BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13756

Length=748
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007011772.1|  TRS120 isoform 1                                   305   8e-92   
ref|XP_006450337.1|  hypothetical protein CICLE_v10007276mg             298   2e-89   
ref|XP_006483432.1|  PREDICTED: uncharacterized protein LOC102615624    298   2e-89   Citrus sinensis [apfelsine]
gb|KDO46778.1|  hypothetical protein CISIN_1g045708mg                   298   2e-89   Citrus sinensis [apfelsine]
gb|KJB07659.1|  hypothetical protein B456_001G035900                    295   2e-88   Gossypium raimondii
ref|XP_009618490.1|  PREDICTED: trafficking protein particle comp...    292   5e-88   Nicotiana tomentosiformis
ref|XP_011074995.1|  PREDICTED: trafficking protein particle comp...    293   1e-87   Sesamum indicum [beniseed]
ref|NP_001237873.1|  uncharacterized protein LOC100305609               271   2e-87   
ref|XP_009618489.1|  PREDICTED: trafficking protein particle comp...    292   3e-87   Nicotiana tomentosiformis
ref|XP_009618488.1|  PREDICTED: trafficking protein particle comp...    292   3e-87   Nicotiana tomentosiformis
ref|XP_009778820.1|  PREDICTED: uncharacterized protein LOC104228...    290   3e-87   Nicotiana sylvestris
ref|XP_010648709.1|  PREDICTED: trafficking protein particle comp...    291   8e-87   Vitis vinifera
ref|XP_010648710.1|  PREDICTED: trafficking protein particle comp...    290   9e-87   Vitis vinifera
ref|XP_010322725.1|  PREDICTED: uncharacterized protein LOC101266...    288   1e-86   
ref|XP_009778819.1|  PREDICTED: trafficking protein particle comp...    290   2e-86   Nicotiana sylvestris
ref|XP_009778818.1|  PREDICTED: trafficking protein particle comp...    290   2e-86   Nicotiana sylvestris
ref|XP_004241792.1|  PREDICTED: trafficking protein particle comp...    288   7e-86   Solanum lycopersicum
ref|XP_010244785.1|  PREDICTED: trafficking protein particle comp...    288   8e-86   Nelumbo nucifera [Indian lotus]
ref|XP_010244786.1|  PREDICTED: trafficking protein particle comp...    288   9e-86   Nelumbo nucifera [Indian lotus]
ref|XP_002515463.1|  conserved hypothetical protein                     287   1e-85   
emb|CDP18799.1|  unnamed protein product                                286   4e-85   Coffea canephora [robusta coffee]
ref|XP_006353665.1|  PREDICTED: trafficking protein particle comp...    282   6e-84   Solanum tuberosum [potatoes]
ref|XP_009355811.1|  PREDICTED: trafficking protein particle comp...    279   2e-83   Pyrus x bretschneideri [bai li]
ref|XP_008394133.1|  PREDICTED: uncharacterized protein LOC103456...    278   6e-83   
ref|XP_009355810.1|  PREDICTED: trafficking protein particle comp...    279   9e-83   Pyrus x bretschneideri [bai li]
gb|EYU32374.1|  hypothetical protein MIMGU_mgv1a000384mg                278   1e-82   Erythranthe guttata [common monkey flower]
ref|XP_007161157.1|  hypothetical protein PHAVU_001G047300g             278   2e-82   Phaseolus vulgaris [French bean]
ref|XP_008394132.1|  PREDICTED: trafficking protein particle comp...    278   3e-82   
emb|CBI21099.3|  unnamed protein product                                277   3e-82   Vitis vinifera
ref|XP_012076471.1|  PREDICTED: trafficking protein particle comp...    277   5e-82   Jatropha curcas
gb|KJB65887.1|  hypothetical protein B456_010G117200                    276   6e-82   Gossypium raimondii
gb|KJB65888.1|  hypothetical protein B456_010G117200                    276   7e-82   Gossypium raimondii
gb|KJB65886.1|  hypothetical protein B456_010G117200                    276   7e-82   Gossypium raimondii
ref|XP_011458837.1|  PREDICTED: trafficking protein particle comp...    275   9e-82   Fragaria vesca subsp. vesca
ref|XP_008219551.1|  PREDICTED: trafficking protein particle comp...    275   1e-81   Prunus mume [ume]
ref|XP_010265703.1|  PREDICTED: trafficking protein particle comp...    276   1e-81   Nelumbo nucifera [Indian lotus]
ref|XP_007225443.1|  hypothetical protein PRUPE_ppa000412mg             275   2e-81   Prunus persica
ref|XP_002324891.2|  hypothetical protein POPTR_0018s02220g             275   3e-81   
ref|XP_011458836.1|  PREDICTED: trafficking protein particle comp...    275   3e-81   Fragaria vesca subsp. vesca
ref|XP_004290928.1|  PREDICTED: trafficking protein particle comp...    275   4e-81   Fragaria vesca subsp. vesca
ref|XP_011036637.1|  PREDICTED: trafficking protein particle comp...    274   4e-81   Populus euphratica
ref|XP_011036636.1|  PREDICTED: trafficking protein particle comp...    274   5e-81   Populus euphratica
ref|XP_008219549.1|  PREDICTED: trafficking protein particle comp...    274   6e-81   Prunus mume [ume]
ref|XP_008219550.1|  PREDICTED: trafficking protein particle comp...    274   6e-81   Prunus mume [ume]
ref|XP_006595493.1|  PREDICTED: uncharacterized protein LOC100305...    273   1e-80   Glycine max [soybeans]
ref|XP_003550201.1|  PREDICTED: trafficking protein particle comp...    272   2e-80   Glycine max [soybeans]
ref|XP_004498769.1|  PREDICTED: trafficking protein particle comp...    271   4e-80   Cicer arietinum [garbanzo]
ref|XP_010105451.1|  hypothetical protein L484_003461                   271   5e-80   Morus notabilis
ref|XP_010519641.1|  PREDICTED: trafficking protein particle comp...    271   6e-80   Tarenaya hassleriana [spider flower]
gb|KEH39853.1|  transporter TRS120                                      270   1e-79   Medicago truncatula
ref|XP_002309653.2|  hypothetical protein POPTR_0006s27580g             270   2e-79   Populus trichocarpa [western balsam poplar]
gb|KHG29759.1|  Trafficking particle complex subunit 9                  270   2e-79   Gossypium arboreum [tree cotton]
ref|XP_010048925.1|  PREDICTED: trafficking protein particle comp...    268   8e-79   Eucalyptus grandis [rose gum]
ref|XP_010048924.1|  PREDICTED: trafficking protein particle comp...    268   9e-79   Eucalyptus grandis [rose gum]
ref|XP_010665754.1|  PREDICTED: trafficking protein particle comp...    268   1e-78   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX97076.1|  BnaC09g45490D                                          266   4e-78   
ref|XP_006399603.1|  hypothetical protein EUTSA_v10012483mg             266   5e-78   Eutrema salsugineum [saltwater cress]
gb|KFK37733.1|  hypothetical protein AALP_AA3G022200                    266   5e-78   Arabis alpina [alpine rockcress]
ref|XP_010942155.1|  PREDICTED: trafficking protein particle comp...    266   6e-78   
ref|XP_009122000.1|  PREDICTED: trafficking protein particle comp...    265   8e-78   Brassica rapa
emb|CDX69788.1|  BnaA10g21370D                                          263   3e-77   
ref|XP_011039615.1|  PREDICTED: trafficking protein particle comp...    262   1e-76   Populus euphratica
ref|XP_008452884.1|  PREDICTED: transport protein particle subuni...    262   1e-76   Cucumis melo [Oriental melon]
ref|XP_006286929.1|  hypothetical protein CARUB_v10000071mg             258   1e-76   
ref|XP_002871450.1|  hypothetical protein ARALYDRAFT_487936             261   1e-76   
ref|XP_006286927.1|  hypothetical protein CARUB_v10000071mg             259   4e-76   
ref|NP_196665.1|  protein TRS120                                        260   6e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009381560.1|  PREDICTED: trafficking protein particle comp...    260   6e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008784808.1|  PREDICTED: trafficking protein particle comp...    260   7e-76   Phoenix dactylifera
ref|XP_006286928.1|  hypothetical protein CARUB_v10000071mg             259   1e-75   Capsella rubella
ref|XP_010453144.1|  PREDICTED: trafficking protein particle comp...    259   1e-75   Camelina sativa [gold-of-pleasure]
ref|XP_003623310.1|  hypothetical protein MTR_7g069440                  247   1e-75   
ref|XP_010491797.1|  PREDICTED: trafficking protein particle comp...    258   3e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010491799.1|  PREDICTED: trafficking protein particle comp...    258   3e-75   
ref|XP_010419658.1|  PREDICTED: trafficking protein particle comp...    257   6e-75   Camelina sativa [gold-of-pleasure]
ref|XP_004145518.1|  PREDICTED: trafficking protein particle comp...    257   6e-75   Cucumis sativus [cucumbers]
gb|ERN10399.1|  hypothetical protein AMTR_s00026p00150010               257   6e-75   Amborella trichopoda
ref|XP_011625069.1|  PREDICTED: trafficking protein particle comp...    257   6e-75   Amborella trichopoda
ref|XP_002446750.1|  hypothetical protein SORBIDRAFT_06g021740          248   9e-72   
tpg|DAA37075.1|  TPA: hypothetical protein ZEAMMB73_993824              246   5e-71   
ref|XP_008669201.1|  PREDICTED: trafficking protein particle comp...    246   6e-71   Zea mays [maize]
gb|EMS61444.1|  hypothetical protein TRIUR3_09999                       243   8e-70   Triticum urartu
dbj|BAJ94931.1|  predicted protein                                      241   2e-69   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT13211.1|  hypothetical protein F775_03305                         241   7e-69   
ref|XP_010227185.1|  PREDICTED: LOW QUALITY PROTEIN: trafficking ...    238   6e-68   
gb|EPS63566.1|  hypothetical protein M569_11217                         237   6e-68   Genlisea aurea
ref|XP_004976133.1|  PREDICTED: trafficking protein particle comp...    234   8e-67   Setaria italica
ref|XP_004976134.1|  PREDICTED: trafficking protein particle comp...    234   9e-67   
ref|NP_001053234.1|  Os04g0502200                                       233   2e-66   
gb|EEC77580.1|  hypothetical protein OsI_16530                          233   3e-66   Oryza sativa Indica Group [Indian rice]
emb|CAH67557.1|  H0311C03.11                                            233   4e-66   Oryza sativa [red rice]
ref|XP_006653574.1|  PREDICTED: trafficking protein particle comp...    231   6e-66   
gb|EEE61278.1|  hypothetical protein OsJ_15360                          229   9e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010453143.1|  PREDICTED: uncharacterized protein LOC104735118    205   8e-63   Camelina sativa [gold-of-pleasure]
gb|AES79528.2|  transporter TRS120                                      197   4e-57   Medicago truncatula
ref|XP_007011773.1|  Trafficking protein particle complex subunit...    199   1e-54   
ref|XP_009362330.1|  PREDICTED: uncharacterized protein LOC103952471    181   3e-53   Pyrus x bretschneideri [bai li]
ref|XP_001774293.1|  predicted protein                                  176   4e-46   
gb|EYU32375.1|  hypothetical protein MIMGU_mgv1a000384mg                175   8e-46   Erythranthe guttata [common monkey flower]
emb|CAE01639.1|  OSJNBa0029H02.30                                       172   1e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001777714.1|  predicted protein                                  167   6e-43   
ref|XP_009762936.1|  PREDICTED: uncharacterized protein LOC104214912    150   1e-40   Nicotiana sylvestris
ref|XP_002962206.1|  hypothetical protein SELMODRAFT_77626              150   3e-37   
ref|XP_002965121.1|  hypothetical protein SELMODRAFT_83253              149   1e-36   
gb|AFW58779.1|  hypothetical protein ZEAMMB73_746167                    125   2e-30   
ref|XP_008664222.1|  PREDICTED: LOW QUALITY PROTEIN: trafficking ...    124   4e-28   
ref|XP_002980237.1|  hypothetical protein SELMODRAFT_444472             122   2e-27   
ref|XP_002963095.1|  hypothetical protein SELMODRAFT_165701           95.5    2e-18   



>ref|XP_007011772.1| TRS120 isoform 1 [Theobroma cacao]
 gb|EOY29391.1| TRS120 isoform 1 [Theobroma cacao]
Length=1201

 Score =   305 bits (780),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 152/195 (78%), Positives = 171/195 (88%), Gaps = 3/195 (2%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS---PEIDVP  578
             SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGF LA+NGS    ++D+P
Sbjct  1006  SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFRLARNGSENASKLDLP  1065

Query  577   KEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTV  398
             KE +      A K+ VIAH+MTPMEVLVRNNTKETIK++LS+TCRDVAGENCVEG K TV
Sbjct  1066  KELNTSIQPSASKNFVIAHDMTPMEVLVRNNTKETIKMNLSVTCRDVAGENCVEGTKATV  1125

Query  397   LWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDES  218
             LWAGVL+GI MEVPPLQE KH FS+YFLVPGEYTL+AAA IDDAN++LRARA++ S DE 
Sbjct  1126  LWAGVLSGITMEVPPLQESKHCFSLYFLVPGEYTLVAAAVIDDANDVLRARAKSKSPDEP  1185

Query  217   IFCRGPPFHIRVNGT  173
             IFCRGPPFH+ V+GT
Sbjct  1186  IFCRGPPFHVHVDGT  1200



>ref|XP_006450337.1| hypothetical protein CICLE_v10007276mg [Citrus clementina]
 gb|ESR63577.1| hypothetical protein CICLE_v10007276mg [Citrus clementina]
Length=1193

 Score =   298 bits (763),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 165/192 (86%), Gaps = 3/192 (2%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             SRIKVRWQSGRNSSGELNIKDA+QAALQSSVMDVLLPDPLTFGF L K GS E D   E 
Sbjct  1004  SRIKVRWQSGRNSSGELNIKDAVQAALQSSVMDVLLPDPLTFGFRLVKKGS-EQDA--EL  1060

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
             D+ N+S   K SV+AH+MTPMEVLVRNNTKE IK+SLSITCRDVAGENC+EG K TVLW+
Sbjct  1061  DLPNDSSGPKGSVLAHDMTPMEVLVRNNTKEMIKMSLSITCRDVAGENCIEGTKPTVLWS  1120

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             GVLN I MEVPPLQE KH FS+YFLVPGEYTL+AAA IDDAN ILRARAR  S DE IFC
Sbjct  1121  GVLNEITMEVPPLQESKHCFSLYFLVPGEYTLVAAAVIDDANNILRARARTDSPDEPIFC  1180

Query  208   RGPPFHIRVNGT  173
             RGPPFH+RV+GT
Sbjct  1181  RGPPFHVRVSGT  1192



>ref|XP_006483432.1| PREDICTED: uncharacterized protein LOC102615624 [Citrus sinensis]
Length=1196

 Score =   298 bits (762),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 165/192 (86%), Gaps = 3/192 (2%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             SRIKVRWQSGRNSSGELNIKDA+QAALQSSVMDVLLPDPLTFGF L K GS E D   E 
Sbjct  1007  SRIKVRWQSGRNSSGELNIKDAVQAALQSSVMDVLLPDPLTFGFRLVKKGS-EQDA--EL  1063

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
             D+ N+S   K SV+AH+MTPMEVLVRNNTKE IK+SLSITCRDVAGENC+EG K TVLW+
Sbjct  1064  DLPNDSSGPKGSVLAHDMTPMEVLVRNNTKEMIKMSLSITCRDVAGENCIEGTKPTVLWS  1123

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             GVLN I MEVPPLQE KH FS+YFLVPGEYTL+AAA IDDAN ILRARAR  S DE IFC
Sbjct  1124  GVLNEITMEVPPLQESKHCFSLYFLVPGEYTLVAAAVIDDANNILRARARTDSPDEPIFC  1183

Query  208   RGPPFHIRVNGT  173
             RGPPFH+RV+GT
Sbjct  1184  RGPPFHVRVSGT  1195



>gb|KDO46778.1| hypothetical protein CISIN_1g045708mg [Citrus sinensis]
Length=1196

 Score =   298 bits (762),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 165/192 (86%), Gaps = 3/192 (2%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             SRIKVRWQSGRNSSGELNIKDA+QAALQSSVMDVLLPDPLTFGF L K GS E D   E 
Sbjct  1007  SRIKVRWQSGRNSSGELNIKDAVQAALQSSVMDVLLPDPLTFGFRLVKKGS-EQDA--EL  1063

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
             D+ N+S   K SV+AH+MTPMEVLVRNNTKE IK+SLSITCRDVAGENC+EG K TVLW+
Sbjct  1064  DLPNDSSGPKGSVLAHDMTPMEVLVRNNTKEMIKMSLSITCRDVAGENCIEGTKPTVLWS  1123

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             GVLN I MEVPPLQE KH FS+YFLVPGEYTL+AAA IDDAN ILRARAR  S DE IFC
Sbjct  1124  GVLNEITMEVPPLQESKHCFSLYFLVPGEYTLVAAAVIDDANNILRARARTDSPDEPIFC  1183

Query  208   RGPPFHIRVNGT  173
             RGPPFH+RV+GT
Sbjct  1184  RGPPFHVRVSGT  1195



>gb|KJB07659.1| hypothetical protein B456_001G035900 [Gossypium raimondii]
Length=1200

 Score =   295 bits (755),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 169/195 (87%), Gaps = 3/195 (2%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS---PEIDVP  578
             SRIKV+WQSGRN SGELN KDAIQAALQSSVMDVLLPDPLTFGF LA+NGS    ++D+P
Sbjct  1005  SRIKVQWQSGRNCSGELNCKDAIQAALQSSVMDVLLPDPLTFGFRLARNGSENAAKLDLP  1064

Query  577   KEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTV  398
             KE D     +A K+SVIAH+MTP EVLVRNNTKETIK++LS+TCRDVAG N +EG K TV
Sbjct  1065  KESDTSIQHIASKNSVIAHDMTPFEVLVRNNTKETIKMNLSVTCRDVAGANSIEGAKATV  1124

Query  397   LWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDES  218
             +WAGVL+GI MEVPPL+E KH FS+YFLVPGEYTL+AAA IDDAN++LRARA++ SSDE 
Sbjct  1125  IWAGVLSGITMEVPPLEETKHGFSLYFLVPGEYTLVAAAVIDDANDVLRARAKSESSDEP  1184

Query  217   IFCRGPPFHIRVNGT  173
             IFCRGPPFH+ VNGT
Sbjct  1185  IFCRGPPFHVHVNGT  1199



>ref|XP_009618490.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X3 [Nicotiana tomentosiformis]
Length=1023

 Score =   292 bits (748),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 170/196 (87%), Gaps = 6/196 (3%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKN---GSPEIDVP  578
             SRIKVRWQSGRN+SGELNIKDAIQAALQSS+MDVLLPDPLTFGF   KN      E+++ 
Sbjct  831   SRIKVRWQSGRNNSGELNIKDAIQAALQSSMMDVLLPDPLTFGFRCGKNTLQDFAELNLD  890

Query  577   KEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTV  398
             +E D+Q      K S+ AH+MTP+EVLVRNNTKE IK+SLSITCRD+AGENCVEGDK TV
Sbjct  891   EESDIQGTR---KGSLRAHDMTPVEVLVRNNTKEMIKVSLSITCRDIAGENCVEGDKATV  947

Query  397   LWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDES  218
             LWAGVL+G+ MEVPPL+E +H FS+YFLVPGEYTLLAAA IDDANE+LRARARA+S DES
Sbjct  948   LWAGVLSGVTMEVPPLKEYRHSFSLYFLVPGEYTLLAAAVIDDANEMLRARARANSCDES  1007

Query  217   IFCRGPPFHIRVNGTL  170
             IFCRGPPFHIRV+GT+
Sbjct  1008  IFCRGPPFHIRVDGTM  1023



>ref|XP_011074995.1| PREDICTED: trafficking protein particle complex subunit 9 [Sesamum 
indicum]
Length=1196

 Score =   293 bits (749),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 170/197 (86%), Gaps = 8/197 (4%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDV---P  578
             SRIKVRWQSGRNSSGEL+IKDAIQAALQ+SVMDVLLPDPLTFGF LAK+ S        P
Sbjct  1002  SRIKVRWQSGRNSSGELDIKDAIQAALQASVMDVLLPDPLTFGFRLAKSSSNNSANLNPP  1061

Query  577   KEFDMQNNSLACKS--SVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKT  404
             K+ DMQ   + C S  S+IAH+MTPMEVLVRNNT+ETIK++LS+TC+DVAGENC+EGDK 
Sbjct  1062  KQADMQ---VYCASGGSIIAHDMTPMEVLVRNNTRETIKINLSVTCKDVAGENCIEGDKA  1118

Query  403   TVLWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSD  224
             TVLW GVL GI ME+PPLQEI+H FS+YFL+PGEYT+ AAA IDDANE+LRARAR +SSD
Sbjct  1119  TVLWEGVLTGIIMEIPPLQEIRHIFSLYFLIPGEYTMSAAAVIDDANEVLRARARTNSSD  1178

Query  223   ESIFCRGPPFHIRVNGT  173
             E IFCRGPPFH+RVNGT
Sbjct  1179  EPIFCRGPPFHVRVNGT  1195



>ref|NP_001237873.1| uncharacterized protein LOC100305609 [Glycine max]
 gb|ACU13379.1| unknown [Glycine max]
Length=228

 Score =   271 bits (692),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/196 (70%), Positives = 163/196 (83%), Gaps = 7/196 (4%)
 Frame = -1

Query  748  SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
            SRIKV+W SGRNSSGELNIK+AIQAALQ+SVMDVLLPDPLTFGF L ++GS   +  K +
Sbjct  35   SRIKVQWHSGRNSSGELNIKEAIQAALQTSVMDVLLPDPLTFGFRLDRDGS---ESGKPY  91

Query  568  DMQNNSL----ACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTT  401
              +++ L      K SV+AHEMTPMEVLVRNNTK+ IK+SL+ITCR VAGENCV+G K T
Sbjct  92   SEKDSDLVESPGSKGSVVAHEMTPMEVLVRNNTKDMIKMSLNITCRGVAGENCVDGTKAT  151

Query  400  VLWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDE  221
            VLW GVL+ I ME+PPLQ+IKH F ++FLVPGEYTLLAAA IDDAN+ILRARA+ +S+ E
Sbjct  152  VLWTGVLSDITMEIPPLQQIKHSFCLHFLVPGEYTLLAAAVIDDANDILRARAKTTSAAE  211

Query  220  SIFCRGPPFHIRVNGT  173
             IFCRGPP+H+RV GT
Sbjct  212  PIFCRGPPYHVRVLGT  227



>ref|XP_009618489.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X2 [Nicotiana tomentosiformis]
Length=1185

 Score =   292 bits (747),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 170/196 (87%), Gaps = 6/196 (3%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKN---GSPEIDVP  578
             SRIKVRWQSGRN+SGELNIKDAIQAALQSS+MDVLLPDPLTFGF   KN      E+++ 
Sbjct  993   SRIKVRWQSGRNNSGELNIKDAIQAALQSSMMDVLLPDPLTFGFRCGKNTLQDFAELNLD  1052

Query  577   KEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTV  398
             +E D+Q      K S+ AH+MTP+EVLVRNNTKE IK+SLSITCRD+AGENCVEGDK TV
Sbjct  1053  EESDIQGTR---KGSLRAHDMTPVEVLVRNNTKEMIKVSLSITCRDIAGENCVEGDKATV  1109

Query  397   LWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDES  218
             LWAGVL+G+ MEVPPL+E +H FS+YFLVPGEYTLLAAA IDDANE+LRARARA+S DES
Sbjct  1110  LWAGVLSGVTMEVPPLKEYRHSFSLYFLVPGEYTLLAAAVIDDANEMLRARARANSCDES  1169

Query  217   IFCRGPPFHIRVNGTL  170
             IFCRGPPFHIRV+GT+
Sbjct  1170  IFCRGPPFHIRVDGTM  1185



>ref|XP_009618488.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Nicotiana tomentosiformis]
Length=1188

 Score =   292 bits (747),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 170/196 (87%), Gaps = 6/196 (3%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKN---GSPEIDVP  578
             SRIKVRWQSGRN+SGELNIKDAIQAALQSS+MDVLLPDPLTFGF   KN      E+++ 
Sbjct  996   SRIKVRWQSGRNNSGELNIKDAIQAALQSSMMDVLLPDPLTFGFRCGKNTLQDFAELNLD  1055

Query  577   KEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTV  398
             +E D+Q      K S+ AH+MTP+EVLVRNNTKE IK+SLSITCRD+AGENCVEGDK TV
Sbjct  1056  EESDIQGTR---KGSLRAHDMTPVEVLVRNNTKEMIKVSLSITCRDIAGENCVEGDKATV  1112

Query  397   LWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDES  218
             LWAGVL+G+ MEVPPL+E +H FS+YFLVPGEYTLLAAA IDDANE+LRARARA+S DES
Sbjct  1113  LWAGVLSGVTMEVPPLKEYRHSFSLYFLVPGEYTLLAAAVIDDANEMLRARARANSCDES  1172

Query  217   IFCRGPPFHIRVNGTL  170
             IFCRGPPFHIRV+GT+
Sbjct  1173  IFCRGPPFHIRVDGTM  1188



>ref|XP_009778820.1| PREDICTED: uncharacterized protein LOC104228113 isoform X3 [Nicotiana 
sylvestris]
Length=1023

 Score =   290 bits (743),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 169/196 (86%), Gaps = 6/196 (3%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKN---GSPEIDVP  578
             SRIKVRWQSGRN+SGELNIKDAIQAALQSS+MDVLLPDPLTFGF   +N      E+++ 
Sbjct  831   SRIKVRWQSGRNNSGELNIKDAIQAALQSSMMDVLLPDPLTFGFRCGQNTLQDFAELNLD  890

Query  577   KEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTV  398
             +E D+Q      K S+ AH+MTP+EVLVRNNTKE IK+SLSITCRD+AGENCVEGDK TV
Sbjct  891   EESDIQGTR---KGSLRAHDMTPIEVLVRNNTKEMIKVSLSITCRDIAGENCVEGDKATV  947

Query  397   LWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDES  218
             LWAGVL+G+ MEVPPL+E +H FS+YFLVPGEYTLLAAA IDDANE+LRARARA S DES
Sbjct  948   LWAGVLSGVTMEVPPLKEYRHSFSLYFLVPGEYTLLAAAVIDDANEMLRARARAKSCDES  1007

Query  217   IFCRGPPFHIRVNGTL  170
             IFCRGPP+HIRV+GT+
Sbjct  1008  IFCRGPPYHIRVDGTM  1023



>ref|XP_010648709.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Vitis vinifera]
Length=1206

 Score =   291 bits (744),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 169/195 (87%), Gaps = 4/195 (2%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS---PEIDVP  578
             SRIK+RWQSGRNSSGELNIKDAIQAALQ+SVMD+LLPDPLTFGF L+KNG+    ++D P
Sbjct  1012  SRIKLRWQSGRNSSGELNIKDAIQAALQTSVMDILLPDPLTFGFKLSKNGAGHAAKLDSP  1071

Query  577   KEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTV  398
             KE ++Q  S + K SV+AH+MTPMEVLVRNNT E IK+  SI CRDVAG NCVEGDK TV
Sbjct  1072  KESNVQVPSTS-KGSVLAHDMTPMEVLVRNNTMEMIKMRFSIRCRDVAGANCVEGDKATV  1130

Query  397   LWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDES  218
             LWAGVL+G+ MEVPPLQE+KH FS+YFLVPGEYTL+AAA IDD N+ILRARAR+ SS+E 
Sbjct  1131  LWAGVLSGVTMEVPPLQEVKHSFSLYFLVPGEYTLVAAAVIDDPNDILRARARSVSSNEP  1190

Query  217   IFCRGPPFHIRVNGT  173
             IFCRGPPFH+RV GT
Sbjct  1191  IFCRGPPFHVRVIGT  1205



>ref|XP_010648710.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X2 [Vitis vinifera]
Length=1202

 Score =   290 bits (743),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 169/195 (87%), Gaps = 4/195 (2%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS---PEIDVP  578
             SRIK+RWQSGRNSSGELNIKDAIQAALQ+SVMD+LLPDPLTFGF L+KNG+    ++D P
Sbjct  1008  SRIKLRWQSGRNSSGELNIKDAIQAALQTSVMDILLPDPLTFGFKLSKNGAGHAAKLDSP  1067

Query  577   KEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTV  398
             KE ++Q  S + K SV+AH+MTPMEVLVRNNT E IK+  SI CRDVAG NCVEGDK TV
Sbjct  1068  KESNVQVPSTS-KGSVLAHDMTPMEVLVRNNTMEMIKMRFSIRCRDVAGANCVEGDKATV  1126

Query  397   LWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDES  218
             LWAGVL+G+ MEVPPLQE+KH FS+YFLVPGEYTL+AAA IDD N+ILRARAR+ SS+E 
Sbjct  1127  LWAGVLSGVTMEVPPLQEVKHSFSLYFLVPGEYTLVAAAVIDDPNDILRARARSVSSNEP  1186

Query  217   IFCRGPPFHIRVNGT  173
             IFCRGPPFH+RV GT
Sbjct  1187  IFCRGPPFHVRVIGT  1201



>ref|XP_010322725.1| PREDICTED: uncharacterized protein LOC101266526 isoform X2 [Solanum 
lycopersicum]
Length=927

 Score =   288 bits (736),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  748  SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
            S+IKVRWQSGRN+SGELNIKDAIQAALQSS+MDVLLPDPLTFGF    N S         
Sbjct  735  SKIKVRWQSGRNNSGELNIKDAIQAALQSSMMDVLLPDPLTFGFRCGNNTSQNSSDLNMD  794

Query  568  DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
            +  N   A K SV AH+ TP+EVLVRNNTKE I++SLSITCRD+AGENCVEGDK TVLWA
Sbjct  795  EGSNIQGARKGSVKAHDTTPVEVLVRNNTKEMIRVSLSITCRDIAGENCVEGDKATVLWA  854

Query  388  GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
            GVLNGI MEVPPL+E +H FS+YFLVPGEYTLLAAA IDDANE+LRARARA+S DESIFC
Sbjct  855  GVLNGITMEVPPLKEYRHSFSLYFLVPGEYTLLAAAVIDDANEMLRARARANSCDESIFC  914

Query  208  RGPPFHIRVNGTL  170
            RGPPFHIRVNGT+
Sbjct  915  RGPPFHIRVNGTM  927



>ref|XP_009778819.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X2 [Nicotiana sylvestris]
Length=1185

 Score =   290 bits (741),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 169/196 (86%), Gaps = 6/196 (3%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKN---GSPEIDVP  578
             SRIKVRWQSGRN+SGELNIKDAIQAALQSS+MDVLLPDPLTFGF   +N      E+++ 
Sbjct  993   SRIKVRWQSGRNNSGELNIKDAIQAALQSSMMDVLLPDPLTFGFRCGQNTLQDFAELNLD  1052

Query  577   KEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTV  398
             +E D+Q      K S+ AH+MTP+EVLVRNNTKE IK+SLSITCRD+AGENCVEGDK TV
Sbjct  1053  EESDIQGTR---KGSLRAHDMTPIEVLVRNNTKEMIKVSLSITCRDIAGENCVEGDKATV  1109

Query  397   LWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDES  218
             LWAGVL+G+ MEVPPL+E +H FS+YFLVPGEYTLLAAA IDDANE+LRARARA S DES
Sbjct  1110  LWAGVLSGVTMEVPPLKEYRHSFSLYFLVPGEYTLLAAAVIDDANEMLRARARAKSCDES  1169

Query  217   IFCRGPPFHIRVNGTL  170
             IFCRGPP+HIRV+GT+
Sbjct  1170  IFCRGPPYHIRVDGTM  1185



>ref|XP_009778818.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Nicotiana sylvestris]
Length=1188

 Score =   290 bits (741),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 169/196 (86%), Gaps = 6/196 (3%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKN---GSPEIDVP  578
             SRIKVRWQSGRN+SGELNIKDAIQAALQSS+MDVLLPDPLTFGF   +N      E+++ 
Sbjct  996   SRIKVRWQSGRNNSGELNIKDAIQAALQSSMMDVLLPDPLTFGFRCGQNTLQDFAELNLD  1055

Query  577   KEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTV  398
             +E D+Q      K S+ AH+MTP+EVLVRNNTKE IK+SLSITCRD+AGENCVEGDK TV
Sbjct  1056  EESDIQGTR---KGSLRAHDMTPIEVLVRNNTKEMIKVSLSITCRDIAGENCVEGDKATV  1112

Query  397   LWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDES  218
             LWAGVL+G+ MEVPPL+E +H FS+YFLVPGEYTLLAAA IDDANE+LRARARA S DES
Sbjct  1113  LWAGVLSGVTMEVPPLKEYRHSFSLYFLVPGEYTLLAAAVIDDANEMLRARARAKSCDES  1172

Query  217   IFCRGPPFHIRVNGTL  170
             IFCRGPP+HIRV+GT+
Sbjct  1173  IFCRGPPYHIRVDGTM  1188



>ref|XP_004241792.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Solanum lycopersicum]
Length=1185

 Score =   288 bits (736),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 163/193 (84%), Gaps = 0/193 (0%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             S+IKVRWQSGRN+SGELNIKDAIQAALQSS+MDVLLPDPLTFGF    N S         
Sbjct  993   SKIKVRWQSGRNNSGELNIKDAIQAALQSSMMDVLLPDPLTFGFRCGNNTSQNSSDLNMD  1052

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
             +  N   A K SV AH+ TP+EVLVRNNTKE I++SLSITCRD+AGENCVEGDK TVLWA
Sbjct  1053  EGSNIQGARKGSVKAHDTTPVEVLVRNNTKEMIRVSLSITCRDIAGENCVEGDKATVLWA  1112

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             GVLNGI MEVPPL+E +H FS+YFLVPGEYTLLAAA IDDANE+LRARARA+S DESIFC
Sbjct  1113  GVLNGITMEVPPLKEYRHSFSLYFLVPGEYTLLAAAVIDDANEMLRARARANSCDESIFC  1172

Query  208   RGPPFHIRVNGTL  170
             RGPPFHIRVNGT+
Sbjct  1173  RGPPFHIRVNGTM  1185



>ref|XP_010244785.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X1 [Nelumbo nucifera]
Length=1204

 Score =   288 bits (736),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 145/195 (74%), Positives = 167/195 (86%), Gaps = 3/195 (2%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS---PEIDVP  578
             SRIKVRWQSGRNSSGELNIKDA+Q ALQ+SVMD+LLPDPLTFGF LA+NG+    +ID P
Sbjct  1009  SRIKVRWQSGRNSSGELNIKDAVQGALQTSVMDILLPDPLTFGFRLARNGNGSVAKIDSP  1068

Query  577   KEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTV  398
             KE D++ +S   K SV AHEMTP+EVLVRNNTKE I++SLSITCRDVAGE+C+EG+K TV
Sbjct  1069  KESDIRISSSGEKGSVPAHEMTPLEVLVRNNTKEIIRMSLSITCRDVAGESCIEGNKATV  1128

Query  397   LWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDES  218
             LWAGVL+ I +EVPPLQEI H FS+YFLVPGEYTL+AAA I DAN+ILRARA+  S DE 
Sbjct  1129  LWAGVLSEICVEVPPLQEISHSFSLYFLVPGEYTLVAAAVIADANDILRARAKTDSPDEP  1188

Query  217   IFCRGPPFHIRVNGT  173
             IFCRG PFHIRV G+
Sbjct  1189  IFCRGSPFHIRVVGS  1203



>ref|XP_010244786.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X2 [Nelumbo nucifera]
Length=1180

 Score =   288 bits (736),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 145/195 (74%), Positives = 167/195 (86%), Gaps = 3/195 (2%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS---PEIDVP  578
             SRIKVRWQSGRNSSGELNIKDA+Q ALQ+SVMD+LLPDPLTFGF LA+NG+    +ID P
Sbjct  985   SRIKVRWQSGRNSSGELNIKDAVQGALQTSVMDILLPDPLTFGFRLARNGNGSVAKIDSP  1044

Query  577   KEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTV  398
             KE D++ +S   K SV AHEMTP+EVLVRNNTKE I++SLSITCRDVAGE+C+EG+K TV
Sbjct  1045  KESDIRISSSGEKGSVPAHEMTPLEVLVRNNTKEIIRMSLSITCRDVAGESCIEGNKATV  1104

Query  397   LWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDES  218
             LWAGVL+ I +EVPPLQEI H FS+YFLVPGEYTL+AAA I DAN+ILRARA+  S DE 
Sbjct  1105  LWAGVLSEICVEVPPLQEISHSFSLYFLVPGEYTLVAAAVIADANDILRARAKTDSPDEP  1164

Query  217   IFCRGPPFHIRVNGT  173
             IFCRG PFHIRV G+
Sbjct  1165  IFCRGSPFHIRVVGS  1179



>ref|XP_002515463.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46912.1| conserved hypothetical protein [Ricinus communis]
Length=1195

 Score =   287 bits (735),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 163/192 (85%), Gaps = 5/192 (3%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             SRIKVRWQSGRNSSGELNIKDAIQAALQ+SVMDVLLPDPLTFGF L K+     +VP+E 
Sbjct  1008  SRIKVRWQSGRNSSGELNIKDAIQAALQTSVMDVLLPDPLTFGFRLVKS-----NVPRES  1062

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
             +M  +S   K SV+AH+MTPMEV+VRNNTKE I++SLSITCRDVAG NCVEG K TVLWA
Sbjct  1063  EMPVDSSGSKGSVMAHDMTPMEVVVRNNTKEMIRMSLSITCRDVAGHNCVEGSKATVLWA  1122

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             GVLNGI MEVP LQE KH FS++FLVPGEYTL+AAA I DAN++LR RAR  S+DE IFC
Sbjct  1123  GVLNGIIMEVPALQESKHCFSLHFLVPGEYTLVAAAVIADANDVLRTRARTDSADEPIFC  1182

Query  208   RGPPFHIRVNGT  173
             RGPPFHIR+ GT
Sbjct  1183  RGPPFHIRIIGT  1194



>emb|CDP18799.1| unnamed protein product [Coffea canephora]
Length=1204

 Score =   286 bits (731),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 167/196 (85%), Gaps = 3/196 (2%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG---SPEIDVP  578
             SRIKVRWQSGRNSSGELNIKDA+Q ALQSSVMDVLLPDPLTFGF LAK+      ++D  
Sbjct  1009  SRIKVRWQSGRNSSGELNIKDAMQTALQSSVMDVLLPDPLTFGFRLAKDNVDHRVKLDST  1068

Query  577   KEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTV  398
             +  D Q +S  C S+V+AH+MTPMEVLVRNNTKE + +SL+ITCRDVAG+NC EG+K TV
Sbjct  1069  ETCDAQPHSAVCNSTVVAHDMTPMEVLVRNNTKEMVGISLNITCRDVAGQNCFEGEKATV  1128

Query  397   LWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDES  218
             LW GVL+ I MEVPPLQE+KH FS+YFLVPGEYTLLAAA I+DANEILRARA++++ DE 
Sbjct  1129  LWTGVLSSINMEVPPLQEVKHSFSLYFLVPGEYTLLAAAVIEDANEILRARAKSNTHDEP  1188

Query  217   IFCRGPPFHIRVNGTL  170
             IFCRG PFH++V+GT+
Sbjct  1189  IFCRGAPFHLQVSGTV  1204



>ref|XP_006353665.1| PREDICTED: trafficking protein particle complex subunit 9-like 
[Solanum tuberosum]
Length=1185

 Score =   282 bits (722),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 164/193 (85%), Gaps = 1/193 (1%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             S+IKVRWQSGRN+SGELNIKDAIQAALQSS+MDVLLPDPLTFGF    N S +       
Sbjct  994   SKIKVRWQSGRNNSGELNIKDAIQAALQSSMMDVLLPDPLTFGFRCGNNTSQDFADLNLD  1053

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
             +  N   A K SV AH+MTP+EVLVRNNTKE I++SLSITCRD+AGENCV+GDK TVLWA
Sbjct  1054  EGSNIQGARKGSVRAHDMTPVEVLVRNNTKEMIRVSLSITCRDIAGENCVKGDKATVLWA  1113

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             GVLNG+ MEVPPL+E +H FS+YFLVPGEYTLLAAA IDDANE+LRARARA+S  ESIFC
Sbjct  1114  GVLNGVTMEVPPLKEYRHSFSLYFLVPGEYTLLAAAVIDDANEMLRARARATSC-ESIFC  1172

Query  208   RGPPFHIRVNGTL  170
             RGPPFHIRVNGT+
Sbjct  1173  RGPPFHIRVNGTM  1185



>ref|XP_009355811.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X2 [Pyrus x bretschneideri]
Length=981

 Score =   279 bits (714),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 164/194 (85%), Gaps = 2/194 (1%)
 Frame = -1

Query  748  SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSP--EIDVPK  575
            S+IKVRWQSGRNSSGELNIKDAIQAALQ+SVMDVLLPDPLTF F L++NG          
Sbjct  787  SKIKVRWQSGRNSSGELNIKDAIQAALQTSVMDVLLPDPLTFCFRLSRNGLAIEHSGSHT  846

Query  574  EFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVL  395
            E + Q +  A K SV+AHEMTPMEV+VRNNTKE IK+SLSITCRDVAGENC+E  K TVL
Sbjct  847  EHNFQVHPSAAKGSVLAHEMTPMEVMVRNNTKEMIKMSLSITCRDVAGENCIECTKATVL  906

Query  394  WAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESI  215
            ++GVL+GI +EVPPL+EIKH FS+YFLVPGEYTL+AA+ IDDAN+ILRARAR  SSDE I
Sbjct  907  YSGVLSGITVEVPPLEEIKHSFSLYFLVPGEYTLVAASVIDDANDILRARARTKSSDEPI  966

Query  214  FCRGPPFHIRVNGT  173
            FCRGPP+H+RV GT
Sbjct  967  FCRGPPYHVRVVGT  980



>ref|XP_008394133.1| PREDICTED: uncharacterized protein LOC103456233 isoform X2 [Malus 
domestica]
Length=981

 Score =   278 bits (711),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 167/194 (86%), Gaps = 2/194 (1%)
 Frame = -1

Query  748  SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG-SPE-IDVPK  575
            S+IKVRWQSGR+SSGELNIKDAIQAALQ+SVMDVLLPDPLTF F L++NG +PE      
Sbjct  787  SKIKVRWQSGRSSSGELNIKDAIQAALQTSVMDVLLPDPLTFCFRLSRNGLAPENSGSHA  846

Query  574  EFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVL  395
            + + Q +  A K SV+AHEMTPMEV+VRNNTKE IK+SLSITCRDVAGENC+E  K TVL
Sbjct  847  QANFQVHPSAAKGSVLAHEMTPMEVMVRNNTKEMIKMSLSITCRDVAGENCIECTKATVL  906

Query  394  WAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESI  215
            ++GVL+GI +EVPPL+EIKH FS+YFLVPGEYTL+AA+ IDDAN+ILRARAR  SSDE I
Sbjct  907  YSGVLSGITVEVPPLEEIKHSFSLYFLVPGEYTLVAASVIDDANDILRARARTKSSDEPI  966

Query  214  FCRGPPFHIRVNGT  173
            FCRGPP+H+RV GT
Sbjct  967  FCRGPPYHVRVVGT  980



>ref|XP_009355810.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Pyrus x bretschneideri]
Length=1202

 Score =   279 bits (714),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 164/194 (85%), Gaps = 2/194 (1%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSP--EIDVPK  575
             S+IKVRWQSGRNSSGELNIKDAIQAALQ+SVMDVLLPDPLTF F L++NG          
Sbjct  1008  SKIKVRWQSGRNSSGELNIKDAIQAALQTSVMDVLLPDPLTFCFRLSRNGLAIEHSGSHT  1067

Query  574   EFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVL  395
             E + Q +  A K SV+AHEMTPMEV+VRNNTKE IK+SLSITCRDVAGENC+E  K TVL
Sbjct  1068  EHNFQVHPSAAKGSVLAHEMTPMEVMVRNNTKEMIKMSLSITCRDVAGENCIECTKATVL  1127

Query  394   WAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESI  215
             ++GVL+GI +EVPPL+EIKH FS+YFLVPGEYTL+AA+ IDDAN+ILRARAR  SSDE I
Sbjct  1128  YSGVLSGITVEVPPLEEIKHSFSLYFLVPGEYTLVAASVIDDANDILRARARTKSSDEPI  1187

Query  214   FCRGPPFHIRVNGT  173
             FCRGPP+H+RV GT
Sbjct  1188  FCRGPPYHVRVVGT  1201



>gb|EYU32374.1| hypothetical protein MIMGU_mgv1a000384mg [Erythranthe guttata]
Length=1197

 Score =   278 bits (712),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 165/196 (84%), Gaps = 5/196 (3%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSP----EIDV  581
             SRIKVRWQSGR+SSGEL+IKDAIQAALQ+SV+DVLLPDPLTFGF LAK+ S     + + 
Sbjct  1002  SRIKVRWQSGRSSSGELDIKDAIQAALQASVLDVLLPDPLTFGFRLAKSTSDLSIMKQNS  1061

Query  580   PKEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTT  401
             PK+ DM N S   + S++AH+MT MEVLVRNNTK  I+++LS+TC+DVAGENC+EGDK T
Sbjct  1062  PKKTDMVN-SCGTEGSIVAHDMTAMEVLVRNNTKGAIRINLSVTCKDVAGENCIEGDKAT  1120

Query  400   VLWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDE  221
             VLW GVL GI MEVPPLQEI+H FS+YFL+PGEYT+ AAA I DANE+LRARAR +S D+
Sbjct  1121  VLWEGVLTGITMEVPPLQEIRHIFSLYFLIPGEYTMAAAAVIKDANEVLRARARTNSFDD  1180

Query  220   SIFCRGPPFHIRVNGT  173
              IFCRGPPF +RVNGT
Sbjct  1181  PIFCRGPPFRVRVNGT  1196



>ref|XP_007161157.1| hypothetical protein PHAVU_001G047300g [Phaseolus vulgaris]
 gb|ESW33151.1| hypothetical protein PHAVU_001G047300g [Phaseolus vulgaris]
Length=1196

 Score =   278 bits (711),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 162/192 (84%), Gaps = 2/192 (1%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             SRIKVRW SGRNSSGELNIK+AIQAALQ+SVMDVLLPDPLTFGF L ++ S       E 
Sbjct  1006  SRIKVRWHSGRNSSGELNIKEAIQAALQTSVMDVLLPDPLTFGFRLVRDDSESKKT--EP  1063

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
             D ++ S   K SVIAHEMTPMEVLVRNNTK+ +K+SL+ITCRDVAGENCV+G K TVLW 
Sbjct  1064  DKESESAVSKGSVIAHEMTPMEVLVRNNTKDMLKMSLNITCRDVAGENCVDGTKATVLWT  1123

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             GVL+ IAME+PPLQ+IKH F ++FLVPGEYTLLAAA IDDAN+ILRARA+ +S+ E IFC
Sbjct  1124  GVLSDIAMEIPPLQQIKHSFCLHFLVPGEYTLLAAAVIDDANDILRARAKTTSAAEPIFC  1183

Query  208   RGPPFHIRVNGT  173
             RGPP+H+RV GT
Sbjct  1184  RGPPYHVRVLGT  1195



>ref|XP_008394132.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Malus domestica]
Length=1202

 Score =   278 bits (710),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 167/194 (86%), Gaps = 2/194 (1%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG-SPE-IDVPK  575
             S+IKVRWQSGR+SSGELNIKDAIQAALQ+SVMDVLLPDPLTF F L++NG +PE      
Sbjct  1008  SKIKVRWQSGRSSSGELNIKDAIQAALQTSVMDVLLPDPLTFCFRLSRNGLAPENSGSHA  1067

Query  574   EFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVL  395
             + + Q +  A K SV+AHEMTPMEV+VRNNTKE IK+SLSITCRDVAGENC+E  K TVL
Sbjct  1068  QANFQVHPSAAKGSVLAHEMTPMEVMVRNNTKEMIKMSLSITCRDVAGENCIECTKATVL  1127

Query  394   WAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESI  215
             ++GVL+GI +EVPPL+EIKH FS+YFLVPGEYTL+AA+ IDDAN+ILRARAR  SSDE I
Sbjct  1128  YSGVLSGITVEVPPLEEIKHSFSLYFLVPGEYTLVAASVIDDANDILRARARTKSSDEPI  1187

Query  214   FCRGPPFHIRVNGT  173
             FCRGPP+H+RV GT
Sbjct  1188  FCRGPPYHVRVVGT  1201



>emb|CBI21099.3| unnamed protein product [Vitis vinifera]
Length=1056

 Score =   277 bits (708),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 158/192 (82%), Gaps = 15/192 (8%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             SRIK+RWQSGRNSSGELNIKDAIQAALQ+SVMD+LLPDPLTFGF L+KN      VP   
Sbjct  879   SRIKLRWQSGRNSSGELNIKDAIQAALQTSVMDILLPDPLTFGFKLSKN------VPS--  930

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
                      K SV+AH+MTPMEVLVRNNT E IK+  SI CRDVAG NCVEGDK TVLWA
Sbjct  931   -------TSKGSVLAHDMTPMEVLVRNNTMEMIKMRFSIRCRDVAGANCVEGDKATVLWA  983

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             GVL+G+ MEVPPLQE+KH FS+YFLVPGEYTL+AAA IDD N+ILRARAR+ SS+E IFC
Sbjct  984   GVLSGVTMEVPPLQEVKHSFSLYFLVPGEYTLVAAAVIDDPNDILRARARSVSSNEPIFC  1043

Query  208   RGPPFHIRVNGT  173
             RGPPFH+RV GT
Sbjct  1044  RGPPFHVRVIGT  1055



>ref|XP_012076471.1| PREDICTED: trafficking protein particle complex II-specific subunit 
120 homolog [Jatropha curcas]
 gb|KDP33546.1| hypothetical protein JCGZ_07117 [Jatropha curcas]
Length=1193

 Score =   277 bits (708),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 161/193 (83%), Gaps = 5/193 (3%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             SRIKVRWQSGRNS GELNIKDAIQAALQ+SVMDVLLPDPLTF F L +N     +  +E 
Sbjct  1006  SRIKVRWQSGRNSFGELNIKDAIQAALQTSVMDVLLPDPLTFNFRLTRN-----NFTQEP  1060

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
             D  ++    K SV AH+MTPMEV+VRNNTKETI +SLSITCRDVAGENCVEG K TVLWA
Sbjct  1061  DRADDFSEPKGSVRAHDMTPMEVIVRNNTKETITMSLSITCRDVAGENCVEGTKATVLWA  1120

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             GVL+GI+MEVPPLQE +H FS++FLVPGEYTL+AAA I+DAN+ILR RAR  S+DE IFC
Sbjct  1121  GVLHGISMEVPPLQESRHSFSLHFLVPGEYTLVAAAVIEDANDILRTRARTESADEPIFC  1180

Query  208   RGPPFHIRVNGTL  170
             RGPPFHI V GT+
Sbjct  1181  RGPPFHISVIGTV  1193



>gb|KJB65887.1| hypothetical protein B456_010G117200 [Gossypium raimondii]
Length=997

 Score =   276 bits (705),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 160/195 (82%), Gaps = 3/195 (2%)
 Frame = -1

Query  748  SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS---PEIDVP  578
            SRIKVRWQSG+NS GELNI DAI+ ALQSS+MD+LLPDPLTF F LA+N S     +D P
Sbjct  802  SRIKVRWQSGQNSCGELNITDAIRVALQSSIMDILLPDPLTFSFRLARNVSKNAANLDSP  861

Query  577  KEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTV  398
            KE  +        SSVI H+MTPMEVLVRNNTKETIK++LS+TCRDVAG+NCVEG K TV
Sbjct  862  KESSINIQPSMSNSSVIEHDMTPMEVLVRNNTKETIKMNLSVTCRDVAGQNCVEGTKATV  921

Query  397  LWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDES  218
            LWAGVL+GI +EVPPL+E KH F +YFLVPGEYT++AAA IDDAN++LRARA+  S DE 
Sbjct  922  LWAGVLSGITIEVPPLEESKHSFFLYFLVPGEYTMVAAAVIDDANDVLRARAKCESPDEP  981

Query  217  IFCRGPPFHIRVNGT  173
            IFCRGPPFH+RV GT
Sbjct  982  IFCRGPPFHVRVIGT  996



>gb|KJB65888.1| hypothetical protein B456_010G117200 [Gossypium raimondii]
Length=1024

 Score =   276 bits (705),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 160/195 (82%), Gaps = 3/195 (2%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS---PEIDVP  578
             SRIKVRWQSG+NS GELNI DAI+ ALQSS+MD+LLPDPLTF F LA+N S     +D P
Sbjct  829   SRIKVRWQSGQNSCGELNITDAIRVALQSSIMDILLPDPLTFSFRLARNVSKNAANLDSP  888

Query  577   KEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTV  398
             KE  +        SSVI H+MTPMEVLVRNNTKETIK++LS+TCRDVAG+NCVEG K TV
Sbjct  889   KESSINIQPSMSNSSVIEHDMTPMEVLVRNNTKETIKMNLSVTCRDVAGQNCVEGTKATV  948

Query  397   LWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDES  218
             LWAGVL+GI +EVPPL+E KH F +YFLVPGEYT++AAA IDDAN++LRARA+  S DE 
Sbjct  949   LWAGVLSGITIEVPPLEESKHSFFLYFLVPGEYTMVAAAVIDDANDVLRARAKCESPDEP  1008

Query  217   IFCRGPPFHIRVNGT  173
             IFCRGPPFH+RV GT
Sbjct  1009  IFCRGPPFHVRVIGT  1023



>gb|KJB65886.1| hypothetical protein B456_010G117200 [Gossypium raimondii]
Length=1044

 Score =   276 bits (705),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 160/195 (82%), Gaps = 3/195 (2%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS---PEIDVP  578
             SRIKVRWQSG+NS GELNI DAI+ ALQSS+MD+LLPDPLTF F LA+N S     +D P
Sbjct  849   SRIKVRWQSGQNSCGELNITDAIRVALQSSIMDILLPDPLTFSFRLARNVSKNAANLDSP  908

Query  577   KEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTV  398
             KE  +        SSVI H+MTPMEVLVRNNTKETIK++LS+TCRDVAG+NCVEG K TV
Sbjct  909   KESSINIQPSMSNSSVIEHDMTPMEVLVRNNTKETIKMNLSVTCRDVAGQNCVEGTKATV  968

Query  397   LWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDES  218
             LWAGVL+GI +EVPPL+E KH F +YFLVPGEYT++AAA IDDAN++LRARA+  S DE 
Sbjct  969   LWAGVLSGITIEVPPLEESKHSFFLYFLVPGEYTMVAAAVIDDANDVLRARAKCESPDEP  1028

Query  217   IFCRGPPFHIRVNGT  173
             IFCRGPPFH+RV GT
Sbjct  1029  IFCRGPPFHVRVIGT  1043



>ref|XP_011458837.1| PREDICTED: trafficking protein particle complex II-specific subunit 
120 homolog isoform X3 [Fragaria vesca subsp. vesca]
Length=978

 Score =   275 bits (703),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 168/194 (87%), Gaps = 2/194 (1%)
 Frame = -1

Query  748  SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG-SPE-IDVPK  575
            SRIKVRWQSGRNSSGELNIKDA+QAALQ+SVMDVLLPDPLTFGF L+++G  PE ID  +
Sbjct  784  SRIKVRWQSGRNSSGELNIKDAVQAALQTSVMDVLLPDPLTFGFRLSRSGPGPENIDSHE  843

Query  574  EFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVL  395
            + + + NS A K SV+AHEMTPMEV+VRNNTKE IK+SL++ CRDVAGE+CVE  K TVL
Sbjct  844  KSNDEVNSSASKGSVMAHEMTPMEVMVRNNTKELIKMSLNVVCRDVAGEDCVECAKATVL  903

Query  394  WAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESI  215
             +GVL+GI +E+PPL+EIKH FS+YFLVPGEYTL+AAA I+DA +ILRARAR +SSDE I
Sbjct  904  CSGVLSGITVEIPPLEEIKHSFSLYFLVPGEYTLIAAAMIEDATDILRARARTTSSDEPI  963

Query  214  FCRGPPFHIRVNGT  173
            FC GPP+H+RV GT
Sbjct  964  FCHGPPYHVRVVGT  977



>ref|XP_008219551.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X3 [Prunus mume]
Length=980

 Score =   275 bits (702),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 163/194 (84%), Gaps = 2/194 (1%)
 Frame = -1

Query  748  SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG-SPEIDVPKE  572
            S+IKVRWQSGRNSSGELNIKDAIQAALQ+SVMDVLLPDPLTF F L++    PE      
Sbjct  786  SKIKVRWQSGRNSSGELNIKDAIQAALQTSVMDVLLPDPLTFCFRLSRYALEPENSSSHN  845

Query  571  F-DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVL  395
              ++Q +S A K SV+AHEMTPMEV+VRNNTKE IK+SL ITCRDVAGENCVEG K TVL
Sbjct  846  SPNVQVHSAAAKGSVLAHEMTPMEVVVRNNTKEKIKMSLGITCRDVAGENCVEGTKATVL  905

Query  394  WAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESI  215
             +GVL+GI +EVP LQEIKH FS+YFLVPGEYTL+AA+ IDDAN+ILRARAR  SSDE I
Sbjct  906  CSGVLSGITVEVPSLQEIKHSFSLYFLVPGEYTLVAASVIDDANDILRARARTKSSDEPI  965

Query  214  FCRGPPFHIRVNGT  173
            FCRGPP+H+RV GT
Sbjct  966  FCRGPPYHVRVVGT  979



>ref|XP_010265703.1| PREDICTED: trafficking protein particle complex subunit 9-like 
[Nelumbo nucifera]
Length=1204

 Score =   276 bits (705),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 166/195 (85%), Gaps = 3/195 (2%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEI---DVP  578
             SRIKVRWQSGRNSSGEL+IKDAIQAALQ+SVMD+LLPDPLTFGF L++NGS ++   D  
Sbjct  1009  SRIKVRWQSGRNSSGELSIKDAIQAALQTSVMDILLPDPLTFGFRLSENGSQQVAMLDSS  1068

Query  577   KEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTV  398
             KE D+  +S   K SV+AHEM PMEVLVRNNTKE I++SLSITCRDVAGENC+EG K+TV
Sbjct  1069  KESDIPVSSSVSKGSVLAHEMIPMEVLVRNNTKEIIRMSLSITCRDVAGENCIEGSKSTV  1128

Query  397   LWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDES  218
             LWAGVL+ I +EV PLQEIKH FS+YFL+PGEYTL AAA I+DAN++LRARAR  S DE 
Sbjct  1129  LWAGVLSEIQVEVSPLQEIKHSFSLYFLLPGEYTLAAAAVINDANDVLRARARTDSPDEP  1188

Query  217   IFCRGPPFHIRVNGT  173
             IFC GPPFHIRV G+
Sbjct  1189  IFCCGPPFHIRVIGS  1203



>ref|XP_007225443.1| hypothetical protein PRUPE_ppa000412mg [Prunus persica]
 gb|EMJ26642.1| hypothetical protein PRUPE_ppa000412mg [Prunus persica]
Length=1200

 Score =   275 bits (703),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 164/194 (85%), Gaps = 2/194 (1%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG-SPEIDVPKE  572
             S+IKVRWQSGRNSSGELNIKDAIQAALQ+SVMDVLLPDPLTF F L++    PE      
Sbjct  1006  SKIKVRWQSGRNSSGELNIKDAIQAALQTSVMDVLLPDPLTFCFRLSRYALEPENSSSHN  1065

Query  571   F-DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVL  395
               ++Q +S A K SV+AHEMTPMEV+VRNNTKE IK+SLSITCRDVAGENCVEG K TVL
Sbjct  1066  SPNVQVHSAAAKGSVLAHEMTPMEVVVRNNTKEKIKMSLSITCRDVAGENCVEGTKATVL  1125

Query  394   WAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESI  215
              +GVL+GI +EVP LQEIKH FS+YFLVPGEYTL+AA+ IDDAN+ILRARAR  SSDE I
Sbjct  1126  CSGVLSGINVEVPSLQEIKHSFSLYFLVPGEYTLVAASVIDDANDILRARARTKSSDEPI  1185

Query  214   FCRGPPFHIRVNGT  173
             FCRGPP+H+RV GT
Sbjct  1186  FCRGPPYHVRVVGT  1199



>ref|XP_002324891.2| hypothetical protein POPTR_0018s02220g [Populus trichocarpa]
 gb|EEF03456.2| hypothetical protein POPTR_0018s02220g [Populus trichocarpa]
Length=1087

 Score =   275 bits (702),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 158/192 (82%), Gaps = 9/192 (5%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             SRIKVRWQSGR SSGELNIKDAIQAAL++S MDVLLPDPLTFGF L +N           
Sbjct  904   SRIKVRWQSGRTSSGELNIKDAIQAALKTSAMDVLLPDPLTFGFRLVRN---------NL  954

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
               ++     K SV+AH+MTPMEVLVRNNTKE I++SL+ITCRDVAGENCVEG K TVLW+
Sbjct  955   SQESGDSRPKGSVVAHDMTPMEVLVRNNTKEMIRMSLNITCRDVAGENCVEGTKATVLWS  1014

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             GVLNGI +EVPPLQE KH FS+YFLVPGEYTL+AAA I+DAN++LRARA+ +S +E IFC
Sbjct  1015  GVLNGITIEVPPLQESKHSFSLYFLVPGEYTLIAAALIEDANDLLRARAKTNSPEEPIFC  1074

Query  208   RGPPFHIRVNGT  173
             RGPPFH+RV GT
Sbjct  1075  RGPPFHVRVIGT  1086



>ref|XP_011458836.1| PREDICTED: trafficking protein particle complex II-specific subunit 
120 homolog isoform X1 [Fragaria vesca subsp. vesca]
Length=1199

 Score =   275 bits (702),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 168/194 (87%), Gaps = 2/194 (1%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG-SPE-IDVPK  575
             SRIKVRWQSGRNSSGELNIKDA+QAALQ+SVMDVLLPDPLTFGF L+++G  PE ID  +
Sbjct  1005  SRIKVRWQSGRNSSGELNIKDAVQAALQTSVMDVLLPDPLTFGFRLSRSGPGPENIDSHE  1064

Query  574   EFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVL  395
             + + + NS A K SV+AHEMTPMEV+VRNNTKE IK+SL++ CRDVAGE+CVE  K TVL
Sbjct  1065  KSNDEVNSSASKGSVMAHEMTPMEVMVRNNTKELIKMSLNVVCRDVAGEDCVECAKATVL  1124

Query  394   WAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESI  215
              +GVL+GI +E+PPL+EIKH FS+YFLVPGEYTL+AAA I+DA +ILRARAR +SSDE I
Sbjct  1125  CSGVLSGITVEIPPLEEIKHSFSLYFLVPGEYTLIAAAMIEDATDILRARARTTSSDEPI  1184

Query  214   FCRGPPFHIRVNGT  173
             FC GPP+H+RV GT
Sbjct  1185  FCHGPPYHVRVVGT  1198



>ref|XP_004290928.1| PREDICTED: trafficking protein particle complex II-specific subunit 
120 homolog isoform X2 [Fragaria vesca subsp. vesca]
Length=1198

 Score =   275 bits (702),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 168/194 (87%), Gaps = 2/194 (1%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG-SPE-IDVPK  575
             SRIKVRWQSGRNSSGELNIKDA+QAALQ+SVMDVLLPDPLTFGF L+++G  PE ID  +
Sbjct  1004  SRIKVRWQSGRNSSGELNIKDAVQAALQTSVMDVLLPDPLTFGFRLSRSGPGPENIDSHE  1063

Query  574   EFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVL  395
             + + + NS A K SV+AHEMTPMEV+VRNNTKE IK+SL++ CRDVAGE+CVE  K TVL
Sbjct  1064  KSNDEVNSSASKGSVMAHEMTPMEVMVRNNTKELIKMSLNVVCRDVAGEDCVECAKATVL  1123

Query  394   WAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESI  215
              +GVL+GI +E+PPL+EIKH FS+YFLVPGEYTL+AAA I+DA +ILRARAR +SSDE I
Sbjct  1124  CSGVLSGITVEIPPLEEIKHSFSLYFLVPGEYTLIAAAMIEDATDILRARARTTSSDEPI  1183

Query  214   FCRGPPFHIRVNGT  173
             FC GPP+H+RV GT
Sbjct  1184  FCHGPPYHVRVVGT  1197



>ref|XP_011036637.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X2 [Populus euphratica]
Length=1183

 Score =   274 bits (701),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 158/192 (82%), Gaps = 9/192 (5%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             SRIKVRWQSGR SSGELNIKDAIQAAL++S MDVLLPDPLTFGF L +N           
Sbjct  1000  SRIKVRWQSGRTSSGELNIKDAIQAALKTSAMDVLLPDPLTFGFRLVRN---------NL  1050

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
               ++     K SV+AH+MTPMEVLVRNNTKE I++SL+ITCRDVAGENCVEG K TVLW+
Sbjct  1051  SQESGDSKPKGSVLAHDMTPMEVLVRNNTKEMIRMSLNITCRDVAGENCVEGTKATVLWS  1110

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             GVLNGI +EVPPLQE KH FS+YFLVPGEYTL+AAA I+DAN++LRARA+ +S +E IFC
Sbjct  1111  GVLNGITIEVPPLQESKHSFSLYFLVPGEYTLIAAALIEDANDLLRARAKTNSPEEPIFC  1170

Query  208   RGPPFHIRVNGT  173
             RGPPFH+RV GT
Sbjct  1171  RGPPFHVRVIGT  1182



>ref|XP_011036636.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X1 [Populus euphratica]
Length=1187

 Score =   274 bits (701),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 158/192 (82%), Gaps = 9/192 (5%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             SRIKVRWQSGR SSGELNIKDAIQAAL++S MDVLLPDPLTFGF L +N           
Sbjct  1004  SRIKVRWQSGRTSSGELNIKDAIQAALKTSAMDVLLPDPLTFGFRLVRN---------NL  1054

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
               ++     K SV+AH+MTPMEVLVRNNTKE I++SL+ITCRDVAGENCVEG K TVLW+
Sbjct  1055  SQESGDSKPKGSVLAHDMTPMEVLVRNNTKEMIRMSLNITCRDVAGENCVEGTKATVLWS  1114

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             GVLNGI +EVPPLQE KH FS+YFLVPGEYTL+AAA I+DAN++LRARA+ +S +E IFC
Sbjct  1115  GVLNGITIEVPPLQESKHSFSLYFLVPGEYTLIAAALIEDANDLLRARAKTNSPEEPIFC  1174

Query  208   RGPPFHIRVNGT  173
             RGPPFH+RV GT
Sbjct  1175  RGPPFHVRVIGT  1186



>ref|XP_008219549.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Prunus mume]
Length=1201

 Score =   274 bits (700),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 163/194 (84%), Gaps = 2/194 (1%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG-SPEIDVPKE  572
             S+IKVRWQSGRNSSGELNIKDAIQAALQ+SVMDVLLPDPLTF F L++    PE      
Sbjct  1007  SKIKVRWQSGRNSSGELNIKDAIQAALQTSVMDVLLPDPLTFCFRLSRYALEPENSSSHN  1066

Query  571   F-DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVL  395
               ++Q +S A K SV+AHEMTPMEV+VRNNTKE IK+SL ITCRDVAGENCVEG K TVL
Sbjct  1067  SPNVQVHSAAAKGSVLAHEMTPMEVVVRNNTKEKIKMSLGITCRDVAGENCVEGTKATVL  1126

Query  394   WAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESI  215
              +GVL+GI +EVP LQEIKH FS+YFLVPGEYTL+AA+ IDDAN+ILRARAR  SSDE I
Sbjct  1127  CSGVLSGITVEVPSLQEIKHSFSLYFLVPGEYTLVAASVIDDANDILRARARTKSSDEPI  1186

Query  214   FCRGPPFHIRVNGT  173
             FCRGPP+H+RV GT
Sbjct  1187  FCRGPPYHVRVVGT  1200



>ref|XP_008219550.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X2 [Prunus mume]
Length=1200

 Score =   274 bits (700),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 163/194 (84%), Gaps = 2/194 (1%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG-SPEIDVPKE  572
             S+IKVRWQSGRNSSGELNIKDAIQAALQ+SVMDVLLPDPLTF F L++    PE      
Sbjct  1006  SKIKVRWQSGRNSSGELNIKDAIQAALQTSVMDVLLPDPLTFCFRLSRYALEPENSSSHN  1065

Query  571   F-DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVL  395
               ++Q +S A K SV+AHEMTPMEV+VRNNTKE IK+SL ITCRDVAGENCVEG K TVL
Sbjct  1066  SPNVQVHSAAAKGSVLAHEMTPMEVVVRNNTKEKIKMSLGITCRDVAGENCVEGTKATVL  1125

Query  394   WAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESI  215
              +GVL+GI +EVP LQEIKH FS+YFLVPGEYTL+AA+ IDDAN+ILRARAR  SSDE I
Sbjct  1126  CSGVLSGITVEVPSLQEIKHSFSLYFLVPGEYTLVAASVIDDANDILRARARTKSSDEPI  1185

Query  214   FCRGPPFHIRVNGT  173
             FCRGPP+H+RV GT
Sbjct  1186  FCRGPPYHVRVVGT  1199



>ref|XP_006595493.1| PREDICTED: uncharacterized protein LOC100305609 isoform X1 [Glycine 
max]
Length=1200

 Score =   273 bits (698),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 164/196 (84%), Gaps = 7/196 (4%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             SRIKV+W SGRNSSGELNIK+AIQAALQ+SVMDVLLPDPLTFGF L ++GS   +  K +
Sbjct  1007  SRIKVQWHSGRNSSGELNIKEAIQAALQTSVMDVLLPDPLTFGFRLDRDGS---ESGKPY  1063

Query  568   DMQNNSL----ACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTT  401
               +++ L      K SV+AHEMTPMEVLVRNNTK+ IK+SL+ITCRDVAGENCV+G K T
Sbjct  1064  SEKDSDLVESPGSKGSVVAHEMTPMEVLVRNNTKDMIKMSLNITCRDVAGENCVDGTKAT  1123

Query  400   VLWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDE  221
             VLW GVL+ I ME+PPLQ+IKH F ++FLVPGEYTLLAAA IDDAN+ILRARA+ +S+ E
Sbjct  1124  VLWTGVLSDITMEIPPLQQIKHSFCLHFLVPGEYTLLAAAVIDDANDILRARAKTTSAAE  1183

Query  220   SIFCRGPPFHIRVNGT  173
              IFCRGPP+H+RV GT
Sbjct  1184  PIFCRGPPYHVRVLGT  1199



>ref|XP_003550201.1| PREDICTED: trafficking protein particle complex subunit 9-like 
[Glycine max]
Length=1198

 Score =   272 bits (696),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 164/196 (84%), Gaps = 7/196 (4%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             SRIKV+W SGRNSSGELNIK+AI AALQ+SVMDVLLPDPLTFGF L ++GS   +  K +
Sbjct  1005  SRIKVQWHSGRNSSGELNIKEAILAALQTSVMDVLLPDPLTFGFRLVRDGS---ESGKPY  1061

Query  568   DMQNNSL----ACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTT  401
               +++ L    A K SVIAHEMTPMEVLVRNNTK+ IK+SL+ITCRDVAGENCV+G K T
Sbjct  1062  SDKDSELVESPASKGSVIAHEMTPMEVLVRNNTKDMIKMSLNITCRDVAGENCVDGTKAT  1121

Query  400   VLWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDE  221
             VLW GVL+ I ME+PPLQ+IKH F ++FLVPGEYTLLAAA IDDAN+ILRARA+ +S+ E
Sbjct  1122  VLWTGVLSDITMEIPPLQQIKHSFCLHFLVPGEYTLLAAAVIDDANDILRARAKTTSAAE  1181

Query  220   SIFCRGPPFHIRVNGT  173
              IFCRGPP+H+RV GT
Sbjct  1182  PIFCRGPPYHVRVLGT  1197



>ref|XP_004498769.1| PREDICTED: trafficking protein particle complex subunit 9-like 
[Cicer arietinum]
Length=1188

 Score =   271 bits (694),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 163/193 (84%), Gaps = 3/193 (2%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG--SPEIDVPK  575
             SRIKV+W SGRNSSGELNIKDAIQAALQ+SVMDVLLPDPLTFGF L +NG  S   D  K
Sbjct  995   SRIKVQWHSGRNSSGELNIKDAIQAALQTSVMDVLLPDPLTFGFRLVRNGFESDNPDPVK  1054

Query  574   EFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVL  395
             E D+   S A K SV+AHEMTPM V VRNNTK+TI++SL+ITCRDVAGENCV+G K+TVL
Sbjct  1055  ESDLPE-SPASKGSVLAHEMTPMVVAVRNNTKDTIQMSLNITCRDVAGENCVDGTKSTVL  1113

Query  394   WAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESI  215
             W GVL+ I ME+PPLQEI H F ++FLVPGEYTLLAAA IDDAN+ILRARARA+S+ E I
Sbjct  1114  WTGVLSDITMEIPPLQEINHSFCLHFLVPGEYTLLAAAVIDDANDILRARARATSAAEPI  1173

Query  214   FCRGPPFHIRVNG  176
             FCRGPP+H+RV G
Sbjct  1174  FCRGPPYHLRVLG  1186



>ref|XP_010105451.1| hypothetical protein L484_003461 [Morus notabilis]
 gb|EXC04752.1| hypothetical protein L484_003461 [Morus notabilis]
Length=1203

 Score =   271 bits (694),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 162/194 (84%), Gaps = 2/194 (1%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVP--K  575
             SRIKVRWQSGRNSSGELNIKDAIQAALQ+SVMDVLLPDPLTFGF L  + S   D+   K
Sbjct  1009  SRIKVRWQSGRNSSGELNIKDAIQAALQTSVMDVLLPDPLTFGFRLLGSISKPDDLGSFK  1068

Query  574   EFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVL  395
             +   Q  S A K SV+AH++TPMEV+VRNNTK+ I++SLSITCRDVAGENC+EG K TVL
Sbjct  1069  KSTTQVQSPALKGSVVAHDVTPMEVVVRNNTKDRIRMSLSITCRDVAGENCMEGAKATVL  1128

Query  394   WAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESI  215
              AGVL+GI MEVPPLQE+KH FS+ FLVPGEYTL+AAA IDDA++ILRARAR  S DE I
Sbjct  1129  LAGVLSGIRMEVPPLQEVKHSFSLNFLVPGEYTLVAAAMIDDASDILRARARTDSPDEPI  1188

Query  214   FCRGPPFHIRVNGT  173
              CRGPP+H+RV GT
Sbjct  1189  LCRGPPYHVRVVGT  1202



>ref|XP_010519641.1| PREDICTED: trafficking protein particle complex subunit 9 [Tarenaya 
hassleriana]
Length=1188

 Score =   271 bits (693),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 155/191 (81%), Gaps = 9/191 (5%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             S+IKVRWQSGRNSSGELNIKDAIQAALQ+SVMDVLLPDPLTFGF L ++GS         
Sbjct  1004  SKIKVRWQSGRNSSGELNIKDAIQAALQTSVMDVLLPDPLTFGFRLVRHGS---------  1054

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
               Q  SLA K SV A EMTPMEVLVRNNT E IKLSLS+TCRDVAG+NCVEG   TVLWA
Sbjct  1055  GRQPESLASKGSVSALEMTPMEVLVRNNTSEAIKLSLSVTCRDVAGQNCVEGADATVLWA  1114

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             G L+ I MEVPPL+EI+H FSMYFLVPGEYT++AAA I+DAN +LRARAR  S +E IFC
Sbjct  1115  GALSEITMEVPPLEEIRHGFSMYFLVPGEYTMVAAAVIEDANNVLRARARTESPEEPIFC  1174

Query  208   RGPPFHIRVNG  176
             RGPPFH+ V G
Sbjct  1175  RGPPFHVCVTG  1185



>gb|KEH39853.1| transporter TRS120 [Medicago truncatula]
Length=1183

 Score =   270 bits (691),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 165/193 (85%), Gaps = 3/193 (2%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPE--IDVPK  575
             SRIKV+W SGRNSSGELNIKDAIQAAL +SVMDVLLPDPLTFGF L K+GS    ID  K
Sbjct  990   SRIKVQWHSGRNSSGELNIKDAIQAALLTSVMDVLLPDPLTFGFKLVKDGSDSDNIDPVK  1049

Query  574   EFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVL  395
             E D+   S A KSSV+AHEMTPM V+VRNNTK+ IK++L+ITCRDVAGENCV+G K+TVL
Sbjct  1050  ESDLPE-SPASKSSVLAHEMTPMVVVVRNNTKDMIKMNLNITCRDVAGENCVDGTKSTVL  1108

Query  394   WAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESI  215
             W GVL+ + +E+PPLQ+IKH F ++FLVPGEYTLLAAA IDDAN+ILRARARA+SS E I
Sbjct  1109  WTGVLSEVTIEIPPLQQIKHSFCLHFLVPGEYTLLAAAVIDDANDILRARARATSSAEPI  1168

Query  214   FCRGPPFHIRVNG  176
             FCRGPP+H+RV G
Sbjct  1169  FCRGPPYHLRVLG  1181



>ref|XP_002309653.2| hypothetical protein POPTR_0006s27580g [Populus trichocarpa]
 gb|EEE93176.2| hypothetical protein POPTR_0006s27580g [Populus trichocarpa]
Length=1183

 Score =   270 bits (689),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 156/192 (81%), Gaps = 9/192 (5%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             SRIKVRWQSGRNSSGELN KDAIQ+AL++S MDVLLPDPLTFGF L +N           
Sbjct  1000  SRIKVRWQSGRNSSGELNTKDAIQSALKTSAMDVLLPDPLTFGFRLVRNN---------L  1050

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
               ++N    K SV+AH+MTPMEVLVRNNTKE I++SLSITCRDVAGENCVE  K TVLW+
Sbjct  1051  SQESNDSRPKGSVLAHDMTPMEVLVRNNTKEMIRMSLSITCRDVAGENCVEDTKATVLWS  1110

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             GVLNGI +E PPL+E KH FS+YFLVPGEYTL+AAA ++DAN+ILRARA+ +S DE IFC
Sbjct  1111  GVLNGITIEAPPLKESKHSFSLYFLVPGEYTLVAAAVVEDANDILRARAKTNSPDEPIFC  1170

Query  208   RGPPFHIRVNGT  173
             RGPPF +RV GT
Sbjct  1171  RGPPFRVRVIGT  1182



>gb|KHG29759.1| Trafficking particle complex subunit 9 [Gossypium arboreum]
Length=1200

 Score =   270 bits (689),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 158/195 (81%), Gaps = 3/195 (2%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS---PEIDVP  578
             SRIKVRWQSG+NS GELNI DAI+ ALQSS+MD+LLPDPLTF F LA+N S     +D P
Sbjct  1005  SRIKVRWQSGQNSCGELNITDAIRVALQSSIMDILLPDPLTFSFRLARNVSKNAANLDSP  1064

Query  577   KEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTV  398
             KE  +        S VI H+MTPMEVLVRNNTKETIK++LS+TCRDVAG+NCVEG K TV
Sbjct  1065  KESSINIQPSMSNSYVIEHDMTPMEVLVRNNTKETIKMNLSVTCRDVAGQNCVEGTKATV  1124

Query  397   LWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDES  218
             LWAGVL+GI +EVPPL+E KH F +YFLVPGEYT++AAA IDDAN++LRARA+  S DE 
Sbjct  1125  LWAGVLSGITIEVPPLEESKHSFFLYFLVPGEYTMVAAAVIDDANDVLRARAKCESPDEP  1184

Query  217   IFCRGPPFHIRVNGT  173
             I CRGPPFH+RV GT
Sbjct  1185  ISCRGPPFHVRVIGT  1199



>ref|XP_010048925.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X2 [Eucalyptus grandis]
Length=1198

 Score =   268 bits (685),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 159/195 (82%), Gaps = 3/195 (2%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEI---DVP  578
             S+IKV+W SGRNSSGELNIKD IQ ALQSSVMDVLLPDPLTFGF L ++GS +    D+P
Sbjct  1003  SKIKVKWHSGRNSSGELNIKDTIQKALQSSVMDVLLPDPLTFGFRLVRDGSSDAAVPDMP  1062

Query  577   KEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTV  398
                 +Q    A +  ++A+E+TPMEVLVRNNTKETI++ LSITCRDVAGENC EG   TV
Sbjct  1063  MASMIQVEKTASEGCMMANEVTPMEVLVRNNTKETIRMCLSITCRDVAGENCTEGANATV  1122

Query  397   LWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDES  218
             LW+GVLNGI MEVPPL+E KH FS+YFLVPGEYTL+AA+ I+DAN+ILRARA+A S DE 
Sbjct  1123  LWSGVLNGITMEVPPLKETKHLFSLYFLVPGEYTLVAASVIEDANDILRARAKADSPDEP  1182

Query  217   IFCRGPPFHIRVNGT  173
             I CRGPPFH+ V GT
Sbjct  1183  ICCRGPPFHVCVMGT  1197



>ref|XP_010048924.1| PREDICTED: trafficking protein particle complex subunit 9 isoform 
X1 [Eucalyptus grandis]
 gb|KCW81340.1| hypothetical protein EUGRSUZ_C02726 [Eucalyptus grandis]
Length=1202

 Score =   268 bits (685),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 159/195 (82%), Gaps = 3/195 (2%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEI---DVP  578
             S+IKV+W SGRNSSGELNIKD IQ ALQSSVMDVLLPDPLTFGF L ++GS +    D+P
Sbjct  1007  SKIKVKWHSGRNSSGELNIKDTIQKALQSSVMDVLLPDPLTFGFRLVRDGSSDAAVPDMP  1066

Query  577   KEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTV  398
                 +Q    A +  ++A+E+TPMEVLVRNNTKETI++ LSITCRDVAGENC EG   TV
Sbjct  1067  MASMIQVEKTASEGCMMANEVTPMEVLVRNNTKETIRMCLSITCRDVAGENCTEGANATV  1126

Query  397   LWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDES  218
             LW+GVLNGI MEVPPL+E KH FS+YFLVPGEYTL+AA+ I+DAN+ILRARA+A S DE 
Sbjct  1127  LWSGVLNGITMEVPPLKETKHLFSLYFLVPGEYTLVAASVIEDANDILRARAKADSPDEP  1186

Query  217   IFCRGPPFHIRVNGT  173
             I CRGPPFH+ V GT
Sbjct  1187  ICCRGPPFHVCVMGT  1201



>ref|XP_010665754.1| PREDICTED: trafficking protein particle complex subunit 9 [Beta 
vulgaris subsp. vulgaris]
Length=1185

 Score =   268 bits (684),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 157/192 (82%), Gaps = 9/192 (5%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             SRIKVRW SGRN++GELNIKDA+QAALQ+SVMDVLLPDPLTF F LA++G          
Sbjct  1002  SRIKVRWDSGRNNTGELNIKDAMQAALQTSVMDVLLPDPLTFAFRLAQDG---------L  1052

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
                      +S V+AH MTPMEVLVRNNTKE IK++L+ITCRDVAGENC+EG K TVLWA
Sbjct  1053  GANPQRSETESLVLAHNMTPMEVLVRNNTKELIKMNLNITCRDVAGENCLEGSKATVLWA  1112

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             GVLNGI++EVPPLQEIKH FSMYFLVPGEYTL+AA+ I+DANEILRARAR+ S  E IFC
Sbjct  1113  GVLNGISLEVPPLQEIKHPFSMYFLVPGEYTLVAASLINDANEILRARARSDSPTEPIFC  1172

Query  208   RGPPFHIRVNGT  173
             RGPP H+RV G+
Sbjct  1173  RGPPVHLRVCGS  1184



>emb|CDX97076.1| BnaC09g45490D [Brassica napus]
Length=1183

 Score =   266 bits (680),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 156/191 (82%), Gaps = 9/191 (5%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             S+IKVRWQSGRNSSGEL+IKDAIQ ALQ++VMDVLLPDPLTFGF L +NGS         
Sbjct  999   SKIKVRWQSGRNSSGELDIKDAIQTALQTTVMDVLLPDPLTFGFRLVRNGS---------  1049

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
             + +  S   K SV++HE+TPMEVLVRNNT E IKL+LS+TCRDVAG+NC EG   TVLWA
Sbjct  1050  EKKAQSPLSKGSVLSHEVTPMEVLVRNNTSEAIKLNLSVTCRDVAGQNCAEGADATVLWA  1109

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             G L+GI+MEV PLQE +H FS+YFLVPGEYT++AAA I+DAN +LRARAR +S +E IFC
Sbjct  1110  GALSGISMEVAPLQETRHCFSLYFLVPGEYTMVAAAVIEDANNVLRARARTASPNEPIFC  1169

Query  208   RGPPFHIRVNG  176
             RGPPFH+RV G
Sbjct  1170  RGPPFHVRVTG  1180



>ref|XP_006399603.1| hypothetical protein EUTSA_v10012483mg [Eutrema salsugineum]
 gb|ESQ41056.1| hypothetical protein EUTSA_v10012483mg [Eutrema salsugineum]
Length=1187

 Score =   266 bits (679),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             S+IKVRWQSGRNSSGEL+IKDAIQ ALQ++VMDVLLPDPLTFGF L +NG     +  + 
Sbjct  999   SKIKVRWQSGRNSSGELDIKDAIQTALQTTVMDVLLPDPLTFGFRLVRNG-----LETDS  1053

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
             + +  S + K SV++HE+TPMEVLVRNNT E IKL+LS+TCRDVAG+NC +G   TVLWA
Sbjct  1054  ETKTQSPSSKGSVLSHEVTPMEVLVRNNTSEAIKLNLSVTCRDVAGQNCADGADATVLWA  1113

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             G L+GI+MEV PLQE +H FS+YFLVPGEYT++AAA I+DAN +LRARAR +S +E IFC
Sbjct  1114  GALSGISMEVAPLQETRHRFSLYFLVPGEYTMVAAAVIEDANNVLRARARTASPNEPIFC  1173

Query  208   RGPPFHIRVNG  176
             RGPPFH+RV G
Sbjct  1174  RGPPFHVRVTG  1184



>gb|KFK37733.1| hypothetical protein AALP_AA3G022200 [Arabis alpina]
Length=1187

 Score =   266 bits (679),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 158/191 (83%), Gaps = 5/191 (3%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             S+IKVRWQSGRNSSGEL+IKDAIQ ALQ++VMDVLLPDPLTFGF L +NGS E D     
Sbjct  999   SKIKVRWQSGRNSSGELDIKDAIQTALQTTVMDVLLPDPLTFGFRLVRNGS-ETDS----  1053

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
             + +  S + K SV++HE+TPMEVLVRNNT E IKL+LS+TCRDVAG+NC EG   TVLWA
Sbjct  1054  ETKAQSPSSKGSVLSHEVTPMEVLVRNNTSEAIKLNLSVTCRDVAGQNCAEGADATVLWA  1113

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             G L+GI+MEV PLQE +H FS+Y LVPGEYT++AAA I+DAN +LRARAR +S +E IFC
Sbjct  1114  GALSGISMEVAPLQETRHRFSLYILVPGEYTMVAAAVIEDANNVLRARARTASPNEPIFC  1173

Query  208   RGPPFHIRVNG  176
             RGPPFH+RV G
Sbjct  1174  RGPPFHVRVTG  1184



>ref|XP_010942155.1| PREDICTED: trafficking protein particle complex subunit 9 [Elaeis 
guineensis]
 ref|XP_010942156.1| PREDICTED: trafficking protein particle complex subunit 9 [Elaeis 
guineensis]
Length=1207

 Score =   266 bits (679),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 158/202 (78%), Gaps = 11/202 (5%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEI------  587
             S+IKVRW SGRNSSGELNIKDA Q ALQ+SVMD+LLPDPLTFGF LAKNG+ +I      
Sbjct  1006  SKIKVRWHSGRNSSGELNIKDATQPALQASVMDILLPDPLTFGFRLAKNGA-QINGFSEE  1064

Query  586   ----DVPKEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCV  419
                 D P    +  N + CK  + AHEMT MEVLVRNNT+E I++SLS+TCRDVAGENC 
Sbjct  1065  SIISDDPPSQCVNGNVIKCKGCISAHEMTHMEVLVRNNTREMIQMSLSVTCRDVAGENCT  1124

Query  418   EGDKTTVLWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrarar  239
             EG+  TVLWAGVLN I +EVPPL+E+KH FS+YFLVPGEYTLLAA+ I+DA ++LRARAR
Sbjct  1125  EGNNATVLWAGVLNDIPLEVPPLEEVKHAFSLYFLVPGEYTLLAASIINDATDVLRARAR  1184

Query  238   assSDESIFCRGPPFHIRVNGT  173
               S DE IFCRG PFH+ V GT
Sbjct  1185  TDSPDEPIFCRGSPFHVYVVGT  1206



>ref|XP_009122000.1| PREDICTED: trafficking protein particle complex subunit 9 [Brassica 
rapa]
Length=1183

 Score =   265 bits (677),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 156/191 (82%), Gaps = 9/191 (5%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             S+IKVRWQSGRNSSGEL+IKDAIQ ALQ++VMDVLLPDPLTFGF L +NG+         
Sbjct  999   SKIKVRWQSGRNSSGELDIKDAIQTALQTTVMDVLLPDPLTFGFRLVRNGA---------  1049

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
             + +  S   K SV++HE+TPMEVLVRNNT E IKL+LS+TCRDVAG+NC EG   TVLWA
Sbjct  1050  ETKAQSPLSKGSVLSHEVTPMEVLVRNNTSEAIKLNLSVTCRDVAGQNCAEGADATVLWA  1109

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             G L+GI+MEV PLQE +H FS+YFLVPGEYT++AAA I+DAN +LRARAR +S +E IFC
Sbjct  1110  GALSGISMEVAPLQETRHCFSLYFLVPGEYTMVAAAVIEDANNVLRARARTASPNEPIFC  1169

Query  208   RGPPFHIRVNG  176
             RGPPFH+RV G
Sbjct  1170  RGPPFHVRVTG  1180



>emb|CDX69788.1| BnaA10g21370D [Brassica napus]
Length=1183

 Score =   263 bits (673),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 155/191 (81%), Gaps = 9/191 (5%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             S+IKVRWQSGRNSSGEL+IKDAIQ ALQ++VMDVLLPDPLTFGF L +N S         
Sbjct  999   SKIKVRWQSGRNSSGELDIKDAIQTALQTTVMDVLLPDPLTFGFRLVRNDS---------  1049

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
             + +  S   K SV++HE+TPMEVLVRNNT E IKL+LS+TCRDVAG+NC EG   TVLWA
Sbjct  1050  ETKAQSPLSKGSVLSHEVTPMEVLVRNNTSEAIKLNLSVTCRDVAGQNCAEGADATVLWA  1109

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             G L+GI+MEV PLQE +H FS+YFLVPGEYT++AAA I+DAN +LRARAR +S +E IFC
Sbjct  1110  GALSGISMEVAPLQETRHCFSLYFLVPGEYTMVAAAVIEDANNVLRARARTTSPNEPIFC  1169

Query  208   RGPPFHIRVNG  176
             RGPPFH+RV G
Sbjct  1170  RGPPFHVRVTG  1180



>ref|XP_011039615.1| PREDICTED: trafficking protein particle complex subunit 9 [Populus 
euphratica]
Length=1182

 Score =   262 bits (669),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/192 (68%), Positives = 155/192 (81%), Gaps = 9/192 (5%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             SRIKVRWQSG+NSSGELN KDA+Q+AL++S MDVLLPDPLTFGF L +N           
Sbjct  999   SRIKVRWQSGQNSSGELNTKDAMQSALKTSAMDVLLPDPLTFGFRLVRN---------NL  1049

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
               ++N    K SV+AH+MTPMEVLVRNNTK+ I++SLSITCRDVAGENCVE  K TVLW+
Sbjct  1050  SKESNDSRPKGSVLAHDMTPMEVLVRNNTKDMIRMSLSITCRDVAGENCVEDTKATVLWS  1109

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             GVLNGI +E PPL+E +H FS+YFLVPGEYTL+A A ++DAN+ILRARA+ +S DE IFC
Sbjct  1110  GVLNGITIEAPPLKESQHSFSLYFLVPGEYTLVATAVVEDANDILRARAKTNSPDEPIFC  1169

Query  208   RGPPFHIRVNGT  173
             RGPPF +RV GT
Sbjct  1170  RGPPFRVRVIGT  1181



>ref|XP_008452884.1| PREDICTED: transport protein particle subunit trs120 [Cucumis 
melo]
Length=1196

 Score =   262 bits (669),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 158/193 (82%), Gaps = 4/193 (2%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             SRIKV+WQSGRNS GELNIKDAI AALQSS+MDVLLPDPLTFGF    N        KE 
Sbjct  1008  SRIKVKWQSGRNSFGELNIKDAILAALQSSMMDVLLPDPLTFGFRTVSNSLER----KES  1063

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
             D   +S++ +SS+ AHEMTP+EV+VRNNTKE IK+SL+ITCRDVAGE+CVEG K+TVLW 
Sbjct  1064  DQNLHSVSSQSSLEAHEMTPLEVIVRNNTKEMIKMSLNITCRDVAGESCVEGAKSTVLWN  1123

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             GVL+GI +EVPPL+E  H FS+YFL+PGEYTL AAA IDDA +ILRARAR SS DE IFC
Sbjct  1124  GVLSGITLEVPPLEETAHSFSLYFLIPGEYTLSAAAIIDDATDILRARARTSSPDEPIFC  1183

Query  208   RGPPFHIRVNGTL  170
              GPP+H+ VNGT+
Sbjct  1184  CGPPYHLCVNGTV  1196



>ref|XP_006286929.1| hypothetical protein CARUB_v10000071mg [Capsella rubella]
 gb|EOA19827.1| hypothetical protein CARUB_v10000071mg [Capsella rubella]
Length=792

 Score =   258 bits (660),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 154/194 (79%), Gaps = 11/194 (6%)
 Frame = -1

Query  748  SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG---SPEIDVP  578
            S+IKVRWQSGRNSSGEL+IKDAIQ ALQ++VMDVLLPDPLTFGF L +N      E   P
Sbjct  604  SKIKVRWQSGRNSSGELDIKDAIQTALQTTVMDVLLPDPLTFGFRLVRNSLEMDSETKAP  663

Query  577  KEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTV  398
              F         K SV++HE+TPMEVLVRNNT E IKL+LS+TCRDVAG+NC EG   TV
Sbjct  664  SPFP--------KGSVLSHEVTPMEVLVRNNTSEAIKLNLSVTCRDVAGQNCTEGADATV  715

Query  397  LWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDES  218
            LWAG L+GI++EV PLQE +H FS+YFLVPGEYT++AAA I+DAN +LRARAR +S +E 
Sbjct  716  LWAGALSGISIEVAPLQEARHCFSLYFLVPGEYTMVAAAVIEDANNVLRARARTASPNEP  775

Query  217  IFCRGPPFHIRVNG  176
            IFCRGPPFH+RV G
Sbjct  776  IFCRGPPFHVRVVG  789



>ref|XP_002871450.1| hypothetical protein ARALYDRAFT_487936 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47709.1| hypothetical protein ARALYDRAFT_487936 [Arabidopsis lyrata subsp. 
lyrata]
Length=1186

 Score =   261 bits (668),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 157/191 (82%), Gaps = 5/191 (3%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             S+IKVRWQSGRNSSGEL+IKDAIQ ALQ++VMDVLLPDPLTFGF L +NG     + ++ 
Sbjct  998   SKIKVRWQSGRNSSGELDIKDAIQTALQTTVMDVLLPDPLTFGFRLVRNG-----LERDS  1052

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
             + +  S   K SV++HE+TPMEVLVRNNT E IKL+LS+TCRDVAG+NC EG   TVLWA
Sbjct  1053  ETKAESPFSKGSVLSHEVTPMEVLVRNNTSEAIKLNLSVTCRDVAGQNCTEGADATVLWA  1112

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             G L+GI+MEV PLQE +H FS+YFLVPGEYT++AAA I+DAN +LRARAR +S +E IFC
Sbjct  1113  GALSGISMEVAPLQEARHCFSLYFLVPGEYTMVAAAVIEDANNVLRARARTASPNEPIFC  1172

Query  208   RGPPFHIRVNG  176
             RGPPFH+ V G
Sbjct  1173  RGPPFHVCVAG  1183



>ref|XP_006286927.1| hypothetical protein CARUB_v10000071mg [Capsella rubella]
 gb|EOA19825.1| hypothetical protein CARUB_v10000071mg [Capsella rubella]
Length=982

 Score =   259 bits (663),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 154/194 (79%), Gaps = 11/194 (6%)
 Frame = -1

Query  748  SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG---SPEIDVP  578
            S+IKVRWQSGRNSSGEL+IKDAIQ ALQ++VMDVLLPDPLTFGF L +N      E   P
Sbjct  794  SKIKVRWQSGRNSSGELDIKDAIQTALQTTVMDVLLPDPLTFGFRLVRNSLEMDSETKAP  853

Query  577  KEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTV  398
              F         K SV++HE+TPMEVLVRNNT E IKL+LS+TCRDVAG+NC EG   TV
Sbjct  854  SPFP--------KGSVLSHEVTPMEVLVRNNTSEAIKLNLSVTCRDVAGQNCTEGADATV  905

Query  397  LWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDES  218
            LWAG L+GI++EV PLQE +H FS+YFLVPGEYT++AAA I+DAN +LRARAR +S +E 
Sbjct  906  LWAGALSGISIEVAPLQEARHCFSLYFLVPGEYTMVAAAVIEDANNVLRARARTASPNEP  965

Query  217  IFCRGPPFHIRVNG  176
            IFCRGPPFH+RV G
Sbjct  966  IFCRGPPFHVRVVG  979



>ref|NP_196665.1| protein TRS120 [Arabidopsis thaliana]
 sp|Q9FY61.1|TR120_ARATH RecName: Full=Trafficking protein particle complex II-specific 
subunit 120 homolog; Short=AtTRS120; Short=TRAPP II-specific 
subunit 120 homolog; AltName: Full=Protein VASCULAR NETWORK 
DEFECTIVE 4 [Arabidopsis thaliana]
 emb|CAC03452.1| putative protein [Arabidopsis thaliana]
 gb|AED91628.1| protein TRS120 [Arabidopsis thaliana]
Length=1186

 Score =   260 bits (664),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 156/191 (82%), Gaps = 5/191 (3%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             S+IKVRWQSGRNSSGEL+IKDAIQ ALQ++VMDVLLPDPLTFGF L +NG     + K+ 
Sbjct  998   SKIKVRWQSGRNSSGELDIKDAIQTALQTTVMDVLLPDPLTFGFRLVRNG-----LEKDP  1052

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
             + +  S   K SV++HE+TPMEVLVRNNT E IKL+LS+TCRDVAG+NC EG   TVLWA
Sbjct  1053  ETKAESPFSKGSVLSHEVTPMEVLVRNNTSEAIKLNLSVTCRDVAGQNCTEGADATVLWA  1112

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             G L+GI+MEV PLQE +H FS++FLVPGEYT++AAA I+DAN +LRARA  +S +E IFC
Sbjct  1113  GALSGISMEVAPLQEARHCFSLFFLVPGEYTMVAAAVIEDANNVLRARAGTASPNEPIFC  1172

Query  208   RGPPFHIRVNG  176
             RGPPFH+ V G
Sbjct  1173  RGPPFHVCVAG  1183



>ref|XP_009381560.1| PREDICTED: trafficking protein particle complex subunit 9 [Musa 
acuminata subsp. malaccensis]
Length=1213

 Score =   260 bits (664),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 161/203 (79%), Gaps = 11/203 (5%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG--SPEIDVPK  575
             S+IKVRW SGRNSSGELNIKDA QAALQ+S+MD+LLPDPLTFGF L +NG  S  I  P+
Sbjct  1010  SKIKVRWHSGRNSSGELNIKDATQAALQASIMDILLPDPLTFGFRLGENGTASENIVSPE  1069

Query  574   EFDMQNNS---------LACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENC  422
             E  + +N             K SV+AHEMT MEV++RNNTKE IK+SL+++CRDVAGENC
Sbjct  1070  ESSISDNPPGQPGSRNVARAKGSVLAHEMTRMEVIIRNNTKERIKMSLNVSCRDVAGENC  1129

Query  421   VEGDKTTVLWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrara  242
             +EG+K TVLWAG L+ I++E PPLQ+I H F++YFLVPG+YTLLAAA I+DA ++LRARA
Sbjct  1130  IEGNKATVLWAGTLSDISLEAPPLQDITHSFALYFLVPGDYTLLAAAVINDATDVLRARA  1189

Query  241   rassSDESIFCRGPPFHIRVNGT  173
             ++ SSDE IFCRG PFH+ V GT
Sbjct  1190  KSDSSDEPIFCRGSPFHVHVVGT  1212



>ref|XP_008784808.1| PREDICTED: trafficking protein particle complex subunit 9 [Phoenix 
dactylifera]
Length=1209

 Score =   260 bits (664),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 156/203 (77%), Gaps = 11/203 (5%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS-------PE  590
             S+IKVRW SGRNSSGELNIKDA Q ALQ+SVMD+LLPDPLTFGF LAKNG+       PE
Sbjct  1006  SKIKVRWHSGRNSSGELNIKDATQPALQASVMDILLPDPLTFGFRLAKNGATARINGFPE  1065

Query  589   IDV----PKEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENC  422
               +    P    +  + + CK S+ AHEMT MEVLVRNNTKE I++SL + CRDVAGENC
Sbjct  1066  ESIISGDPPSQCVNGSVVKCKGSISAHEMTHMEVLVRNNTKEMIQMSLCVACRDVAGENC  1125

Query  421   VEGDKTTVLWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrara  242
              EG+  TVLWAGVLN I +EVPPL+E++H FS+YFLVPGEYTL AA+ I+DA ++LRARA
Sbjct  1126  TEGNNATVLWAGVLNDIRLEVPPLEEVEHAFSLYFLVPGEYTLQAASVINDATDVLRARA  1185

Query  241   rassSDESIFCRGPPFHIRVNGT  173
             R  S DE IFCRG PFH+ V GT
Sbjct  1186  RTDSPDEPIFCRGSPFHVHVVGT  1208



>ref|XP_006286928.1| hypothetical protein CARUB_v10000071mg [Capsella rubella]
 gb|EOA19826.1| hypothetical protein CARUB_v10000071mg [Capsella rubella]
Length=1186

 Score =   259 bits (662),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/194 (68%), Positives = 154/194 (79%), Gaps = 11/194 (6%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNG---SPEIDVP  578
             S+IKVRWQSGRNSSGEL+IKDAIQ ALQ++VMDVLLPDPLTFGF L +N      E   P
Sbjct  998   SKIKVRWQSGRNSSGELDIKDAIQTALQTTVMDVLLPDPLTFGFRLVRNSLEMDSETKAP  1057

Query  577   KEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTV  398
               F         K SV++HE+TPMEVLVRNNT E IKL+LS+TCRDVAG+NC EG   TV
Sbjct  1058  SPFP--------KGSVLSHEVTPMEVLVRNNTSEAIKLNLSVTCRDVAGQNCTEGADATV  1109

Query  397   LWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDES  218
             LWAG L+GI++EV PLQE +H FS+YFLVPGEYT++AAA I+DAN +LRARAR +S +E 
Sbjct  1110  LWAGALSGISIEVAPLQEARHCFSLYFLVPGEYTMVAAAVIEDANNVLRARARTASPNEP  1169

Query  217   IFCRGPPFHIRVNG  176
             IFCRGPPFH+RV G
Sbjct  1170  IFCRGPPFHVRVVG  1183



>ref|XP_010453144.1| PREDICTED: trafficking protein particle complex subunit 9-like 
[Camelina sativa]
Length=1186

 Score =   259 bits (661),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 156/191 (82%), Gaps = 5/191 (3%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             S+IKVRWQSGRNSSGEL+IKDAIQ ALQ++VMDVLLPDPLTFGF L +N S E D     
Sbjct  998   SKIKVRWQSGRNSSGELDIKDAIQTALQTTVMDVLLPDPLTFGFRLVRN-SLETDS----  1052

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
             + +  S     SV++HE+TPMEVLVRNNT E IKL+LS+TCRDVAG+NC EG   TVLWA
Sbjct  1053  ETKAQSPFPTGSVLSHEVTPMEVLVRNNTSEAIKLNLSVTCRDVAGQNCTEGADATVLWA  1112

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             G L+GI+MEV PLQE +H FS+YFLVPGEYT++AAA I+DAN +LRARAR +S +E IFC
Sbjct  1113  GALSGISMEVAPLQEARHCFSLYFLVPGEYTMVAAAVIEDANNVLRARARTASPNEPIFC  1172

Query  208   RGPPFHIRVNG  176
             RGPPFH+RV G
Sbjct  1173  RGPPFHVRVVG  1183



>ref|XP_003623310.1| hypothetical protein MTR_7g069440 [Medicago truncatula]
Length=438

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 156/185 (84%), Gaps = 3/185 (2%)
 Frame = -1

Query  724  SGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKN--GSPEIDVPKEFDMQNNS  551
            +GRNSSGELNIKDAIQAAL +SVMDVLLPDPLTFGF L ++   S  +D  KE D+   S
Sbjct  253  NGRNSSGELNIKDAIQAALLTSVMDVLLPDPLTFGFKLVRDESDSDNLDPVKESDLPE-S  311

Query  550  LACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGI  371
             A KSSV+AHEMT M V+VRNNTK+TIK++L+ITCRDVAGENCV+G K+TVLW GVL+ I
Sbjct  312  PASKSSVLAHEMTSMVVVVRNNTKDTIKINLNITCRDVAGENCVDGTKSTVLWTGVLSEI  371

Query  370  AMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGPPFH  191
             +E+PPL +IKH F ++FLVPGEYTLLAAA IDDAN+ILRARARA+SS E IFCRGPP+H
Sbjct  372  TVEIPPLHQIKHSFCLHFLVPGEYTLLAAAVIDDANDILRARARATSSAEPIFCRGPPYH  431

Query  190  IRVNG  176
            +RV G
Sbjct  432  LRVLG  436



>ref|XP_010491797.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X1 [Camelina sativa]
Length=1186

 Score =   258 bits (659),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 156/191 (82%), Gaps = 5/191 (3%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             S+IKVRWQSGRNSSGEL+IKDAIQ ALQ++VMDVLLPDPLTFGF L +N S E D     
Sbjct  998   SKIKVRWQSGRNSSGELDIKDAIQTALQTTVMDVLLPDPLTFGFRLVRN-SLETDS----  1052

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
             + +  S   K SV++HE+TPMEVLVRNNT E IKL+LS+TCRDVAG+NC EG   TVLWA
Sbjct  1053  ETKAQSPFPKGSVLSHEVTPMEVLVRNNTSEAIKLNLSVTCRDVAGQNCTEGADATVLWA  1112

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             G L+GI+MEV PLQE +H FS+YFLVPGEYT++AAA I+DAN +LRARAR +S +E IFC
Sbjct  1113  GALSGISMEVAPLQEARHCFSLYFLVPGEYTMVAAAVIEDANNVLRARARTASPNEPIFC  1172

Query  208   RGPPFHIRVNG  176
             RGP FH+RV G
Sbjct  1173  RGPSFHVRVVG  1183



>ref|XP_010491799.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X2 [Camelina sativa]
Length=1196

 Score =   258 bits (659),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 156/191 (82%), Gaps = 5/191 (3%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             S+IKVRWQSGRNSSGEL+IKDAIQ ALQ++VMDVLLPDPLTFGF L +N S E D     
Sbjct  1008  SKIKVRWQSGRNSSGELDIKDAIQTALQTTVMDVLLPDPLTFGFRLVRN-SLETDS----  1062

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
             + +  S   K SV++HE+TPMEVLVRNNT E IKL+LS+TCRDVAG+NC EG   TVLWA
Sbjct  1063  ETKAQSPFPKGSVLSHEVTPMEVLVRNNTSEAIKLNLSVTCRDVAGQNCTEGADATVLWA  1122

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             G L+GI+MEV PLQE +H FS+YFLVPGEYT++AAA I+DAN +LRARAR +S +E IFC
Sbjct  1123  GALSGISMEVAPLQEARHCFSLYFLVPGEYTMVAAAVIEDANNVLRARARTASPNEPIFC  1182

Query  208   RGPPFHIRVNG  176
             RGP FH+RV G
Sbjct  1183  RGPSFHVRVVG  1193



>ref|XP_010419658.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X1 [Camelina sativa]
 ref|XP_010419659.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X2 [Camelina sativa]
Length=1186

 Score =   257 bits (657),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 156/191 (82%), Gaps = 5/191 (3%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             S+IKVRWQSGRNSSGEL+IKDAIQ ALQ++VMDVLLPDPLTFGF L ++ S E D     
Sbjct  998   SKIKVRWQSGRNSSGELDIKDAIQTALQTTVMDVLLPDPLTFGFRLVRD-SLETDS----  1052

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
             + +  S   K SV++HE+TPMEVLVRNNT E IKL+LS+TCRDVAG+NC EG   TVLWA
Sbjct  1053  ETKAQSPFPKGSVLSHEVTPMEVLVRNNTSEAIKLNLSVTCRDVAGQNCTEGAVATVLWA  1112

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             G L GI+MEV PLQE +H FS+YFLVPGEYT++AAA I+DAN +LRARAR +S +E IFC
Sbjct  1113  GALCGISMEVAPLQEARHCFSLYFLVPGEYTMVAAAVIEDANNVLRARARTASPNEPIFC  1172

Query  208   RGPPFHIRVNG  176
             RGPPFH+RV G
Sbjct  1173  RGPPFHVRVVG  1183



>ref|XP_004145518.1| PREDICTED: trafficking protein particle complex II-specific subunit 
120 homolog [Cucumis sativus]
 gb|KGN55459.1| hypothetical protein Csa_4G652710 [Cucumis sativus]
Length=1196

 Score =   257 bits (657),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 160/194 (82%), Gaps = 6/194 (3%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             SRIKV+WQSGRNS GELNIKDAI AALQSS+MDVLLPDPLTFGF    N      + ++ 
Sbjct  1008  SRIKVKWQSGRNSFGELNIKDAILAALQSSMMDVLLPDPLTFGFRTVTNS-----LDRKE  1062

Query  568   DMQN-NSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLW  392
               QN ++++ +SS+ AHEMTP+EV+VRNNTKE IK+SL+ITCRDVAGE+CVEG K+TVLW
Sbjct  1063  SYQNLHTVSSQSSLEAHEMTPLEVIVRNNTKEMIKMSLNITCRDVAGESCVEGAKSTVLW  1122

Query  391   AGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIF  212
              GVL+GI +EVPPL+E  H FS+YFL+PGEYTL AAA IDDA +ILRARAR SS DE IF
Sbjct  1123  NGVLSGITLEVPPLEETAHSFSLYFLIPGEYTLSAAAIIDDATDILRARARTSSPDEPIF  1182

Query  211   CRGPPFHIRVNGTL  170
             C GPP+H+ VNGT+
Sbjct  1183  CCGPPYHLCVNGTV  1196



>gb|ERN10399.1| hypothetical protein AMTR_s00026p00150010 [Amborella trichopoda]
Length=1207

 Score =   257 bits (657),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 159/204 (78%), Gaps = 14/204 (7%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKN--GSPEIDVPK  575
             SRIKVRWQSGRNSSGELNIKDA+QAALQ+++MD+LLPDPLTFGF L++N   +  +D  +
Sbjct  1005  SRIKVRWQSGRNSSGELNIKDAVQAALQTTIMDILLPDPLTFGFRLSRNKFSTGPLDAQQ  1064

Query  574   EF----------DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGEN  425
                         D +   L C  S++AHEMTPMEVLVRNNTKE +K+SLSITC+DVAG+N
Sbjct  1065  NARSHGRHHSGEDGRTKVLNC--SILAHEMTPMEVLVRNNTKELVKMSLSITCKDVAGDN  1122

Query  424   CVEGDKTTVLWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrar  245
             C +GDK TVLWAGVL+GI ++VPPLQEI H F MYFLVPGEYTL+ +A IDDA++ LR R
Sbjct  1123  CFDGDKATVLWAGVLSGIRVDVPPLQEITHSFVMYFLVPGEYTLMGSAVIDDASDFLRDR  1182

Query  244   arassSDESIFCRGPPFHIRVNGT  173
             AR  SS+E IFC GPPF + V GT
Sbjct  1183  ARTDSSNEPIFCSGPPFRLHVLGT  1206



>ref|XP_011625069.1| PREDICTED: trafficking protein particle complex II-specific subunit 
120 homolog [Amborella trichopoda]
Length=1205

 Score =   257 bits (657),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 159/204 (78%), Gaps = 14/204 (7%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKN--GSPEIDVPK  575
             SRIKVRWQSGRNSSGELNIKDA+QAALQ+++MD+LLPDPLTFGF L++N   +  +D  +
Sbjct  1003  SRIKVRWQSGRNSSGELNIKDAVQAALQTTIMDILLPDPLTFGFRLSRNKFSTGPLDAQQ  1062

Query  574   EF----------DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGEN  425
                         D +   L C  S++AHEMTPMEVLVRNNTKE +K+SLSITC+DVAG+N
Sbjct  1063  NARSHGRHHSGEDGRTKVLNC--SILAHEMTPMEVLVRNNTKELVKMSLSITCKDVAGDN  1120

Query  424   CVEGDKTTVLWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrar  245
             C +GDK TVLWAGVL+GI ++VPPLQEI H F MYFLVPGEYTL+ +A IDDA++ LR R
Sbjct  1121  CFDGDKATVLWAGVLSGIRVDVPPLQEITHSFVMYFLVPGEYTLMGSAVIDDASDFLRDR  1180

Query  244   arassSDESIFCRGPPFHIRVNGT  173
             AR  SS+E IFC GPPF + V GT
Sbjct  1181  ARTDSSNEPIFCSGPPFRLHVLGT  1204



>ref|XP_002446750.1| hypothetical protein SORBIDRAFT_06g021740 [Sorghum bicolor]
 gb|EES11078.1| hypothetical protein SORBIDRAFT_06g021740 [Sorghum bicolor]
Length=1163

 Score =   248 bits (633),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 154/193 (80%), Gaps = 4/193 (2%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSP-EIDVPKE  572
             S+IKV+W SGRNSSGELNIKDAIQAALQ+S+MD+LLPDPLTF F LAKNG+    D  K+
Sbjct  973   SKIKVKWHSGRNSSGELNIKDAIQAALQASIMDILLPDPLTFSFKLAKNGTVINDDSSKD  1032

Query  571   FDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLW  392
             F    + L CK  + AHEMT MEV +RNNTKE I+++LSI+C+DVAGENC + +  TVLW
Sbjct  1033  F---GSVLRCKDPISAHEMTHMEVQIRNNTKEIIQMNLSISCKDVAGENCFDENSATVLW  1089

Query  391   AGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIF  212
             AGVL+ I +EVPPLQE+ H FSMYFLVPG+Y+L AA+ I DA ++LRARA+A S DE I 
Sbjct  1090  AGVLSDIHLEVPPLQEVIHPFSMYFLVPGDYSLQAASVIIDATDVLRARAKAESPDEPIL  1149

Query  211   CRGPPFHIRVNGT  173
             CRG PFHIRV GT
Sbjct  1150  CRGSPFHIRVVGT  1162



>tpg|DAA37075.1| TPA: hypothetical protein ZEAMMB73_993824 [Zea mays]
Length=1163

 Score =   246 bits (628),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 151/193 (78%), Gaps = 4/193 (2%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSP-EIDVPKE  572
             S+IKV+W SGRNSSGELNIKDAIQ ALQ+S+MD+LLPDPL F F L  NG+   +D PK+
Sbjct  973   SKIKVKWHSGRNSSGELNIKDAIQTALQASIMDILLPDPLMFSFKLVTNGTVVNVDSPKD  1032

Query  571   FDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLW  392
                  N L CK  + AHEMT MEV +RNNTKE I+++LSI+C+DVAGENC + +  TVLW
Sbjct  1033  ---SGNVLRCKDPISAHEMTHMEVQIRNNTKEIIRMNLSISCKDVAGENCFDENSATVLW  1089

Query  391   AGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIF  212
             AGVL+ I +EVPPLQE+ H FSMYFLVPG+Y+L AA+ I DA ++LRARA+A S DE I 
Sbjct  1090  AGVLSDIHLEVPPLQEVVHPFSMYFLVPGDYSLQAASVIIDATDVLRARAKAESPDEPIL  1149

Query  211   CRGPPFHIRVNGT  173
             CRG PFHIRV GT
Sbjct  1150  CRGSPFHIRVVGT  1162



>ref|XP_008669201.1| PREDICTED: trafficking protein particle complex subunit 9 [Zea 
mays]
 tpg|DAA37076.1| TPA: hypothetical protein ZEAMMB73_993824 [Zea mays]
Length=1178

 Score =   246 bits (628),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 125/193 (65%), Positives = 151/193 (78%), Gaps = 4/193 (2%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSP-EIDVPKE  572
             S+IKV+W SGRNSSGELNIKDAIQ ALQ+S+MD+LLPDPL F F L  NG+   +D PK+
Sbjct  988   SKIKVKWHSGRNSSGELNIKDAIQTALQASIMDILLPDPLMFSFKLVTNGTVVNVDSPKD  1047

Query  571   FDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLW  392
                  N L CK  + AHEMT MEV +RNNTKE I+++LSI+C+DVAGENC + +  TVLW
Sbjct  1048  ---SGNVLRCKDPISAHEMTHMEVQIRNNTKEIIRMNLSISCKDVAGENCFDENSATVLW  1104

Query  391   AGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIF  212
             AGVL+ I +EVPPLQE+ H FSMYFLVPG+Y+L AA+ I DA ++LRARA+A S DE I 
Sbjct  1105  AGVLSDIHLEVPPLQEVVHPFSMYFLVPGDYSLQAASVIIDATDVLRARAKAESPDEPIL  1164

Query  211   CRGPPFHIRVNGT  173
             CRG PFHIRV GT
Sbjct  1165  CRGSPFHIRVVGT  1177



>gb|EMS61444.1| hypothetical protein TRIUR3_09999 [Triticum urartu]
Length=1134

 Score =   243 bits (619),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 150/198 (76%), Gaps = 6/198 (3%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             S+IKVRW SGRNSSGELNIKDAIQAALQ+S++D+LLPDPLTF F LAK+  P  D     
Sbjct  936   SKIKVRWHSGRNSSGELNIKDAIQAALQASILDILLPDPLTFSFRLAKDAKPVNDSNHST  995

Query  568   DMQ------NNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDK  407
             D         N L CK  + AH+MT MEV +RNNTKE I+++LSI+C+DVAGENC E + 
Sbjct  996   DENVGPSAGENVLRCKDPISAHKMTHMEVQIRNNTKEIIQMNLSISCKDVAGENCFEENS  1055

Query  406   TTVLWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassS  227
              TVLWAGVLN I +EVPPLQE+ H FS+YFLVPG+Y+L +++ I DA ++LRARA+A S 
Sbjct  1056  ATVLWAGVLNDIQLEVPPLQEVVHPFSVYFLVPGDYSLQSSSVIIDATDVLRARAKAESP  1115

Query  226   DESIFCRGPPFHIRVNGT  173
             DE I CRG PFHI V GT
Sbjct  1116  DEPILCRGSPFHIHVVGT  1133



>dbj|BAJ94931.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1019

 Score =   241 bits (615),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 152/199 (76%), Gaps = 8/199 (4%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             S+IKVRW SGRNSSGELNIKDAIQAALQ+S++D+LLPDPLTF F LAK+  P  D     
Sbjct  821   SKIKVRWHSGRNSSGELNIKDAIQAALQASILDILLPDPLTFSFRLAKDAKPAND-SSHS  879

Query  568   DMQN-------NSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGD  410
              ++N       N L CK  + AH+MT MEV +RNNTKE I+++LSI+C+DVAGENC E +
Sbjct  880   TVENVGPFTGENVLRCKDPISAHKMTHMEVQIRNNTKEIIQMNLSISCKDVAGENCFEEN  939

Query  409   KTTVLWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararass  230
               TVLWAGVLN I +EVPPLQE+ H FS+YFLVPG+Y+L +++ I DA ++LRARA+A S
Sbjct  940   SATVLWAGVLNDIQLEVPPLQEVMHPFSVYFLVPGDYSLQSSSVIIDATDVLRARAKAES  999

Query  229   SDESIFCRGPPFHIRVNGT  173
              DE I CRG PFHI V GT
Sbjct  1000  PDEPILCRGSPFHIHVVGT  1018



>gb|EMT13211.1| hypothetical protein F775_03305 [Aegilops tauschii]
Length=1214

 Score =   241 bits (614),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 150/198 (76%), Gaps = 6/198 (3%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             S+IKVRW SGRNSSGELNIKDAIQAALQ+S++D+LLPDPLTF F LAK+  P  D     
Sbjct  1016  SKIKVRWNSGRNSSGELNIKDAIQAALQASILDILLPDPLTFSFRLAKDAKPANDSSHST  1075

Query  568   ------DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDK  407
                       N L CK  + AH+MT MEV +RNNTKE I+++LSI+C+DVAGENC E + 
Sbjct  1076  VENVGPSAGENVLRCKDPISAHKMTHMEVQIRNNTKEIIQMNLSISCKDVAGENCFEENS  1135

Query  406   TTVLWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassS  227
              TVLWAGVLN I +EVPPLQE+ H FS+YFLVPG+Y+L +++ I DA ++LRARA+A SS
Sbjct  1136  ATVLWAGVLNDIQLEVPPLQEVIHPFSVYFLVPGDYSLQSSSVIIDATDVLRARAKAESS  1195

Query  226   DESIFCRGPPFHIRVNGT  173
             DE I CRG PFHI V GT
Sbjct  1196  DEPILCRGSPFHIHVVGT  1213



>ref|XP_010227185.1| PREDICTED: LOW QUALITY PROTEIN: trafficking protein particle 
complex subunit 9 [Brachypodium distachyon]
Length=1210

 Score =   238 bits (607),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 152/205 (74%), Gaps = 13/205 (6%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDV---P  578
             S+IKVRW SGRNSSGELNIKDAIQAALQ+S+MD+LLPDPLTF F LAK+G+    V    
Sbjct  1005  SKIKVRWHSGRNSSGELNIKDAIQAALQASIMDILLPDPLTFSFRLAKDGTMAKTVSASA  1064

Query  577   KEFDMQNNS----------LACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGE  428
              +F    N           L CK  + AHEMT MEV +RNNTKE I+++LSI+C+DVAGE
Sbjct  1065  NDFSHSTNENACPSTGESVLRCKDPISAHEMTHMEVQIRNNTKEIIRMNLSISCKDVAGE  1124

Query  427   NCVEGDKTTVLWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILra  248
             NC + +  TVLWAGVL+ I +EVPPLQE+ H FS+YFLVPG+Y+L A++ I DA ++LRA
Sbjct  1125  NCFDENSATVLWAGVLSDIQVEVPPLQELVHPFSVYFLVPGDYSLQASSVIIDATDVLRA  1184

Query  247   rarassSDESIFCRGPPFHIRVNGT  173
             RA+A S DE I CRG PFHI V GT
Sbjct  1185  RAKAESPDEPILCRGSPFHIHVVGT  1209



>gb|EPS63566.1| hypothetical protein M569_11217, partial [Genlisea aurea]
Length=1100

 Score =   237 bits (604),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 152/189 (80%), Gaps = 13/189 (7%)
 Frame = -1

Query  739   KVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQ  560
             KVRW+SGRNSSGEL+IKDAIQ+ALQ+SVMDVLLPDPLTFGF L+K G             
Sbjct  922   KVRWRSGRNSSGELDIKDAIQSALQASVMDVLLPDPLTFGFRLSKTG-------------  968

Query  559   NNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAGVL  380
              +S +  + V+A+EMT ME LVRNNT ET+++SLSI C+DVAGE C++G + TVLW GVL
Sbjct  969   GDSASAAAVVVANEMTTMEALVRNNTMETLEISLSIACKDVAGEKCMDGGRATVLWEGVL  1028

Query  379   NGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFCRGP  200
              G++ME+PPL+E+ H FS++FL+PG+YT+LAAA I DANE+LRARAR +SSDE I CRGP
Sbjct  1029  TGVSMEIPPLREVGHVFSLFFLIPGDYTVLAAAVIKDANEVLRARARTTSSDEPIVCRGP  1088

Query  199   PFHIRVNGT  173
             PF +RV+GT
Sbjct  1089  PFRLRVDGT  1097



>ref|XP_004976133.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X1 [Setaria italica]
Length=1185

 Score =   234 bits (598),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 148/192 (77%), Gaps = 11/192 (6%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             S+IKV+W SGRNSSGELNIKDAIQAALQ+S+MD+LLPDPLTF F LAKNG+         
Sbjct  1004  SKIKVKWHSGRNSSGELNIKDAIQAALQASIMDILLPDPLTFSFKLAKNGA---------  1054

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
                 N  + K  + AHEMT MEV +RNNTKE I+++LSI+C+DVAGENC + +  TVLWA
Sbjct  1055  --VTNVDSSKDPISAHEMTHMEVQIRNNTKEIIRMNLSISCKDVAGENCFDENSATVLWA  1112

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             GVL+ I +EV PLQE+ H FS+YFLVPG+Y+L A++ I DA ++LRARA+A S DE I C
Sbjct  1113  GVLSDIHLEVLPLQEVVHPFSVYFLVPGDYSLQASSVIIDATDVLRARAKAESPDEPILC  1172

Query  208   RGPPFHIRVNGT  173
             RG PFHIRV GT
Sbjct  1173  RGSPFHIRVVGT  1184



>ref|XP_004976134.1| PREDICTED: trafficking protein particle complex subunit 9-like 
isoform X2 [Setaria italica]
Length=1182

 Score =   234 bits (598),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 148/192 (77%), Gaps = 11/192 (6%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             S+IKV+W SGRNSSGELNIKDAIQAALQ+S+MD+LLPDPLTF F LAKNG+         
Sbjct  1001  SKIKVKWHSGRNSSGELNIKDAIQAALQASIMDILLPDPLTFSFKLAKNGA---------  1051

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
                 N  + K  + AHEMT MEV +RNNTKE I+++LSI+C+DVAGENC + +  TVLWA
Sbjct  1052  --VTNVDSSKDPISAHEMTHMEVQIRNNTKEIIRMNLSISCKDVAGENCFDENSATVLWA  1109

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             GVL+ I +EV PLQE+ H FS+YFLVPG+Y+L A++ I DA ++LRARA+A S DE I C
Sbjct  1110  GVLSDIHLEVLPLQEVVHPFSVYFLVPGDYSLQASSVIIDATDVLRARAKAESPDEPILC  1169

Query  208   RGPPFHIRVNGT  173
             RG PFHIRV GT
Sbjct  1170  RGSPFHIRVVGT  1181



>ref|NP_001053234.1| Os04g0502200 [Oryza sativa Japonica Group]
 sp|Q0JBY9.1|TR120_ORYSJ RecName: Full=Trafficking protein particle complex II-specific 
subunit 120 homolog; Short=TRAPP II-specific subunit 120 homolog 
[Oryza sativa Japonica Group]
 dbj|BAF15148.1| Os04g0502200 [Oryza sativa Japonica Group]
Length=1187

 Score =   233 bits (595),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 151/199 (76%), Gaps = 7/199 (4%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS-PEIDVPKE  572
             S+IKV+W SGRNSSGELNIKDAIQ ALQ+S+MD+LLPDPLTF F  AK+G+  + D  KE
Sbjct  988   SKIKVKWHSGRNSSGELNIKDAIQTALQASIMDILLPDPLTFSFRHAKDGTTAKTDSSKE  1047

Query  571   ------FDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGD  410
                        + L CK  + A+EMT MEV +RNNTKETI+++LSI+C+DVAGENC + +
Sbjct  1048  PGDGSSRSADESVLRCKDPIFANEMTHMEVQIRNNTKETIRMNLSISCKDVAGENCFDEN  1107

Query  409   KTTVLWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararass  230
               TVLWAGVL+ I +EV PLQE+ H FS+YFLVPG+Y+L AA+ I DA ++LRARA+A S
Sbjct  1108  SATVLWAGVLSDIYLEVQPLQEVVHPFSIYFLVPGDYSLQAASVIIDATDVLRARAKAES  1167

Query  229   SDESIFCRGPPFHIRVNGT  173
              DE I CRG PFHI V GT
Sbjct  1168  PDEPILCRGSPFHIHVVGT  1186



>gb|EEC77580.1| hypothetical protein OsI_16530 [Oryza sativa Indica Group]
Length=1167

 Score =   233 bits (594),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 151/199 (76%), Gaps = 7/199 (4%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS-PEIDVPKE  572
             S+IKV+W SGRNSSGELNIKDAIQ ALQ+S+MD+LLPDPLTF F  AK+G+  + D  KE
Sbjct  968   SKIKVKWHSGRNSSGELNIKDAIQTALQASIMDILLPDPLTFSFRHAKDGTTAKTDSSKE  1027

Query  571   ------FDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGD  410
                        + L CK  + A+EMT MEV +RNNTKETI+++LSI+C+DVAGENC + +
Sbjct  1028  PGDGSSRSADESVLRCKDPIFANEMTHMEVQIRNNTKETIQMNLSISCKDVAGENCFDEN  1087

Query  409   KTTVLWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararass  230
               TVLWAGVL+ I +EV PLQE+ H FS+YFLVPG+Y+L AA+ I DA ++LRARA+A S
Sbjct  1088  SATVLWAGVLSDIYLEVQPLQEVVHPFSIYFLVPGDYSLQAASVIIDATDVLRARAKAES  1147

Query  229   SDESIFCRGPPFHIRVNGT  173
              DE I CRG PFHI V GT
Sbjct  1148  PDEPILCRGSPFHIHVVGT  1166



>emb|CAH67557.1| H0311C03.11 [Oryza sativa Indica Group]
Length=1187

 Score =   233 bits (593),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 151/199 (76%), Gaps = 7/199 (4%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS-PEIDVPKE  572
             S+IKV+W SGRNSSGELNIKDAIQ ALQ+S+MD+LLPDPLTF F  AK+G+  + D  KE
Sbjct  988   SKIKVKWHSGRNSSGELNIKDAIQTALQASIMDILLPDPLTFSFRHAKDGTTAKTDSSKE  1047

Query  571   ------FDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGD  410
                        + L CK  + A+EMT MEV +RNNTKETI+++LSI+C+DVAGENC + +
Sbjct  1048  PGDGSSRSADESVLRCKDPIFANEMTHMEVQIRNNTKETIQMNLSISCKDVAGENCFDEN  1107

Query  409   KTTVLWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararass  230
               TVLWAGVL+ I +EV PLQE+ H FS+YFLVPG+Y+L AA+ I DA ++LRARA+A S
Sbjct  1108  SATVLWAGVLSDIYLEVQPLQEVVHPFSIYFLVPGDYSLQAASVIIDATDVLRARAKAES  1167

Query  229   SDESIFCRGPPFHIRVNGT  173
              DE I CRG PFHI V GT
Sbjct  1168  PDEPILCRGSPFHIHVVGT  1186



>ref|XP_006653574.1| PREDICTED: trafficking protein particle complex subunit 9-like 
[Oryza brachyantha]
Length=1113

 Score =   231 bits (590),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 149/199 (75%), Gaps = 7/199 (4%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPE-------  590
             S+IKV+W SGRNSSGELNIKDAIQAALQ+S+MD+LLPDPLTF F  AK+G+         
Sbjct  914   SKIKVKWHSGRNSSGELNIKDAIQAALQASIMDILLPDPLTFSFRHAKDGTSAKTDSSEE  973

Query  589   IDVPKEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGD  410
                       ++ L CK  + A+EMT MEV +RNNTKETI+++LSI+C+DVAGENC + +
Sbjct  974   PSDDSSHSANDSVLRCKDPISANEMTHMEVQIRNNTKETIRMNLSISCKDVAGENCFDEN  1033

Query  409   KTTVLWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararass  230
               TVLWAGVL+ I +EV PLQE+ H FS+YFLVPG+Y+L AA+ I DA ++LRARA+A S
Sbjct  1034  SATVLWAGVLSDIYLEVQPLQEVVHPFSIYFLVPGDYSLQAASVIIDATDVLRARAKAES  1093

Query  229   SDESIFCRGPPFHIRVNGT  173
              DE I CRG PFHI V GT
Sbjct  1094  PDEPILCRGSPFHIHVVGT  1112



>gb|EEE61278.1| hypothetical protein OsJ_15360 [Oryza sativa Japonica Group]
Length=1247

 Score =   229 bits (584),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 148/194 (76%), Gaps = 7/194 (4%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS-PEIDVPKE  572
             S+IKV+W SGRNSSGELNIKDAIQ ALQ+S+MD+LLPDPLTF F  AK+G+  + D  KE
Sbjct  969   SKIKVKWHSGRNSSGELNIKDAIQTALQASIMDILLPDPLTFSFRHAKDGTTAKTDSSKE  1028

Query  571   ------FDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGD  410
                        + L CK  + A+EMT MEV +RNNTKETI+++LSI+C+DVAGENC + +
Sbjct  1029  PGDGSSRSADESVLRCKDPIFANEMTHMEVQIRNNTKETIRMNLSISCKDVAGENCFDEN  1088

Query  409   KTTVLWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararass  230
               TVLWAGVL+ I +EV PLQE+ H FS+YFLVPG+Y+L AA+ I DA ++LRARA+A S
Sbjct  1089  SATVLWAGVLSDIYLEVQPLQEVVHPFSIYFLVPGDYSLQAASVIIDATDVLRARAKAES  1148

Query  229   SDESIFCRGPPFHI  188
              DE I CRG PFHI
Sbjct  1149  PDEPILCRGSPFHI  1162



>ref|XP_010453143.1| PREDICTED: uncharacterized protein LOC104735118 [Camelina sativa]
Length=158

 Score =   205 bits (522),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 127/160 (79%), Gaps = 5/160 (3%)
 Frame = -1

Query  655  MDVLLPDPLTFGFSLAKNGSPEIDVPKEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKE  476
            MDVLLPDPLTFGF L +N S E D     + +  S     SV++HE+TPMEVLVRNNT E
Sbjct  1    MDVLLPDPLTFGFRLVRN-SLETDS----ETKAQSPFPTGSVLSHEVTPMEVLVRNNTSE  55

Query  475  TIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYT  296
             IKL+LS+TCRDVAG+NC EG   TVLWAG L+GI+MEV PLQE +H FS+YFLVPGEYT
Sbjct  56   AIKLNLSVTCRDVAGQNCTEGADATVLWAGALSGISMEVAPLQEARHCFSLYFLVPGEYT  115

Query  295  LLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNG  176
            ++AAA I+DAN +LRARAR +SS+E IFCRGPPFH+RV G
Sbjct  116  MVAAAVIEDANNVLRARARTASSNEPIFCRGPPFHVRVVG  155



>gb|AES79528.2| transporter TRS120 [Medicago truncatula]
Length=369

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 130/160 (81%), Gaps = 3/160 (2%)
 Frame = -1

Query  649  VLLPDPLTFGFSLAKN--GSPEIDVPKEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKE  476
            + L +PLTFGF L ++   S  +D  KE D+   S A KSSV+AHEMT M V+VRNNTK+
Sbjct  209  IALENPLTFGFKLVRDESDSDNLDPVKESDLPE-SPASKSSVLAHEMTSMVVVVRNNTKD  267

Query  475  TIKLSLSITCRDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYT  296
            TIK++L+ITCRDVAGENCV+G K+TVLW GVL+ I +E+PPL +IKH F ++FLVPGEYT
Sbjct  268  TIKINLNITCRDVAGENCVDGTKSTVLWTGVLSEITVEIPPLHQIKHSFCLHFLVPGEYT  327

Query  295  LLAAAAIDDANEILrararassSDESIFCRGPPFHIRVNG  176
            LLAAA IDDAN+ILRARARA+SS E IFCRGPP+H+RV G
Sbjct  328  LLAAAVIDDANDILRARARATSSAEPIFCRGPPYHLRVLG  367



>ref|XP_007011773.1| Trafficking protein particle complex subunit 9 isoform 2 [Theobroma 
cacao]
 gb|EOY29392.1| Trafficking protein particle complex subunit 9 isoform 2 [Theobroma 
cacao]
Length=1057

 Score =   199 bits (507),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 108/124 (87%), Gaps = 3/124 (2%)
 Frame = -1

Query  748  SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS---PEIDVP  578
            SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGF LA+NGS    ++D+P
Sbjct  842  SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFRLARNGSENASKLDLP  901

Query  577  KEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTV  398
            KE +      A K+ VIAH+MTPMEVLVRNNTKETIK++LS+TCRDVAGENCVEG K TV
Sbjct  902  KELNTSIQPSASKNFVIAHDMTPMEVLVRNNTKETIKMNLSVTCRDVAGENCVEGTKATV  961

Query  397  LWAG  386
            LWAG
Sbjct  962  LWAG  965



>ref|XP_009362330.1| PREDICTED: uncharacterized protein LOC103952471 [Pyrus x bretschneideri]
 ref|XP_009362331.1| PREDICTED: uncharacterized protein LOC103952471 [Pyrus x bretschneideri]
Length=153

 Score =   181 bits (458),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 115/151 (76%), Gaps = 2/151 (1%)
 Frame = -1

Query  619  FSLAKNGS-PEIDVPK-EFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITC  446
            + L++NG  PE      E +   +  A K S +AHE+  MEV+VRNNTKE IK+SLSITC
Sbjct  3    YHLSRNGRVPETSGSHTEPNFHGHPFASKGSALAHEIIAMEVMVRNNTKEMIKMSLSITC  62

Query  445  RDVAGENCVEGDKTTVLWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDA  266
            RDVAGENCVE  K TVL +GVL+GI  EVPPL+EIKH  S+YFLV GEYTL+AA+ IDDA
Sbjct  63   RDVAGENCVECTKATVLCSGVLSGITAEVPPLREIKHSLSLYFLVLGEYTLVAASVIDDA  122

Query  265  NEILrararassSDESIFCRGPPFHIRVNGT  173
            N+ILRARAR  SSDE I CRGPP+H+RV GT
Sbjct  123  NDILRARARTKSSDEPILCRGPPYHVRVVGT  153



>ref|XP_001774293.1| predicted protein [Physcomitrella patens]
 gb|EDQ60929.1| predicted protein [Physcomitrella patens]
Length=1118

 Score =   176 bits (446),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 123/191 (64%), Gaps = 18/191 (9%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             S+I VRW SGRNS+GEL IKDA++ ALQ+SV+ +LLPDPLTFGF LAK       +    
Sbjct  940   SKICVRWTSGRNSAGELPIKDALREALQASVLKILLPDPLTFGFRLAKTSISAPSLRSAR  999

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVE--GDKTTVL  395
             D  N     K  +   E+TP+E+LVRNNT E++K++LS+TCRDV G +C+   G K TVL
Sbjct  1000  DSDN-----KGGIGVRELTPIEMLVRNNTNESVKMTLSVTCRDVTGTSCMSAAGAKATVL  1054

Query  394   WAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESI  215
             WAG L+G+ +EV  L E  H F++ FLVPG+YTLL +A ID              + E++
Sbjct  1055  WAGTLDGVDVEVGALGEAVHRFALCFLVPGQYTLLGSAVIDS-----------QPTHEAL  1103

Query  214   FCRGPPFHIRV  182
                GPPF + V
Sbjct  1104  SYTGPPFAVHV  1114



>gb|EYU32375.1| hypothetical protein MIMGU_mgv1a000384mg [Erythranthe guttata]
Length=1153

 Score =   175 bits (443),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 105/128 (82%), Gaps = 5/128 (4%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSP----EIDV  581
             SRIKVRWQSGR+SSGEL+IKDAIQAALQ+SV+DVLLPDPLTFGF LAK+ S     + + 
Sbjct  1026  SRIKVRWQSGRSSSGELDIKDAIQAALQASVLDVLLPDPLTFGFRLAKSTSDLSIMKQNS  1085

Query  580   PKEFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTT  401
             PK+ DM N S   + S++AH+MT MEVLVRNNTK  I+++LS+TC+DVAGENC+EGDK T
Sbjct  1086  PKKTDMVN-SCGTEGSIVAHDMTAMEVLVRNNTKGAIRINLSVTCKDVAGENCIEGDKAT  1144

Query  400   VLWAGVLN  377
             VLW G  N
Sbjct  1145  VLWEGANN  1152



>emb|CAE01639.1| OSJNBa0029H02.30 [Oryza sativa Japonica Group]
Length=1193

 Score =   172 bits (435),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 109/142 (77%), Gaps = 7/142 (5%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS-PEIDVPKE  572
             S+IKV+W SGRNSSGELNIKDAIQ ALQ+S+MD+LLPDPLTF F  AK+G+  + D  KE
Sbjct  968   SKIKVKWHSGRNSSGELNIKDAIQTALQASIMDILLPDPLTFSFRHAKDGTTAKTDSSKE  1027

Query  571   -FDMQNNS-----LACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGD  410
               D  + S     L CK  + A+EMT MEV +RNNTKETI+++LSI+C+DVAGENC + +
Sbjct  1028  PGDGSSRSADESVLRCKDPIFANEMTHMEVQIRNNTKETIRMNLSISCKDVAGENCFDEN  1087

Query  409   KTTVLWAGVLNGIAMEVPPLQE  344
               TVLWAGVL+ I +EV PLQE
Sbjct  1088  SATVLWAGVLSDIYLEVQPLQE  1109



>ref|XP_001777714.1| predicted protein [Physcomitrella patens]
 gb|EDQ57494.1| predicted protein [Physcomitrella patens]
Length=1123

 Score =   167 bits (422),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 91/193 (47%), Positives = 120/193 (62%), Gaps = 18/193 (9%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             S+I VRW SGRNS+GEL IKDA++ ALQ+SV+ +LLPD LTFGF LAK     I  P   
Sbjct  941   SKICVRWTSGRNSAGELPIKDALREALQASVLKILLPDSLTFGFRLAKT---SISAPSLR  997

Query  568   DMQNNSLAC--KSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCV--EGDKTT  401
                +  L+   K      E+ P+E+LVRNNT E +K++LS+TCRDV G +C+   G K T
Sbjct  998   SADDGGLSTDNKGGFGVRELAPIEMLVRNNTNEAVKMTLSVTCRDVTGTSCLGAAGTKAT  1057

Query  400   VLWAGVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDE  221
             VLWAG L+ + +EV  L E+ H FS+ FLVPG+YTLL +A I+                E
Sbjct  1058  VLWAGTLDRVNVEVGALGEVVHRFSLCFLVPGQYTLLGSAVINS-----------QPGHE  1106

Query  220   SIFCRGPPFHIRV  182
             ++   GPPF + V
Sbjct  1107  ALSYTGPPFAVDV  1119



>ref|XP_009762936.1| PREDICTED: uncharacterized protein LOC104214912 [Nicotiana sylvestris]
Length=209

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 93/120 (78%), Gaps = 6/120 (5%)
 Frame = -1

Query  745  RIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKN---GSPEIDVPK  575
            R KVRWQSGRN+ GEL+IK+AIQAALQSS+MD+LL DPLTFGF   KN      E+++ +
Sbjct  93   RTKVRWQSGRNNCGELHIKEAIQAALQSSMMDILLSDPLTFGFRCGKNTLRDFAELNLDE  152

Query  574  EFDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVL  395
            E D+Q    A K S+ AH+M P+EVLV NN KE IK+SLSITCRD+ G+NCVEGDK TVL
Sbjct  153  ESDIQG---ARKCSLRAHDMAPIEVLVCNNAKEIIKVSLSITCRDIVGDNCVEGDKATVL  209



>ref|XP_002962206.1| hypothetical protein SELMODRAFT_77626 [Selaginella moellendorffii]
 gb|EFJ37466.1| hypothetical protein SELMODRAFT_77626 [Selaginella moellendorffii]
Length=1091

 Score =   150 bits (380),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 114/189 (60%), Gaps = 36/189 (19%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             S I+VRW SG+N+SGEL++KDAI+ AL+ SV ++LLPDPLTF F LA             
Sbjct  938   SSIRVRWSSGKNTSGELHLKDAIRDALRDSVREILLPDPLTFAFRLAAG-----------  986

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
                         V A+++ P+E+LV+NNT E + +SLS+ CRD++G +CV   +  +L+A
Sbjct  987   ----------EDVRANQLVPIEMLVKNNTAEDVAVSLSVACRDISGASCVV--EQQILYA  1034

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             G L+G+ +E+  L E  H FS++FLVPGEYTLL AA +                D+SI  
Sbjct  1035  GALDGVEVELSSLGEAVHRFSLFFLVPGEYTLLGAAVVS-------------LRDDSICY  1081

Query  208   RGPPFHIRV  182
              GPPF + V
Sbjct  1082  CGPPFAVHV  1090



>ref|XP_002965121.1| hypothetical protein SELMODRAFT_83253 [Selaginella moellendorffii]
 gb|EFJ33959.1| hypothetical protein SELMODRAFT_83253 [Selaginella moellendorffii]
Length=1091

 Score =   149 bits (375),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 114/189 (60%), Gaps = 36/189 (19%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
             S I+VRW SG+N+SGEL++KDAI+ AL+ SV ++LLPDPLTF F LA             
Sbjct  938   SSIRVRWSSGKNTSGELHLKDAIRDALRDSVREILLPDPLTFAFRLAAG-----------  986

Query  568   DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
                         V A+++ P+E+LV+NNT E + +SLS+ CRD++G +CV   +  +L+A
Sbjct  987   ----------EDVRANQLVPIEMLVKNNTAEDVAVSLSVACRDISGTSCVV--EQQILYA  1034

Query  388   GVLNGIAMEVPPLQEIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
             G L+G+ +E+  L +  H FS++FLVPGEYTLL AA +                D+SI  
Sbjct  1035  GALDGVEVELSSLGDAVHRFSLFFLVPGEYTLLGAAVVP-------------LRDDSICY  1081

Query  208   RGPPFHIRV  182
              GPPF + V
Sbjct  1082  CGPPFAVHV  1090



>gb|AFW58779.1| hypothetical protein ZEAMMB73_746167 [Zea mays]
Length=280

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 86/132 (65%), Gaps = 4/132 (3%)
 Frame = -1

Query  748  SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS-PEIDVPKE  572
            S+IKV+W SGRNSSGELNIKDAI AA+Q+S++D+LLPDPLTF F LAKNG+   +D  K+
Sbjct  149  SKIKVKWHSGRNSSGELNIKDAILAAIQASIIDILLPDPLTFSFKLAKNGTVNNVDSSKD  208

Query  571  FDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLW  392
             D   + L CK  + AHEM  MEV V NNTKE I+++L+I+C+   G         +V  
Sbjct  209  SD---DVLRCKDPISAHEMIHMEVQVCNNTKEIIRMNLNISCKGKRGRKTNRKQMKSVTR  265

Query  391  AGVLNGIAMEVP  356
              VL       P
Sbjct  266  GFVLPRFGSRKP  277



>ref|XP_008664222.1| PREDICTED: LOW QUALITY PROTEIN: trafficking protein particle 
complex subunit 9-like [Zea mays]
Length=1113

 Score =   124 bits (311),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 81/109 (74%), Gaps = 4/109 (4%)
 Frame = -1

Query  748   SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGS-PEIDVPKE  572
             S+IKV+W SGRNSSGELNIKDAI AA+Q+S++D+LLPDPLTF F LAKNG+   +D  K+
Sbjct  970   SKIKVKWHSGRNSSGELNIKDAILAAIQASIIDILLPDPLTFSFKLAKNGTVNNVDSSKD  1029

Query  571   FDMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGEN  425
              D   + L CK  + AHEM  MEV V NNTKE I+++L+I+C+   G  
Sbjct  1030  SD---DVLRCKDPISAHEMIHMEVQVCNNTKEIIRMNLNISCKGKRGRK  1075



>ref|XP_002980237.1| hypothetical protein SELMODRAFT_444472 [Selaginella moellendorffii]
 gb|EFJ18497.1| hypothetical protein SELMODRAFT_444472 [Selaginella moellendorffii]
Length=1093

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/190 (38%), Positives = 105/190 (55%), Gaps = 29/190 (15%)
 Frame = -1

Query  745   RIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEFD  566
             ++K RWQ GRNS GEL + DAI+AA+Q S+  +L  +PLTF F LA              
Sbjct  932   QVKFRWQWGRNSVGELQVADAIRAAVQESMSQILASNPLTFNFRLASE------------  979

Query  565   MQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWAG  386
              QNN    + SV A E+TP+E++V NNTK+ I + LS+TC DV   +C+     +V+W+G
Sbjct  980   -QNNG---QRSVEACELTPVEMIVTNNTKDEISMELSVTCLDVTSSSCL----NSVMWSG  1031

Query  385   VLNGIAMEVPPLQ-EIKHFFSMYFLVPGEYTLLAAAAIDDANEILrararassSDESIFC  209
              ++GI   +   Q +  H F + FLVPGEY+L+  A ++   +            +S   
Sbjct  1032  SMSGIEASISASQGQHIHSFELCFLVPGEYSLVGVAQVNSVGK--------KQQHKSQCY  1083

Query  208   RGPPFHIRVN  179
               PPF I V+
Sbjct  1084  SSPPFTIHVS  1093



>ref|XP_002963095.1| hypothetical protein SELMODRAFT_165701 [Selaginella moellendorffii]
 gb|EFJ36558.1| hypothetical protein SELMODRAFT_165701 [Selaginella moellendorffii]
Length=1000

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 75/123 (61%), Gaps = 20/123 (16%)
 Frame = -1

Query  748  SRIKVRWQSGRNSSGELNIKDAIQAALQSSVMDVLLPDPLTFGFSLAKNGSPEIDVPKEF  569
            +++K RWQ GRNS GEL + DAI+AA+Q S+  +L  +PLTF F LA             
Sbjct  889  NQVKFRWQWGRNSVGELQVADAIRAAVQESMSQILASNPLTFNFRLASE-----------  937

Query  568  DMQNNSLACKSSVIAHEMTPMEVLVRNNTKETIKLSLSITCRDVAGENCVEGDKTTVLWA  389
              QNN    + SV A ++TP+E++V NNTK+ I + LS+TC DV   +C+     +V+W+
Sbjct  938  --QNNG---QRSVKACDLTPVEMIVTNNTKDEISMELSVTCLDVTSSSCL----NSVMWS  988

Query  388  GVL  380
            G L
Sbjct  989  GKL  991



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427800438025