGVWKELILRPTPAVRRVLLTALGIHFFQHATGIEAVLLYGPKIFKRAGITAK  323

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
                 L TI +G  KT FI +ATF LDK GRR LLLTSVGGMV  L +LG  LT+  +S  
Sbjct  324   DKLFLVTIGVGIMKTTFIFIATFLLDKVGRRKLLLTSVGGMVCALTMLGFGLTMAQNSGG  383

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             K+ WA+ ++I    ++VA FSIG GPITWVYSSE+FPLKLRA G SLG  +NRV +  VS
Sbjct  384   KLAWALVLSIVSAYSFVAVFSIGLGPITWVYSSEVFPLKLRAQGASLGVAVNRVMNATVS  443

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQR  388
             M+F+SL +AI+ GG+FF++A +AAV W FFF LMPET+GK+LEE EALF         QR
Sbjct  444   MSFLSLTRAITTGGAFFMFAGVAAVAWNFFFFLMPETKGKSLEEIEALF---------QR  494

Query  387   EVDAKKANNN  358
             + D K    N
Sbjct  495   DGDNKTKGEN  504



>ref|XP_010908358.1| PREDICTED: probable polyol transporter 6 [Elaeis guineensis]
Length=535

 Score =   362 bits (929),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 170/289 (59%), Positives = 225/289 (78%), Gaps = 1/289 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V +LAMPESPRWLVMQGR+ DAR VL++ S+S EEA +RL +IK AAG+ E C  +VV +
Sbjct  154   VGILAMPESPRWLVMQGRVKDARDVLVRVSNSREEAEIRLKEIKAAAGVDESCTGDVVKL  213

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
             TK    E  VW+EL + PTP V HILI  +GIH F+ A+GI+AVVLY PRIF+KAGI++ 
Sbjct  214   TKSSRGE-GVWKELLLRPTPPVKHILIAAIGIHFFEHATGIEAVVLYSPRIFKKAGIRTR  272

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE  748
                LL T+++G TKT FIL+ATF LD+ GRRPLLLTS+GGMV +L+ LG+ LT+++H+ E
Sbjct  273   NKLLLTTMSVGLTKTCFILIATFLLDRVGRRPLLLTSLGGMVVSLSGLGLGLTMVEHTEE  332

Query  747   KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVS  568
             ++ WAV ++I   L++VA +S+G GPITWVYSSEIFPL+LRA G S+G  +NRV +G +S
Sbjct  333   RLVWAVTLSILAVLSFVAFYSVGLGPITWVYSSEIFPLRLRAQGASMGVAVNRVMNGTIS  392

Query  567   MTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALF  421
             MTFISLY AI+IGG+FF++  I+ + W+FFF L PET+G+ LEE E +F
Sbjct  393   MTFISLYNAITIGGAFFMFGGISILAWLFFFFLCPETRGRPLEEMEEVF  441



>ref|XP_008465477.1| PREDICTED: polyol transporter 5-like [Cucumis melo]
Length=517

 Score =   361 bits (927),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 184/321 (57%), Positives = 229/321 (71%), Gaps = 14/321 (4%)
 Frame = -3

Query  1290  GVSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIP---EHCDDE  1120
              + VL MPESPRWLVM+GR+ +A+RVL KTS S EE+  RL DIK AAGIP      DD 
Sbjct  202   AIVVLIMPESPRWLVMKGRIAEAKRVLDKTSVSIEESQQRLIDIKLAAGIPLNFSRTDDA  261

Query  1119  VVTV--TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEK  946
              VTV  +      +SVW+ELFI PTP V HILI  +G+H FQQASG D VVLY PRIFEK
Sbjct  262   NVTVPLSNSTTKGESVWKELFIHPTPPVRHILIAAIGLHFFQQASGNDGVVLYSPRIFEK  321

Query  945   AGIKSDTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTV  766
             AGI S   KLL T+A+G  KT FILVATF LD+ GRRP +LTSV G   +LA LG SLT+
Sbjct  322   AGITSSDHKLLATVAVGIVKTAFILVATFFLDRMGRRPCILTSVAGQTVSLATLGFSLTI  381

Query  765   IDHSHEKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRV  586
             I+ S EKV WA+ + IAM L+ V+ FSIG GP+  VY+SEIFPL+LRA G S+    NR+
Sbjct  382   INRSQEKVKWAIVLCIAMVLSNVSFFSIGLGPMAAVYTSEIFPLRLRALGVSVAIMANRI  441

Query  585   TSGVVSMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFR  406
             TSGVV+MTF+SLY A++IGG+FFL+A I+AV W+FF+ + PET+G+ LE+ E LFG  F 
Sbjct  442   TSGVVTMTFLSLYHALTIGGAFFLFAGISAVSWLFFYVVFPETRGQNLEDVERLFGN-FP  500

Query  405   WRSRQREVDAKKANNNSQLQM  343
             WR        KK N ++ +++
Sbjct  501   WR--------KKKNKDTNIEV  513



>ref|NP_001060109.2| Os07g0582500 [Oryza sativa Japonica Group]
 gb|EAZ40439.1| hypothetical protein OsJ_24894 [Oryza sativa Japonica Group]
 dbj|BAF22023.2| Os07g0582500 [Oryza sativa Japonica Group]
Length=502

 Score =   361 bits (926),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 182/291 (63%), Positives = 224/291 (77%), Gaps = 3/291 (1%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VL MPESPRWLVM+GRL DA+ VL K +D+PEEA  RLADIK AAGIP+  D +VVTV+K
Sbjct  189   VLGMPESPRWLVMKGRLADAKAVLEKIADTPEEASERLADIKAAAGIPDDLDGDVVTVSK  248

Query  1101  KRGDED-SVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDT  925
             KRG E+  VWREL +SPTPA+  I++  VG+H FQQASG+D+VVLY PR+F+ AGI  D 
Sbjct  249   KRGGEEGQVWRELVVSPTPAMRRIVLAAVGLHFFQQASGVDSVVLYSPRVFQSAGITGDD  308

Query  924   DKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-  748
               L  T A+GF KTVFILVA F LD+ GRRPLLLTS GGMV +L  L   LTV+  S + 
Sbjct  309   QLLGTTCAVGFAKTVFILVAAFLLDRAGRRPLLLTSTGGMVFSLVGLATGLTVVGGSPDA  368

Query  747   KVP-WAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             +VP WAV + +A  LAYVA FS+G GP++ VY+SEIFPL+ RA G ++    NRVTSGV+
Sbjct  369   QVPSWAVGLCVASILAYVAFFSVGLGPMSGVYTSEIFPLRARALGFAVAVACNRVTSGVI  428

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
             SMTF+SL  AI+IGGSFFLYAAI+++ WVFFFT +PET+G+TLEE   +FG
Sbjct  429   SMTFLSLSSAITIGGSFFLYAAISSLAWVFFFTRLPETRGQTLEEIGKVFG  479



>ref|XP_009121388.1| PREDICTED: LOW QUALITY PROTEIN: putative polyol transporter 1 
[Brassica rapa]
Length=511

 Score =   361 bits (927),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 171/293 (58%), Positives = 223/293 (76%), Gaps = 1/293 (0%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLV+QGR+GDA +VL KTS++ EEA  RL DIK AAGIPE   D+V+ V
Sbjct  200   IGVLAMPESPRWLVLQGRIGDAFKVLDKTSNTKEEAISRLNDIKRAAGIPEDMTDDVIVV  259

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               ++     VW++L + PTPAV HILI  +GIH  QQASGIDAVVLY P IF+KAG+KS 
Sbjct  260   PNRKSAGKGVWKDLLVRPTPAVRHILIACLGIHFAQQASGIDAVVLYSPTIFQKAGLKSK  319

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-H  751
              D+LL T+A+G  KT+FI+V T  +D+FGRR LLLTS+GGM  +L  LG SLTVID +  
Sbjct  320   NDQLLATVAVGIVKTLFIVVGTCVVDRFGRRALLLTSMGGMFLSLTALGTSLTVIDRNPG  379

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             + + WA+ +++   + +VA FSIGAGP+TWVY SEIFP++LRA G SLG  +NR+ SG++
Sbjct  380   QTLKWAIGLSVTTVMTFVATFSIGAGPVTWVYCSEIFPVRLRAQGASLGVMLNRLMSGII  439

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTF  412
              MTF+SL K ++IGG+F L+A +AA  WVFFFT +PET+G  LEE E+LFG++
Sbjct  440   GMTFLSLSKGLTIGGAFLLFAGVAAAAWVFFFTFLPETRGMPLEEMESLFGSY  492



>dbj|BAC83311.1| putative sorbitol transporter [Oryza sativa Japonica Group]
Length=511

 Score =   361 bits (926),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 182/291 (63%), Positives = 224/291 (77%), Gaps = 3/291 (1%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VL MPESPRWLVM+GRL DA+ VL K +D+PEEA  RLADIK AAGIP+  D +VVTV+K
Sbjct  198   VLGMPESPRWLVMKGRLADAKAVLEKIADTPEEASERLADIKAAAGIPDDLDGDVVTVSK  257

Query  1101  KRGDED-SVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDT  925
             KRG E+  VWREL +SPTPA+  I++  VG+H FQQASG+D+VVLY PR+F+ AGI  D 
Sbjct  258   KRGGEEGQVWRELVVSPTPAMRRIVLAAVGLHFFQQASGVDSVVLYSPRVFQSAGITGDD  317

Query  924   DKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-  748
               L  T A+GF KTVFILVA F LD+ GRRPLLLTS GGMV +L  L   LTV+  S + 
Sbjct  318   QLLGTTCAVGFAKTVFILVAAFLLDRAGRRPLLLTSTGGMVFSLVGLATGLTVVGGSPDA  377

Query  747   KVP-WAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             +VP WAV + +A  LAYVA FS+G GP++ VY+SEIFPL+ RA G ++    NRVTSGV+
Sbjct  378   QVPSWAVGLCVASILAYVAFFSVGLGPMSGVYTSEIFPLRARALGFAVAVACNRVTSGVI  437

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
             SMTF+SL  AI+IGGSFFLYAAI+++ WVFFFT +PET+G+TLEE   +FG
Sbjct  438   SMTFLSLSSAITIGGSFFLYAAISSLAWVFFFTRLPETRGQTLEEIGKVFG  488



>ref|XP_002886203.1| hypothetical protein ARALYDRAFT_343514 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62462.1| hypothetical protein ARALYDRAFT_343514 [Arabidopsis lyrata subsp. 
lyrata]
Length=511

 Score =   360 bits (924),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 173/310 (56%), Positives = 228/310 (74%), Gaps = 4/310 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLV+QGRLGDA +VL KTS++ EEA  RL DIK AAGIP+   D+V+ V
Sbjct  200   IGVLAMPESPRWLVLQGRLGDAFKVLDKTSNTKEEAITRLDDIKRAAGIPDDMTDDVIVV  259

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               K+     VW++L + PTP+V HILI  +GIH  QQASGIDAVVLY P IF +AG+KS 
Sbjct  260   PNKKSAGKGVWKDLLVRPTPSVRHILIACLGIHFAQQASGIDAVVLYSPTIFSRAGLKSK  319

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-H  751
              D+LL T+A+G  KT+FI+V T  +D+FGRR LLLTS+GGM  +L  LG SLTVID +  
Sbjct  320   NDQLLATVAVGVVKTLFIVVGTCVVDRFGRRALLLTSMGGMFLSLTALGTSLTVIDRNPG  379

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             + + WA+ +A+   + +VA FSIGAGP+TWVY SEIFP++LRA G SLG  +NR+ SG++
Sbjct  380   QTIKWAIGLAVTTVMTFVATFSIGAGPVTWVYCSEIFPVRLRAQGASLGVMLNRLMSGII  439

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
              MTF+SL K ++IGG+F L+A +AA  WVFFFT +PET+G  LEE E+LFG++    + +
Sbjct  440   GMTFLSLSKGLTIGGAFLLFAGVAAAAWVFFFTFLPETRGMPLEEMESLFGSY---TANK  496

Query  390   REVDAKKANN  361
             ++    K N 
Sbjct  497   KKNSVSKDNE  506



>gb|EAZ04481.1| hypothetical protein OsI_26630 [Oryza sativa Indica Group]
Length=502

 Score =   359 bits (921),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 181/291 (62%), Positives = 223/291 (77%), Gaps = 3/291 (1%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VL MPESPRWLVM+GRL DA+ VL K +D+PEEA  RLADIK AAGIP+  D +VVTV+K
Sbjct  189   VLGMPESPRWLVMKGRLADAKAVLEKIADTPEEASERLADIKAAAGIPDDLDGDVVTVSK  248

Query  1101  KRGDED-SVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDT  925
             KRG E+  VWREL +SPTPA+  I++  VG+H FQQASG+D+VVLY PR+F+ AGI  D 
Sbjct  249   KRGGEEGQVWRELVVSPTPAMRRIVLAAVGLHFFQQASGVDSVVLYSPRVFQSAGITGDD  308

Query  924   DKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHE-  748
               L  T A+G  KTVFILVA F LD+ GRRPLLLTS GGMV +L  L   LTV+  S + 
Sbjct  309   QLLGTTCAVGVAKTVFILVAAFLLDRAGRRPLLLTSTGGMVFSLVGLATGLTVVGRSPDA  368

Query  747   KVP-WAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             +VP WAV + +A  LAYVA FS+G GP++ VY+SEIFPL+ RA G ++    NRVTSGV+
Sbjct  369   QVPSWAVGLCVASILAYVAFFSVGLGPMSGVYTSEIFPLRARALGFAVAVACNRVTSGVI  428

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
             SMTF+SL  AI+IGGSFFLYAAI+++ WVFFFT +PET+G+TLEE   +FG
Sbjct  429   SMTFLSLSSAITIGGSFFLYAAISSLAWVFFFTRLPETRGQTLEEIGKVFG  479



>ref|XP_008447047.1| PREDICTED: polyol transporter 5-like [Cucumis melo]
Length=519

 Score =   359 bits (922),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 179/304 (59%), Positives = 226/304 (74%), Gaps = 3/304 (1%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             VL MPESPRWLVM+GR+ +A+RVL KTS S  E+  RL DIK AAGI +   + VV ++ 
Sbjct  214   VLVMPESPRWLVMKGRIPEAKRVLDKTSASILESQQRLLDIKNAAGIDD--VNGVVPLSN  271

Query  1101  KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTD  922
                   SVW+ELFI PTP+V HILI  +G+H FQQASG D+VVLY PRIFEKAGI S   
Sbjct  272   PHKQGKSVWKELFIHPTPSVRHILIAALGLHFFQQASGSDSVVLYSPRIFEKAGITSSDH  331

Query  921   KLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKV  742
             KLL T+A+G  K +FILVATF LD+ GRRPL+LTSV G   +LA+LG SLT+I++S  KV
Sbjct  332   KLLATVAVGIVKAIFILVATFLLDRVGRRPLILTSVAGQTISLAILGFSLTIINNSDVKV  391

Query  741   PWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMT  562
              WA+ + IA  L+ VA FSIG GP++ VY+SEIFPL+LRA G S+   +NR+ SGVV+MT
Sbjct  392   KWAIVLCIATVLSNVAFFSIGLGPMSPVYTSEIFPLRLRALGVSVAVTLNRIVSGVVAMT  451

Query  561   FISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV  382
             F+SLY A++IGG+FFLYA IAAVGW+FFF + PET+G  LE+ E LFG  F WR ++ + 
Sbjct  452   FLSLYHALTIGGAFFLYAGIAAVGWLFFFVVFPETRGHNLEDIEGLFGN-FSWRLKKNKN  510

Query  381   DAKK  370
              A +
Sbjct  511   TAME  514



>ref|XP_006299557.1| hypothetical protein CARUB_v10015731mg [Capsella rubella]
 gb|EOA32455.1| hypothetical protein CARUB_v10015731mg [Capsella rubella]
Length=511

 Score =   359 bits (921),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 173/310 (56%), Positives = 226/310 (73%), Gaps = 11/310 (4%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLV+QGRLGDA +VL KTS++ EEA  RL DIK A GIP+   D+V+ V
Sbjct  200   IGVLAMPESPRWLVLQGRLGDAFKVLDKTSNTKEEAISRLNDIKRATGIPDDMTDDVIVV  259

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               K+     VW++L + PTP+V HILI  +GIH  QQASGIDAVVLY P IF KAG+KS 
Sbjct  260   PNKKSAGKGVWKDLLVRPTPSVRHILIACLGIHFAQQASGIDAVVLYSPTIFSKAGLKSK  319

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-H  751
              D+LL T+A+G  KT+FI+V T  +D+FGRR LLLTS+GGM  +L  LG SLTVID +  
Sbjct  320   NDQLLATVAVGVVKTLFIVVGTCVVDRFGRRALLLTSMGGMFISLTALGTSLTVIDRNPG  379

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             + + WA+ +++   +++VA FSIGAGP+TWVY SEIFP++LRA G SLG  +NR+ SG++
Sbjct  380   QTLKWAIGLSVTTVMSFVATFSIGAGPVTWVYCSEIFPVRLRAQGASLGVMLNRLMSGII  439

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
              MTF+SL K ++IGG+F L+A ++A  WVFFFT +PET+G  LEE E+LFG++       
Sbjct  440   GMTFLSLSKGLTIGGAFLLFAGVSAAAWVFFFTFLPETRGVALEEMESLFGSY-------  492

Query  390   REVDAKKANN  361
                 A K NN
Sbjct  493   ---SANKKNN  499



>ref|XP_010435020.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   359 bits (921),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 171/310 (55%), Positives = 229/310 (74%), Gaps = 11/310 (4%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLV+QGR+GDA +VL KTS++ EEA  RL DIK AAGIP+   D+V+ +
Sbjct  200   IGVLAMPESPRWLVIQGRIGDAFKVLDKTSNTKEEAISRLNDIKRAAGIPDDMTDDVIVL  259

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               K+     VW++L + PTP+V HILI  +GIH  QQASGIDAVVLY P IF KAG++S 
Sbjct  260   PNKKTAGKGVWKDLLVRPTPSVRHILIACLGIHFAQQASGIDAVVLYSPNIFSKAGLRSK  319

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVID-HSH  751
              D+LL T+A+G  KT+FI+V T  +D+FGRR LLLTS+GGM  +L+ LG SLTVI+ +  
Sbjct  320   NDQLLATVAVGVVKTLFIVVGTCVVDRFGRRALLLTSMGGMFISLSALGTSLTVINMNPG  379

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             + + WA+ +++   +++VA FSIGAGP+TWVY SEIFP++LRA G SLG  +NR+ SG++
Sbjct  380   QTIKWAIGLSVTTVMSFVATFSIGAGPVTWVYCSEIFPVRLRAQGASLGVMLNRLMSGII  439

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
              MTF+SL K ++IGG+F L+A +AA  WVFFFT +PET+G  LEE E+LFG++       
Sbjct  440   GMTFLSLAKGLTIGGAFLLFAGVAAAAWVFFFTFLPETRGVALEEMESLFGSY-------  492

Query  390   REVDAKKANN  361
                +A K NN
Sbjct  493   ---NANKKNN  499



>ref|XP_004985337.1| PREDICTED: polyol transporter 5-like isoform X1 [Setaria italica]
Length=517

 Score =   358 bits (920),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 182/316 (58%), Positives = 227/316 (72%), Gaps = 6/316 (2%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGR+GDARRVL KTS+SP EA  RLADIK A GIPE    +   V
Sbjct  200   LGVLAMPESPRWLVMQGRIGDARRVLAKTSNSPAEAEERLADIKRAIGIPEGVGGDDDDV  259

Query  1107  -----TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKA  943
                    K    + VWR+L + PTP V  ILI  +G+  FQQASGID+VVLY PR+F+KA
Sbjct  260   VVVARNNKGTHGEGVWRDLLLRPTPPVRRILIACLGLQFFQQASGIDSVVLYSPRVFQKA  319

Query  942   GIKSDTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVI  763
             G++SD++ L  T+A+G  KT+FILVATF LD+ GRRPLLLTS GGMV +L  L  +L  I
Sbjct  320   GLQSDSNSLGATMAVGACKTLFILVATFFLDRVGRRPLLLTSAGGMVVSLVTLASALHAI  379

Query  762   DHSHEKVPWAVA-MAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRV  586
             D      P  +A ++IA  L +VA+FSIG GPI WVYSSEIFPL+LRA GC+LGT +NR+
Sbjct  380   DRLPTGQPTPLAGVSIAAVLTFVASFSIGMGPIAWVYSSEIFPLRLRAQGCALGTAMNRI  439

Query  585   TSGVVSMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFR  406
              SG ++M+FISLYKAI+  GSF++YA IAA GWVF F  +PET+G++LE+TE LFG    
Sbjct  440   MSGAITMSFISLYKAITFAGSFYVYAGIAAAGWVFMFFFLPETRGRSLEDTEKLFGGGDG  499

Query  405   WRSRQREVDAKKANNN  358
                R+ E DA+K +  
Sbjct  500   QDGREDERDAQKKSTE  515



>ref|XP_006409469.1| hypothetical protein EUTSA_v10023129mg [Eutrema salsugineum]
 gb|ESQ50922.1| hypothetical protein EUTSA_v10023129mg [Eutrema salsugineum]
Length=511

 Score =   358 bits (920),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 172/306 (56%), Positives = 229/306 (75%), Gaps = 3/306 (1%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLV+QGRLGDA +VL KTS++ EEA  RL DIK AAGIPE   ++V+ V
Sbjct  200   IGVLAMPESPRWLVLQGRLGDAFKVLDKTSNTKEEAISRLDDIKRAAGIPEDMTEDVIVV  259

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               K+     VW++L + PTP+V HILI  +GIH  QQASGIDAVVLY P IF KAG+KS 
Sbjct  260   PNKKSVGKGVWKDLLVRPTPSVRHILIACLGIHFSQQASGIDAVVLYSPTIFSKAGLKSK  319

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-H  751
              D+LL T+A+G  KT+FI+V T  +D+FGRR LLLTS+GGM  +L  LG SLTVID +  
Sbjct  320   NDQLLATVAVGVVKTLFIIVGTCVVDRFGRRALLLTSMGGMFLSLTALGTSLTVIDRNPG  379

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             + + WA+ +++   + +VA FSIGAGP+TWVY SEIFP++LRA G SLG  +NR+ SG++
Sbjct  380   QTLKWAIGLSVTTVMMFVATFSIGAGPVTWVYCSEIFPVRLRAQGASLGVMLNRLMSGII  439

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
              MTF+SL K ++IGG+F L+A +AA  W+FFFT +PET+G  LEE E+LFG++    +++
Sbjct  440   GMTFLSLSKGLTIGGAFLLFAGVAAAAWIFFFTFLPETRGMPLEEMESLFGSY--TANKK  497

Query  390   REVDAK  373
             + V +K
Sbjct  498   KNVTSK  503



>ref|XP_002440825.1| hypothetical protein SORBIDRAFT_09g007450 [Sorghum bicolor]
 gb|EES19255.1| hypothetical protein SORBIDRAFT_09g007450 [Sorghum bicolor]
Length=524

 Score =   358 bits (920),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 184/321 (57%), Positives = 226/321 (70%), Gaps = 16/321 (5%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV--  1108
             VLAMPESPRWLVMQGR+GDARRVL KTSDSP EA  RLADIK+A GIP+   D       
Sbjct  205   VLAMPESPRWLVMQGRIGDARRVLAKTSDSPAEAEERLADIKKAIGIPDGIGDNAAADDD  264

Query  1107  --------TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIF  952
                     +K+    + VWR+L I PTP V  ILI  +G+  FQQASGID+VVLY PR+F
Sbjct  265   DVVVVARRSKQGSHGEGVWRDLLIRPTPPVRRILIACLGLQCFQQASGIDSVVLYSPRVF  324

Query  951   EKAGIKSDTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSL  772
             EKAG++SD + L  T+A+G +KT+FILVATF LD+ GRRPLLLTS GGMV +L  L  +L
Sbjct  325   EKAGLRSDNNSLGATMAVGASKTLFILVATFFLDRVGRRPLLLTSAGGMVVSLVTLASAL  384

Query  771   TVIDHSHE--KVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTG  598
               ID   E    P A  ++IA  L +VA+FSIG GPI WVYSSEIFPL+LRA GC+LGT 
Sbjct  385   HAIDRLPEGHATPLA-GVSIAAVLTFVASFSIGMGPIAWVYSSEIFPLRLRAQGCALGTA  443

Query  597   INRVTSGVVSMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFG  418
             +NR+ SG ++M+FISLYKAI++ GSF+LYA IAA GW+F F  +PET+G++LE+TE LFG
Sbjct  444   MNRIMSGAITMSFISLYKAITLAGSFYLYAGIAAAGWLFMFFFLPETRGRSLEDTEKLFG  503

Query  417   TFFRWRSRQREVDAKKANNNS  355
                     + E D     N S
Sbjct  504   G---GDHGEDEEDGHDGQNKS  521



>gb|KGN56185.1| hypothetical protein Csa_3G095020 [Cucumis sativus]
Length=471

 Score =   357 bits (915),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 175/309 (57%), Positives = 230/309 (74%), Gaps = 6/309 (2%)
 Frame = -3

Query  1281  VLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTVTK  1102
             +L MPESPRWLVMQGRLG+A++VL++TSD+ EE+  RL DIK A GI   C+++VV + K
Sbjct  169   ILVMPESPRWLVMQGRLGEAKQVLIRTSDTIEESLQRLDDIKTAVGISASCEEDVVEIRK  228

Query  1101  KRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSDTD  922
             + G    VW+E F+ PTPAV HILI  VG+H FQ+ASG +A VLY PRIFEKAGI S   
Sbjct  229   QTGS--GVWKE-FLHPTPAVRHILIAAVGVHFFQEASGTNAAVLYSPRIFEKAGISSSDQ  285

Query  921   KLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSHEKV  742
             KLL T+A+G  KT FILVAT   D+ GRRPL+L S+GGM+ +L  LG+ LT+I+ S E+ 
Sbjct  286   KLLATVAVGVVKTAFILVATILFDRVGRRPLILMSLGGMIVSLITLGVGLTIIERSQEEG  345

Query  741   PWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVVSMT  562
              W V + ++M L  VA FS+G GP+++V SSE+FPLKLRA G SLG  +N VT G+VSMT
Sbjct  346   TWVVGLCVSMVLMDVAFFSMGIGPMSYV-SSELFPLKLRAQGMSLGMVVNNVTGGIVSMT  404

Query  561   FISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQREV  382
             F+SLY+AI+IGG+FF+YAAIA VGWVFF+ + PET+G  LE+ E LFG    W+     +
Sbjct  405   FLSLYRAITIGGAFFVYAAIAMVGWVFFYVVFPETRGHNLEDVERLFGNLL-WK-FSHTL  462

Query  381   DAKKANNNS  355
             DA++++ N+
Sbjct  463   DAEESSENA  471



>ref|XP_008795662.1| PREDICTED: probable polyol transporter 6 [Phoenix dactylifera]
Length=480

 Score =   357 bits (915),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 173/321 (54%), Positives = 234/321 (73%), Gaps = 12/321 (4%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             V +  MPESPRWLVMQG + DAR VL++ S+S EEA +RL +IK AAG+ E C  +VV +
Sbjct  166   VGIWKMPESPRWLVMQGHIKDARDVLVRVSNSREEAELRLKEIKGAAGVDESCTGDVVKL  225

Query  1107  TKK-RGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKS  931
             TK  RG+   VW+EL + PTP V  ILI  +GIH F+ A+GI+AVVLY PRIF+KAGI +
Sbjct  226   TKSTRGE--GVWKELLLRPTPPVKRILIAAIGIHFFEHATGIEAVVLYSPRIFKKAGITT  283

Query  930   DTDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHSH  751
                 L+ T+ +G TKT FIL+ATF LD+ GRRPLLLTS+GGM+ +L+ LG+ LT+++H+ 
Sbjct  284   RNKLLVATMGVGLTKTFFILIATFLLDRVGRRPLLLTSLGGMIVSLSGLGLGLTMVEHTE  343

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             E++ WA++++I     +VA+FSIG GPITWVYSSEIFPLKLRA G S+G  +NRV +G +
Sbjct  344   ERLVWAISLSILTVFFFVASFSIGLGPITWVYSSEIFPLKLRAQGASIGVAVNRVMNGTI  403

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
             SMTFISLYKAI+IGG+FF++A I+ + W+FFF L PET+G+ LEE E +F    +W    
Sbjct  404   SMTFISLYKAITIGGAFFMFAGISILAWMFFFFLCPETKGRPLEEMEEVFSK--KWLY--  459

Query  390   REVDAKKANNNSQLQMGTLQA  328
                   +  N  + +MG ++A
Sbjct  460   -----SRPVNRERFEMGKVEA  475



>ref|NP_179210.1| polyol/monosaccharide transporter 2 [Arabidopsis thaliana]
 sp|Q9XIH6.1|PLT2_ARATH RecName: Full=Putative polyol transporter 2 [Arabidopsis thaliana]
 gb|AAD26955.1| putative sugar transporter [Arabidopsis thaliana]
 gb|AEC06468.1| polyol/monosaccharide transporter 2 [Arabidopsis thaliana]
Length=511

 Score =   357 bits (916),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 173/310 (56%), Positives = 225/310 (73%), Gaps = 11/310 (4%)
 Frame = -3

Query  1287  VSVLAMPESPRWLVMQGRLGDARRVLLKTSDSPEEAHMRLADIKEAAGIPEHCDDEVVTV  1108
             + VLAMPESPRWLVMQGRLGDA +VL KTS++ EEA  RL DIK A GIP+   D+V+ V
Sbjct  200   IGVLAMPESPRWLVMQGRLGDAFKVLDKTSNTKEEAISRLNDIKRAVGIPDDMTDDVIVV  259

Query  1107  TKKRGDEDSVWRELFISPTPAVLHILITGVGIHLFQQASGIDAVVLYGPRIFEKAGIKSD  928
               K+     VW++L + PTP+V HILI  +GIH  QQASGIDAVVLY P IF +AG+KS 
Sbjct  260   PNKKSAGKGVWKDLLVRPTPSVRHILIACLGIHFSQQASGIDAVVLYSPTIFSRAGLKSK  319

Query  927   TDKLLCTIAIGFTKTVFILVATFTLDKFGRRPLLLTSVGGMVTTLALLGMSLTVIDHS-H  751
              D+LL T+A+G  KT+FI+V T  +D+FGRR LLLTS+GGM  +L  LG SLTVID +  
Sbjct  320   NDQLLATVAVGVVKTLFIVVGTCLVDRFGRRALLLTSMGGMFFSLTALGTSLTVIDRNPG  379

Query  750   EKVPWAVAMAIAMTLAYVAAFSIGAGPITWVYSSEIFPLKLRATGCSLGTGINRVTSGVV  571
             + + WA+ +A+   + +VA FS+GAGP+TWVY+SEIFP++LRA G SLG  +NR+ SG++
Sbjct  380   QTLKWAIGLAVTTVMTFVATFSLGAGPVTWVYASEIFPVRLRAQGASLGVMLNRLMSGII  439

Query  570   SMTFISLYKAISIGGSFFLYAAIAAVGWVFFFTLMPETQGKTLEETEALFGTFFRWRSRQ  391
              MTF+SL K ++IGG+F L+A +A   WVFFFT +PET+G  LEE E+LFG++       
Sbjct  440   GMTFLSLSKGLTIGGAFLLFAGVAVAAWVFFFTFLPETRGVPLEEIESLFGSY-------  492

Query  390   REVDAKKANN  361
                 A K NN
Sbjct  493   ---SANKKNN  499



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3713195021306