BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13740

Length=1098
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009792212.1|  PREDICTED: respiratory burst oxidase homolog...    339   4e-106   Nicotiana sylvestris
ref|XP_009610988.1|  PREDICTED: respiratory burst oxidase homolog...    341   1e-105   Nicotiana tomentosiformis
ref|XP_009610987.1|  PREDICTED: respiratory burst oxidase homolog...    341   3e-105   Nicotiana tomentosiformis
ref|XP_009792203.1|  PREDICTED: respiratory burst oxidase homolog...    339   2e-104   Nicotiana sylvestris
ref|XP_012088674.1|  PREDICTED: respiratory burst oxidase homolog...    338   7e-104   Jatropha curcas
gb|EYU21772.1|  hypothetical protein MIMGU_mgv1a011557mg                317   9e-103   Erythranthe guttata [common monkey flower]
gb|KHG21481.1|  Respiratory burst oxidase D -like protein               328   9e-103   Gossypium arboreum [tree cotton]
ref|XP_009619772.1|  PREDICTED: respiratory burst oxidase homolog...    335   1e-102   Nicotiana tomentosiformis
gb|AFS18256.1|  respiratory burst oxidase protein D                     318   2e-102   Lepidium sativum
ref|XP_009775685.1|  PREDICTED: respiratory burst oxidase homolog...    333   7e-102   Nicotiana sylvestris
emb|CAC84140.1|  NADPH oxidase                                          333   7e-102   Nicotiana tabacum [American tobacco]
dbj|BAC56865.1|  respiratory burst oxidase homolog                      333   8e-102   Nicotiana benthamiana
ref|XP_007017524.1|  Respiratory burst oxidase D                        333   1e-101   
ref|XP_002303736.2|  hypothetical protein POPTR_0003s15810g             332   1e-101   Populus trichocarpa [western balsam poplar]
gb|ADR70882.1|  respiratory burst oxidase D                             332   2e-101   Manihot esculenta [manioc]
ref|XP_012090542.1|  PREDICTED: respiratory burst oxidase homolog...    331   2e-101   Jatropha curcas
gb|ABW87870.1|  NADPH oxidase                                           331   4e-101   Nicotiana attenuata
gb|KJB59801.1|  hypothetical protein B456_009G273400                    331   5e-101   Gossypium raimondii
emb|CDO98277.1|  unnamed protein product                                331   5e-101   Coffea canephora [robusta coffee]
ref|XP_010250429.1|  PREDICTED: respiratory burst oxidase homolog...    330   7e-101   Nelumbo nucifera [Indian lotus]
ref|XP_006663498.1|  PREDICTED: respiratory burst oxidase homolog...    326   1e-100   Oryza brachyantha
ref|NP_001234271.1|  whitefly-induced gp91-phox                         330   1e-100   
ref|XP_010112007.1|  Respiratory burst oxidase-like protein D           329   2e-100   
gb|AII25876.1|  NADPH oxidase A                                         329   2e-100   Camellia sinensis [black tea]
ref|XP_010249370.1|  PREDICTED: respiratory burst oxidase homolog...    329   2e-100   Nelumbo nucifera [Indian lotus]
ref|XP_010522982.1|  PREDICTED: respiratory burst oxidase homolog...    329   3e-100   Tarenaya hassleriana [spider flower]
ref|XP_008465165.1|  PREDICTED: respiratory burst oxidase homolog...    328   3e-100   Cucumis melo [Oriental melon]
ref|XP_004141156.1|  PREDICTED: respiratory burst oxidase homolog...    328   4e-100   Cucumis sativus [cucumbers]
gb|KJB51325.1|  hypothetical protein B456_008G212100                    321   4e-100   Gossypium raimondii
ref|XP_010530642.1|  PREDICTED: respiratory burst oxidase homolog...    328   7e-100   Tarenaya hassleriana [spider flower]
emb|CBI29288.3|  unnamed protein product                                325   1e-99    Vitis vinifera
gb|ADR70892.1|  respiratory burst oxidase C                             326   1e-99    Manihot esculenta [manioc]
ref|XP_011020924.1|  PREDICTED: respiratory burst oxidase homolog...    327   1e-99    Populus euphratica
gb|KHG19081.1|  Respiratory burst oxidase D -like protein               320   2e-99    Gossypium arboreum [tree cotton]
gb|AFW64932.1|  respiratory burst oxidase protein D variant beta        320   2e-99    
ref|NP_001108123.1|  LOC100136880 isoform 2                             320   2e-99    
ref|XP_006423884.1|  hypothetical protein CICLE_v10027774mg             326   2e-99    
ref|XP_006487656.1|  PREDICTED: respiratory burst oxidase homolog...    326   2e-99    Citrus sinensis [apfelsine]
ref|NP_001275453.1|  respiratory burst oxidase homolog protein C        326   3e-99    Solanum tuberosum [potatoes]
emb|CDY35764.1|  BnaC02g38300D                                          325   4e-99    Brassica napus [oilseed rape]
ref|XP_009129697.1|  PREDICTED: respiratory burst oxidase homolog...    325   6e-99    Brassica rapa
emb|CDY45918.1|  BnaAnng07990D                                          325   7e-99    Brassica napus [oilseed rape]
ref|XP_002318793.2|  respiratory burst oxidase C family protein         325   7e-99    Populus trichocarpa [western balsam poplar]
ref|XP_011003531.1|  PREDICTED: respiratory burst oxidase homolog...    324   9e-99    Populus euphratica
gb|ADE76874.1|  unknown                                                 309   1e-98    Picea sitchensis
dbj|BAJ89207.1|  predicted protein                                      320   1e-98    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ93971.1|  predicted protein                                      320   1e-98    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002511059.1|  respiratory burst oxidase, putative                324   1e-98    
gb|KJB51327.1|  hypothetical protein B456_008G212100                    323   1e-98    Gossypium raimondii
ref|XP_004979405.1|  PREDICTED: respiratory burst oxidase homolog...    323   3e-98    Setaria italica
gb|KJB51323.1|  hypothetical protein B456_008G212100                    323   3e-98    Gossypium raimondii
ref|XP_011015154.1|  PREDICTED: respiratory burst oxidase homolog...    323   3e-98    Populus euphratica
ref|XP_003577502.1|  PREDICTED: respiratory burst oxidase homolog...    323   5e-98    Brachypodium distachyon [annual false brome]
gb|ADR70880.1|  respiratory burst oxidase A                             322   6e-98    Manihot esculenta [manioc]
gb|KHG00108.1|  Respiratory burst oxidase C                             322   7e-98    Gossypium arboreum [tree cotton]
gb|KHG05306.1|  Respiratory burst oxidase D -like protein               322   7e-98    Gossypium arboreum [tree cotton]
ref|XP_009151593.1|  PREDICTED: respiratory burst oxidase homolog...    322   9e-98    Brassica rapa
emb|CDX86335.1|  BnaA06g30520D                                          322   9e-98    
ref|XP_004299201.1|  PREDICTED: respiratory burst oxidase homolog...    322   1e-97    Fragaria vesca subsp. vesca
ref|XP_006395230.1|  hypothetical protein EUTSA_v10003619mg             321   2e-97    Eutrema salsugineum [saltwater cress]
gb|EMT25284.1|  Respiratory burst oxidase-B-like protein                317   2e-97    
dbj|BAJ97450.1|  predicted protein                                      321   2e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011040313.1|  PREDICTED: respiratory burst oxidase homolog...    320   3e-97    Populus euphratica
sp|Q2HXK9.2|RBOHD_SOLTU  RecName: Full=Respiratory burst oxidase ...    319   3e-97    Solanum tuberosum [potatoes]
gb|KJB58284.1|  hypothetical protein B456_009G202500                    320   4e-97    Gossypium raimondii
gb|ABA94089.2|  respiratory burst oxidase protein D, putative, ex...    320   4e-97    Oryza sativa Japonica Group [Japonica rice]
gb|ACF05504.2|  respiratory burst oxidase-like protein                  320   5e-97    Citrullus colocynthis [alhandal]
gb|KFK35232.1|  hypothetical protein AALP_AA5G257400                    320   6e-97    Arabis alpina [alpine rockcress]
ref|XP_002322314.2|  respiratory burst oxidase C family protein         320   7e-97    
ref|XP_009404717.1|  PREDICTED: respiratory burst oxidase homolog...    319   9e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002450884.1|  hypothetical protein SORBIDRAFT_05g020380          319   1e-96    
ref|XP_009404716.1|  PREDICTED: respiratory burst oxidase homolog...    319   1e-96    Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAK03403.1|  predicted protein                                      319   1e-96    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010657584.1|  PREDICTED: respiratory burst oxidase homolog...    318   2e-96    Vitis vinifera
emb|CBI39505.3|  unnamed protein product                                317   2e-96    Vitis vinifera
ref|XP_003602726.1|  Respiratory burst oxidase-like protein             318   2e-96    Medicago truncatula
gb|AIT39747.1|  respiratory burst oxidase                               311   2e-96    Chrysanthemum boreale
ref|XP_002863831.1|  hypothetical protein ARALYDRAFT_917612             318   2e-96    Arabidopsis lyrata subsp. lyrata
ref|XP_002283888.1|  PREDICTED: respiratory burst oxidase homolog...    318   2e-96    Vitis vinifera
ref|XP_004241641.1|  PREDICTED: respiratory burst oxidase homolog...    317   3e-96    Solanum lycopersicum
ref|XP_002865839.1|  hypothetical protein ARALYDRAFT_495172             318   3e-96    
ref|XP_004503030.1|  PREDICTED: respiratory burst oxidase homolog...    318   3e-96    Cicer arietinum [garbanzo]
ref|XP_009421001.1|  PREDICTED: respiratory burst oxidase homolog...    318   3e-96    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG02500.1|  Respiratory burst oxidase C                             317   4e-96    Gossypium arboreum [tree cotton]
ref|XP_008807833.1|  PREDICTED: respiratory burst oxidase homolog...    317   5e-96    Phoenix dactylifera
ref|XP_004309557.1|  PREDICTED: respiratory burst oxidase homolog...    317   5e-96    Fragaria vesca subsp. vesca
emb|CBI29289.3|  unnamed protein product                                317   6e-96    Vitis vinifera
ref|XP_006282261.1|  hypothetical protein CARUB_v10028541mg             317   6e-96    Capsella rubella
ref|XP_010942321.1|  PREDICTED: respiratory burst oxidase homolog...    317   6e-96    Elaeis guineensis
ref|NP_199919.1|  Respiratory burst oxidase homolog protein C           317   6e-96    Arabidopsis thaliana [mouse-ear cress]
emb|CAN64415.1|  hypothetical protein VITISV_013316                     317   6e-96    Vitis vinifera
gb|AAC39477.1|  respiratory burst oxidase protein C                     316   6e-96    Arabidopsis thaliana [mouse-ear cress]
dbj|BAC41837.1|  putative respiratory burst oxidase protein             317   7e-96    Arabidopsis thaliana [mouse-ear cress]
gb|EMT01380.1|  Respiratory burst oxidase-B-like protein                311   7e-96    
emb|CDX85316.1|  BnaC07g26270D                                          317   8e-96    
gb|ADQ74913.1|  respiratory burst oxidase protein 1                     317   1e-95    Picea abies
gb|AFW64933.1|  respiratory burst oxidase protein D variant alpha       316   1e-95    
ref|NP_001157759.1|  LOC100136880 isoform 1                             316   1e-95    Zea mays [maize]
ref|XP_010445756.1|  PREDICTED: respiratory burst oxidase homolog...    311   1e-95    
ref|XP_008807834.1|  PREDICTED: respiratory burst oxidase homolog...    316   2e-95    Phoenix dactylifera
gb|KDO56233.1|  hypothetical protein CISIN_1g002711mg                   315   2e-95    Citrus sinensis [apfelsine]
ref|XP_006433403.1|  hypothetical protein CICLE_v10000227mg             315   2e-95    Citrus clementina [clementine]
ref|XP_010442839.1|  PREDICTED: respiratory burst oxidase homolog...    315   2e-95    Camelina sativa [gold-of-pleasure]
ref|XP_009132634.1|  PREDICTED: respiratory burst oxidase homolog...    315   2e-95    Brassica rapa
emb|CDY38845.1|  BnaA03g13340D                                          315   2e-95    Brassica napus [oilseed rape]
ref|XP_010482435.1|  PREDICTED: respiratory burst oxidase homolog...    315   2e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010442586.1|  PREDICTED: respiratory burst oxidase homolog...    315   2e-95    Camelina sativa [gold-of-pleasure]
gb|AEP25514.1|  putative respiratory burst oxidase-like protein B       301   2e-95    Vicia faba [broad bean]
emb|CDY32647.1|  BnaC03g16150D                                          315   3e-95    Brassica napus [oilseed rape]
ref|XP_007038195.1|  NADPH/respiratory burst oxidase protein D          315   3e-95    
ref|XP_010536571.1|  PREDICTED: respiratory burst oxidase homolog...    315   4e-95    Tarenaya hassleriana [spider flower]
ref|XP_006279397.1|  hypothetical protein CARUB_v10007974mg             315   4e-95    Capsella rubella
ref|XP_011073263.1|  PREDICTED: LOW QUALITY PROTEIN: respiratory ...    315   5e-95    Sesamum indicum [beniseed]
gb|KHN16903.1|  Respiratory burst oxidase like protein C                312   6e-95    Glycine soja [wild soybean]
gb|KFK36751.1|  hypothetical protein AALP_AA4G165200                    314   6e-95    Arabis alpina [alpine rockcress]
ref|XP_006402027.1|  hypothetical protein EUTSA_v10012613mg             314   6e-95    Eutrema salsugineum [saltwater cress]
ref|XP_002299364.2|  hypothetical protein POPTR_0001s12650g             315   6e-95    
ref|XP_010259644.1|  PREDICTED: respiratory burst oxidase homolog...    314   6e-95    Nelumbo nucifera [Indian lotus]
gb|KJB19751.1|  hypothetical protein B456_003G117900                    314   9e-95    Gossypium raimondii
ref|XP_006437008.1|  hypothetical protein CICLE_v10030649mg             314   9e-95    Citrus clementina [clementine]
gb|AAS15724.1|  respiratory burst oxidase protein C                     313   9e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006485050.1|  PREDICTED: respiratory burst oxidase homolog...    314   1e-94    Citrus sinensis [apfelsine]
ref|XP_009353482.1|  PREDICTED: respiratory burst oxidase homolog...    314   1e-94    Pyrus x bretschneideri [bai li]
ref|XP_003532261.1|  PREDICTED: respiratory burst oxidase homolog...    312   2e-94    Glycine max [soybeans]
ref|XP_007225362.1|  hypothetical protein PRUPE_ppa000883mg             313   3e-94    Prunus persica
gb|EYU24549.1|  hypothetical protein MIMGU_mgv1a001003mg                312   3e-94    Erythranthe guttata [common monkey flower]
ref|XP_008222292.1|  PREDICTED: respiratory burst oxidase homolog...    313   4e-94    Prunus mume [ume]
ref|XP_010482026.1|  PREDICTED: respiratory burst oxidase homolog...    312   5e-94    Camelina sativa [gold-of-pleasure]
ref|XP_009359839.1|  PREDICTED: respiratory burst oxidase homolog...    313   5e-94    Pyrus x bretschneideri [bai li]
ref|NP_199602.1|  respiratory burst oxidase-D                           312   5e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008369593.1|  PREDICTED: respiratory burst oxidase homolog...    313   5e-94    Malus domestica [apple tree]
gb|KHN17442.1|  Respiratory burst oxidase like protein C                311   5e-94    Glycine soja [wild soybean]
ref|XP_002268641.1|  PREDICTED: respiratory burst oxidase homolog...    312   5e-94    Vitis vinifera
gb|AAC39479.1|  respiratory burst oxidase protein D                     312   5e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003525163.2|  PREDICTED: respiratory burst oxidase homolog...    311   5e-94    
ref|XP_010438870.1|  PREDICTED: respiratory burst oxidase homolog...    311   7e-94    Camelina sativa [gold-of-pleasure]
ref|XP_008378424.1|  PREDICTED: respiratory burst oxidase homolog...    311   1e-93    
ref|XP_008375433.1|  PREDICTED: respiratory burst oxidase homolog...    311   2e-93    Malus domestica [apple tree]
dbj|BAJ94299.1|  predicted protein                                      310   3e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003556516.1|  PREDICTED: respiratory burst oxidase homolog...    309   3e-93    Glycine max [soybeans]
ref|XP_006844712.1|  PREDICTED: respiratory burst oxidase homolog...    310   3e-93    Amborella trichopoda
dbj|BAJ86360.1|  predicted protein                                      310   3e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AEX56133.1|  NADPH oxidase                                           310   3e-93    Phaseolus vulgaris [French bean]
ref|XP_007137830.1|  hypothetical protein PHAVU_009G159200g             310   4e-93    Phaseolus vulgaris [French bean]
ref|XP_003591142.1|  Respiratory burst oxidase-like protein             309   4e-93    Medicago truncatula
ref|XP_009390376.1|  PREDICTED: respiratory burst oxidase homolog...    309   5e-93    Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS73914.1|  hypothetical protein M569_00842                         308   1e-92    Genlisea aurea
gb|KHN09692.1|  Respiratory burst oxidase like protein C                308   1e-92    Glycine soja [wild soybean]
ref|XP_003526909.1|  PREDICTED: respiratory burst oxidase homolog...    308   2e-92    Glycine max [soybeans]
ref|XP_010442849.1|  PREDICTED: respiratory burst oxidase homolog...    308   2e-92    Camelina sativa [gold-of-pleasure]
gb|KHN31235.1|  Respiratory burst oxidase like protein C                308   2e-92    Glycine soja [wild soybean]
ref|XP_003522455.1|  PREDICTED: respiratory burst oxidase homolog...    308   2e-92    Glycine max [soybeans]
ref|XP_009404193.1|  PREDICTED: respiratory burst oxidase homolog...    308   3e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007030987.1|  Respiratory burst oxidase B                        306   3e-92    
ref|XP_003536070.1|  PREDICTED: respiratory burst oxidase homolog...    306   3e-92    
ref|XP_011036858.1|  PREDICTED: respiratory burst oxidase homolog...    306   5e-92    Populus euphratica
ref|XP_010269487.1|  PREDICTED: respiratory burst oxidase homolog...    306   5e-92    Nelumbo nucifera [Indian lotus]
ref|XP_002512422.1|  respiratory burst oxidase, putative                306   6e-92    Ricinus communis
ref|XP_008807835.1|  PREDICTED: respiratory burst oxidase homolog...    306   7e-92    
gb|KJB45301.1|  hypothetical protein B456_007G299500                    305   7e-92    Gossypium raimondii
ref|XP_007144946.1|  hypothetical protein PHAVU_007G196800g             305   9e-92    Phaseolus vulgaris [French bean]
ref|XP_007210905.1|  hypothetical protein PRUPE_ppa000984mg             305   2e-91    Prunus persica
ref|XP_010929525.1|  PREDICTED: respiratory burst oxidase homolog...    305   2e-91    Elaeis guineensis
gb|ABG35768.1|  NOX3                                                    295   4e-91    Striga asiatica [witchweed]
ref|XP_004495711.1|  PREDICTED: respiratory burst oxidase homolog...    303   4e-91    Cicer arietinum [garbanzo]
ref|XP_008239295.1|  PREDICTED: respiratory burst oxidase homolog...    304   5e-91    Prunus mume [ume]
ref|XP_006283129.1|  hypothetical protein CARUB_v10004156mg             302   5e-91    Capsella rubella
ref|XP_006382490.1|  respiratory burst oxidase protein B                303   5e-91    
ref|XP_011082784.1|  PREDICTED: respiratory burst oxidase homolog...    303   9e-91    Sesamum indicum [beniseed]
ref|XP_010549734.1|  PREDICTED: respiratory burst oxidase homolog...    303   9e-91    Tarenaya hassleriana [spider flower]
ref|XP_010438933.1|  PREDICTED: putative respiratory burst oxidas...    291   1e-90    Camelina sativa [gold-of-pleasure]
ref|XP_009360267.1|  PREDICTED: respiratory burst oxidase homolog...    303   1e-90    Pyrus x bretschneideri [bai li]
emb|CDX70035.1|  BnaA10g23840D                                          302   1e-90    
ref|XP_008797083.1|  PREDICTED: respiratory burst oxidase homolog...    303   2e-90    Phoenix dactylifera
ref|XP_010032776.1|  PREDICTED: respiratory burst oxidase homolog...    303   2e-90    Eucalyptus grandis [rose gum]
gb|EEC68302.1|  hypothetical protein OsI_36373                          303   3e-90    Oryza sativa Indica Group [Indian rice]
ref|XP_008450637.1|  PREDICTED: respiratory burst oxidase homolog...    301   3e-90    Cucumis melo [Oriental melon]
ref|XP_010523340.1|  PREDICTED: respiratory burst oxidase homolog...    301   4e-90    Tarenaya hassleriana [spider flower]
ref|XP_004135613.1|  PREDICTED: respiratory burst oxidase homolog...    301   5e-90    Cucumis sativus [cucumbers]
gb|KJB07927.1|  hypothetical protein B456_001G053300                    301   7e-90    Gossypium raimondii
emb|CDP15485.1|  unnamed protein product                                299   1e-89    Coffea canephora [robusta coffee]
gb|ADR70881.1|  respiratory burst oxidase B                             299   2e-89    Manihot esculenta [manioc]
ref|XP_004503856.1|  PREDICTED: respiratory burst oxidase homolog...    300   2e-89    Cicer arietinum [garbanzo]
ref|XP_010491345.1|  PREDICTED: respiratory burst oxidase homolog...    299   2e-89    Camelina sativa [gold-of-pleasure]
ref|XP_007147029.1|  hypothetical protein PHAVU_006G090200g             299   2e-89    Phaseolus vulgaris [French bean]
ref|XP_008800853.1|  PREDICTED: respiratory burst oxidase homolog...    298   3e-89    Phoenix dactylifera
ref|XP_010931626.1|  PREDICTED: respiratory burst oxidase homolog...    298   3e-89    Elaeis guineensis
ref|XP_012089018.1|  PREDICTED: respiratory burst oxidase homolog...    298   4e-89    Jatropha curcas
gb|KHN03979.1|  Respiratory burst oxidase like protein B                296   4e-89    Glycine soja [wild soybean]
ref|XP_010674039.1|  PREDICTED: respiratory burst oxidase homolog...    298   4e-89    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004230232.1|  PREDICTED: respiratory burst oxidase homolog...    297   6e-89    Solanum lycopersicum
ref|XP_009402525.1|  PREDICTED: respiratory burst oxidase homolog...    298   7e-89    Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU26891.1|  hypothetical protein MIMGU_mgv1a001109mg                298   7e-89    Erythranthe guttata [common monkey flower]
ref|XP_003630437.1|  Respiratory burst oxidase-like protein             298   7e-89    Medicago truncatula
gb|AAC39475.1|  respiratory burst oxidase protein A                     298   8e-89    Arabidopsis thaliana [mouse-ear cress]
ref|NP_196356.1|  Respiratory burst oxidase-A                           298   8e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004304974.1|  PREDICTED: respiratory burst oxidase homolog...    297   9e-89    Fragaria vesca subsp. vesca
ref|XP_010423214.1|  PREDICTED: respiratory burst oxidase homolog...    297   1e-88    
ref|XP_003554649.1|  PREDICTED: respiratory burst oxidase homolog...    297   1e-88    Glycine max [soybeans]
gb|KHN43296.1|  Respiratory burst oxidase like protein B                296   1e-88    Glycine soja [wild soybean]
ref|XP_003521697.1|  PREDICTED: respiratory burst oxidase homolog...    297   1e-88    Glycine max [soybeans]
ref|NP_001170285.1|  uncharacterized protein LOC100384248               281   1e-88    
gb|AEX56131.1|  NADPH oxidase                                           296   1e-88    Phaseolus vulgaris [French bean]
ref|XP_007159934.1|  hypothetical protein PHAVU_002G279700g             297   1e-88    Phaseolus vulgaris [French bean]
ref|XP_008246416.1|  PREDICTED: respiratory burst oxidase homolog...    296   3e-88    Prunus mume [ume]
ref|XP_008246413.1|  PREDICTED: respiratory burst oxidase homolog...    296   3e-88    
ref|XP_010041041.1|  PREDICTED: respiratory burst oxidase homolog...    296   4e-88    Eucalyptus grandis [rose gum]
ref|XP_010025215.1|  PREDICTED: respiratory burst oxidase homolog...    296   4e-88    Eucalyptus grandis [rose gum]
ref|XP_004494602.1|  PREDICTED: respiratory burst oxidase homolog...    295   5e-88    Cicer arietinum [garbanzo]
ref|XP_002865538.1|  predicted protein                                  290   6e-88    
ref|NP_194239.2|  riboflavin synthase-like superfamily protein          294   6e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010452698.1|  PREDICTED: respiratory burst oxidase homolog...    295   6e-88    Camelina sativa [gold-of-pleasure]
emb|CAB36751.1|  respiratory burst oxidase-like protein                 295   6e-88    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190833.1|  riboflavin synthase-like superfamily protein       294   7e-88    Arabidopsis thaliana [mouse-ear cress]
emb|CAM35833.1|  respiratory burst oxidase homologue                    291   8e-88    Medicago truncatula
ref|XP_007206556.1|  hypothetical protein PRUPE_ppa019730mg             295   1e-87    Prunus persica
ref|XP_009611315.1|  PREDICTED: respiratory burst oxidase homolog...    294   1e-87    Nicotiana tomentosiformis
ref|NP_001274981.1|  respiratory burst oxidase homolog protein B        294   1e-87    Solanum tuberosum [potatoes]
emb|CDX98976.1|  BnaC09g48590D                                          294   2e-87    
ref|NP_001167766.1|  uncharacterized protein LOC100381459               281   3e-87    
ref|XP_009122345.1|  PREDICTED: respiratory burst oxidase homolog...    293   3e-87    Brassica rapa
gb|EYU21750.1|  hypothetical protein MIMGU_mgv1a001620mg                291   3e-87    Erythranthe guttata [common monkey flower]
ref|XP_002873307.1|  respiratory burst oxidase protein A                293   4e-87    
ref|XP_002867627.1|  hypothetical protein ARALYDRAFT_492327             292   4e-87    Arabidopsis lyrata subsp. lyrata
gb|AAB70398.1|  Strong similarity to Oryza NADPH oxidase (gb|X93301)    285   5e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003626253.1|  Respiratory burst oxidase-like protein             292   6e-87    Medicago truncatula
gb|AAW78863.1|  respiratory burst oxidase 1                             293   7e-87    Medicago truncatula
ref|XP_006399223.1|  hypothetical protein EUTSA_v10012617mg             292   8e-87    Eutrema salsugineum [saltwater cress]
gb|AEP25512.1|  putative respiratory burst oxidase-like protein A       292   9e-87    Vicia faba [broad bean]
ref|XP_010448480.1|  PREDICTED: putative respiratory burst oxidas...    291   1e-86    Camelina sativa [gold-of-pleasure]
emb|CDY22644.1|  BnaC08g42780D                                          284   2e-86    Brassica napus [oilseed rape]
ref|XP_010475733.1|  PREDICTED: respiratory burst oxidase homolog...    290   3e-86    Camelina sativa [gold-of-pleasure]
ref|XP_002863082.1|  predicted protein                                  281   4e-86    
gb|EYU24552.1|  hypothetical protein MIMGU_mgv1a001077mg                290   5e-86    Erythranthe guttata [common monkey flower]
emb|CDY06348.1|  BnaA09g48550D                                          288   6e-86    
ref|XP_010433689.1|  PREDICTED: putative respiratory burst oxidas...    289   7e-86    Camelina sativa [gold-of-pleasure]
ref|XP_010433690.1|  PREDICTED: putative respiratory burst oxidas...    288   1e-85    
ref|XP_009778242.1|  PREDICTED: respiratory burst oxidase homolog...    288   1e-85    Nicotiana sylvestris
ref|XP_006417613.1|  hypothetical protein EUTSA_v10006793mg             288   1e-85    
ref|XP_006306752.1|  hypothetical protein CARUB_v10008289mg             288   2e-85    
ref|XP_010489693.1|  PREDICTED: respiratory burst oxidase homolog...    287   2e-85    Camelina sativa [gold-of-pleasure]
ref|XP_010458177.1|  PREDICTED: respiratory burst oxidase homolog...    287   3e-85    Camelina sativa [gold-of-pleasure]
ref|XP_002889733.1|  hypothetical protein ARALYDRAFT_470991             285   3e-85    
ref|NP_973799.1|  Respiratory burst oxidase-B                           287   3e-85    Arabidopsis thaliana [mouse-ear cress]
gb|ABG35769.1|  NOX2                                                    279   5e-85    Striga asiatica [witchweed]
ref|XP_006285093.1|  hypothetical protein CARUB_v10006425mg             286   1e-84    Capsella rubella
ref|XP_003567677.1|  PREDICTED: respiratory burst oxidase homolog...    286   2e-84    
ref|XP_006413344.1|  hypothetical protein EUTSA_v10024426mg             285   2e-84    Eutrema salsugineum [saltwater cress]
ref|XP_008366996.1|  PREDICTED: respiratory burst oxidase homolog...    276   2e-84    
ref|XP_009118326.1|  PREDICTED: respiratory burst oxidase homolog...    285   2e-84    Brassica rapa
gb|EYU23415.1|  hypothetical protein MIMGU_mgv1a0020022mg               275   4e-84    Erythranthe guttata [common monkey flower]
ref|NP_001132613.1|  uncharacterized protein LOC100194086               269   5e-84    
ref|NP_001043020.1|  Os01g0360200                                       284   8e-84    
ref|XP_003602722.1|  Respiratory burst oxidase-like protein             267   1e-83    
ref|XP_008662098.1|  PREDICTED: uncharacterized protein LOC100381...    283   2e-83    
gb|AFW56509.1|  hypothetical protein ZEAMMB73_659141                    283   2e-83    
ref|XP_006644164.1|  PREDICTED: respiratory burst oxidase homolog...    283   2e-83    Oryza brachyantha
emb|CDM82708.1|  unnamed protein product                                283   2e-83    Triticum aestivum [Canadian hard winter wheat]
gb|ADK25934.1|  NADPH oxidase                                           267   3e-83    Musa acuminata AAA Group [Cavendish banana]
ref|XP_002457825.1|  hypothetical protein SORBIDRAFT_03g014430          283   3e-83    Sorghum bicolor [broomcorn]
ref|XP_002442264.1|  hypothetical protein SORBIDRAFT_08g017240          283   3e-83    Sorghum bicolor [broomcorn]
ref|XP_008670768.1|  PREDICTED: respiratory burst oxidase homolog...    283   3e-83    
ref|XP_008349116.1|  PREDICTED: respiratory burst oxidase homolog...    275   4e-83    
gb|EMT32939.1|  Respiratory burst oxidase-B-like protein                283   4e-83    
tpg|DAA42070.1|  TPA: hypothetical protein ZEAMMB73_604696              283   4e-83    
ref|XP_006413343.1|  hypothetical protein EUTSA_v10024427mg             281   5e-83    Eutrema salsugineum [saltwater cress]
gb|ACB56481.1|  respiratory burst oxidase-like protein B1               281   7e-83    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009137494.1|  PREDICTED: putative respiratory burst oxidas...    277   1e-82    Brassica rapa
gb|ACB56482.1|  respiratory burst oxidase-like protein B2               281   1e-82    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008673282.1|  PREDICTED: uncharacterized protein LOC100384...    280   2e-82    
emb|CBI34401.3|  unnamed protein product                                281   2e-82    Vitis vinifera
ref|XP_009416413.1|  PREDICTED: respiratory burst oxidase homolog...    281   2e-82    Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA54556.1|  TPA: hypothetical protein ZEAMMB73_247137              281   2e-82    
ref|XP_002277529.1|  PREDICTED: respiratory burst oxidase homolog...    281   3e-82    Vitis vinifera
emb|CDY11053.1|  BnaA03g47120D                                          279   3e-82    Brassica napus [oilseed rape]
ref|XP_004968726.1|  PREDICTED: respiratory burst oxidase homolog...    280   3e-82    Setaria italica
ref|XP_010237191.1|  PREDICTED: LOW QUALITY PROTEIN: respiratory ...    278   4e-82    
gb|EMS46678.1|  Respiratory burst oxidase-like protein B                279   4e-82    Triticum urartu
ref|XP_006664613.1|  PREDICTED: respiratory burst oxidase homolog...    278   5e-82    
ref|XP_008655905.1|  PREDICTED: respiratory burst oxidase homolog...    279   8e-82    
gb|ADR70884.1|  respiratory burst oxidase F                             279   1e-81    
ref|XP_011022605.1|  PREDICTED: respiratory burst oxidase homolog...    277   1e-81    
gb|EMT26659.1|  hypothetical protein F775_52502                         281   1e-81    
ref|XP_009137493.1|  PREDICTED: putative respiratory burst oxidas...    277   1e-81    
ref|XP_003538264.1|  PREDICTED: respiratory burst oxidase homolog...    278   2e-81    
ref|XP_004980724.1|  PREDICTED: respiratory burst oxidase homolog...    277   2e-81    
gb|KHN35050.1|  Respiratory burst oxidase like protein F                278   2e-81    
ref|XP_009350322.1|  PREDICTED: respiratory burst oxidase homolog...    278   2e-81    
ref|XP_003517484.1|  PREDICTED: respiratory burst oxidase homolog...    278   2e-81    
ref|XP_007040366.1|  Respiratory burst oxidase protein A                278   3e-81    
gb|EEC69442.1|  hypothetical protein OsI_38619                          277   3e-81    
gb|ABA99454.2|  respiratory burst oxidase, putative, expressed          277   3e-81    
emb|CDX92671.1|  BnaC07g39290D                                          275   3e-81    
ref|XP_007210398.1|  hypothetical protein PRUPE_ppa000913mg             278   4e-81    
ref|XP_011080899.1|  PREDICTED: respiratory burst oxidase homolog...    278   4e-81    
ref|XP_008437348.1|  PREDICTED: respiratory burst oxidase homolog...    277   4e-81    
ref|XP_006439453.1|  hypothetical protein CICLE_v10018741mg             278   4e-81    
ref|XP_006476481.1|  PREDICTED: respiratory burst oxidase homolog...    277   4e-81    
gb|ABA99453.1|  respiratory burst oxidase, putative, expressed          277   4e-81    
ref|XP_007158539.1|  hypothetical protein PHAVU_002G160700g             277   5e-81    
gb|KDO76360.1|  hypothetical protein CISIN_1g002259mg                   277   5e-81    
ref|XP_008238986.1|  PREDICTED: respiratory burst oxidase homolog...    277   6e-81    
dbj|BAJ95243.1|  predicted protein                                      265   6e-81    
ref|XP_012086808.1|  PREDICTED: respiratory burst oxidase homolog...    277   6e-81    
ref|XP_006385777.1|  NADPH oxidase family protein                       277   7e-81    
ref|XP_010251608.1|  PREDICTED: respiratory burst oxidase homolog...    276   9e-81    
gb|AEP25513.1|  putative respiratory burst oxidase-like protein C       276   9e-81    
gb|KHG03419.1|  Respiratory burst oxidase A                             275   9e-81    
ref|XP_011022604.1|  PREDICTED: respiratory burst oxidase homolog...    276   1e-80    
ref|XP_002972507.1|  hypothetical protein SELMODRAFT_97417              275   1e-80    
gb|KJB19099.1|  hypothetical protein B456_003G085100                    276   1e-80    
gb|EEE68800.1|  hypothetical protein OsJ_27546                          264   1e-80    
gb|KHF98208.1|  Respiratory burst oxidase A                             276   2e-80    
emb|CDP12086.1|  unnamed protein product                                276   2e-80    
gb|KEH21155.1|  respiratory burst oxidase-like protein                  275   2e-80    
ref|XP_006368770.1|  hypothetical protein POPTR_0001s09970g             275   2e-80    
ref|XP_002509871.1|  respiratory burst oxidase, putative                275   2e-80    
ref|XP_009784877.1|  PREDICTED: respiratory burst oxidase homolog...    269   3e-80    
emb|CDY08237.1|  BnaA05g13820D                                          266   3e-80    
gb|KHN16780.1|  Respiratory burst oxidase like protein F                274   4e-80    
dbj|BAD87798.1|  putative NAD(P)H oxidase                               266   4e-80    
ref|XP_003532995.1|  PREDICTED: respiratory burst oxidase homolog...    275   4e-80    
gb|EEC71441.1|  hypothetical protein OsI_03642                          266   4e-80    
ref|XP_010533625.1|  PREDICTED: respiratory burst oxidase homolog...    275   5e-80    
ref|XP_010924767.1|  PREDICTED: respiratory burst oxidase homolog...    274   5e-80    
gb|AFS18257.1|  respiratory burst oxidase protein F                     274   6e-80    
ref|XP_004962826.1|  PREDICTED: respiratory burst oxidase homolog...    274   6e-80    
ref|XP_008792374.1|  PREDICTED: respiratory burst oxidase homolog...    274   6e-80    
gb|KHM99939.1|  Respiratory burst oxidase like protein F                274   6e-80    
emb|CAA63704.1|  NAD(P)H oxidase                                        267   7e-80    
ref|XP_010533624.1|  PREDICTED: respiratory burst oxidase homolog...    275   7e-80    
ref|XP_004143967.2|  PREDICTED: respiratory burst oxidase homolog...    274   7e-80    
ref|XP_002992564.1|  hypothetical protein SELMODRAFT_135543             273   7e-80    
gb|KJB52203.1|  hypothetical protein B456_008G250500                    274   8e-80    
ref|XP_006301285.1|  hypothetical protein CARUB_v10021686mg             274   8e-80    
ref|XP_010676396.1|  PREDICTED: respiratory burst oxidase homolog...    274   8e-80    
ref|XP_002887923.1|  respiratory burst oxidase                          274   8e-80    
ref|XP_010430522.1|  PREDICTED: respiratory burst oxidase homolog...    274   9e-80    
tpg|DAA61634.1|  TPA: hypothetical protein ZEAMMB73_547100              260   9e-80    
ref|XP_003525369.1|  PREDICTED: respiratory burst oxidase homolog...    274   9e-80    
ref|XP_010473652.1|  PREDICTED: respiratory burst oxidase homolog...    274   9e-80    
ref|XP_007160115.1|  hypothetical protein PHAVU_002G293700g             274   1e-79    
ref|XP_004503663.1|  PREDICTED: respiratory burst oxidase homolog...    273   1e-79    
ref|XP_011026969.1|  PREDICTED: respiratory burst oxidase homolog...    273   2e-79    
ref|XP_006391675.1|  hypothetical protein EUTSA_v10023240mg             273   2e-79    
emb|CDY08347.1|  BnaC09g12490D                                          273   2e-79    
ref|NP_564821.1|  respiratory burst oxidase                             273   2e-79    
ref|XP_010055795.1|  PREDICTED: respiratory burst oxidase homolog...    273   2e-79    
ref|XP_003602723.1|  Respiratory burst oxidase-like protein             272   2e-79    
gb|EAZ13446.1|  hypothetical protein OsJ_03364                          266   3e-79    
ref|XP_009112796.1|  PREDICTED: respiratory burst oxidase homolog...    272   3e-79    
gb|ACB56487.1|  respiratory burst oxidase-like protein F1               267   3e-79    
ref|XP_006646295.1|  PREDICTED: respiratory burst oxidase homolog...    269   4e-79    
emb|CDY38202.1|  BnaA09g11870D                                          272   5e-79    
ref|XP_009406782.1|  PREDICTED: respiratory burst oxidase homolog...    272   5e-79    
dbj|BAA28953.1|  Atrboh F                                               272   5e-79    
ref|NP_001234126.1|  NADPH oxidase                                      272   6e-79    
emb|CDY26109.1|  BnaC06g10870D                                          265   6e-79    
gb|KFK40474.1|  hypothetical protein AALP_AA2G000500                    271   6e-79    
emb|CAC87256.1|  NADPH oxidase                                          271   1e-78    
ref|XP_004300824.1|  PREDICTED: respiratory burst oxidase homolog...    271   1e-78    
dbj|BAJ33963.1|  unnamed protein product                                271   1e-78    
tpg|DAA57760.1|  TPA: respiratory burst oxidase protein B               270   1e-78    
ref|NP_001105965.1|  LOC100037794                                       270   2e-78    
ref|XP_009631606.1|  PREDICTED: respiratory burst oxidase homolog...    270   2e-78    
ref|NP_001044165.1|  Os01g0734200                                       267   2e-78    
gb|AAB87790.1|  RbohAOsp                                                267   2e-78    
gb|EMT31127.1|  Respiratory burst oxidase-F-like protein                266   2e-78    
ref|NP_001275304.1|  respiratory burst oxidase homolog protein A        270   2e-78    
gb|ACB56488.1|  respiratory burst oxidase-like protein F2               267   2e-78    
ref|XP_009803142.1|  PREDICTED: putative respiratory burst oxidas...    264   3e-78    
ref|XP_004969859.1|  PREDICTED: respiratory burst oxidase homolog...    270   3e-78    
ref|XP_009384814.1|  PREDICTED: putative respiratory burst oxidas...    268   4e-78    
gb|EMT13143.1|  Respiratory burst oxidase-F-like protein                266   4e-78    
dbj|BAJ94661.1|  predicted protein                                      269   5e-78    
ref|XP_006828231.1|  PREDICTED: putative respiratory burst oxidas...    268   5e-78    
dbj|BAC56864.1|  respiratory burst oxidase homolog                      269   5e-78    
dbj|BAK03598.1|  predicted protein                                      267   6e-78    
ref|XP_008451998.1|  PREDICTED: respiratory burst oxidase homolog...    269   7e-78    
emb|CDX78290.1|  BnaA03g02020D                                          267   7e-78    
ref|XP_004980520.1|  PREDICTED: respiratory burst oxidase homolog...    269   8e-78    
gb|ABS85195.1|  RbohF                                                   268   9e-78    
emb|CAK22348.1|  respiratory burst oxidase homologue A                  268   1e-77    
ref|XP_009618155.1|  PREDICTED: putative respiratory burst oxidas...    263   1e-77    
gb|KEH35678.1|  respiratory burst oxidase-like protein D                267   1e-77    
ref|XP_010644201.1|  PREDICTED: respiratory burst oxidase homolog...    266   1e-77    
gb|ACB56485.1|  respiratory burst oxidase-like protein F2               268   1e-77    
gb|AES72972.2|  respiratory burst oxidase-like protein D                267   2e-77    
ref|XP_010313535.1|  PREDICTED: putative respiratory burst oxidas...    262   2e-77    
ref|XP_003569742.1|  PREDICTED: respiratory burst oxidase homolog...    268   2e-77    
gb|ACB56484.1|  respiratory burst oxidase-like protein F1               267   2e-77    
dbj|BAK02169.1|  predicted protein                                      267   2e-77    
ref|XP_003568053.1|  PREDICTED: respiratory burst oxidase homolog...    268   2e-77    
ref|XP_008670771.1|  PREDICTED: respiratory burst oxidase homolog...    265   2e-77    
dbj|BAC06825.1|  respiratory burst oxydase                              268   3e-77    
ref|XP_006654681.1|  PREDICTED: respiratory burst oxidase homolog...    263   3e-77    
gb|KGN53361.1|  hypothetical protein Csa_4G050170                       266   3e-77    
ref|XP_004146573.1|  PREDICTED: respiratory burst oxidase homolog...    266   4e-77    
ref|XP_002441420.1|  hypothetical protein SORBIDRAFT_09g026320          266   4e-77    
tpg|DAA42075.1|  TPA: hypothetical protein ZEAMMB73_871898              266   4e-77    
ref|XP_009803141.1|  PREDICTED: putative respiratory burst oxidas...    264   4e-77    
ref|NP_001106018.1|  respiratory burst oxidase-like protein C           266   5e-77    
gb|AFW78791.1|  respiratory burst oxidase-like protein                  266   5e-77    
ref|XP_006353773.1|  PREDICTED: respiratory burst oxidase homolog...    265   9e-77    
emb|CDM84067.1|  unnamed protein product                                265   1e-76    
ref|XP_009618154.1|  PREDICTED: putative respiratory burst oxidas...    263   1e-76    
ref|XP_009618153.1|  PREDICTED: putative respiratory burst oxidas...    263   1e-76    
ref|XP_006353772.1|  PREDICTED: respiratory burst oxidase homolog...    265   1e-76    
gb|KEH22867.1|  respiratory burst oxidase-like protein                  259   1e-76    
ref|XP_002961459.1|  hypothetical protein SELMODRAFT_451607             264   2e-76    
gb|KJB24293.1|  hypothetical protein B456_004G137300                    264   2e-76    
gb|KHN49078.1|  Respiratory burst oxidase like protein E                259   2e-76    
ref|XP_002971353.1|  hypothetical protein SELMODRAFT_451606             264   2e-76    
ref|XP_010418449.1|  PREDICTED: respiratory burst oxidase homolog...    264   2e-76    
ref|XP_010261399.1|  PREDICTED: respiratory burst oxidase homolog...    264   2e-76    
ref|XP_004973608.1|  PREDICTED: respiratory burst oxidase homolog...    265   3e-76    
ref|XP_004251452.1|  PREDICTED: putative respiratory burst oxidas...    262   3e-76    
ref|XP_002985727.1|  hypothetical protein SELMODRAFT_122844             263   4e-76    
gb|EEC83672.1|  hypothetical protein OsI_29451                          264   4e-76    
ref|XP_002974429.1|  hypothetical protein SELMODRAFT_101139             263   4e-76    
ref|XP_006661273.1|  PREDICTED: respiratory burst oxidase homolog...    256   4e-76    
ref|XP_010323981.1|  PREDICTED: respiratory burst oxidase homolog...    264   4e-76    
ref|NP_001061956.1|  Os08g0453700                                       265   4e-76    
ref|XP_008664615.1|  PREDICTED: respiratory burst oxidase homolog...    264   4e-76    
ref|XP_010323982.1|  PREDICTED: respiratory burst oxidase homolog...    263   5e-76    
ref|XP_010917407.1|  PREDICTED: respiratory burst oxidase homolog...    261   5e-76    
tpg|DAA48814.1|  TPA: hypothetical protein ZEAMMB73_227037              264   5e-76    
dbj|BAD09781.1|  putative respiratory burst oxidase protein E           264   6e-76    
ref|XP_002987538.1|  hypothetical protein SELMODRAFT_183259             261   6e-76    
dbj|BAJ87852.1|  predicted protein                                      252   7e-76    
gb|KEH37646.1|  respiratory burst oxidase-like protein                  263   1e-75    
gb|EYU36233.1|  hypothetical protein MIMGU_mgv1a023588mg                261   1e-75    
ref|XP_001778593.1|  gp91phox, respiratory burst oxidase-like pro...    259   1e-75    
ref|NP_001056115.1|  Os05g0528000                                       262   1e-75    
gb|AFS18255.1|  respiratory burst oxidase protein B                     260   2e-75    
ref|XP_004961425.1|  PREDICTED: respiratory burst oxidase homolog...    262   2e-75    
ref|XP_002444463.1|  hypothetical protein SORBIDRAFT_07g022250          263   2e-75    
ref|XP_002982059.1|  hypothetical protein SELMODRAFT_115913             261   2e-75    
ref|XP_002966462.1|  hypothetical protein SELMODRAFT_168047             261   2e-75    
ref|XP_001755524.1|  predicted protein                                  259   2e-75    
ref|XP_002987726.1|  hypothetical protein SELMODRAFT_183352             260   2e-75    
ref|XP_010112614.1|  Respiratory burst oxidase-like protein F           263   2e-75    
ref|XP_002460265.1|  hypothetical protein SORBIDRAFT_02g025660          259   2e-75    
ref|XP_009618954.1|  PREDICTED: respiratory burst oxidase homolog...    261   2e-75    
ref|XP_006363388.1|  PREDICTED: putative respiratory burst oxidas...    259   3e-75    
ref|XP_008651821.1|  PREDICTED: uncharacterized protein LOC100502...    260   3e-75    
gb|AES79267.2|  respiratory burst oxidase-like protein                  260   4e-75    
ref|XP_003623049.1|  Respiratory burst oxidase-like protein             260   5e-75    
ref|XP_008797383.1|  PREDICTED: respiratory burst oxidase homolog...    260   5e-75    
ref|XP_010917405.1|  PREDICTED: respiratory burst oxidase homolog...    260   5e-75    
emb|CDP03040.1|  unnamed protein product                                260   6e-75    
ref|XP_006597890.1|  PREDICTED: respiratory burst oxidase homolog...    258   7e-75    
ref|XP_009609858.1|  PREDICTED: respiratory burst oxidase homolog...    260   8e-75    
ref|XP_002969827.1|  hypothetical protein SELMODRAFT_92462              259   9e-75    
ref|XP_002964593.1|  hypothetical protein SELMODRAFT_81185              256   9e-75    
ref|XP_010687558.1|  PREDICTED: respiratory burst oxidase homolog...    260   9e-75    
emb|CDX81049.1|  BnaC03g03030D                                          259   1e-74    
ref|XP_008651819.1|  PREDICTED: uncharacterized protein LOC100502...    260   1e-74    
ref|XP_002960366.1|  hypothetical protein SELMODRAFT_74260              256   1e-74    
ref|XP_004488138.1|  PREDICTED: respiratory burst oxidase homolog...    259   1e-74    
ref|XP_004956897.1|  PREDICTED: respiratory burst oxidase homolog...    260   1e-74    
ref|XP_009769453.1|  PREDICTED: respiratory burst oxidase homolog...    259   2e-74    
ref|XP_002988802.1|  hypothetical protein SELMODRAFT_128789             256   2e-74    
gb|EMS56450.1|  Respiratory burst oxidase-like protein B                254   2e-74    
ref|XP_011078139.1|  PREDICTED: LOW QUALITY PROTEIN: respiratory ...    258   2e-74    
gb|KJB51328.1|  hypothetical protein B456_008G212100                    259   2e-74    
ref|XP_009391217.1|  PREDICTED: respiratory burst oxidase homolog...    259   2e-74    
ref|XP_010273898.1|  PREDICTED: respiratory burst oxidase homolog...    259   3e-74    
emb|CDX81047.1|  BnaC03g03010D                                          258   3e-74    
ref|XP_002967350.1|  hypothetical protein SELMODRAFT_86677              256   3e-74    
ref|XP_004492338.1|  PREDICTED: putative respiratory burst oxidas...    257   3e-74    
gb|KHN47615.1|  Respiratory burst oxidase like protein E                256   3e-74    
ref|XP_007138622.1|  hypothetical protein PHAVU_009G224100g             258   4e-74    
ref|XP_010033187.1|  PREDICTED: putative respiratory burst oxidas...    257   4e-74    
ref|XP_001753615.1|  predicted protein                                  254   4e-74    
ref|XP_007012555.1|  Respiratory burst oxidase protein E                258   4e-74    
ref|XP_012077105.1|  PREDICTED: respiratory burst oxidase homolog...    258   4e-74    
ref|XP_009799187.1|  PREDICTED: respiratory burst oxidase homolog...    258   5e-74    
ref|XP_011657973.1|  PREDICTED: putative respiratory burst oxidas...    256   5e-74    
ref|XP_006349977.1|  PREDICTED: respiratory burst oxidase homolog...    257   6e-74    
ref|XP_006597889.1|  PREDICTED: respiratory burst oxidase homolog...    258   6e-74    
ref|XP_003574580.1|  PREDICTED: respiratory burst oxidase homolog...    258   6e-74    
gb|KGN65680.1|  hypothetical protein Csa_1G495280                       256   9e-74    
gb|EMS51619.1|  Respiratory burst oxidase-like protein E                252   9e-74    
ref|XP_004239582.1|  PREDICTED: respiratory burst oxidase homolog...    256   9e-74    
gb|KHN16233.1|  Putative respiratory burst oxidase like protein H       256   1e-73    
gb|EMS59216.1|  Respiratory burst oxidase-like protein E                251   1e-73    
ref|XP_006587062.1|  PREDICTED: respiratory burst oxidase homolog...    257   1e-73    
gb|KJB07346.1|  hypothetical protein B456_001G017400                    257   1e-73    
gb|KDO73805.1|  hypothetical protein CISIN_1g0028301mg                  252   1e-73    
dbj|BAJ91445.1|  predicted protein                                      251   1e-73    
gb|KJB51326.1|  hypothetical protein B456_008G212100                    256   2e-73    
gb|EMT19006.1|  Respiratory burst oxidase-E-like protein                251   2e-73    
ref|XP_001758312.1|  predicted protein                                  253   2e-73    
dbj|BAD73393.1|  putative respiratory burst oxidase                     251   2e-73    
ref|XP_002277540.1|  PREDICTED: respiratory burst oxidase homolog...    256   2e-73    
ref|XP_002516222.1|  respiratory burst oxidase, putative                256   2e-73    
gb|EEC84635.1|  hypothetical protein OsI_31509                          255   2e-73    
ref|XP_002985163.1|  hypothetical protein SELMODRAFT_121926             254   2e-73    
gb|KHN40314.1|  Putative respiratory burst oxidase like protein H       254   3e-73    



>ref|XP_009792212.1| PREDICTED: respiratory burst oxidase homolog protein D-like isoform 
X2 [Nicotiana sylvestris]
Length=711

 Score =   339 bits (869),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 178/204 (87%), Gaps = 9/204 (4%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeg---------gvengg  946
             YGAPAQDYKKY+V+LLVGLGIGATPMISI KDIVNNM A ++EE                
Sbjct  508   YGAPAQDYKKYEVLLLVGLGIGATPMISIAKDIVNNMKAIEKEENNDLENRHEYIPSATS  567

Query  945   aATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSA  766
                +NF++K+AYFYWVTREQGSFDWFKGIMNE+AEMD +GVIEMHNYCTSVYEEGDARSA
Sbjct  568   QKKRNFKSKRAYFYWVTREQGSFDWFKGIMNEIAEMDPKGVIEMHNYCTSVYEEGDARSA  627

Query  765   LITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTT  586
             LI M+QSL HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNH++++VGVFYCGAPALT 
Sbjct  628   LIAMIQSLQHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHSNARVGVFYCGAPALTK  687

Query  585   ELRQLALDFSRKTSTKFDFHKENF  514
             ELRQLALDFSRKTSTKFDFHKENF
Sbjct  688   ELRQLALDFSRKTSTKFDFHKENF  711



>ref|XP_009610988.1| PREDICTED: respiratory burst oxidase homolog protein D-like isoform 
X2 [Nicotiana tomentosiformis]
Length=850

 Score =   341 bits (875),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 178/200 (89%), Gaps = 5/200 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggve-----nggaATK  934
             YGAPAQDYKKY+V+LLVGLGIGATPMISI KDIVNNM A +E++               +
Sbjct  651   YGAPAQDYKKYEVLLLVGLGIGATPMISIAKDIVNNMKAKEEDDLENRHENPNPTSQKKR  710

Query  933   NFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITM  754
             NF++K+AYFYWVTREQGSFDWFKGIMNE+AEMD +GVIEMHNYCTSVYEEGDARSALI M
Sbjct  711   NFKSKRAYFYWVTREQGSFDWFKGIMNEIAEMDPKGVIEMHNYCTSVYEEGDARSALIAM  770

Query  753   LQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQ  574
             +QSL HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHT+++VGVFYCGAPALT ELRQ
Sbjct  771   IQSLQHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTNARVGVFYCGAPALTKELRQ  830

Query  573   LALDFSRKTSTKFDFHKENF  514
             LALDFSRKTSTKFDFHKENF
Sbjct  831   LALDFSRKTSTKFDFHKENF  850



>ref|XP_009610987.1| PREDICTED: respiratory burst oxidase homolog protein D-like isoform 
X1 [Nicotiana tomentosiformis]
Length=882

 Score =   341 bits (875),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 163/200 (82%), Positives = 178/200 (89%), Gaps = 5/200 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggve-----nggaATK  934
             YGAPAQDYKKY+V+LLVGLGIGATPMISI KDIVNNM A +E++               +
Sbjct  683   YGAPAQDYKKYEVLLLVGLGIGATPMISIAKDIVNNMKAKEEDDLENRHENPNPTSQKKR  742

Query  933   NFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITM  754
             NF++K+AYFYWVTREQGSFDWFKGIMNE+AEMD +GVIEMHNYCTSVYEEGDARSALI M
Sbjct  743   NFKSKRAYFYWVTREQGSFDWFKGIMNEIAEMDPKGVIEMHNYCTSVYEEGDARSALIAM  802

Query  753   LQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQ  574
             +QSL HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHT+++VGVFYCGAPALT ELRQ
Sbjct  803   IQSLQHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTNARVGVFYCGAPALTKELRQ  862

Query  573   LALDFSRKTSTKFDFHKENF  514
             LALDFSRKTSTKFDFHKENF
Sbjct  863   LALDFSRKTSTKFDFHKENF  882



>ref|XP_009792203.1| PREDICTED: respiratory burst oxidase homolog protein D-like isoform 
X1 [Nicotiana sylvestris]
Length=892

 Score =   339 bits (869),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 178/204 (87%), Gaps = 9/204 (4%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeg---------gvengg  946
             YGAPAQDYKKY+V+LLVGLGIGATPMISI KDIVNNM A ++EE                
Sbjct  689   YGAPAQDYKKYEVLLLVGLGIGATPMISIAKDIVNNMKAIEKEENNDLENRHEYIPSATS  748

Query  945   aATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSA  766
                +NF++K+AYFYWVTREQGSFDWFKGIMNE+AEMD +GVIEMHNYCTSVYEEGDARSA
Sbjct  749   QKKRNFKSKRAYFYWVTREQGSFDWFKGIMNEIAEMDPKGVIEMHNYCTSVYEEGDARSA  808

Query  765   LITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTT  586
             LI M+QSL HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNH++++VGVFYCGAPALT 
Sbjct  809   LIAMIQSLQHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHSNARVGVFYCGAPALTK  868

Query  585   ELRQLALDFSRKTSTKFDFHKENF  514
             ELRQLALDFSRKTSTKFDFHKENF
Sbjct  869   ELRQLALDFSRKTSTKFDFHKENF  892



>ref|XP_012088674.1| PREDICTED: respiratory burst oxidase homolog protein C [Jatropha 
curcas]
 gb|KDP23231.1| hypothetical protein JCGZ_23064 [Jatropha curcas]
Length=923

 Score =   338 bits (867),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 179/202 (89%), Gaps = 7/202 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT------  937
             YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDI+NNM   D+ E  +E G A +      
Sbjct  722   YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIINNMQEEDDRENSLEAGKATSAPNYNN  781

Query  936   -KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALI  760
              K F+T KAYFYWVTREQGSF+WFKGIMNEVAEMD++ VIE+HNYCTSVYEEGDARSALI
Sbjct  782   KKGFKTTKAYFYWVTREQGSFEWFKGIMNEVAEMDDKAVIELHNYCTSVYEEGDARSALI  841

Query  759   TMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTEL  580
              MLQSLHHAKNGVD+VSGTRVKSHFAKPNWR VYK+IAL+H DS++GVFYCGAPALT EL
Sbjct  842   AMLQSLHHAKNGVDVVSGTRVKSHFAKPNWRQVYKKIALHHPDSRIGVFYCGAPALTKEL  901

Query  579   RQLALDFSRKTSTKFDFHKENF  514
             RQLALDFSRKTSTKFDFHKENF
Sbjct  902   RQLALDFSRKTSTKFDFHKENF  923



>gb|EYU21772.1| hypothetical protein MIMGU_mgv1a011557mg [Erythranthe guttata]
Length=277

 Score =   317 bits (811),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 162/218 (74%), Positives = 175/218 (80%), Gaps = 23/218 (11%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT------  937
             YGAP QDYK YDVVLLVGLGIGATPMIS+VKDIVNNM A DEEE  +ENG   +      
Sbjct  60    YGAPTQDYKDYDVVLLVGLGIGATPMISVVKDIVNNMKAIDEEENSLENGEITSLPSNAS  119

Query  936   -----------------KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHN  808
                               NF+T +AYFYWVTREQGSFDWFKG+MNEVAEMD +GVIEMHN
Sbjct  120   PLTPMPKKKPVGQSGRHNNFKTSRAYFYWVTREQGSFDWFKGVMNEVAEMDYKGVIEMHN  179

Query  807   YCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDS  628
             YCTSVYEEGDARSALITMLQSL+HAKNGVD+VSGTRVKSHFAKPNWR VYKRIALNH +S
Sbjct  180   YCTSVYEEGDARSALITMLQSLNHAKNGVDVVSGTRVKSHFAKPNWRTVYKRIALNHPNS  239

Query  627   KVGVFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             +VGVFYCGAP    ELRQLA DFS KT+TKF+FHKENF
Sbjct  240   RVGVFYCGAPPPVKELRQLASDFSHKTNTKFEFHKENF  277



>gb|KHG21481.1| Respiratory burst oxidase D -like protein [Gossypium arboreum]
Length=622

 Score =   328 bits (840),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 173/203 (85%), Gaps = 8/203 (4%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaa--------deeeggvengga  943
             YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDI+NNM            E      N   
Sbjct  420   YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIINNMRMEDDSFPGSGLENGNYNNNNNN  479

Query  942   ATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSAL  763
              +K F+T+KAYFYWVTREQGSF+WFKGIMNEVAEMD + VIE+HNYCTSVYEEGDARSAL
Sbjct  480   KSKGFKTRKAYFYWVTREQGSFEWFKGIMNEVAEMDEKRVIELHNYCTSVYEEGDARSAL  539

Query  762   ITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTE  583
             ITMLQSLHHAKNGVD+VSGTRVKSHFAKPNWR VYK+IAL+H D+++GVFYCGAPALT E
Sbjct  540   ITMLQSLHHAKNGVDVVSGTRVKSHFAKPNWRQVYKKIALHHPDARIGVFYCGAPALTKE  599

Query  582   LRQLALDFSRKTSTKFDFHKENF  514
             LRQLA DFS KTSTKF+FHKENF
Sbjct  600   LRQLASDFSHKTSTKFEFHKENF  622



>ref|XP_009619772.1| PREDICTED: respiratory burst oxidase homolog protein C [Nicotiana 
tomentosiformis]
Length=938

 Score =   335 bits (859),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 170/218 (78%), Positives = 178/218 (82%), Gaps = 23/218 (11%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeegg--------------  961
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIVNNM A DEEE                
Sbjct  721   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNMKAMDEEENSLENGDNNNMAQNSS  780

Query  960   ---------venggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHN  808
                        +  +   NF T++AYFYWVTREQGSFDWFKGIMNE AEMD++GVIEMHN
Sbjct  781   PNIAQKRGNKSDSASGRNNFNTRRAYFYWVTREQGSFDWFKGIMNEAAEMDHKGVIEMHN  840

Query  807   YCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDS  628
             YCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNH D+
Sbjct  841   YCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHPDA  900

Query  627   KVGVFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             KVGVFYCGAPALT ELRQ ALDFS KTSTKFDFHKENF
Sbjct  901   KVGVFYCGAPALTKELRQHALDFSHKTSTKFDFHKENF  938



>gb|AFS18256.1| respiratory burst oxidase protein D, partial [Lepidium sativum]
Length=356

 Score =   318 bits (815),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 167/195 (86%), Gaps = 0/195 (0%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDI+NNM + D +     N     K F+T 
Sbjct  162   YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIINNMKSPDSDSDIENNSNGHNKGFKTT  221

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             KAYFYWVTREQGSF+WFKGIM+EV+EMD  GVIE+HNYCTSVYEEGDAR ALI MLQSL 
Sbjct  222   KAYFYWVTREQGSFEWFKGIMDEVSEMDEEGVIELHNYCTSVYEEGDARVALIAMLQSLQ  281

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             HAKNGVD+VSGTRV+SHFAKPNWR VYK+IA+ +   ++GVFYCGAP LT EL+ LALDF
Sbjct  282   HAKNGVDVVSGTRVESHFAKPNWRQVYKKIAVQYPGKRIGVFYCGAPGLTKELKNLALDF  341

Query  558   SRKTSTKFDFHKENF  514
             SRKT+TKFDFHKENF
Sbjct  342   SRKTTTKFDFHKENF  356



>ref|XP_009775685.1| PREDICTED: respiratory burst oxidase homolog protein C [Nicotiana 
sylvestris]
 gb|AAM28891.1| NADPH oxidase [Nicotiana tabacum]
 gb|ABN58915.1| rbohD [Nicotiana tabacum]
Length=938

 Score =   333 bits (854),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 169/218 (78%), Positives = 177/218 (81%), Gaps = 23/218 (11%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeegg--------------  961
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIVNNM A DEEE                
Sbjct  721   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNMKAMDEEENSLEDGHNNNMAPNSS  780

Query  960   ---------venggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHN  808
                           +   NF T++AYFYWVTREQGSFDWFKGIMNE AEMD++GVIEMHN
Sbjct  781   PNIAKNKGNKSGSASGGNNFNTRRAYFYWVTREQGSFDWFKGIMNEAAEMDHKGVIEMHN  840

Query  807   YCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDS  628
             YCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNH ++
Sbjct  841   YCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHPEA  900

Query  627   KVGVFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             KVGVFYCGAPALT ELRQ ALDFS KTSTKFDFHKENF
Sbjct  901   KVGVFYCGAPALTKELRQHALDFSHKTSTKFDFHKENF  938



>emb|CAC84140.1| NADPH oxidase [Nicotiana tabacum]
Length=939

 Score =   333 bits (854),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 169/218 (78%), Positives = 177/218 (81%), Gaps = 23/218 (11%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeegg--------------  961
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIVNNM A DEEE                
Sbjct  722   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNMKAMDEEENSLEDGHNNNMAPNSS  781

Query  960   ---------venggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHN  808
                           +   NF T++AYFYWVTREQGSFDWFKGIMNE AEMD++GVIEMHN
Sbjct  782   PNIAKNKGNKSGSASGGNNFNTRRAYFYWVTREQGSFDWFKGIMNEAAEMDHKGVIEMHN  841

Query  807   YCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDS  628
             YCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNH ++
Sbjct  842   YCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHPEA  901

Query  627   KVGVFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             KVGVFYCGAPALT ELRQ ALDFS KTSTKFDFHKENF
Sbjct  902   KVGVFYCGAPALTKELRQHALDFSHKTSTKFDFHKENF  939



>dbj|BAC56865.1| respiratory burst oxidase homolog [Nicotiana benthamiana]
Length=939

 Score =   333 bits (854),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 169/218 (78%), Positives = 177/218 (81%), Gaps = 23/218 (11%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeegg--------------  961
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIVNNM A DEEE                
Sbjct  722   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNMKAMDEEENSLEDGHNNNMAPNSS  781

Query  960   ---------venggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHN  808
                           +   NF T++AYFYWVTREQGSFDWFKGIMNE AEMD++GVIEMHN
Sbjct  782   PNIAKNKGNKSGSASGRNNFNTRRAYFYWVTREQGSFDWFKGIMNEAAEMDHKGVIEMHN  841

Query  807   YCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDS  628
             YCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNH ++
Sbjct  842   YCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHPEA  901

Query  627   KVGVFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             KVGVFYCGAPALT ELRQ ALDFS KTSTKFDFHKENF
Sbjct  902   KVGVFYCGAPALTKELRQHALDFSHKTSTKFDFHKENF  939



>ref|XP_007017524.1| Respiratory burst oxidase D [Theobroma cacao]
 gb|EOY14749.1| Respiratory burst oxidase D [Theobroma cacao]
Length=961

 Score =   333 bits (854),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 175/201 (87%), Gaps = 6/201 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggve------nggaAT  937
             YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDI+NNM   ++   G        +     
Sbjct  761   YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIINNMKMEEDSVPGPALENGNYSKNKNN  820

Query  936   KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALIT  757
             K F+T+KAYFYWVTREQGSF+WFKGIMNEVAEMD + VIE+HNYCTSVYEEGDARSALIT
Sbjct  821   KGFKTRKAYFYWVTREQGSFEWFKGIMNEVAEMDEKRVIELHNYCTSVYEEGDARSALIT  880

Query  756   MLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELR  577
             MLQSLHHAKNGVD+VSGTRVKSHFAKPNWR VYK+IAL+H D+++GVFYCGAPALT ELR
Sbjct  881   MLQSLHHAKNGVDVVSGTRVKSHFAKPNWRQVYKKIALHHPDARIGVFYCGAPALTKELR  940

Query  576   QLALDFSRKTSTKFDFHKENF  514
             QLALDFS KTSTKF+FHKENF
Sbjct  941   QLALDFSHKTSTKFEFHKENF  961



>ref|XP_002303736.2| hypothetical protein POPTR_0003s15810g [Populus trichocarpa]
 gb|EEE78715.2| hypothetical protein POPTR_0003s15810g [Populus trichocarpa]
Length=926

 Score =   332 bits (852),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 159/209 (76%), Positives = 175/209 (84%), Gaps = 14/209 (7%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM--------------Taadeeegg  961
             +GAPAQDYKKYDVVLLVGLGIGATPMISIVKDI+NNM                       
Sbjct  718   FGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIINNMKIKDKDEGNNGALDALESGRATP  777

Query  960   venggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEG  781
              +N    +K+F+T+KAYFYWVTREQGSF+WFKGIMNEVAEMD++ VIE+HNYCTSVYEEG
Sbjct  778   NKNNKINSKSFKTRKAYFYWVTREQGSFEWFKGIMNEVAEMDDKQVIELHNYCTSVYEEG  837

Query  780   DARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGA  601
             DARSALI MLQSLHHAK+GVD+VSGTRVKSHFAKPNWR VYK+IAL H DS++GVFYCGA
Sbjct  838   DARSALIAMLQSLHHAKSGVDVVSGTRVKSHFAKPNWRQVYKKIALQHPDSRIGVFYCGA  897

Query  600   PALTTELRQLALDFSRKTSTKFDFHKENF  514
             PALT ELRQLALDFSRKTSTKFDFHKENF
Sbjct  898   PALTKELRQLALDFSRKTSTKFDFHKENF  926



>gb|ADR70882.1| respiratory burst oxidase D [Manihot esculenta]
Length=914

 Score =   332 bits (850),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 179/204 (88%), Gaps = 9/204 (4%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT------  937
             YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDI+NNM   D+EE  +E G AA       
Sbjct  711   YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIINNMKEEDDEETALEAGRAAQGNSNNN  770

Query  936   ---KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSA  766
                K F+T+KAYFYWVTREQGSF+WFKGIMNEVAEMD++G+IE+HNYCTSVYEEGDARSA
Sbjct  771   ISKKGFKTRKAYFYWVTREQGSFEWFKGIMNEVAEMDDKGLIELHNYCTSVYEEGDARSA  830

Query  765   LITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTT  586
             LI MLQSLHHAKNGVD+VSGTRVKSHFAKPNWR VYK+IAL H + ++GVFYCGAPALT 
Sbjct  831   LIAMLQSLHHAKNGVDVVSGTRVKSHFAKPNWRQVYKKIALQHPNGRIGVFYCGAPALTK  890

Query  585   ELRQLALDFSRKTSTKFDFHKENF  514
             ELRQLALDFS +TSTKFDFHKENF
Sbjct  891   ELRQLALDFSHRTSTKFDFHKENF  914



>ref|XP_012090542.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Jatropha 
curcas]
 gb|KDP22507.1| hypothetical protein JCGZ_26338 [Jatropha curcas]
Length=904

 Score =   331 bits (849),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 165/206 (80%), Positives = 177/206 (86%), Gaps = 11/206 (5%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATK-----  934
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIV+N+ A DEEE      G   K     
Sbjct  699   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNIRATDEEEENAIENGTLPKTPSPN  758

Query  933   ------NFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDAR  772
                   NF+T++AYFYWVTREQGSFDWFKGIMNEVAE+D+  VIE+HNYCTSVYEEGDAR
Sbjct  759   TFKRKENFKTRRAYFYWVTREQGSFDWFKGIMNEVAELDDNHVIELHNYCTSVYEEGDAR  818

Query  771   SALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPAL  592
             SALI MLQS+HHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNH DS+VGVFYCGAPAL
Sbjct  819   SALIAMLQSIHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHPDSRVGVFYCGAPAL  878

Query  591   TTELRQLALDFSRKTSTKFDFHKENF  514
             T ELR LALDFS KT+TKFDFHKENF
Sbjct  879   TKELRHLALDFSHKTNTKFDFHKENF  904



>gb|ABW87870.1| NADPH oxidase [Nicotiana attenuata]
Length=937

 Score =   331 bits (849),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 176/217 (81%), Gaps = 22/217 (10%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeegg--------------  961
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIVNNM A DEEE                
Sbjct  721   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNMKAMDEEENSLENGHNNMAPNSSP  780

Query  960   --------venggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNY  805
                          +   NF T++AYFYWVTREQGSFDWFKGIMNE AEMD++GVIEMHNY
Sbjct  781   NIAQKKGNKSGSASGRNNFNTRRAYFYWVTREQGSFDWFKGIMNEAAEMDHKGVIEMHNY  840

Query  804   CTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSK  625
             CTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNH ++K
Sbjct  841   CTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHPEAK  900

Query  624   VGVFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             VGVFYCGAPALT ELRQ A DFS KTSTKFDFHKENF
Sbjct  901   VGVFYCGAPALTNELRQHAWDFSHKTSTKFDFHKENF  937



>gb|KJB59801.1| hypothetical protein B456_009G273400 [Gossypium raimondii]
Length=930

 Score =   331 bits (848),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 175/202 (87%), Gaps = 7/202 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM-------TaadeeeggvenggaA  940
             YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDI+NNM         +  E G   N    
Sbjct  729   YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIINNMRMEDDSFPGSGLENGNYNNNNNK  788

Query  939   TKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALI  760
             +K F+T+KAYFYWVTREQGSF+WFKGIMNEVAEMD + VIE+HNYCTSVYEEGDARSALI
Sbjct  789   SKGFKTRKAYFYWVTREQGSFEWFKGIMNEVAEMDEKRVIELHNYCTSVYEEGDARSALI  848

Query  759   TMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTEL  580
             TMLQSLHHAKNGVD+VSGTRVKSHFAKPNWR VYK+IAL+H D+++GVFYCGAPALT EL
Sbjct  849   TMLQSLHHAKNGVDVVSGTRVKSHFAKPNWRQVYKKIALHHPDARIGVFYCGAPALTKEL  908

Query  579   RQLALDFSRKTSTKFDFHKENF  514
             RQLA DFS KTSTKF+FHKENF
Sbjct  909   RQLASDFSHKTSTKFEFHKENF  930



>emb|CDO98277.1| unnamed protein product [Coffea canephora]
Length=933

 Score =   331 bits (848),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 168/219 (77%), Positives = 181/219 (83%), Gaps = 24/219 (11%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKN----  931
             YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM A + EE  +E+G  A ++    
Sbjct  715   YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMKAIEAEESSLEDGTRAAEDGGPV  774

Query  930   --------------------FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMH  811
                                 F+TK+AYFYWVTREQGSFDWFKGIMNE AEMD +GVIEMH
Sbjct  775   APNSSSLTQKRKSGSGSGGSFKTKRAYFYWVTREQGSFDWFKGIMNEAAEMDKKGVIEMH  834

Query  810   NYCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTD  631
             NYCTSVYEEGDARSALITMLQSL+HAK+GVDIVSGTRVKSHFAKPNWRNVYKRIALNHT 
Sbjct  835   NYCTSVYEEGDARSALITMLQSLNHAKHGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTS  894

Query  630   SKVGVFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             ++VGVFYCGAPALT EL+QLA DFS KTSTKFDFHKENF
Sbjct  895   ARVGVFYCGAPALTKELKQLASDFSHKTSTKFDFHKENF  933



>ref|XP_010250429.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Nelumbo 
nucifera]
Length=924

 Score =   330 bits (847),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 162/203 (80%), Positives = 176/203 (87%), Gaps = 8/203 (4%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT------  937
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIVN++ A +EEE        A       
Sbjct  722   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNDIKAMEEEEASTALVLEAATPPQKR  781

Query  936   --KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSAL  763
                +F+T +AYFYWVTREQGSFDWFKG+MNEVAEMD+ GVIE+HNYCTSVYEEGDARSAL
Sbjct  782   KGNSFKTSRAYFYWVTREQGSFDWFKGVMNEVAEMDHEGVIELHNYCTSVYEEGDARSAL  841

Query  762   ITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTE  583
             I MLQSL+HAKNGVD+VSGTRVKSHFAKPNWRNVYKRIAL H D++VGVFYCGAPALT E
Sbjct  842   IAMLQSLNHAKNGVDVVSGTRVKSHFAKPNWRNVYKRIALKHGDARVGVFYCGAPALTKE  901

Query  582   LRQLALDFSRKTSTKFDFHKENF  514
             LRQLALDFS KTSTKFDFHKENF
Sbjct  902   LRQLALDFSHKTSTKFDFHKENF  924



>ref|XP_006663498.1| PREDICTED: respiratory burst oxidase homolog protein C-like, 
partial [Oryza brachyantha]
Length=769

 Score =   326 bits (836),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 172/195 (88%), Gaps = 0/195 (0%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDYK+YD+VLLVGLGIGATPMISI+KDI+NNM   D +        +   +FRT+
Sbjct  575   YGAPAQDYKQYDIVLLVGLGIGATPMISIIKDIINNMRQLDGDLENGGGDASVPSSFRTR  634

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             +AYFYWVTREQGSF+WF+G+M+EVAE D +GVIE+HNYCTSVYEEGDARSALI MLQSL+
Sbjct  635   RAYFYWVTREQGSFEWFRGVMDEVAETDKKGVIELHNYCTSVYEEGDARSALIAMLQSLN  694

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             HAK+GVD+VSGTRVK+HFA+PNWRNVYKRIALNH D +VGVFYCGAP LT ELR+LA DF
Sbjct  695   HAKHGVDVVSGTRVKTHFARPNWRNVYKRIALNHRDQRVGVFYCGAPVLTKELRELAQDF  754

Query  558   SRKTSTKFDFHKENF  514
             SRKTSTKFDFHKENF
Sbjct  755   SRKTSTKFDFHKENF  769



>ref|NP_001234271.1| whitefly-induced gp91-phox [Solanum lycopersicum]
 gb|AAF73104.1|AF147783_1 whitefly-induced gp91-phox [Solanum lycopersicum]
 gb|AAF73124.1|AF148534_1 whitefly-induced gp91-phox [Solanum lycopersicum]
Length=938

 Score =   330 bits (846),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 162/218 (74%), Positives = 176/218 (81%), Gaps = 23/218 (11%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM-----------------------  988
             YGAPAQDYK+Y+VVLLVGLGIGATPMISIVKDIVNNM                       
Sbjct  721   YGAPAQDYKQYEVVLLVGLGIGATPMISIVKDIVNNMKAMDEEENSLENGHGMSNAAQNA  780

Query  987   TaadeeeggvenggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHN  808
             +    ++ G     +   +F T++AYFYWVTREQGSFDWFKGIMNE AEMD++GVIEMHN
Sbjct  781   SPNMAQKRGKSGSASGRNSFNTRRAYFYWVTREQGSFDWFKGIMNEAAEMDHKGVIEMHN  840

Query  807   YCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDS  628
             YCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNH ++
Sbjct  841   YCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHPEA  900

Query  627   KVGVFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             KVGVFYCGAPALT EL+Q ALDFS KTSTKFDFHKENF
Sbjct  901   KVGVFYCGAPALTKELKQHALDFSHKTSTKFDFHKENF  938



>ref|XP_010112007.1| Respiratory burst oxidase-like protein D [Morus notabilis]
 gb|EXC32352.1| Respiratory burst oxidase-like protein D [Morus notabilis]
Length=924

 Score =   329 bits (844),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/195 (79%), Positives = 170/195 (87%), Gaps = 0/195 (0%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDYKKYDVVLLVGLGIGATPMISI+KDI+ N+   +E      N   +   FRT+
Sbjct  730   YGAPAQDYKKYDVVLLVGLGIGATPMISIMKDIIGNIKMEEESIIVKSNNRLSASGFRTR  789

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             KAY+YWVTREQGSF+WF+GI+NEVAE+D +GVIE+HNYCTSVYEEGDARSALI MLQSLH
Sbjct  790   KAYYYWVTREQGSFEWFRGILNEVAEIDEKGVIELHNYCTSVYEEGDARSALIAMLQSLH  849

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             HAKNGVD+VSGTRVKSHFAKPNWR VYKRIAL H  S+VGVFYCGAPALT ELRQLA DF
Sbjct  850   HAKNGVDVVSGTRVKSHFAKPNWRQVYKRIALQHPHSRVGVFYCGAPALTKELRQLASDF  909

Query  558   SRKTSTKFDFHKENF  514
             S KTSTKF+FHKENF
Sbjct  910   SHKTSTKFEFHKENF  924



>gb|AII25876.1| NADPH oxidase A [Camellia sinensis]
Length=922

 Score =   329 bits (843),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 167/201 (83%), Positives = 179/201 (89%), Gaps = 6/201 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT------  937
             YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIV+NM A DEEE  +E G  AT      
Sbjct  722   YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVDNMKANDEEENALEGGDGATATKRSG  781

Query  936   KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALIT  757
              +F+T +AYFYWV REQGSFDWFKGIMNEVAE D  GVIEMHNYCTSVYEEGDARSALIT
Sbjct  782   NSFKTTRAYFYWVPREQGSFDWFKGIMNEVAETDKNGVIEMHNYCTSVYEEGDARSALIT  841

Query  756   MLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELR  577
             MLQSL+HAK+GVD+VSGTRVKSHFAKPNWRNVYKRIALNHT+ +VGVFYCGAPALT EL+
Sbjct  842   MLQSLNHAKHGVDVVSGTRVKSHFAKPNWRNVYKRIALNHTNGRVGVFYCGAPALTKELK  901

Query  576   QLALDFSRKTSTKFDFHKENF  514
             QLA DFSRKTSTKF+FHKENF
Sbjct  902   QLASDFSRKTSTKFEFHKENF  922



>ref|XP_010249370.1| PREDICTED: respiratory burst oxidase homolog protein C [Nelumbo 
nucifera]
Length=926

 Score =   329 bits (843),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 162/201 (81%), Positives = 177/201 (88%), Gaps = 6/201 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggven------ggaAT  937
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIVNNM A +EEE  +E          + 
Sbjct  726   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNMKAMEEEESALEAATHNPNKKNSK  785

Query  936   KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALIT  757
              +F+T +AYFYWVTREQGSFDWFKG+MNEVAEMD +GVIE+HNYCTSVYEEGDARSALI 
Sbjct  786   ASFKTTRAYFYWVTREQGSFDWFKGVMNEVAEMDQKGVIELHNYCTSVYEEGDARSALIA  845

Query  756   MLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELR  577
             MLQSL+HAKNGVD+VSGTRVKSHFAKPNWRNVYKRIALNH +++VGVFYCGAPA T ELR
Sbjct  846   MLQSLNHAKNGVDVVSGTRVKSHFAKPNWRNVYKRIALNHQNARVGVFYCGAPAPTKELR  905

Query  576   QLALDFSRKTSTKFDFHKENF  514
             QLA DFS KTSTKFDFHKENF
Sbjct  906   QLASDFSHKTSTKFDFHKENF  926



>ref|XP_010522982.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Tarenaya 
hassleriana]
Length=945

 Score =   329 bits (843),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/209 (76%), Positives = 173/209 (83%), Gaps = 14/209 (7%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggve------------  955
             YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDI+NNM  +  EE  +             
Sbjct  737   YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIINNMKTSSTEEDEMMDHIENGSNQNNS  796

Query  954   --nggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEG  781
               +     K FRT+KAYFYWVTREQGSF+WFKGIM+EVAEMD  GVIE+HNYCTSVYEEG
Sbjct  797   KNSKADKEKGFRTRKAYFYWVTREQGSFEWFKGIMDEVAEMDEEGVIELHNYCTSVYEEG  856

Query  780   DARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGA  601
             DARSALI MLQSL HAKNGVD+VSGTRVK+HFAKPNWR VYK+IAL+H DS+VGVFYCGA
Sbjct  857   DARSALIAMLQSLQHAKNGVDVVSGTRVKTHFAKPNWRQVYKKIALHHADSRVGVFYCGA  916

Query  600   PALTTELRQLALDFSRKTSTKFDFHKENF  514
             P LT ELRQLALDFS +TSTKFDFHKENF
Sbjct  917   PGLTKELRQLALDFSHRTSTKFDFHKENF  945



>ref|XP_008465165.1| PREDICTED: respiratory burst oxidase homolog protein C [Cucumis 
melo]
 ref|XP_008465166.1| PREDICTED: respiratory burst oxidase homolog protein C [Cucumis 
melo]
Length=924

 Score =   328 bits (842),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 175/203 (86%), Gaps = 8/203 (4%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT------  937
             YGAPAQDYKKYDVVLLVGLGIGATPM+SIVKDI++N+   + E   VENG   +      
Sbjct  722   YGAPAQDYKKYDVVLLVGLGIGATPMVSIVKDIIDNIEEKESEANAVENGQGHSSRGGSK  781

Query  936   --KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSAL  763
               K FRTKKAYFYWVTREQGSF+WFKGIMNEVAEMD RGVIE+HNYCTSVYEEGDARSAL
Sbjct  782   HGKGFRTKKAYFYWVTREQGSFEWFKGIMNEVAEMDERGVIELHNYCTSVYEEGDARSAL  841

Query  762   ITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTE  583
             ITMLQSLHHAKNGVD+VSGTRVKSHFAKPNWR VYK+I L+H D+KVGVFYCG P LT E
Sbjct  842   ITMLQSLHHAKNGVDVVSGTRVKSHFAKPNWRQVYKKITLHHPDTKVGVFYCGTPVLTKE  901

Query  582   LRQLALDFSRKTSTKFDFHKENF  514
             L QLA DF+RKTSTKF+FHKENF
Sbjct  902   LSQLASDFTRKTSTKFEFHKENF  924



>ref|XP_004141156.1| PREDICTED: respiratory burst oxidase homolog protein C [Cucumis 
sativus]
 gb|KGN59783.1| hypothetical protein Csa_3G845500 [Cucumis sativus]
Length=926

 Score =   328 bits (842),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 175/203 (86%), Gaps = 8/203 (4%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT------  937
             YGAPAQDYKKYDVVLLVGLGIGATPM+SIVKDI++N+   + E   VENG   +      
Sbjct  724   YGAPAQDYKKYDVVLLVGLGIGATPMVSIVKDIIDNIEEKESEANAVENGQGHSSRGGSK  783

Query  936   --KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSAL  763
               K FRTKKAYFYWVTREQGSF+WFKGIMNEVAEMD RGVIE+HNYCTSVYEEGDARSAL
Sbjct  784   HGKGFRTKKAYFYWVTREQGSFEWFKGIMNEVAEMDERGVIELHNYCTSVYEEGDARSAL  843

Query  762   ITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTE  583
             ITMLQSLHHAKNGVD+VSGTRVKSHFAKPNWR VYK+I L+H D+KVGVFYCG P LT E
Sbjct  844   ITMLQSLHHAKNGVDVVSGTRVKSHFAKPNWRQVYKKITLHHPDTKVGVFYCGTPVLTKE  903

Query  582   LRQLALDFSRKTSTKFDFHKENF  514
             L QLA DF+RKTSTKF+FHKENF
Sbjct  904   LSQLASDFTRKTSTKFEFHKENF  926



>gb|KJB51325.1| hypothetical protein B456_008G212100 [Gossypium raimondii]
Length=634

 Score =   321 bits (823),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 175/212 (83%), Gaps = 17/212 (8%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaade-----------------e  970
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIVNN+ A +E                 +
Sbjct  423   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNIRAMEEEEEEEKSCGIDEGNGVNK  482

Query  969   eggvenggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVY  790
                        +NF+T++AYFYWVTREQGSFDWFKGIMNEVAEMD+  VIE+HNYCTSVY
Sbjct  483   TNSTSPNSKRKENFKTRRAYFYWVTREQGSFDWFKGIMNEVAEMDHNHVIELHNYCTSVY  542

Query  789   EEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFY  610
             EEGDARSALITMLQSL+HAKNGVDIVSGTRVKSHFAKPNWR+VYK IA+NH +S+VGVFY
Sbjct  543   EEGDARSALITMLQSLNHAKNGVDIVSGTRVKSHFAKPNWRSVYKHIAVNHNNSRVGVFY  602

Query  609   CGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             CGAPALT ELRQLA DFS KTSTKFDFHKENF
Sbjct  603   CGAPALTKELRQLASDFSHKTSTKFDFHKENF  634



>ref|XP_010530642.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Tarenaya 
hassleriana]
Length=929

 Score =   328 bits (840),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 157/199 (79%), Positives = 171/199 (86%), Gaps = 4/199 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaa----deeeggvenggaATKN  931
             YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDI+NNM ++     +      N  +    
Sbjct  731   YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIINNMKSSNDNQMDRMENQNNNNSNNNG  790

Query  930   FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITML  751
             FRTKKAYFYWVTREQGSF+WFKGIM+EVAEMD  GVIE+HNYCTSVYEEGDARSALI ML
Sbjct  791   FRTKKAYFYWVTREQGSFEWFKGIMDEVAEMDEEGVIELHNYCTSVYEEGDARSALIAML  850

Query  750   QSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQL  571
             QSL HAK GVD+VSGTRVK+HFAKPNWR VYK+IAL+H DS+VGVFYCGAPALT ELR L
Sbjct  851   QSLQHAKTGVDVVSGTRVKTHFAKPNWRQVYKKIALHHADSRVGVFYCGAPALTKELRHL  910

Query  570   ALDFSRKTSTKFDFHKENF  514
             ALDFS +TSTKFDFHKENF
Sbjct  911   ALDFSHRTSTKFDFHKENF  929



>emb|CBI29288.3| unnamed protein product [Vitis vinifera]
Length=827

 Score =   325 bits (833),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/195 (79%), Positives = 172/195 (88%), Gaps = 8/195 (4%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDI++NM   D+E   +           TK
Sbjct  641   YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIISNMKTKDQETEDI--------QITTK  692

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             +AY+YWVTREQGSF+WFKGIMNEVAEMD +GVIE+HNYCTSV+EEGDARSALITMLQSLH
Sbjct  693   RAYYYWVTREQGSFEWFKGIMNEVAEMDEKGVIELHNYCTSVFEEGDARSALITMLQSLH  752

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             HAKNGVD+VSGTRVKSHFAKPNWR V+K+IA+ H DS+VGVFYCGAPALT +LRQLALDF
Sbjct  753   HAKNGVDVVSGTRVKSHFAKPNWRQVFKKIAIQHPDSRVGVFYCGAPALTKDLRQLALDF  812

Query  558   SRKTSTKFDFHKENF  514
             S +T+TKFDFHKENF
Sbjct  813   SHRTTTKFDFHKENF  827



>gb|ADR70892.1| respiratory burst oxidase C [Manihot esculenta]
Length=882

 Score =   326 bits (836),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 175/207 (85%), Gaps = 12/207 (6%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATK-----  934
             YGAPAQDYK+Y+V+LLVGLGIGATPMISIVKDIV+N+ A +EE  G    G   K     
Sbjct  676   YGAPAQDYKEYEVLLLVGLGIGATPMISIVKDIVSNIRAMEEEAEGSIENGTFAKTPSPS  735

Query  933   -------NFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDA  775
                     F+T +AYFYWVTREQGSFDWFKG+MNEVAE+D+  VIE+HNYCTSVYEEGDA
Sbjct  736   NALRRREEFKTSRAYFYWVTREQGSFDWFKGVMNEVAELDHNHVIELHNYCTSVYEEGDA  795

Query  774   RSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPA  595
             RSALI MLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNH DS+VGVFYCGAPA
Sbjct  796   RSALIAMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHPDSRVGVFYCGAPA  855

Query  594   LTTELRQLALDFSRKTSTKFDFHKENF  514
             LT ELR LALDFS KTSTKFDFHKENF
Sbjct  856   LTKELRHLALDFSHKTSTKFDFHKENF  882



>ref|XP_011020924.1| PREDICTED: respiratory burst oxidase homolog protein D [Populus 
euphratica]
Length=926

 Score =   327 bits (838),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 157/209 (75%), Positives = 173/209 (83%), Gaps = 14/209 (7%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM--------------Taadeeegg  961
             +GAPAQDYKKYDVVLLVGLGIGATPMISIVKDI+NNM                       
Sbjct  718   FGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIINNMKIKDKDEGNNGALDALESGRTTP  777

Query  960   venggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEG  781
              +N    +K+F+T+KAYFYWVTREQGSF+WFKGIMNEVAEMD++ VIE+HNYCTSVYEEG
Sbjct  778   NKNNKINSKSFKTRKAYFYWVTREQGSFEWFKGIMNEVAEMDDKQVIELHNYCTSVYEEG  837

Query  780   DARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGA  601
             DARSALI MLQSLHHAK+GVD+VSGTRVKSHFAKPNWR VYK+IAL H DS++GVFYCGA
Sbjct  838   DARSALIAMLQSLHHAKSGVDVVSGTRVKSHFAKPNWRQVYKKIALQHPDSRIGVFYCGA  897

Query  600   PALTTELRQLALDFSRKTSTKFDFHKENF  514
             PA T ELRQLAL FSRKTSTKFDFHKENF
Sbjct  898   PAPTNELRQLALAFSRKTSTKFDFHKENF  926



>gb|KHG19081.1| Respiratory burst oxidase D -like protein [Gossypium arboreum]
 gb|KHG23280.1| Respiratory burst oxidase D -like protein [Gossypium arboreum]
Length=651

 Score =   320 bits (820),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 169/203 (83%), Gaps = 8/203 (4%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM--------Taadeeeggvengga  943
             YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDI+NNM        +              
Sbjct  449   YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIINNMKMEEMEEDSFPGSGLENGNYNKK  508

Query  942   ATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSAL  763
               K F+T+KAYFYWVTREQGSF+WFKGIMNEVAEMD + VIE+HNYCTSVYEEGDARSAL
Sbjct  509   NNKGFKTRKAYFYWVTREQGSFEWFKGIMNEVAEMDEQWVIELHNYCTSVYEEGDARSAL  568

Query  762   ITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTE  583
             ITMLQSLHHAKNGVD+VSGTRVKSHFAKPNWR VYK IAL+H  +++GVFYCGAPALT E
Sbjct  569   ITMLQSLHHAKNGVDVVSGTRVKSHFAKPNWRQVYKNIALHHQGARIGVFYCGAPALTKE  628

Query  582   LRQLALDFSRKTSTKFDFHKENF  514
             LRQLALDFS KT TKFDFHKENF
Sbjct  629   LRQLALDFSHKTGTKFDFHKENF  651



>gb|AFW64932.1| respiratory burst oxidase protein D variant beta [Zea mays]
Length=648

 Score =   320 bits (819),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 173/199 (87%), Gaps = 4/199 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaad----eeeggvenggaATKN  931
             YGAPAQDYK+YD+VLLVGLGIGATPMISI+KDI+NNM   D     E        ++  +
Sbjct  450   YGAPAQDYKQYDIVLLVGLGIGATPMISIIKDIINNMRQLDGGGDLEASDASASSSSMAS  509

Query  930   FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITML  751
             FRT++AYFYWVTREQGSF+WF+G+M+EVAE D +GVIE+HNYCTSVYEEGDARSALI ML
Sbjct  510   FRTRRAYFYWVTREQGSFEWFRGVMDEVAETDRKGVIELHNYCTSVYEEGDARSALIAML  569

Query  750   QSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQL  571
             QSL+HAK+GVD+VSGTRVK+HFA+PNWRNVYKRIALNH + +VGVFYCGAP LT ELR+L
Sbjct  570   QSLNHAKHGVDVVSGTRVKTHFARPNWRNVYKRIALNHQNQRVGVFYCGAPVLTKELREL  629

Query  570   ALDFSRKTSTKFDFHKENF  514
             A DFSRKT+TKF+FHKENF
Sbjct  630   AQDFSRKTNTKFEFHKENF  648



>ref|NP_001108123.1| LOC100136880 isoform 2 [Zea mays]
 gb|ABP48737.1| respiratory burst oxidase protein D variant beta [Zea mays]
Length=648

 Score =   320 bits (819),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 174/199 (87%), Gaps = 4/199 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaad----eeeggvenggaATKN  931
             YGAPAQDYK+YD+VLLVGLGIGATPMISI+KDI+NNM   D     E     +  ++  +
Sbjct  450   YGAPAQDYKQYDIVLLVGLGIGATPMISIIKDIINNMRQLDGGGDLEASDASSSSSSMAS  509

Query  930   FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITML  751
             FRT++AYFYWVTREQGSF+WF+G+M+EVAE D +GVIE+HNYCTSVYEEGDARSALI ML
Sbjct  510   FRTRRAYFYWVTREQGSFEWFRGVMDEVAETDRKGVIELHNYCTSVYEEGDARSALIAML  569

Query  750   QSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQL  571
             QSL+HAK+GVD+VSGTRVK+HFA+PNWRNVYKRIALNH + +VGVFYCGAP LT ELR+L
Sbjct  570   QSLNHAKHGVDVVSGTRVKTHFARPNWRNVYKRIALNHQNQRVGVFYCGAPVLTKELREL  629

Query  570   ALDFSRKTSTKFDFHKENF  514
             A DFSRKT+TKF+FHKENF
Sbjct  630   AQDFSRKTNTKFEFHKENF  648



>ref|XP_006423884.1| hypothetical protein CICLE_v10027774mg [Citrus clementina]
 gb|ESR37124.1| hypothetical protein CICLE_v10027774mg [Citrus clementina]
 gb|KDO45136.1| hypothetical protein CISIN_1g002525mg [Citrus sinensis]
Length=912

 Score =   326 bits (836),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 171/197 (87%), Gaps = 2/197 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeegg--venggaATKNFR  925
             YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDI+NNM + D         N      +F 
Sbjct  716   YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIINNMKSEDNNLESGLTVNNNNKNSSFN  775

Query  924   TKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQS  745
             T+KAYFYWVTREQGSF+WFKGIMNEVAEMD + VIE+HNYCTSVYEEGDARSALI MLQS
Sbjct  776   TRKAYFYWVTREQGSFEWFKGIMNEVAEMDEKRVIELHNYCTSVYEEGDARSALIAMLQS  835

Query  744   LHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLAL  565
             LHHAKNGVD+VSGTRVKSHFAKPNWR VYKRIAL+H DS++GVFYCGAPALT ELRQLA 
Sbjct  836   LHHAKNGVDVVSGTRVKSHFAKPNWRQVYKRIALHHPDSRIGVFYCGAPALTKELRQLAS  895

Query  564   DFSRKTSTKFDFHKENF  514
             DFS KTSTKF+FHKENF
Sbjct  896   DFSHKTSTKFEFHKENF  912



>ref|XP_006487656.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Citrus 
sinensis]
Length=915

 Score =   326 bits (835),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 159/197 (81%), Positives = 171/197 (87%), Gaps = 2/197 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeegg--venggaATKNFR  925
             YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDI+NNM + D         N      +F 
Sbjct  719   YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIINNMKSEDNNLESGLTVNNNNKNSSFN  778

Query  924   TKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQS  745
             T+KAYFYWVTREQGSF+WFKGIMNEVAEMD + VIE+HNYCTSVYEEGDARSALI MLQS
Sbjct  779   TRKAYFYWVTREQGSFEWFKGIMNEVAEMDEKRVIELHNYCTSVYEEGDARSALIAMLQS  838

Query  744   LHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLAL  565
             LHHAKNGVD+VSGTRVKSHFAKPNWR VYKRIAL+H DS++GVFYCGAPALT ELRQLA 
Sbjct  839   LHHAKNGVDVVSGTRVKSHFAKPNWRQVYKRIALHHPDSRIGVFYCGAPALTKELRQLAS  898

Query  564   DFSRKTSTKFDFHKENF  514
             DFS KTSTKF+FHKENF
Sbjct  899   DFSHKTSTKFEFHKENF  915



>ref|NP_001275453.1| respiratory burst oxidase homolog protein C [Solanum tuberosum]
 sp|Q2HXL0.2|RBOHC_SOLTU RecName: Full=Respiratory burst oxidase homolog protein C; AltName: 
Full=NADPH oxidase RBOHC; AltName: Full=StRBOHC [Solanum 
tuberosum]
 dbj|BAE79344.2| NADPH oxidase [Solanum tuberosum]
Length=938

 Score =   326 bits (836),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 160/218 (73%), Positives = 177/218 (81%), Gaps = 23/218 (11%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM-----------------------  988
             YGAPAQDYK+Y+VVLLVGLGIGATPMISIVKDIVNNM                       
Sbjct  721   YGAPAQDYKQYEVVLLVGLGIGATPMISIVKDIVNNMKAMDEEENSLENGNGMSNAAQNA  780

Query  987   TaadeeeggvenggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHN  808
             +    ++ G  +  +   +F T++AYFYWVTREQGSFDWFKGIMNE AEMD++GVIEMHN
Sbjct  781   SPNMAQKRGKSSSASGGNSFNTRRAYFYWVTREQGSFDWFKGIMNEAAEMDHKGVIEMHN  840

Query  807   YCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDS  628
             YCTSVYEEGDARSALITMLQSLHHAK+GVDIVSGTRVKSHFAKPNWRNVYKRIALNH ++
Sbjct  841   YCTSVYEEGDARSALITMLQSLHHAKSGVDIVSGTRVKSHFAKPNWRNVYKRIALNHPEA  900

Query  627   KVGVFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             KVGVFYCGAPALT EL+Q AL+FS KTSTKFDFHKENF
Sbjct  901   KVGVFYCGAPALTKELKQHALNFSHKTSTKFDFHKENF  938



>emb|CDY35764.1| BnaC02g38300D [Brassica napus]
Length=899

 Score =   325 bits (833),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 171/196 (87%), Gaps = 1/196 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM-TaadeeeggvenggaATKNFRT  922
             YGAPAQDYKKYDVVLLVGLGIGATPMISI+KDI+NNM +   + +    +    +K FRT
Sbjct  704   YGAPAQDYKKYDVVLLVGLGIGATPMISILKDIINNMKSRDRDSDIENNSSNGNSKGFRT  763

Query  921   KKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSL  742
             +KAYFYWVTREQGSF+WFKGIM+EV+E+D+ G+IE+HNYCTSVYEEGDAR ALI MLQSL
Sbjct  764   RKAYFYWVTREQGSFEWFKGIMDEVSELDDEGIIELHNYCTSVYEEGDARVALIAMLQSL  823

Query  741   HHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALD  562
              HAKNGVD+VSGTRVKSHFAKPNWR VYKRIA+ H D ++GVFYCGAP LT +L+ LALD
Sbjct  824   QHAKNGVDVVSGTRVKSHFAKPNWRQVYKRIAVQHPDKRIGVFYCGAPGLTKDLKNLALD  883

Query  561   FSRKTSTKFDFHKENF  514
             FSRKTSTKFDFHKENF
Sbjct  884   FSRKTSTKFDFHKENF  899



>ref|XP_009129697.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Brassica 
rapa]
Length=921

 Score =   325 bits (833),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 171/196 (87%), Gaps = 1/196 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM-TaadeeeggvenggaATKNFRT  922
             YGAPAQDYKKYDVVLLVGLGIGATPMISI+KDI+NNM +   + +    +    +K FRT
Sbjct  726   YGAPAQDYKKYDVVLLVGLGIGATPMISILKDIINNMKSRDRDSDIENNSSNGNSKGFRT  785

Query  921   KKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSL  742
             +KAYFYWVTREQGSF+WFKGIM+EV+E+D+ G+IE+HNYCTSVYEEGDAR ALI MLQSL
Sbjct  786   RKAYFYWVTREQGSFEWFKGIMDEVSELDDEGIIELHNYCTSVYEEGDARVALIAMLQSL  845

Query  741   HHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALD  562
              HAKNGVD+VSGTRVKSHFAKPNWR VYKRIA+ H D ++GVFYCGAP LT +L+ LALD
Sbjct  846   QHAKNGVDVVSGTRVKSHFAKPNWRQVYKRIAVQHPDKRIGVFYCGAPGLTKDLKNLALD  905

Query  561   FSRKTSTKFDFHKENF  514
             FSRKTSTKFDFHKENF
Sbjct  906   FSRKTSTKFDFHKENF  921



>emb|CDY45918.1| BnaAnng07990D [Brassica napus]
Length=921

 Score =   325 bits (833),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 171/196 (87%), Gaps = 1/196 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM-TaadeeeggvenggaATKNFRT  922
             YGAPAQDYKKYDVVLLVGLGIGATPMISI+KDI+NNM +   + +    +    +K FRT
Sbjct  726   YGAPAQDYKKYDVVLLVGLGIGATPMISILKDIINNMKSRDRDSDIENNSSNGNSKGFRT  785

Query  921   KKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSL  742
             +KAYFYWVTREQGSF+WFKGIM+EV+E+D+ G+IE+HNYCTSVYEEGDAR ALI MLQSL
Sbjct  786   RKAYFYWVTREQGSFEWFKGIMDEVSELDDEGIIELHNYCTSVYEEGDARVALIAMLQSL  845

Query  741   HHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALD  562
              HAKNGVD+VSGTRVKSHFAKPNWR VYKRIA+ H D ++GVFYCGAP LT +L+ LALD
Sbjct  846   QHAKNGVDVVSGTRVKSHFAKPNWRQVYKRIAVQHPDKRIGVFYCGAPGLTKDLKNLALD  905

Query  561   FSRKTSTKFDFHKENF  514
             FSRKTSTKFDFHKENF
Sbjct  906   FSRKTSTKFDFHKENF  921



>ref|XP_002318793.2| respiratory burst oxidase C family protein [Populus trichocarpa]
 gb|EEE97013.2| respiratory burst oxidase C family protein [Populus trichocarpa]
Length=909

 Score =   325 bits (832),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 163/212 (77%), Positives = 178/212 (84%), Gaps = 17/212 (8%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggven-----------  952
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIV+N+   +EEE  VEN           
Sbjct  698   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNIRTMEEEENAVENGAGGIGNSPST  757

Query  951   ------ggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVY  790
                        +NF+T++AYFYWVTREQGSFDWFKG+MNEVAE+D+  VIE+HNYCTSVY
Sbjct  758   KIPSPYTQKRKENFKTRRAYFYWVTREQGSFDWFKGVMNEVAEIDHNHVIELHNYCTSVY  817

Query  789   EEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFY  610
             EEGDARSALI MLQS++HAKNGVDIVSGTRVKSHFAKPNWRNVYKR ALNH DS+VGVFY
Sbjct  818   EEGDARSALIAMLQSINHAKNGVDIVSGTRVKSHFAKPNWRNVYKRTALNHPDSRVGVFY  877

Query  609   CGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             CGAPALT ELRQLALDFS KTSTKFDFHKENF
Sbjct  878   CGAPALTKELRQLALDFSHKTSTKFDFHKENF  909



>ref|XP_011003531.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Populus 
euphratica]
Length=909

 Score =   324 bits (831),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 162/212 (76%), Positives = 176/212 (83%), Gaps = 17/212 (8%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeegg--------------  961
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIV+N+ A +EEE                
Sbjct  698   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNIRAIEEEENAVENGTGGLGNSPST  757

Query  960   ---venggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVY  790
                  N     +NF+T++AYFYWVTREQGSFDWFKG+MNEVAE D+  VIE+HNYCTSVY
Sbjct  758   KIPSPNTQKRKENFKTRRAYFYWVTREQGSFDWFKGVMNEVAEQDHNHVIELHNYCTSVY  817

Query  789   EEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFY  610
             EEGDARSALI MLQS++HAKNGVDIVSGTRVKSHFAKPNWRNVYKR ALNH DS+VGVFY
Sbjct  818   EEGDARSALIAMLQSINHAKNGVDIVSGTRVKSHFAKPNWRNVYKRTALNHPDSRVGVFY  877

Query  609   CGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             CGAPALT ELRQLALDFS KTSTKFDFHKENF
Sbjct  878   CGAPALTKELRQLALDFSHKTSTKFDFHKENF  909



>gb|ADE76874.1| unknown [Picea sitchensis]
Length=358

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 169/195 (87%), Gaps = 0/195 (0%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDYKKYDV+LLVGLGIGATP ISI+KDIVN+M  ++EE      G    K F T 
Sbjct  164   YGAPAQDYKKYDVLLLVGLGIGATPFISILKDIVNHMKVSEEERNIENVGKQKKKTFNTV  223

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             +A+FYWVTRE+GSFDWFKG+MNEVAE+D +G+IE+HNYCTSVYEEGDARSALI MLQ+L+
Sbjct  224   RAFFYWVTREEGSFDWFKGVMNEVAEIDQKGIIELHNYCTSVYEEGDARSALIAMLQALN  283

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             HAK+GVDIVSGTRV +HFAKPNWRNV+K I L H DS+VGVFYCG  ALT +LRQL+LDF
Sbjct  284   HAKHGVDIVSGTRVCTHFAKPNWRNVFKSITLKHKDSRVGVFYCGPAALTDDLRQLSLDF  343

Query  558   SRKTSTKFDFHKENF  514
             +RKTST+FDFHKENF
Sbjct  344   TRKTSTRFDFHKENF  358



>dbj|BAJ89207.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=716

 Score =   320 bits (819),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 175/196 (89%), Gaps = 1/196 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATK-NFRT  922
             YGAPAQDYK+YD+VLLVGLGIGATPMISI+KDI+NNM   + +      G A+T  +FRT
Sbjct  521   YGAPAQDYKQYDIVLLVGLGIGATPMISIIKDIINNMKRLEGDVESGNPGDASTSTSFRT  580

Query  921   KKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSL  742
             ++AYFYWVTREQGSF+WF+G+M+E+AE D +GVIE+HNYCTSVYE+GDARSALI MLQSL
Sbjct  581   RRAYFYWVTREQGSFEWFRGVMDEIAESDKKGVIELHNYCTSVYEDGDARSALIAMLQSL  640

Query  741   HHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALD  562
             +HAKNGVDIVSGTRVK+HFA+PNWRNVYKRIALNH + +VGVFYCGAP LT ELR+LA D
Sbjct  641   NHAKNGVDIVSGTRVKTHFARPNWRNVYKRIALNHREQRVGVFYCGAPVLTKELRELAQD  700

Query  561   FSRKTSTKFDFHKENF  514
             FSRKT+TKF+FHKENF
Sbjct  701   FSRKTNTKFEFHKENF  716



>dbj|BAJ93971.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=716

 Score =   320 bits (819),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 175/196 (89%), Gaps = 1/196 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATK-NFRT  922
             YGAPAQDYK+YD+VLLVGLGIGATPMISI+KDI+NNM   + +      G A+T  +FRT
Sbjct  521   YGAPAQDYKQYDIVLLVGLGIGATPMISIIKDIINNMKRLEGDVESGNPGDASTSTSFRT  580

Query  921   KKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSL  742
             ++AYFYWVTREQGSF+WF+G+M+E+AE D +GVIE+HNYCTSVYE+GDARSALI MLQSL
Sbjct  581   RRAYFYWVTREQGSFEWFRGVMDEIAESDKKGVIELHNYCTSVYEDGDARSALIAMLQSL  640

Query  741   HHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALD  562
             +HAKNGVDIVSGTRVK+HFA+PNWRNVYKRIALNH + +VGVFYCGAP LT ELR+LA D
Sbjct  641   NHAKNGVDIVSGTRVKTHFARPNWRNVYKRIALNHREQRVGVFYCGAPVLTKELRELAQD  700

Query  561   FSRKTSTKFDFHKENF  514
             FSRKT+TKF+FHKENF
Sbjct  701   FSRKTNTKFEFHKENF  716



>ref|XP_002511059.1| respiratory burst oxidase, putative [Ricinus communis]
 gb|EEF51661.1| respiratory burst oxidase, putative [Ricinus communis]
Length=910

 Score =   324 bits (830),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 172/207 (83%), Gaps = 12/207 (6%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNN------------MTaadeeeggve  955
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIVNN            +      +    
Sbjct  704   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNIRAREDEEEENALENGTLPKTPSP  763

Query  954   nggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDA  775
             +     +NF+T++AYFYWVTREQGSFDWFKG+MNEVAE+D+  VIE+HNYCTSVYEEGDA
Sbjct  764   DAQKRRENFKTRRAYFYWVTREQGSFDWFKGVMNEVAELDHNHVIELHNYCTSVYEEGDA  823

Query  774   RSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPA  595
             RSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWR+VYKR ALNH +S+VGVFYCGAPA
Sbjct  824   RSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRSVYKRTALNHPNSRVGVFYCGAPA  883

Query  594   LTTELRQLALDFSRKTSTKFDFHKENF  514
             LT ELR LA DFS KT+TKFDFHKENF
Sbjct  884   LTKELRHLASDFSHKTNTKFDFHKENF  910



>gb|KJB51327.1| hypothetical protein B456_008G212100 [Gossypium raimondii]
Length=888

 Score =   323 bits (829),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 175/212 (83%), Gaps = 17/212 (8%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaade-----------------e  970
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIVNN+ A +E                 +
Sbjct  677   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNIRAMEEEEEEEKSCGIDEGNGVNK  736

Query  969   eggvenggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVY  790
                        +NF+T++AYFYWVTREQGSFDWFKGIMNEVAEMD+  VIE+HNYCTSVY
Sbjct  737   TNSTSPNSKRKENFKTRRAYFYWVTREQGSFDWFKGIMNEVAEMDHNHVIELHNYCTSVY  796

Query  789   EEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFY  610
             EEGDARSALITMLQSL+HAKNGVDIVSGTRVKSHFAKPNWR+VYK IA+NH +S+VGVFY
Sbjct  797   EEGDARSALITMLQSLNHAKNGVDIVSGTRVKSHFAKPNWRSVYKHIAVNHNNSRVGVFY  856

Query  609   CGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             CGAPALT ELRQLA DFS KTSTKFDFHKENF
Sbjct  857   CGAPALTKELRQLASDFSHKTSTKFDFHKENF  888



>ref|XP_004979405.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Setaria 
italica]
Length=931

 Score =   323 bits (829),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 153/197 (78%), Positives = 175/197 (89%), Gaps = 2/197 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaad--eeeggvenggaATKNFR  925
             YGAPAQDYKKYDVVLLVGLGIGATPMISI+KDI+NNM   D   E G   +   +T +FR
Sbjct  735   YGAPAQDYKKYDVVLLVGLGIGATPMISIIKDIINNMKQLDGDLEAGSGNDNSVSTASFR  794

Query  924   TKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQS  745
             T++AYFYWVTREQGSF+WF+G+M+EVAE D +GVIE+HNYCTSVYEEGDARSALI MLQS
Sbjct  795   TRRAYFYWVTREQGSFEWFRGVMDEVAETDKKGVIELHNYCTSVYEEGDARSALIAMLQS  854

Query  744   LHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLAL  565
             L+HAK+GVD+VSGTRVK+HFA+PNWRNVYKRIALNH D +VGVFYCGAP LT ELR+LA 
Sbjct  855   LNHAKHGVDVVSGTRVKTHFARPNWRNVYKRIALNHRDQRVGVFYCGAPVLTKELRELAQ  914

Query  564   DFSRKTSTKFDFHKENF  514
             DFSRKT+TKF+FHKENF
Sbjct  915   DFSRKTNTKFEFHKENF  931



>gb|KJB51323.1| hypothetical protein B456_008G212100 [Gossypium raimondii]
Length=918

 Score =   323 bits (828),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 175/212 (83%), Gaps = 17/212 (8%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaade-----------------e  970
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIVNN+ A +E                 +
Sbjct  707   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNIRAMEEEEEEEKSCGIDEGNGVNK  766

Query  969   eggvenggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVY  790
                        +NF+T++AYFYWVTREQGSFDWFKGIMNEVAEMD+  VIE+HNYCTSVY
Sbjct  767   TNSTSPNSKRKENFKTRRAYFYWVTREQGSFDWFKGIMNEVAEMDHNHVIELHNYCTSVY  826

Query  789   EEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFY  610
             EEGDARSALITMLQSL+HAKNGVDIVSGTRVKSHFAKPNWR+VYK IA+NH +S+VGVFY
Sbjct  827   EEGDARSALITMLQSLNHAKNGVDIVSGTRVKSHFAKPNWRSVYKHIAVNHNNSRVGVFY  886

Query  609   CGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             CGAPALT ELRQLA DFS KTSTKFDFHKENF
Sbjct  887   CGAPALTKELRQLASDFSHKTSTKFDFHKENF  918



>ref|XP_011015154.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Populus 
euphratica]
Length=909

 Score =   323 bits (827),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 161/212 (76%), Positives = 176/212 (83%), Gaps = 17/212 (8%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeegg--------------  961
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIV+N+ A +EEE                
Sbjct  698   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVSNIRAIEEEENAVENGTGGLGNSPST  757

Query  960   ---venggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVY  790
                  N     +NF+T++AYFYWVTREQGSFDWFKG+MNEVAE D+  VIE+HNYCTSVY
Sbjct  758   KIPSPNTQKRKENFKTRRAYFYWVTREQGSFDWFKGVMNEVAEQDHNHVIELHNYCTSVY  817

Query  789   EEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFY  610
             EEGDARSALI MLQS++HAKNGVDIVSGTRVKSHFAKP+WRNVYKR ALNH DS+VGVFY
Sbjct  818   EEGDARSALIAMLQSINHAKNGVDIVSGTRVKSHFAKPDWRNVYKRTALNHPDSRVGVFY  877

Query  609   CGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             CGAPALT ELRQLALDFS KTSTKFDFHKENF
Sbjct  878   CGAPALTKELRQLALDFSHKTSTKFDFHKENF  909



>ref|XP_003577502.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Brachypodium 
distachyon]
Length=924

 Score =   323 bits (827),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 173/195 (89%), Gaps = 1/195 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDYK+YDVVLLVGLGIGATPMISI+KDI+NNM    + +    +   ++ NFRT 
Sbjct  731   YGAPAQDYKQYDVVLLVGLGIGATPMISILKDIINNM-KRLDGDVESGDASVSSANFRTT  789

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             +AYFYWVTREQGSF+WF+G+M+EVAE D +GVIE+HNYCTSVYEEGDARSALI MLQSL+
Sbjct  790   RAYFYWVTREQGSFEWFRGVMDEVAETDKKGVIELHNYCTSVYEEGDARSALIAMLQSLN  849

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             HAK+GVD+VSGTRVK+HFA+PNWRNVYKRIALNH + +VGVFYCGAP LT ELR+LA DF
Sbjct  850   HAKHGVDVVSGTRVKTHFARPNWRNVYKRIALNHREQRVGVFYCGAPVLTKELRELAQDF  909

Query  558   SRKTSTKFDFHKENF  514
             SRKTSTKF+FHKENF
Sbjct  910   SRKTSTKFEFHKENF  924



>gb|ADR70880.1| respiratory burst oxidase A [Manihot esculenta]
Length=908

 Score =   322 bits (826),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 172/206 (83%), Gaps = 11/206 (5%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATK-----  934
             YGAPAQDY  YDVVLLVGLGIGATPMISIVKDIV+N+ A +EE       G   +     
Sbjct  703   YGAPAQDYHNYDVVLLVGLGIGATPMISIVKDIVSNIRAMEEEGESSLENGTVPRTPSPN  762

Query  933   ------NFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDAR  772
                   NF+T +AYFYWVTREQGSFDWFKG+MNEVAE+D+  VIE+HNYCTSVYEEGDAR
Sbjct  763   TLKRKENFKTTRAYFYWVTREQGSFDWFKGVMNEVAELDHNNVIELHNYCTSVYEEGDAR  822

Query  771   SALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPAL  592
             SALI MLQSLHHAKNGVDIVSGTRVKSHFAKPNWR VYKRIALNH +S+VGVFYCGAPAL
Sbjct  823   SALIAMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRTVYKRIALNHPNSRVGVFYCGAPAL  882

Query  591   TTELRQLALDFSRKTSTKFDFHKENF  514
             T ELRQLA DFS KT+TKFDFHKENF
Sbjct  883   TKELRQLASDFSHKTNTKFDFHKENF  908



>gb|KHG00108.1| Respiratory burst oxidase C [Gossypium arboreum]
Length=915

 Score =   322 bits (825),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 159/212 (75%), Positives = 174/212 (82%), Gaps = 17/212 (8%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaade-----------------e  970
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIVNN+ A +E                 +
Sbjct  704   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNIRAMEEEEEEEKSSGIEKGNGVNK  763

Query  969   eggvenggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVY  790
                        +NF+T++AYFYWVTREQGSFDWFKGIMNEVAEMD   VIE+HNYCTSVY
Sbjct  764   TNSTSPSSKRKENFKTRRAYFYWVTREQGSFDWFKGIMNEVAEMDRNHVIELHNYCTSVY  823

Query  789   EEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFY  610
             EEGDARSALITMLQSL+HAKNGVDIVSGTRVKSHFAKPNWR+VYK IA+NH +S+VGVFY
Sbjct  824   EEGDARSALITMLQSLNHAKNGVDIVSGTRVKSHFAKPNWRSVYKHIAVNHNNSRVGVFY  883

Query  609   CGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             CGAPALT +LRQLA DFS KTSTKFDFHKENF
Sbjct  884   CGAPALTKDLRQLASDFSHKTSTKFDFHKENF  915



>gb|KHG05306.1| Respiratory burst oxidase D -like protein [Gossypium arboreum]
Length=916

 Score =   322 bits (825),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 167/201 (83%), Gaps = 6/201 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM------TaadeeeggvenggaAT  937
             YGAPAQD+KKYDVVLLVGLGIGATPMISIVKDI+NNM      T                
Sbjct  716   YGAPAQDHKKYDVVLLVGLGIGATPMISIVKDIINNMKMEEDSTPEGSAMENGNYSNKNN  775

Query  936   KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALIT  757
             K F+T+KAYFYWVTREQGSF+WFKGIMNEVAEMD + VIE+HNYCTSVYEEGDARSALIT
Sbjct  776   KGFKTRKAYFYWVTREQGSFEWFKGIMNEVAEMDEKKVIELHNYCTSVYEEGDARSALIT  835

Query  756   MLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELR  577
             MLQSLHHAKNGVD+VSGTRVKSHFAKPNWR VYK IAL H ++++GVFYCGAPALT ELR
Sbjct  836   MLQSLHHAKNGVDVVSGTRVKSHFAKPNWRQVYKNIALRHPNARIGVFYCGAPALTKELR  895

Query  576   QLALDFSRKTSTKFDFHKENF  514
              LA DFS K +TKF+FHKENF
Sbjct  896   HLASDFSHKITTKFEFHKENF  916



>ref|XP_009151593.1| PREDICTED: respiratory burst oxidase homolog protein D [Brassica 
rapa]
Length=922

 Score =   322 bits (825),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 171/196 (87%), Gaps = 1/196 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM-TaadeeeggvenggaATKNFRT  922
             YGAPAQDYKKYDVVLLVGLGIGATPMISI+KDI+NNM T A + +    N    +K FRT
Sbjct  727   YGAPAQDYKKYDVVLLVGLGIGATPMISILKDIINNMKTDAHDRDIENNNSNGNSKGFRT  786

Query  921   KKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSL  742
             +KAYFYWVTREQGSF+WFKGIM+EVAE+D  G+IE+HNYCTSVYE+GDAR ALI MLQSL
Sbjct  787   RKAYFYWVTREQGSFEWFKGIMDEVAELDEEGIIELHNYCTSVYEDGDARVALIAMLQSL  846

Query  741   HHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALD  562
              HAKNGVD+VSGTRVKSHFAKPNWR VYKRIA+ H D ++GVFYCGAPA T EL+ LALD
Sbjct  847   QHAKNGVDVVSGTRVKSHFAKPNWRQVYKRIAVQHPDKRIGVFYCGAPAPTKELKNLALD  906

Query  561   FSRKTSTKFDFHKENF  514
             FSRKT+TKFDFHKENF
Sbjct  907   FSRKTTTKFDFHKENF  922



>emb|CDX86335.1| BnaA06g30520D [Brassica napus]
Length=922

 Score =   322 bits (825),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 171/196 (87%), Gaps = 1/196 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM-TaadeeeggvenggaATKNFRT  922
             YGAPAQDYKKYDVVLLVGLGIGATPMISI+KDI+NNM T A + +    N    +K FRT
Sbjct  727   YGAPAQDYKKYDVVLLVGLGIGATPMISILKDIINNMKTDAHDRDIENNNSNGNSKGFRT  786

Query  921   KKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSL  742
             +KAYFYWVTREQGSF+WFKGIM+EVAE+D  G+IE+HNYCTSVYE+GDAR ALI MLQSL
Sbjct  787   RKAYFYWVTREQGSFEWFKGIMDEVAELDEEGIIELHNYCTSVYEDGDARVALIAMLQSL  846

Query  741   HHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALD  562
              HAKNGVD+VSGTRVKSHFAKPNWR VYKRIA+ H D ++GVFYCGAPA T EL+ LALD
Sbjct  847   QHAKNGVDVVSGTRVKSHFAKPNWRQVYKRIAVQHPDKRIGVFYCGAPAPTKELKNLALD  906

Query  561   FSRKTSTKFDFHKENF  514
             FSRKT+TKFDFHKENF
Sbjct  907   FSRKTTTKFDFHKENF  922



>ref|XP_004299201.1| PREDICTED: respiratory burst oxidase homolog protein D [Fragaria 
vesca subsp. vesca]
Length=935

 Score =   322 bits (825),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/219 (71%), Positives = 174/219 (79%), Gaps = 24/219 (11%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT------  937
             YGAPAQDYKKYDVVLLVGLGIGATPM+SIVKDI+NNM +   +E                
Sbjct  717   YGAPAQDYKKYDVVLLVGLGIGATPMVSIVKDIINNMNSLKNKELDEYAVLDDVLESGRA  776

Query  936   ------------------KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMH  811
                               K FRT+KAY+YWVTREQGSF+WFKGI+NEVAEMD +GVIE+H
Sbjct  777   GNNTNNSSSSNGKSNKSNKGFRTQKAYYYWVTREQGSFEWFKGILNEVAEMDEKGVIELH  836

Query  810   NYCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTD  631
             NYCTSVYEEGDARSALI MLQ+LHHAKNGVD+VSGTRVKSHFAKPNWR VYK+IAL+H D
Sbjct  837   NYCTSVYEEGDARSALIAMLQNLHHAKNGVDVVSGTRVKSHFAKPNWRQVYKKIALHHPD  896

Query  630   SKVGVFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             S+VGVFYCGAPALT EL+QLALDFS +TSTKF+FHKENF
Sbjct  897   SRVGVFYCGAPALTKELKQLALDFSHRTSTKFEFHKENF  935



>ref|XP_006395230.1| hypothetical protein EUTSA_v10003619mg [Eutrema salsugineum]
 gb|ESQ32516.1| hypothetical protein EUTSA_v10003619mg [Eutrema salsugineum]
Length=928

 Score =   321 bits (823),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 168/195 (86%), Gaps = 0/195 (0%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDI+NNM + D +     N    +K F+T 
Sbjct  734   YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIINNMKSHDSDIESNTNSNGNSKGFKTT  793

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             KAYFYWVTREQGSF+WFKGIM+EV+E+D  GVIE+HNYCTSVYEEGDAR ALI MLQSL 
Sbjct  794   KAYFYWVTREQGSFEWFKGIMDEVSELDEEGVIELHNYCTSVYEEGDARVALIAMLQSLQ  853

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             HAKNGVD+VSGTRVKSHFAKPNWR VYK+IA+ +   ++GVFYCGAP LT EL+ LALDF
Sbjct  854   HAKNGVDVVSGTRVKSHFAKPNWRQVYKKIAVQYPGKRIGVFYCGAPGLTKELKNLALDF  913

Query  558   SRKTSTKFDFHKENF  514
             SRKT+TKFDFHKENF
Sbjct  914   SRKTTTKFDFHKENF  928



>gb|EMT25284.1| Respiratory burst oxidase-B-like protein [Aegilops tauschii]
Length=717

 Score =   317 bits (811),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 173/196 (88%), Gaps = 1/196 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATK-NFRT  922
             YGAPAQDYK+YD+VLLVGLGIGATPMISI+KDI+NNM   + +      G A+T  +FRT
Sbjct  522   YGAPAQDYKQYDIVLLVGLGIGATPMISIIKDIINNMKRLEGDVESGNPGDASTSASFRT  581

Query  921   KKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSL  742
             ++AYFYWVTREQGSF+WF+G+M+E+AE D + VIE+HNYCTSVYE+GDARSALI MLQSL
Sbjct  582   RRAYFYWVTREQGSFEWFRGVMDEIAESDKKSVIELHNYCTSVYEDGDARSALIAMLQSL  641

Query  741   HHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALD  562
             +HAKNGVDIVSGTRVK+HFA+PNWRNVYKRIALNH + +VGVFYCGAP LT ELR LA D
Sbjct  642   NHAKNGVDIVSGTRVKTHFARPNWRNVYKRIALNHREQRVGVFYCGAPVLTKELRDLAQD  701

Query  561   FSRKTSTKFDFHKENF  514
             FSRKT+TKF+FHKENF
Sbjct  702   FSRKTNTKFEFHKENF  717



>dbj|BAJ97450.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=916

 Score =   321 bits (822),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 175/196 (89%), Gaps = 1/196 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATK-NFRT  922
             YGAPAQDYK+YD+VLLVGLGIGATPMISI+KDI+NNM   + +      G A+T  +FRT
Sbjct  721   YGAPAQDYKQYDIVLLVGLGIGATPMISIIKDIINNMKRLEGDVESGNPGDASTSTSFRT  780

Query  921   KKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSL  742
             ++AYFYWVTREQGSF+WF+G+M+E+AE D +GVIE+HNYCTSVYE+GDARSALI MLQSL
Sbjct  781   RRAYFYWVTREQGSFEWFRGVMDEIAESDKKGVIELHNYCTSVYEDGDARSALIAMLQSL  840

Query  741   HHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALD  562
             +HAKNGVDIVSGTRVK+HFA+PNWRNVYKRIALNH + +VGVFYCGAP LT ELR+LA D
Sbjct  841   NHAKNGVDIVSGTRVKTHFARPNWRNVYKRIALNHREQRVGVFYCGAPVLTKELRELAQD  900

Query  561   FSRKTSTKFDFHKENF  514
             FSRKT+TKF+FHKENF
Sbjct  901   FSRKTNTKFEFHKENF  916



>ref|XP_011040313.1| PREDICTED: respiratory burst oxidase homolog protein C [Populus 
euphratica]
Length=909

 Score =   320 bits (821),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 161/212 (76%), Positives = 179/212 (84%), Gaps = 17/212 (8%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggven------ggaAT  937
             YGAPAQDYKKY+V+LLVGLGIGATPMISIVKDI +N+ A +EEE  +E+          T
Sbjct  698   YGAPAQDYKKYEVLLLVGLGIGATPMISIVKDIASNIRAMEEEEKALEDGTDGAGNSPLT  757

Query  936   KN-----------FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVY  790
             KN           F+T++AYFYWVTREQGSFDWFKG+MNEVAE+D+  VIE+HNYCTSVY
Sbjct  758   KNQSPNAQRRKESFKTRRAYFYWVTREQGSFDWFKGVMNEVAELDHNHVIELHNYCTSVY  817

Query  789   EEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFY  610
             EEGDARSALI MLQS++HAKNGVDIVSGTRVKSHFAKP+WRNVYKR ALNH DS+VGVFY
Sbjct  818   EEGDARSALIAMLQSINHAKNGVDIVSGTRVKSHFAKPDWRNVYKRTALNHPDSRVGVFY  877

Query  609   CGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             CGAPALT ELRQLALDFS KTSTKFDFHKENF
Sbjct  878   CGAPALTKELRQLALDFSHKTSTKFDFHKENF  909



>sp|Q2HXK9.2|RBOHD_SOLTU RecName: Full=Respiratory burst oxidase homolog protein D; AltName: 
Full=NADPH oxidase RBOHD; AltName: Full=StRBOHD [Solanum 
tuberosum]
 dbj|BAE79345.2| NADPH oxidase [Solanum tuberosum]
Length=858

 Score =   319 bits (818),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/195 (77%), Positives = 168/195 (86%), Gaps = 0/195 (0%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDYK+Y+V+LLVGLGIGATPMISIVKDIVNNM     +    +   + +     K
Sbjct  664   YGAPAQDYKEYEVLLLVGLGIGATPMISIVKDIVNNMKEEKYDHDLEKKTVSGSGRSNFK  723

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             + YFYWVTREQGSFDWFKG+MNE+A MD  G+IEMHNYCTSVYEEGDARSALI MLQS++
Sbjct  724   RVYFYWVTREQGSFDWFKGLMNELAVMDCDGIIEMHNYCTSVYEEGDARSALIAMLQSIN  783

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             HAKNGVDIVSGTRVK+HFA+PNWRNVYKRIALNHTD++VGVFYCGAPALT  L QLALDF
Sbjct  784   HAKNGVDIVSGTRVKTHFARPNWRNVYKRIALNHTDARVGVFYCGAPALTKVLGQLALDF  843

Query  558   SRKTSTKFDFHKENF  514
             S KTSTKFDFHKENF
Sbjct  844   SHKTSTKFDFHKENF  858



>gb|KJB58284.1| hypothetical protein B456_009G202500 [Gossypium raimondii]
Length=936

 Score =   320 bits (821),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 173/206 (84%), Gaps = 11/206 (5%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeegg-----------ven  952
             YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDI+NNM   + EE              +N
Sbjct  731   YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIINNMKMEEMEEDSFPGSGLENGNYNKN  790

Query  951   ggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDAR  772
                  K F+T+KAYFYWVTREQGSF+WFKGIMNEVAEMD + VIE+HNYCTSVYEEGDAR
Sbjct  791   KNKNNKGFKTRKAYFYWVTREQGSFEWFKGIMNEVAEMDEQRVIELHNYCTSVYEEGDAR  850

Query  771   SALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPAL  592
             SALITMLQSLHHAKNGVD+VSGTRVKSHFAKPNWR VYK IAL+H  +++GVFYCGAPAL
Sbjct  851   SALITMLQSLHHAKNGVDVVSGTRVKSHFAKPNWRQVYKNIALHHQGARIGVFYCGAPAL  910

Query  591   TTELRQLALDFSRKTSTKFDFHKENF  514
             T ELRQLALDFS KT TKFDFHKENF
Sbjct  911   TKELRQLALDFSHKTGTKFDFHKENF  936



>gb|ABA94089.2| respiratory burst oxidase protein D, putative, expressed [Oryza 
sativa Japonica Group]
Length=936

 Score =   320 bits (821),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 174/199 (87%), Gaps = 4/199 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeegg----venggaATKN  931
             YGAPAQDYK+YD+VLLVGLGIGATPMISI+KDI+NNM   D +         +  +++  
Sbjct  738   YGAPAQDYKQYDIVLLVGLGIGATPMISIIKDIINNMRQLDGDLEDGDGNDNSVSSSSAA  797

Query  930   FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITML  751
             F+T++AYFYWVTREQGSF+WF+G+M+EVAE D +GVIE+HNYCTSVYEEGDARSALI ML
Sbjct  798   FKTRRAYFYWVTREQGSFEWFRGVMDEVAETDKKGVIELHNYCTSVYEEGDARSALIAML  857

Query  750   QSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQL  571
             QSL+HAK+GVD+VSGTRVK+HFA+PNWRNVYKRIALNH D +VGVFYCGAP LT ELR+L
Sbjct  858   QSLNHAKHGVDVVSGTRVKTHFARPNWRNVYKRIALNHRDQRVGVFYCGAPVLTKELREL  917

Query  570   ALDFSRKTSTKFDFHKENF  514
             A DFSRKTSTKFDFHKENF
Sbjct  918   AQDFSRKTSTKFDFHKENF  936



>gb|ACF05504.2| respiratory burst oxidase-like protein [Citrullus colocynthis]
Length=926

 Score =   320 bits (820),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 174/203 (86%), Gaps = 8/203 (4%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT------  937
             YGAPAQDYKKYDVVLLVGLGIGATPM+SIVKDI++N+   + E   VENG   +      
Sbjct  724   YGAPAQDYKKYDVVLLVGLGIGATPMVSIVKDIIDNIEGKEAEANAVENGQGHSSRGGSK  783

Query  936   --KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSAL  763
               K FRT+KAYFYWVTREQGSF+WFKGIMNEVAEMD RGVIE+HNYCTSVYEEGDARSAL
Sbjct  784   HGKGFRTRKAYFYWVTREQGSFEWFKGIMNEVAEMDERGVIELHNYCTSVYEEGDARSAL  843

Query  762   ITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTE  583
             I MLQSL HAK+GVD+VSGTRVKSHFAKPNWR VYK+I ++H D++VGV YCGAPALT E
Sbjct  844   IAMLQSLQHAKSGVDVVSGTRVKSHFAKPNWRQVYKKITIHHPDTRVGVSYCGAPALTRE  903

Query  582   LRQLALDFSRKTSTKFDFHKENF  514
             L QLA DFSRKTSTKF+FHKENF
Sbjct  904   LSQLASDFSRKTSTKFEFHKENF  926



>gb|KFK35232.1| hypothetical protein AALP_AA5G257400 [Arabis alpina]
Length=914

 Score =   320 bits (819),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 151/195 (77%), Positives = 168/195 (86%), Gaps = 3/195 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDYKKYDVVLLVGLGIGATPMISI+KDI+NNM ++ + E    N     K FRT 
Sbjct  723   YGAPAQDYKKYDVVLLVGLGIGATPMISILKDIINNMKSSSDIENDNNNN---NKGFRTS  779

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             KAYFYWVTREQGSF+WFKGIM+EV+E+D  GVIE+HNYCTSVYEEGDAR ALI MLQSL 
Sbjct  780   KAYFYWVTREQGSFEWFKGIMDEVSELDEEGVIELHNYCTSVYEEGDARVALIAMLQSLQ  839

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             HAKNGVD+VSGTRVKSHFAKPNWR VYK+IA+ H   ++GVFYCGAP LT EL+ LALDF
Sbjct  840   HAKNGVDVVSGTRVKSHFAKPNWRQVYKKIAVQHPGKRIGVFYCGAPGLTKELKNLALDF  899

Query  558   SRKTSTKFDFHKENF  514
             SRKT+TKFDFHKENF
Sbjct  900   SRKTTTKFDFHKENF  914



>ref|XP_002322314.2| respiratory burst oxidase C family protein [Populus trichocarpa]
 gb|EEF06441.2| respiratory burst oxidase C family protein [Populus trichocarpa]
Length=915

 Score =   320 bits (819),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 161/212 (76%), Positives = 178/212 (84%), Gaps = 17/212 (8%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKN----  931
             YGAPAQDYKKY+V+LLVGLGIGATPMISIVKDI +N+ A +EEE  +ENG     N    
Sbjct  704   YGAPAQDYKKYEVLLLVGLGIGATPMISIVKDIASNIRAMEEEEKALENGTDGAGNSPLT  763

Query  930   -------------FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVY  790
                          F+T++AYFYWVTREQGSFDWFKG+MNEVAE+D+  VIE+HNYCTSVY
Sbjct  764   RTPSPNAHKRKESFKTRRAYFYWVTREQGSFDWFKGVMNEVAELDHNHVIELHNYCTSVY  823

Query  789   EEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFY  610
             EEGDARSALI MLQS++HAKNGVDIVSGTRVKSHFAKP+WRNVYKR ALNH DS+VGVFY
Sbjct  824   EEGDARSALIAMLQSINHAKNGVDIVSGTRVKSHFAKPDWRNVYKRTALNHPDSRVGVFY  883

Query  609   CGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             CGAPALT ELRQLALDFS KTSTKFDFHKENF
Sbjct  884   CGAPALTKELRQLALDFSHKTSTKFDFHKENF  915



>ref|XP_009404717.1| PREDICTED: respiratory burst oxidase homolog protein C-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=926

 Score =   319 bits (818),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 174/215 (81%), Gaps = 20/215 (9%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggv-------------  958
             YGAPAQ+YKKY+VVLLVGLGIGATP ISIVKDIVNNM   D +E                
Sbjct  712   YGAPAQEYKKYEVVLLVGLGIGATPFISIVKDIVNNMKQLDPDEESSDDGRSEEDGSGGG  771

Query  957   -------enggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCT  799
                    +   + + +FRT++AYFYWVTREQGSF+WF+G+MNEVAE D +GVIE+HN+CT
Sbjct  772   GSSSHQRKLTSSPSSSFRTRRAYFYWVTREQGSFEWFRGVMNEVAEADKKGVIELHNFCT  831

Query  798   SVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVG  619
             SVYEEGDARSALI MLQSL+HAK+GVDIVSGTRVKSHFA+PNWRNVYKRIALNH D ++G
Sbjct  832   SVYEEGDARSALIVMLQSLNHAKHGVDIVSGTRVKSHFARPNWRNVYKRIALNHRDQRIG  891

Query  618   VFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             VFYCGAP LT ELRQLA DFSRKTSTKFDFHKENF
Sbjct  892   VFYCGAPTLTKELRQLATDFSRKTSTKFDFHKENF  926



>ref|XP_002450884.1| hypothetical protein SORBIDRAFT_05g020380 [Sorghum bicolor]
 gb|EES09872.1| hypothetical protein SORBIDRAFT_05g020380 [Sorghum bicolor]
Length=936

 Score =   319 bits (818),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 173/199 (87%), Gaps = 4/199 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaa----deeeggvenggaATKN  931
             YGAPAQDYK+YD+VLLVGLGIGATPMISI+KDI+NNM       +   G   +  +   +
Sbjct  738   YGAPAQDYKQYDIVLLVGLGIGATPMISIIKDIINNMKQPDGDLEAGAGADTSASSMASS  797

Query  930   FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITML  751
             FRT++AYFYWVTREQGSF+WF+G+M+EVAE D +GVIE+HNYCTSVYEEGDARSALI ML
Sbjct  798   FRTRRAYFYWVTREQGSFEWFRGVMDEVAETDKKGVIELHNYCTSVYEEGDARSALIAML  857

Query  750   QSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQL  571
             QSL+HAK+GVD+VSGTRVK+HFA+PNWRNVYKRIALNH + +VGVFYCGAP LT ELR+L
Sbjct  858   QSLNHAKHGVDVVSGTRVKTHFARPNWRNVYKRIALNHQNQRVGVFYCGAPVLTKELREL  917

Query  570   ALDFSRKTSTKFDFHKENF  514
             A DFSRKT+TKF+FHKENF
Sbjct  918   AQDFSRKTNTKFEFHKENF  936



>ref|XP_009404716.1| PREDICTED: respiratory burst oxidase homolog protein B-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=938

 Score =   319 bits (818),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 174/215 (81%), Gaps = 20/215 (9%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggv-------------  958
             YGAPAQ+YKKY+VVLLVGLGIGATP ISIVKDIVNNM   D +E                
Sbjct  724   YGAPAQEYKKYEVVLLVGLGIGATPFISIVKDIVNNMKQLDPDEESSDDGRSEEDGSGGG  783

Query  957   -------enggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCT  799
                    +   + + +FRT++AYFYWVTREQGSF+WF+G+MNEVAE D +GVIE+HN+CT
Sbjct  784   GSSSHQRKLTSSPSSSFRTRRAYFYWVTREQGSFEWFRGVMNEVAEADKKGVIELHNFCT  843

Query  798   SVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVG  619
             SVYEEGDARSALI MLQSL+HAK+GVDIVSGTRVKSHFA+PNWRNVYKRIALNH D ++G
Sbjct  844   SVYEEGDARSALIVMLQSLNHAKHGVDIVSGTRVKSHFARPNWRNVYKRIALNHRDQRIG  903

Query  618   VFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             VFYCGAP LT ELRQLA DFSRKTSTKFDFHKENF
Sbjct  904   VFYCGAPTLTKELRQLATDFSRKTSTKFDFHKENF  938



>dbj|BAK03403.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=916

 Score =   319 bits (817),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 174/196 (89%), Gaps = 1/196 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATK-NFRT  922
             YGAPAQDYK+YD+VLLVGLGIGATPMIS +KDI+NNM   + +      G A+T  +FRT
Sbjct  721   YGAPAQDYKQYDIVLLVGLGIGATPMISTIKDIINNMKRLEGDVESGNPGDASTSTSFRT  780

Query  921   KKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSL  742
             ++AYFYWVTREQGSF+WF+G+M+E+AE D +GVIE+HNYCTSVYE+GDARSALI MLQSL
Sbjct  781   RRAYFYWVTREQGSFEWFRGVMDEIAESDKKGVIELHNYCTSVYEDGDARSALIAMLQSL  840

Query  741   HHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALD  562
             +HAKNGVDIVSGTRVK+HFA+PNWRNVYKRIALNH + +VGVFYCGAP LT ELR+LA D
Sbjct  841   NHAKNGVDIVSGTRVKTHFARPNWRNVYKRIALNHREQRVGVFYCGAPVLTKELRELAQD  900

Query  561   FSRKTSTKFDFHKENF  514
             FSRKT+TKF+FHKENF
Sbjct  901   FSRKTNTKFEFHKENF  916



>ref|XP_010657584.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Vitis 
vinifera]
 ref|XP_010657595.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Vitis 
vinifera]
Length=923

 Score =   318 bits (816),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 156/208 (75%), Positives = 177/208 (85%), Gaps = 13/208 (6%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKN----  931
             YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDI++NM   D+E   ++     T +    
Sbjct  716   YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIISNMKTKDQETEDIQITVETTPDHDNG  775

Query  930   ---------FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGD  778
                      F+TK+AY+YWVTREQGSF+WFKGIMNEVAEMD +GVIE+HNYCTSV+EEGD
Sbjct  776   NRKKKNKKTFKTKRAYYYWVTREQGSFEWFKGIMNEVAEMDEKGVIELHNYCTSVFEEGD  835

Query  777   ARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAP  598
             ARSALITMLQSLHHAKNGVD+VSGTRVKSHFAKPNWR V+K+IA+ H DS+VGVFYCGAP
Sbjct  836   ARSALITMLQSLHHAKNGVDVVSGTRVKSHFAKPNWRQVFKKIAIQHPDSRVGVFYCGAP  895

Query  597   ALTTELRQLALDFSRKTSTKFDFHKENF  514
             ALT +LRQLALDFS +T+TKFDFHKENF
Sbjct  896   ALTKDLRQLALDFSHRTTTKFDFHKENF  923



>emb|CBI39505.3| unnamed protein product [Vitis vinifera]
Length=873

 Score =   317 bits (813),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 170/199 (85%), Gaps = 4/199 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKN----  931
             YGAPAQDYKKYDVVLLVGLGIGATP+ISIVKD++NN+    E E G+        N    
Sbjct  675   YGAPAQDYKKYDVVLLVGLGIGATPLISIVKDVLNNVKQYQELEEGMTESNGERGNARKP  734

Query  930   FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITML  751
             F T++AYFYWVTREQGSF+WF+ +MNEV E D  GVIE+HNYCTSVYEEGDARSALI ML
Sbjct  735   FATRRAYFYWVTREQGSFEWFRSVMNEVTENDKDGVIELHNYCTSVYEEGDARSALIAML  794

Query  750   QSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQL  571
             QSLHHAKNGVDIVSGTRVK+HFA+PNWRNV+KR+ALNH + +VGVFYCGAP LT EL++L
Sbjct  795   QSLHHAKNGVDIVSGTRVKTHFARPNWRNVFKRVALNHANQRVGVFYCGAPTLTGELKRL  854

Query  570   ALDFSRKTSTKFDFHKENF  514
             ALDFSRKTSTKFDFHKENF
Sbjct  855   ALDFSRKTSTKFDFHKENF  873



>ref|XP_003602726.1| Respiratory burst oxidase-like protein [Medicago truncatula]
 gb|AES72977.1| respiratory burst oxidase-like protein D [Medicago truncatula]
Length=923

 Score =   318 bits (816),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 176/208 (85%), Gaps = 13/208 (6%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKN----  931
             YGAPAQDYK+YDVVLLVGLGIGATPMISI+KDIVNN  A +E+EG     G ++K+    
Sbjct  716   YGAPAQDYKQYDVVLLVGLGIGATPMISILKDIVNNFKAMEEDEGTTIEEGTSSKSPRPS  775

Query  930   ---------FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGD  778
                      F+TK+AYFYWVTREQGSFDWFKG+MNEVAE D+RGVIE+HNYCTSVYEEGD
Sbjct  776   QHKRTGLNSFKTKRAYFYWVTREQGSFDWFKGVMNEVAEDDHRGVIELHNYCTSVYEEGD  835

Query  777   ARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAP  598
             ARSALI MLQSL+HAKNGVDIVSGTRVKSHFAKPNWR+VYKRIALNH  ++VGVFYCG P
Sbjct  836   ARSALIAMLQSLNHAKNGVDIVSGTRVKSHFAKPNWRSVYKRIALNHPQTRVGVFYCGPP  895

Query  597   ALTTELRQLALDFSRKTSTKFDFHKENF  514
             ALT ELRQL  DFS  T+TK+DFHKENF
Sbjct  896   ALTKELRQLGSDFSHNTTTKYDFHKENF  923



>gb|AIT39747.1| respiratory burst oxidase, partial [Chrysanthemum boreale]
Length=617

 Score =   311 bits (797),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 154/204 (75%), Positives = 170/204 (83%), Gaps = 10/204 (5%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggven----------g  949
             YGAPAQDYKKYDVVLLVGLGIGATPMISI+KDIVNNM    EEE  +E+           
Sbjct  414   YGAPAQDYKKYDVVLLVGLGIGATPMISILKDIVNNMKTKQEEEAALESGVNSSVPPPSP  473

Query  948   gaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARS  769
              +    F+T +AYFYWVTREQGSFDWFKG+MNEVAE D+  VIEMHNYCTSVYEEGDARS
Sbjct  474   LSKKSTFKTTQAYFYWVTREQGSFDWFKGVMNEVAETDHDNVIEMHNYCTSVYEEGDARS  533

Query  768   ALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALT  589
             ALITMLQSL+HAKNGVD+VSGTRVKSHFAKPNWR+VYKRIA+ H+  +VGVFYCGAPAL 
Sbjct  534   ALITMLQSLNHAKNGVDVVSGTRVKSHFAKPNWRSVYKRIAVTHSGQRVGVFYCGAPALV  593

Query  588   TELRQLALDFSRKTSTKFDFHKEN  517
              EL+QLA DF+ KT TKFDFHKEN
Sbjct  594   PELKQLAADFTHKTPTKFDFHKEN  617



>ref|XP_002863831.1| hypothetical protein ARALYDRAFT_917612 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40090.1| hypothetical protein ARALYDRAFT_917612 [Arabidopsis lyrata subsp. 
lyrata]
Length=920

 Score =   318 bits (815),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/195 (76%), Positives = 169/195 (87%), Gaps = 1/195 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDYKKYDVVLLVGLGIGATPMISI+KDI+NNM + D +     +    +K F+T+
Sbjct  727   YGAPAQDYKKYDVVLLVGLGIGATPMISILKDIINNMKSPDSDIENNNSNNN-SKGFKTR  785

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             KAYFYWVTREQGSF+WFKGIM+EV+E+D  G+IE+HNYCTSVYEEGDAR ALI MLQSL 
Sbjct  786   KAYFYWVTREQGSFEWFKGIMDEVSELDEEGIIELHNYCTSVYEEGDARVALIAMLQSLQ  845

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             HAKNGVD+VSGTRVKSHFAKPNWR VYK+IA+ H   ++GVFYCGAP LT EL+ LALDF
Sbjct  846   HAKNGVDVVSGTRVKSHFAKPNWRQVYKKIAVQHPGKRIGVFYCGAPGLTKELKNLALDF  905

Query  558   SRKTSTKFDFHKENF  514
             SRKT+TKFDFHKENF
Sbjct  906   SRKTTTKFDFHKENF  920



>ref|XP_002283888.1| PREDICTED: respiratory burst oxidase homolog protein B [Vitis 
vinifera]
Length=894

 Score =   318 bits (814),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 170/199 (85%), Gaps = 4/199 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKN----  931
             YGAPAQDYKKYDVVLLVGLGIGATP+ISIVKD++NN+    E E G+        N    
Sbjct  696   YGAPAQDYKKYDVVLLVGLGIGATPLISIVKDVLNNVKQYQELEEGMTESNGERGNARKP  755

Query  930   FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITML  751
             F T++AYFYWVTREQGSF+WF+ +MNEV E D  GVIE+HNYCTSVYEEGDARSALI ML
Sbjct  756   FATRRAYFYWVTREQGSFEWFRSVMNEVTENDKDGVIELHNYCTSVYEEGDARSALIAML  815

Query  750   QSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQL  571
             QSLHHAKNGVDIVSGTRVK+HFA+PNWRNV+KR+ALNH + +VGVFYCGAP LT EL++L
Sbjct  816   QSLHHAKNGVDIVSGTRVKTHFARPNWRNVFKRVALNHANQRVGVFYCGAPTLTGELKRL  875

Query  570   ALDFSRKTSTKFDFHKENF  514
             ALDFSRKTSTKFDFHKENF
Sbjct  876   ALDFSRKTSTKFDFHKENF  894



>ref|XP_004241641.1| PREDICTED: respiratory burst oxidase homolog protein D [Solanum 
lycopersicum]
Length=857

 Score =   317 bits (812),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 171/199 (86%), Gaps = 6/199 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaad----eeeggvenggaATKN  931
             YGAPAQDYK+Y+V+LLVGLGIGATPMISIVKDIVNNM   +     E    +    +  N
Sbjct  661   YGAPAQDYKEYEVLLLVGLGIGATPMISIVKDIVNNMKEEEYDHDLESTEQKKKSGSGSN  720

Query  930   FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITML  751
             F  K+ YFYWVTREQGSFDWFKG+MNE+AEMD   +IEMHNYCTSVYEEGDARSALI ML
Sbjct  721   F--KRVYFYWVTREQGSFDWFKGLMNELAEMDCAEIIEMHNYCTSVYEEGDARSALIAML  778

Query  750   QSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQL  571
             QS++HAKNGVDIVSGTRVK+HFA+PNWR+VYKRIALNHTD++VGVFYCGAPALT +L QL
Sbjct  779   QSINHAKNGVDIVSGTRVKTHFARPNWRDVYKRIALNHTDARVGVFYCGAPALTKQLGQL  838

Query  570   ALDFSRKTSTKFDFHKENF  514
             ALDFS KTSTKFDFHKENF
Sbjct  839   ALDFSHKTSTKFDFHKENF  857



>ref|XP_002865839.1| hypothetical protein ARALYDRAFT_495172 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42098.1| hypothetical protein ARALYDRAFT_495172 [Arabidopsis lyrata subsp. 
lyrata]
Length=906

 Score =   318 bits (814),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 171/201 (85%), Gaps = 6/201 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeg------gvenggaAT  937
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIVNN+ A ++ +         E      
Sbjct  706   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNIKAKEQAQLNRMENGTSEPQRNKK  765

Query  936   KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALIT  757
             ++FRT++AYFYWVTREQGSFDWFK IMNEVAE D   +IEMHNYCTSVYEEGDARSALI 
Sbjct  766   ESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDTNRIIEMHNYCTSVYEEGDARSALIH  825

Query  756   MLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELR  577
             MLQSL+HAKNGVDIVSGTRV SHFAKPNWRNVYKRIA++H +SKVGVFYCGAPALT ELR
Sbjct  826   MLQSLNHAKNGVDIVSGTRVMSHFAKPNWRNVYKRIAMDHPNSKVGVFYCGAPALTKELR  885

Query  576   QLALDFSRKTSTKFDFHKENF  514
              LALDF+ KTST+F FHKENF
Sbjct  886   HLALDFTHKTSTRFSFHKENF  906



>ref|XP_004503030.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Cicer 
arietinum]
Length=927

 Score =   318 bits (815),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 154/197 (78%), Positives = 173/197 (88%), Gaps = 2/197 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT--KNFR  925
             YGAPAQDYK+Y+VVLLVGLGIGATPMISI+KDIVNN  A ++EEG   +        NF+
Sbjct  731   YGAPAQDYKQYEVVLLVGLGIGATPMISILKDIVNNFKAIEDEEGSRASQHKKNGLSNFK  790

Query  924   TKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQS  745
             TK+AYFYWVT+EQGSF+WFKG+MNEVAE D+RGVIE+HNYCTSVYEEGDARSALI MLQS
Sbjct  791   TKRAYFYWVTKEQGSFEWFKGVMNEVAEEDHRGVIELHNYCTSVYEEGDARSALIAMLQS  850

Query  744   LHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLAL  565
             L+HAKNGVDIVSGTRVKSHFAKPNWR+VYKRIALNH  ++VGVFYCG PAL  ELRQLA 
Sbjct  851   LNHAKNGVDIVSGTRVKSHFAKPNWRSVYKRIALNHPQARVGVFYCGLPALAKELRQLAS  910

Query  564   DFSRKTSTKFDFHKENF  514
             DFS  T+TK+DFHKENF
Sbjct  911   DFSHNTTTKYDFHKENF  927



>ref|XP_009421001.1| PREDICTED: respiratory burst oxidase homolog protein B [Musa 
acuminata subsp. malaccensis]
Length=940

 Score =   318 bits (815),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/215 (71%), Positives = 172/215 (80%), Gaps = 20/215 (9%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM--------------------Taa  979
             YGAPAQ+YKKY+VVLLVGLGIGATP ISIVKDIVNNM                     + 
Sbjct  726   YGAPAQEYKKYEVVLLVGLGIGATPFISIVKDIVNNMKQWDPEESSDGDDVRDASEGGSG  785

Query  978   deeeggvenggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCT  799
                        ++T +F+T++AYFYWVTREQGSF+WF+G+MNEVAE D +GVIE+HN+CT
Sbjct  786   GHSSSHRRPVTSSTSSFKTRRAYFYWVTREQGSFEWFRGVMNEVAETDKKGVIELHNFCT  845

Query  798   SVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVG  619
             SVYEEGDARSALI MLQSL+HAK+GVDIVSGTRVKSHFA+PNWRNVYKRIALNH D ++G
Sbjct  846   SVYEEGDARSALIVMLQSLNHAKHGVDIVSGTRVKSHFARPNWRNVYKRIALNHRDQRIG  905

Query  618   VFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             VFYCGAP LT ELRQLA DFSRKTSTKFDFHKENF
Sbjct  906   VFYCGAPTLTKELRQLATDFSRKTSTKFDFHKENF  940



>gb|KHG02500.1| Respiratory burst oxidase C [Gossypium arboreum]
Length=919

 Score =   317 bits (813),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 173/214 (81%), Gaps = 19/214 (9%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM-------------------Taad  976
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIV+N+                   T  +
Sbjct  706   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVHNIRSMAEDEDEELSSALENGATINN  765

Query  975   eeeggvenggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTS  796
             +            +NF+TK+AYFYWVTREQGSFDWFKGIMNEVAEMD+  VIE+HNYCTS
Sbjct  766   KTSSPSPPNPKRRENFKTKRAYFYWVTREQGSFDWFKGIMNEVAEMDHDHVIELHNYCTS  825

Query  795   VYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGV  616
             VYEEGDARSALITMLQSL+HAKNGVD+VSGTRVKSHFAKPNWR+VYK IA+NH +++VGV
Sbjct  826   VYEEGDARSALITMLQSLNHAKNGVDVVSGTRVKSHFAKPNWRSVYKHIAVNHNNARVGV  885

Query  615   FYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             FYCGAPALT  LRQLA DFS KTSTKFDFHKENF
Sbjct  886   FYCGAPALTKVLRQLASDFSHKTSTKFDFHKENF  919



>ref|XP_008807833.1| PREDICTED: respiratory burst oxidase homolog protein C-like isoform 
X1 [Phoenix dactylifera]
Length=921

 Score =   317 bits (813),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 169/209 (81%), Gaps = 14/209 (7%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggven-----------  952
             YGAPAQDYKKYDVVLLVGLGIGATP ISI+KDIVNNM   + E                 
Sbjct  713   YGAPAQDYKKYDVVLLVGLGIGATPFISILKDIVNNMKQLESEGLLDSEGDRDLEGAGGS  772

Query  951   ---ggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEG  781
                    +  F T++AYFYWVTREQGSF+WF+G+MNEVAE D +GVIE+H YCTSVYEEG
Sbjct  773   SHRPSGTSSTFNTRRAYFYWVTREQGSFEWFRGVMNEVAETDKKGVIELHTYCTSVYEEG  832

Query  780   DARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGA  601
             DARSALITMLQSL+HAK+GVD+VSGTRVKSHFA+PNWRNVYKRIALNH D ++GVFYCGA
Sbjct  833   DARSALITMLQSLNHAKHGVDVVSGTRVKSHFARPNWRNVYKRIALNHRDQRIGVFYCGA  892

Query  600   PALTTELRQLALDFSRKTSTKFDFHKENF  514
             P LT +LRQLA DFSRKT+TKFDFHKENF
Sbjct  893   PTLTKQLRQLAQDFSRKTTTKFDFHKENF  921



>ref|XP_004309557.1| PREDICTED: respiratory burst oxidase homolog protein C [Fragaria 
vesca subsp. vesca]
 ref|XP_011470839.1| PREDICTED: respiratory burst oxidase homolog protein C [Fragaria 
vesca subsp. vesca]
Length=917

 Score =   317 bits (813),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 172/203 (85%), Gaps = 8/203 (4%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATK-----  934
             YGAPAQDYK Y+VVLLVGLGIGATPMISI+KDIVNN+ A ++E       G A       
Sbjct  715   YGAPAQDYKNYEVVLLVGLGIGATPMISILKDIVNNIKAIEDESQNALESGTAGSGSPVS  774

Query  933   ---NFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSAL  763
                NF+TK+AYFYWVTREQGSFDWFKG MNEVAE+D+  VIE HNYCTSVYEEGDARSAL
Sbjct  775   LHSNFKTKRAYFYWVTREQGSFDWFKGAMNEVAELDHNRVIEFHNYCTSVYEEGDARSAL  834

Query  762   ITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTE  583
             I MLQSL+HAKNGVDIVSGTRVKSHFAKPNWR VYKRIAL+HT+ KVGVFYCG PALT E
Sbjct  835   IAMLQSLNHAKNGVDIVSGTRVKSHFAKPNWREVYKRIALDHTNDKVGVFYCGPPALTEE  894

Query  582   LRQLALDFSRKTSTKFDFHKENF  514
             LRQL+LDF+ KTST+F+FHKENF
Sbjct  895   LRQLSLDFNHKTSTRFEFHKENF  917



>emb|CBI29289.3| unnamed protein product [Vitis vinifera]
Length=906

 Score =   317 bits (812),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 174/195 (89%), Gaps = 4/195 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDI+NNM A +E++  ++      + F+TK
Sbjct  716   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIINNMKAKEEDKEDIQIR----RTFKTK  771

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             +AY+YWVTREQGSF+WFKGIMNEVAEMD +GV+E+HNYCTSV+EEGDARSALITMLQ+L+
Sbjct  772   RAYYYWVTREQGSFEWFKGIMNEVAEMDEKGVVELHNYCTSVFEEGDARSALITMLQTLY  831

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             HAKNGVD+VSGTRVKSHFA+PNWR V K IAL H DS+VGVFYCGAP LT EL++LAL F
Sbjct  832   HAKNGVDVVSGTRVKSHFARPNWRQVLKNIALQHPDSRVGVFYCGAPGLTKELQKLALYF  891

Query  558   SRKTSTKFDFHKENF  514
             S KT+TKFDFHKENF
Sbjct  892   SHKTTTKFDFHKENF  906



>ref|XP_006282261.1| hypothetical protein CARUB_v10028541mg [Capsella rubella]
 gb|EOA15159.1| hypothetical protein CARUB_v10028541mg [Capsella rubella]
Length=916

 Score =   317 bits (812),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 171/201 (85%), Gaps = 6/201 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeg------gvenggaAT  937
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIVNN+ A ++ +         E      
Sbjct  716   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNIKAKEQAQLNRMENGTSEPQRNKK  775

Query  936   KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALIT  757
             ++FRT++AYFYWVTREQGSFDWFK IMNEVAE D   VIEMHNYCTSVYEEGDARSALI 
Sbjct  776   ESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDTNRVIEMHNYCTSVYEEGDARSALIH  835

Query  756   MLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELR  577
             MLQSL+HAKNGVDIVSGTRV SHFAKPNWRNVYKRIA++H ++KVGVFYCGAPALT ELR
Sbjct  836   MLQSLNHAKNGVDIVSGTRVMSHFAKPNWRNVYKRIAMDHPNTKVGVFYCGAPALTKELR  895

Query  576   QLALDFSRKTSTKFDFHKENF  514
              LALDF+ KTST+F FHKENF
Sbjct  896   HLALDFTHKTSTRFSFHKENF  916



>ref|XP_010942321.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Elaeis 
guineensis]
Length=928

 Score =   317 bits (813),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 154/218 (71%), Positives = 172/218 (79%), Gaps = 23/218 (11%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKN----  931
             YGAPAQDYKKYDVVLLVGLGIGATP ISI+KDIVNNM   + E      G    +N    
Sbjct  711   YGAPAQDYKKYDVVLLVGLGIGATPFISILKDIVNNMKQLELEGLLDSEGDRDLENAVVG  770

Query  930   -------------------FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHN  808
                                F T++AYFYWVTREQGSF+WF+G+MNEVAE D +GVIE+H 
Sbjct  771   EGSSTKGAGGSSHRPSGTTFNTRRAYFYWVTREQGSFEWFRGVMNEVAETDKKGVIELHT  830

Query  807   YCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDS  628
             YCTSVYEEGDARSALITMLQSL+HAK+GVD+VSGTRVKSHFA+PNWRNVYKRIALNH D 
Sbjct  831   YCTSVYEEGDARSALITMLQSLNHAKHGVDVVSGTRVKSHFARPNWRNVYKRIALNHRDQ  890

Query  627   KVGVFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             ++GVFYCGAP LT +LRQLALDFSRKT+TKFDFHKENF
Sbjct  891   RIGVFYCGAPTLTKQLRQLALDFSRKTTTKFDFHKENF  928



>ref|NP_199919.1| Respiratory burst oxidase homolog protein C [Arabidopsis thaliana]
 sp|O81210.2|RBOHC_ARATH RecName: Full=Respiratory burst oxidase homolog protein C; AltName: 
Full=NADPH oxidase RBOHC; Short=AtRBOHC; AltName: Full=Protein 
ROOT HAIR DEFECTIVE 2 [Arabidopsis thaliana]
 dbj|BAB08752.1| respiratory burst oxidase protein [Arabidopsis thaliana]
 gb|AED96028.1| Respiratory burst oxidase homolog protein C [Arabidopsis thaliana]
Length=905

 Score =   317 bits (812),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 172/201 (86%), Gaps = 6/201 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeg------gvenggaAT  937
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIVNN+ A ++ +         E   +  
Sbjct  705   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNIKAKEQAQLNRMENGTSEPQRSKK  764

Query  936   KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALIT  757
             ++FRT++AYFYWVTREQGSFDWFK IMNEVAE D   VIEMHNYCTSVYEEGDARSALI 
Sbjct  765   ESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDANRVIEMHNYCTSVYEEGDARSALIH  824

Query  756   MLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELR  577
             MLQSL+HAKNGVDIVSGTRV SHFAKPNWRNVYKRIA++H ++KVGVFYCGAPALT ELR
Sbjct  825   MLQSLNHAKNGVDIVSGTRVMSHFAKPNWRNVYKRIAMDHPNTKVGVFYCGAPALTKELR  884

Query  576   QLALDFSRKTSTKFDFHKENF  514
              LALDF+ KTST+F FHKENF
Sbjct  885   HLALDFTHKTSTRFSFHKENF  905



>emb|CAN64415.1| hypothetical protein VITISV_013316 [Vitis vinifera]
Length=894

 Score =   317 bits (811),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 170/199 (85%), Gaps = 4/199 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKN----  931
             YGAPAQDYKKYDVVLLVGLGIGATP+ISIVKD++NN+    E E G+        N    
Sbjct  696   YGAPAQDYKKYDVVLLVGLGIGATPLISIVKDVLNNVKQYQELEEGMTESNGERGNARKP  755

Query  930   FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITML  751
             F T++AYFYWVTREQGSF+WF+ +MNEV E D  GVIE+HNYCTSVYEEGDARSALI ML
Sbjct  756   FATRRAYFYWVTREQGSFEWFRSVMNEVTENDKDGVIELHNYCTSVYEEGDARSALIAML  815

Query  750   QSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQL  571
             QSLHHAKNGVDIVSGTRVK+HFA+PNWRNV+KR+A+NH + +VGVFYCGAP LT EL++L
Sbjct  816   QSLHHAKNGVDIVSGTRVKTHFARPNWRNVFKRVAVNHANQRVGVFYCGAPTLTGELKRL  875

Query  570   ALDFSRKTSTKFDFHKENF  514
             ALDFSRKTSTKFDFHKENF
Sbjct  876   ALDFSRKTSTKFDFHKENF  894



>gb|AAC39477.1| respiratory burst oxidase protein C [Arabidopsis thaliana]
Length=867

 Score =   316 bits (809),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 172/201 (86%), Gaps = 6/201 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeg------gvenggaAT  937
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIVNN+ A ++ +         E   +  
Sbjct  667   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNIKAKEQAQLNRMENGTSEPQRSKK  726

Query  936   KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALIT  757
             ++FRT++AYFYWVTREQGSFDWFK IMNEVAE D   VIEMHNYCTSVYEEGDARSALI 
Sbjct  727   ESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDANRVIEMHNYCTSVYEEGDARSALIH  786

Query  756   MLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELR  577
             MLQSL+HAKNGVDIVSGTRV SHFAKPNWRNVYKRIA++H ++KVGVFYCGAPALT ELR
Sbjct  787   MLQSLNHAKNGVDIVSGTRVMSHFAKPNWRNVYKRIAMDHPNTKVGVFYCGAPALTKELR  846

Query  576   QLALDFSRKTSTKFDFHKENF  514
              LALDF+ KTST+F FHKENF
Sbjct  847   HLALDFTHKTSTRFSFHKENF  867



>dbj|BAC41837.1| putative respiratory burst oxidase protein [Arabidopsis thaliana]
Length=905

 Score =   317 bits (811),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 172/201 (86%), Gaps = 6/201 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeg------gvenggaAT  937
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIVNN+ A ++ +         E   +  
Sbjct  705   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNIKAKEQAQLNRMENGTSEPQRSKK  764

Query  936   KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALIT  757
             ++FRT++AYFYWVTREQGSFDWFK IMNEVAE D   VIEMHNYCTSVYEEGDARSALI 
Sbjct  765   ESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDANRVIEMHNYCTSVYEEGDARSALIH  824

Query  756   MLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELR  577
             MLQSL+HAKNGVDIVSGTRV SHFAKPNWRNVYKRIA++H ++KVGVFYCGAPALT ELR
Sbjct  825   MLQSLNHAKNGVDIVSGTRVMSHFAKPNWRNVYKRIAMDHPNTKVGVFYCGAPALTKELR  884

Query  576   QLALDFSRKTSTKFDFHKENF  514
              LALDF+ KTST+F FHKENF
Sbjct  885   HLALDFTHKTSTRFSFHKENF  905



>gb|EMT01380.1| Respiratory burst oxidase-B-like protein [Aegilops tauschii]
Length=669

 Score =   311 bits (797),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 168/197 (85%), Gaps = 2/197 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaad--eeeggvenggaATKNFR  925
             YGAPAQDYK+YDVVLLVGLGIGATPMISI+KDI+NNM   D   E     +   +  +FR
Sbjct  473   YGAPAQDYKQYDVVLLVGLGIGATPMISIIKDIINNMKRLDGDTESARPTDRSVSAASFR  532

Query  924   TKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQS  745
             T++AYFYWVTRE+GSFDWF+G+M+EVAE D +G+IE+HNYCTSVYEEGDARSALI MLQS
Sbjct  533   TRRAYFYWVTREEGSFDWFRGVMDEVAESDKKGIIELHNYCTSVYEEGDARSALIAMLQS  592

Query  744   LHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLAL  565
             L+HAK+GVD+VSGTRVK+HFA+PNWR VYK IAL H   +VGVFYCGAP L  ELRQLA 
Sbjct  593   LNHAKHGVDVVSGTRVKTHFARPNWRKVYKDIALKHAGQRVGVFYCGAPVLIKELRQLAQ  652

Query  564   DFSRKTSTKFDFHKENF  514
             DFSRKTSTKF+FHKENF
Sbjct  653   DFSRKTSTKFEFHKENF  669



>emb|CDX85316.1| BnaC07g26270D [Brassica napus]
Length=922

 Score =   317 bits (811),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 170/196 (87%), Gaps = 1/196 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM-TaadeeeggvenggaATKNFRT  922
             YGAPAQDYKKYDVVLLVGLGIGATPMISI+KDI++NM T A + +    N    +K FRT
Sbjct  727   YGAPAQDYKKYDVVLLVGLGIGATPMISILKDIISNMKTDAHDRDIENNNSNGNSKGFRT  786

Query  921   KKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSL  742
             +KAYFYWVTREQGSF+WFKGIM+EVAE+D  G+IE+HNYCTSVYE+GDAR ALI MLQSL
Sbjct  787   RKAYFYWVTREQGSFEWFKGIMDEVAELDEEGIIELHNYCTSVYEDGDARVALIAMLQSL  846

Query  741   HHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALD  562
              HAKNGVD+VSGTRVKSHFAKPNWR VYKRIA+ H   ++GVFYCGAPA T EL+ LALD
Sbjct  847   QHAKNGVDVVSGTRVKSHFAKPNWRQVYKRIAVQHPGKRIGVFYCGAPAPTKELKNLALD  906

Query  561   FSRKTSTKFDFHKENF  514
             FSRKT+TKFDFHKENF
Sbjct  907   FSRKTTTKFDFHKENF  922



>gb|ADQ74913.1| respiratory burst oxidase protein 1 [Picea abies]
Length=954

 Score =   317 bits (812),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/199 (76%), Positives = 177/199 (89%), Gaps = 4/199 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATK----N  931
             YGAPAQDY+KYDV+LLVGLGIGATP ISIVKDIVNNM   +EE   +ENG   +K    +
Sbjct  756   YGAPAQDYRKYDVLLLVGLGIGATPFISIVKDIVNNMKLKEEESSHLENGSNGSKHKKKS  815

Query  930   FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITML  751
             F T +AYFYWVTREQGSF+WFKG+MNEVAE+D++ +IE+HNYCTSVYEEGDARSALI ML
Sbjct  816   FNTSRAYFYWVTREQGSFEWFKGVMNEVAEIDDKRIIELHNYCTSVYEEGDARSALIAML  875

Query  750   QSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQL  571
             Q+L+HAK+GVDIVSGTRVK+HFAKPNWRNV+KR+A+NH D +VGVFYCGAP LT EL+QL
Sbjct  876   QALNHAKHGVDIVSGTRVKTHFAKPNWRNVFKRVAVNHKDERVGVFYCGAPGLTNELKQL  935

Query  570   ALDFSRKTSTKFDFHKENF  514
             +LDF+RKTST+FDFHKENF
Sbjct  936   SLDFTRKTSTRFDFHKENF  954



>gb|AFW64933.1| respiratory burst oxidase protein D variant alpha [Zea mays]
Length=932

 Score =   316 bits (810),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 173/199 (87%), Gaps = 4/199 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaad----eeeggvenggaATKN  931
             YGAPAQDYK+YD+VLLVGLGIGATPMISI+KDI+NNM   D     E        ++  +
Sbjct  734   YGAPAQDYKQYDIVLLVGLGIGATPMISIIKDIINNMRQLDGGGDLEASDASASSSSMAS  793

Query  930   FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITML  751
             FRT++AYFYWVTREQGSF+WF+G+M+EVAE D +GVIE+HNYCTSVYEEGDARSALI ML
Sbjct  794   FRTRRAYFYWVTREQGSFEWFRGVMDEVAETDRKGVIELHNYCTSVYEEGDARSALIAML  853

Query  750   QSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQL  571
             QSL+HAK+GVD+VSGTRVK+HFA+PNWRNVYKRIALNH + +VGVFYCGAP LT ELR+L
Sbjct  854   QSLNHAKHGVDVVSGTRVKTHFARPNWRNVYKRIALNHQNQRVGVFYCGAPVLTKELREL  913

Query  570   ALDFSRKTSTKFDFHKENF  514
             A DFSRKT+TKF+FHKENF
Sbjct  914   AQDFSRKTNTKFEFHKENF  932



>ref|NP_001157759.1| LOC100136880 isoform 1 [Zea mays]
 gb|ACJ05393.1| respiratory burst oxidase protein D variant alpha [Zea mays]
Length=932

 Score =   316 bits (810),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 174/199 (87%), Gaps = 4/199 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaad----eeeggvenggaATKN  931
             YGAPAQDYK+YD+VLLVGLGIGATPMISI+KDI+NNM   D     E     +  ++  +
Sbjct  734   YGAPAQDYKQYDIVLLVGLGIGATPMISIIKDIINNMRQLDGGGDLEASDASSSSSSMAS  793

Query  930   FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITML  751
             FRT++AYFYWVTREQGSF+WF+G+M+EVAE D +GVIE+HNYCTSVYEEGDARSALI ML
Sbjct  794   FRTRRAYFYWVTREQGSFEWFRGVMDEVAETDRKGVIELHNYCTSVYEEGDARSALIAML  853

Query  750   QSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQL  571
             QSL+HAK+GVD+VSGTRVK+HFA+PNWRNVYKRIALNH + +VGVFYCGAP LT ELR+L
Sbjct  854   QSLNHAKHGVDVVSGTRVKTHFARPNWRNVYKRIALNHQNQRVGVFYCGAPVLTKELREL  913

Query  570   ALDFSRKTSTKFDFHKENF  514
             A DFSRKT+TKF+FHKENF
Sbjct  914   AQDFSRKTNTKFEFHKENF  932



>ref|XP_010445756.1| PREDICTED: respiratory burst oxidase homolog protein D-like, 
partial [Camelina sativa]
Length=701

 Score =   311 bits (797),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 169/198 (85%), Gaps = 3/198 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaa---deeeggvenggaATKNF  928
             YGAPAQDYKKYDVVLLVGLGIGATPMISI+KDI+NNM +     + E    N    +K F
Sbjct  504   YGAPAQDYKKYDVVLLVGLGIGATPMISILKDIINNMKSPDRDSDIENNNSNNNNNSKGF  563

Query  927   RTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQ  748
             +T+KAYFYWVTREQGSF+WFKGIM+EV+E+D+ G+IE+HNYCTSVYEEGDAR ALI MLQ
Sbjct  564   KTRKAYFYWVTREQGSFEWFKGIMDEVSELDDEGIIELHNYCTSVYEEGDARVALIAMLQ  623

Query  747   SLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLA  568
             SL HAKNGVD+VSGTRVKSHFAKPNWR VYK++A++H   ++GVFYCG P +  EL+ LA
Sbjct  624   SLQHAKNGVDVVSGTRVKSHFAKPNWRQVYKKVAVHHPGKRIGVFYCGMPGMVKELKNLA  683

Query  567   LDFSRKTSTKFDFHKENF  514
             LDFSRKT+TKFDFHKENF
Sbjct  684   LDFSRKTTTKFDFHKENF  701



>ref|XP_008807834.1| PREDICTED: respiratory burst oxidase homolog protein C-like isoform 
X2 [Phoenix dactylifera]
Length=921

 Score =   316 bits (809),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/209 (72%), Positives = 169/209 (81%), Gaps = 14/209 (7%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggven-----------  952
             YGAPAQDYKKYDVVLLVGLGIGATP ISI+KDIVNNM   + E                 
Sbjct  713   YGAPAQDYKKYDVVLLVGLGIGATPFISILKDIVNNMKQLESEGLLDSEGDRDLEGAGGS  772

Query  951   ---ggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEG  781
                    +  F T++AYFYWVTREQGSF+WF+G+MNEVAE D +G+IE+H YCTSVYEEG
Sbjct  773   SHRPSGTSSTFNTRRAYFYWVTREQGSFEWFRGVMNEVAETDKKGMIELHTYCTSVYEEG  832

Query  780   DARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGA  601
             DARSALITMLQSL+HAK+GVD+VSGTRVKSHFA+PNWRNVYKRIALNH D ++GVFYCGA
Sbjct  833   DARSALITMLQSLNHAKHGVDVVSGTRVKSHFARPNWRNVYKRIALNHRDQRIGVFYCGA  892

Query  600   PALTTELRQLALDFSRKTSTKFDFHKENF  514
             P LT +LRQLA DFSRKT+TKFDFHKENF
Sbjct  893   PTLTKQLRQLAQDFSRKTTTKFDFHKENF  921



>gb|KDO56233.1| hypothetical protein CISIN_1g002711mg [Citrus sinensis]
Length=889

 Score =   315 bits (807),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 173/200 (87%), Gaps = 5/200 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKN----  931
             YGAPAQDYK YDV+LLVGLGIGATP+ISI+KD++NN+    E E G+   G ATKN    
Sbjct  690   YGAPAQDYKDYDVLLLVGLGIGATPLISIIKDVLNNIKQQKEIEEGITEDGGATKNSKKK  749

Query  930   -FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITM  754
              F TK+AYFYWVTREQGSF+WF+G+MNEVAE D  GVIE+HNYCTSVYEEGDARSALITM
Sbjct  750   PFATKRAYFYWVTREQGSFEWFRGVMNEVAEYDQDGVIELHNYCTSVYEEGDARSALITM  809

Query  753   LQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQ  574
             LQS+HHAKNG+DIVSGTRVK+HFA+PNWR V+K +A+ HTD +VGVFYCGAP LT ELR+
Sbjct  810   LQSIHHAKNGLDIVSGTRVKTHFARPNWRTVFKHVAVKHTDERVGVFYCGAPGLTGELRR  869

Query  573   LALDFSRKTSTKFDFHKENF  514
             L+ DFSRKT+TKFDFHKENF
Sbjct  870   LSQDFSRKTTTKFDFHKENF  889



>ref|XP_006433403.1| hypothetical protein CICLE_v10000227mg [Citrus clementina]
 ref|XP_006472080.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Citrus 
sinensis]
 gb|ESR46643.1| hypothetical protein CICLE_v10000227mg [Citrus clementina]
Length=889

 Score =   315 bits (807),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 173/200 (87%), Gaps = 5/200 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKN----  931
             YGAPAQDYK YDV+LLVGLGIGATP+ISI+KD++NN+    E E G+   G ATKN    
Sbjct  690   YGAPAQDYKDYDVLLLVGLGIGATPLISIIKDVLNNIKQQKEIEEGITEDGGATKNSKKK  749

Query  930   -FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITM  754
              F TK+AYFYWVTREQGSF+WF+G+MNEVAE D  GVIE+HNYCTSVYEEGDARSALITM
Sbjct  750   PFATKRAYFYWVTREQGSFEWFRGVMNEVAEYDQDGVIELHNYCTSVYEEGDARSALITM  809

Query  753   LQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQ  574
             LQS+HHAKNG+DIVSGTRVK+HFA+PNWR V+K +A+ HTD +VGVFYCGAP LT ELR+
Sbjct  810   LQSIHHAKNGLDIVSGTRVKTHFARPNWRTVFKHVAVKHTDERVGVFYCGAPGLTGELRR  869

Query  573   LALDFSRKTSTKFDFHKENF  514
             L+ DFSRKT+TKFDFHKENF
Sbjct  870   LSQDFSRKTTTKFDFHKENF  889



>ref|XP_010442839.1| PREDICTED: respiratory burst oxidase homolog protein C isoform 
X1 [Camelina sativa]
Length=913

 Score =   315 bits (808),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 171/201 (85%), Gaps = 6/201 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeg------gvenggaAT  937
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIVNN+ A ++ +         E      
Sbjct  713   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNIKAKEQAQLNRMENGTSEPQRNKK  772

Query  936   KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALIT  757
             ++FRT++AYFYWVTREQGSFDWFK IMNEVAE D   VIE+HNYCTSVYEEGDARSALI 
Sbjct  773   ESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDTNRVIELHNYCTSVYEEGDARSALIH  832

Query  756   MLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELR  577
             MLQSL+HAKNGVDIVSGTRV SHFAKPNWRNVYKRIA++H ++KVGVFYCGAPALT ELR
Sbjct  833   MLQSLNHAKNGVDIVSGTRVMSHFAKPNWRNVYKRIAMDHPNTKVGVFYCGAPALTKELR  892

Query  576   QLALDFSRKTSTKFDFHKENF  514
              LALDF+ KTST+F FHKENF
Sbjct  893   HLALDFTHKTSTRFSFHKENF  913



>ref|XP_009132634.1| PREDICTED: respiratory burst oxidase homolog protein C [Brassica 
rapa]
Length=910

 Score =   315 bits (808),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 170/202 (84%), Gaps = 7/202 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeee-------ggvenggaA  940
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIVNN+ A ++ E                
Sbjct  709   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNIRAKEQAELNRMEHGTSEPQQRNK  768

Query  939   TKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALI  760
              ++FRT++AYFYWVTREQGSFDWFK IMNEVAE D   +IE+HNYCTSVYEEGDARSALI
Sbjct  769   KESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDTNRIIELHNYCTSVYEEGDARSALI  828

Query  759   TMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTEL  580
              MLQSL+HAKNGVDIVSGTRV SHFAKPNWRNVYKRIA++H ++KVGVFYCGAPALT EL
Sbjct  829   HMLQSLNHAKNGVDIVSGTRVMSHFAKPNWRNVYKRIAMDHPNTKVGVFYCGAPALTKEL  888

Query  579   RQLALDFSRKTSTKFDFHKENF  514
             R LALDF+ KTST+F FHKENF
Sbjct  889   RHLALDFTHKTSTRFSFHKENF  910



>emb|CDY38845.1| BnaA03g13340D [Brassica napus]
Length=910

 Score =   315 bits (808),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 170/202 (84%), Gaps = 7/202 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeee-------ggvenggaA  940
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIVNN+ A ++ E                
Sbjct  709   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNIRAKEQAELNRMEHGTSEPQQRNK  768

Query  939   TKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALI  760
              ++FRT++AYFYWVTREQGSFDWFK IMNEVAE D   +IE+HNYCTSVYEEGDARSALI
Sbjct  769   KESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDTNRIIELHNYCTSVYEEGDARSALI  828

Query  759   TMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTEL  580
              MLQSL+HAKNGVDIVSGTRV SHFAKPNWRNVYKRIA++H ++KVGVFYCGAPALT EL
Sbjct  829   HMLQSLNHAKNGVDIVSGTRVMSHFAKPNWRNVYKRIAMDHPNTKVGVFYCGAPALTKEL  888

Query  579   RQLALDFSRKTSTKFDFHKENF  514
             R LALDF+ KTST+F FHKENF
Sbjct  889   RHLALDFTHKTSTRFSFHKENF  910



>ref|XP_010482435.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Camelina 
sativa]
Length=913

 Score =   315 bits (808),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 171/201 (85%), Gaps = 6/201 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeg------gvenggaAT  937
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIVNN+ A ++ +         E      
Sbjct  713   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNIKAKEQAQLNRMENGTSEPQRNKK  772

Query  936   KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALIT  757
             ++FRT++AYFYWVTREQGSFDWFK IMNEVAE D   VIE+HNYCTSVYEEGDARSALI 
Sbjct  773   ESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDTNRVIELHNYCTSVYEEGDARSALIH  832

Query  756   MLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELR  577
             MLQSL+HAKNGVDIVSGTRV SHFAKPNWRNVYKRIA++H ++KVGVFYCGAPALT ELR
Sbjct  833   MLQSLNHAKNGVDIVSGTRVMSHFAKPNWRNVYKRIAMDHPNTKVGVFYCGAPALTKELR  892

Query  576   QLALDFSRKTSTKFDFHKENF  514
              LALDF+ KTST+F FHKENF
Sbjct  893   HLALDFTHKTSTRFSFHKENF  913



>ref|XP_010442586.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Camelina 
sativa]
Length=913

 Score =   315 bits (808),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 171/201 (85%), Gaps = 6/201 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeg------gvenggaAT  937
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIVNN+ A ++ +         E      
Sbjct  713   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNIKAKEQAQLNRMENGTSEPQRNKK  772

Query  936   KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALIT  757
             ++FRT++AYFYWVTREQGSFDWFK IMNEVAE D   VIE+HNYCTSVYEEGDARSALI 
Sbjct  773   ESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDTNRVIELHNYCTSVYEEGDARSALIH  832

Query  756   MLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELR  577
             MLQSL+HAKNGVDIVSGTRV SHFAKPNWRNVYKRIA++H ++KVGVFYCGAPALT ELR
Sbjct  833   MLQSLNHAKNGVDIVSGTRVMSHFAKPNWRNVYKRIAMDHPNTKVGVFYCGAPALTKELR  892

Query  576   QLALDFSRKTSTKFDFHKENF  514
              LALDF+ KTST+F FHKENF
Sbjct  893   HLALDFTHKTSTRFSFHKENF  913



>gb|AEP25514.1| putative respiratory burst oxidase-like protein B, partial [Vicia 
faba]
Length=375

 Score =   301 bits (770),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/199 (72%), Positives = 165/199 (83%), Gaps = 4/199 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKN----  931
             YGAPAQDYK Y+V+LLVGLGIGATP+ISI+KD++NN+   +E+    E       N    
Sbjct  177   YGAPAQDYKNYEVLLLVGLGIGATPLISILKDVLNNIKQQEEDLEEGEVESGVKSNKKKP  236

Query  930   FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITML  751
             F TK+AYFYWVTREQGSF+WFKG+MNE+AE D  GVIE+HNYCTSVYEEGDARSALITML
Sbjct  237   FATKRAYFYWVTREQGSFEWFKGVMNEIAENDKEGVIELHNYCTSVYEEGDARSALITML  296

Query  750   QSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQL  571
             QSLHHAK+GVD+VS TRVK+HFA+PNWRNVYK +AL H D +VGVFYCGA  L  ELR+ 
Sbjct  297   QSLHHAKSGVDVVSETRVKTHFARPNWRNVYKHVALKHPDKRVGVFYCGAHGLVGELRKF  356

Query  570   ALDFSRKTSTKFDFHKENF  514
             +LDFSRKT TKFDFHKENF
Sbjct  357   SLDFSRKTDTKFDFHKENF  375



>emb|CDY32647.1| BnaC03g16150D [Brassica napus]
Length=910

 Score =   315 bits (807),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 170/202 (84%), Gaps = 7/202 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeee-------ggvenggaA  940
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIVNN+ A ++ E                
Sbjct  709   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNIRAKEQAELNRMEHGTSEPQQRNK  768

Query  939   TKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALI  760
              ++FRT++AYFYWVTREQGSFDWFK IMNEVAE D   +IE+HNYCTSVYEEGDARSALI
Sbjct  769   KESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDTNRIIELHNYCTSVYEEGDARSALI  828

Query  759   TMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTEL  580
              MLQSL+HAKNGVDIVSGTRV SHFAKPNWRNVYKRIA++H ++KVGVFYCGAPALT EL
Sbjct  829   HMLQSLNHAKNGVDIVSGTRVMSHFAKPNWRNVYKRIAMDHPNTKVGVFYCGAPALTKEL  888

Query  579   RQLALDFSRKTSTKFDFHKENF  514
             R LALDF+ KTST+F FHKENF
Sbjct  889   RHLALDFTHKTSTRFSFHKENF  910



>ref|XP_007038195.1| NADPH/respiratory burst oxidase protein D [Theobroma cacao]
 gb|EOY22696.1| NADPH/respiratory burst oxidase protein D [Theobroma cacao]
Length=910

 Score =   315 bits (807),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 174/207 (84%), Gaps = 12/207 (6%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeegg------------ve  955
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIVNN+ A +EEE                
Sbjct  704   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNIRAREEEESALENGNADGVNKTSP  763

Query  954   nggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDA  775
                   ++F+T++AYFYWVTREQGSFDWFKGIMNEVAEMD+  VIE+HNYCTSVYEEGDA
Sbjct  764   PNSKRKESFKTRRAYFYWVTREQGSFDWFKGIMNEVAEMDHNHVIELHNYCTSVYEEGDA  823

Query  774   RSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPA  595
             RSALI MLQSL+HAKNGVD+VSGTRVKSHFAKPNWR+VYK+IA+NH +++VGVFYCG PA
Sbjct  824   RSALIAMLQSLNHAKNGVDVVSGTRVKSHFAKPNWRSVYKQIAVNHNNTRVGVFYCGPPA  883

Query  594   LTTELRQLALDFSRKTSTKFDFHKENF  514
             LT EL QLA DFS +TSTKFDFHKENF
Sbjct  884   LTKELGQLASDFSHRTSTKFDFHKENF  910



>ref|XP_010536571.1| PREDICTED: respiratory burst oxidase homolog protein C [Tarenaya 
hassleriana]
Length=911

 Score =   315 bits (806),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 174/201 (87%), Gaps = 6/201 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT------  937
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIVNN+ A ++ +      G+ +      
Sbjct  711   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNIKAKEQADLNGLESGSHSNGRGKK  770

Query  936   KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALIT  757
             ++FRT++AYFYWVTREQGSFDWFK IMNEVAE DN  VIE+HNYCTSVYEEGDARSALI 
Sbjct  771   ESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDNNNVIELHNYCTSVYEEGDARSALIA  830

Query  756   MLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELR  577
             MLQSL+HAKNGVDIVSGTRV SHFAKPNWR+VYKRIA+++ ++KVGVFYCG+PALT ELR
Sbjct  831   MLQSLNHAKNGVDIVSGTRVMSHFAKPNWRSVYKRIAMDYPNTKVGVFYCGSPALTKELR  890

Query  576   QLALDFSRKTSTKFDFHKENF  514
              LALDF+ KTSTKF FHKENF
Sbjct  891   HLALDFTHKTSTKFSFHKENF  911



>ref|XP_006279397.1| hypothetical protein CARUB_v10007974mg [Capsella rubella]
 gb|EOA12295.1| hypothetical protein CARUB_v10007974mg [Capsella rubella]
Length=921

 Score =   315 bits (807),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 168/196 (86%), Gaps = 1/196 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM-TaadeeeggvenggaATKNFRT  922
             YGAPAQDYKKYDVVLLVGLGIGATPMISI+KDI+NNM +   + +    N  + +K F+T
Sbjct  726   YGAPAQDYKKYDVVLLVGLGIGATPMISILKDIINNMKSPDRDTDIENNNTNSNSKGFKT  785

Query  921   KKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSL  742
             +KAYFYWVTREQGSF+WFKGIM+EVAE+D  G+IE+HNYCTSVYEEGDAR ALI MLQSL
Sbjct  786   RKAYFYWVTREQGSFEWFKGIMDEVAELDEEGIIELHNYCTSVYEEGDARVALIAMLQSL  845

Query  741   HHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALD  562
              HAKNGVD+VSGTRVKSHFAKPNWR VYK+IA+ H   ++GVFYCG P +  EL+ LALD
Sbjct  846   QHAKNGVDVVSGTRVKSHFAKPNWRQVYKKIAVQHPGKRIGVFYCGIPGMIKELKNLALD  905

Query  561   FSRKTSTKFDFHKENF  514
             FSRKT+TKFDFHKENF
Sbjct  906   FSRKTTTKFDFHKENF  921



>ref|XP_011073263.1| PREDICTED: LOW QUALITY PROTEIN: respiratory burst oxidase homolog 
protein C-like [Sesamum indicum]
Length=918

 Score =   315 bits (806),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 168/214 (79%), Gaps = 19/214 (9%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM-------------------Taad  976
             YGAP QDYK YDVVLLVGLGIGATPMIS+VKDIVNN+                    +  
Sbjct  705   YGAPTQDYKDYDVVLLVGLGIGATPMISVVKDIVNNIKEMEEDENALEDGTTPPHNPSPL  764

Query  975   eeeggvenggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTS  796
                       +   NF+T++AYFYWVTREQGSFDWFKG+MNEVAE D++GVIEMHNYCTS
Sbjct  765   TTPRRKSGSASGRHNFKTRRAYFYWVTREQGSFDWFKGVMNEVAETDHKGVIEMHNYCTS  824

Query  795   VYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGV  616
             VYEEGDARSALITMLQSL+HAKNGVDIVSGTRVKSHFAKPNWR VYKRIALNH +++VGV
Sbjct  825   VYEEGDARSALITMLQSLNHAKNGVDIVSGTRVKSHFAKPNWRTVYKRIALNHPNARVGV  884

Query  615   FYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             FYCGAP    EL+QLA DFS KTSTKF+FHKENF
Sbjct  885   FYCGAPPPVKELKQLASDFSHKTSTKFEFHKENF  918



>gb|KHN16903.1| Respiratory burst oxidase like protein C [Glycine soja]
Length=816

 Score =   312 bits (800),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 173/195 (89%), Gaps = 4/195 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDY++Y+VVLLVGLGIGATPMISI+KD+VNN  A DEEEGG E       +F+T+
Sbjct  626   YGAPAQDYREYEVVLLVGLGIGATPMISILKDMVNNFKANDEEEGGQER----VSDFKTR  681

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             +AYFYWVTREQGSFDWFKG+MNEVAE D R VIE+H+YCTSVYEEGDARSALI MLQSL+
Sbjct  682   RAYFYWVTREQGSFDWFKGVMNEVAEEDRRKVIELHSYCTSVYEEGDARSALIAMLQSLN  741

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             HAKNGVDIVSGTRV SHFAKPNWR+VYKRIALNH D++VGVFYCG  ALT ELRQLALDF
Sbjct  742   HAKNGVDIVSGTRVMSHFAKPNWRSVYKRIALNHPDARVGVFYCGPSALTHELRQLALDF  801

Query  558   SRKTSTKFDFHKENF  514
             S  TSTK+DFHKENF
Sbjct  802   SHNTSTKYDFHKENF  816



>gb|KFK36751.1| hypothetical protein AALP_AA4G165200 [Arabis alpina]
Length=900

 Score =   314 bits (805),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 154/202 (76%), Positives = 171/202 (85%), Gaps = 7/202 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeee-------ggvenggaA  940
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIVNN+ A ++ E         V      
Sbjct  699   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNLRAKEQAELNRMEHGTSVPQPRNK  758

Query  939   TKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALI  760
              ++FRT++AYFYWVTREQGSFDWFK IMNEVAE D   VI++HNYCTSVYEEGDARSALI
Sbjct  759   KESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDTNRVIDLHNYCTSVYEEGDARSALI  818

Query  759   TMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTEL  580
              MLQSL+HAKNGVDIVSGTRV SHFAKPNWRNVYKRIA++H ++KVGVFYCGAPALT EL
Sbjct  819   HMLQSLNHAKNGVDIVSGTRVMSHFAKPNWRNVYKRIAMDHPNTKVGVFYCGAPALTKEL  878

Query  579   RQLALDFSRKTSTKFDFHKENF  514
             R LALDF+ KTST+F FHKENF
Sbjct  879   RHLALDFTHKTSTRFSFHKENF  900



>ref|XP_006402027.1| hypothetical protein EUTSA_v10012613mg [Eutrema salsugineum]
 gb|ESQ43480.1| hypothetical protein EUTSA_v10012613mg [Eutrema salsugineum]
Length=913

 Score =   314 bits (805),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 170/202 (84%), Gaps = 7/202 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeee-------ggvenggaA  940
             YGAPAQDYKK++VVLLVGLGIGATPMISIVKDIVNN+ A ++ +                
Sbjct  712   YGAPAQDYKKFEVVLLVGLGIGATPMISIVKDIVNNIRAKEQAQLNRMEHGTSAPQQKNK  771

Query  939   TKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALI  760
              ++FRT++AYFYWVTREQGSFDWFK IMNEVAE D   VIE+HNYCTSVYEEGDARSALI
Sbjct  772   KESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDTNRVIELHNYCTSVYEEGDARSALI  831

Query  759   TMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTEL  580
              MLQSL+HAKNGVDIVSGTRV SHFAKPNWRNVYKRIA++H ++KVGVFYCGAPALT EL
Sbjct  832   HMLQSLNHAKNGVDIVSGTRVMSHFAKPNWRNVYKRIAMDHPNTKVGVFYCGAPALTKEL  891

Query  579   RQLALDFSRKTSTKFDFHKENF  514
             R LALDF+ KTST+F FHKENF
Sbjct  892   RHLALDFTHKTSTRFSFHKENF  913



>ref|XP_002299364.2| hypothetical protein POPTR_0001s12650g [Populus trichocarpa]
 gb|EEE84169.2| hypothetical protein POPTR_0001s12650g [Populus trichocarpa]
Length=926

 Score =   315 bits (806),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 172/209 (82%), Gaps = 14/209 (7%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTa--------------adeeegg  961
             +GAPAQ+YKKYDVVLLVGLGIGATPM+SIVKDI+NN                        
Sbjct  718   FGAPAQEYKKYDVVLLVGLGIGATPMVSIVKDIINNKKLKDKDGEDNGALEGLESGRGPP  777

Query  960   venggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEG  781
              +N  + +++F+T+KAYFYWVTREQGSF+WFK IMNEVAEMD++ VIEMHNYCTSVYEEG
Sbjct  778   NKNKISTSRSFKTRKAYFYWVTREQGSFEWFKEIMNEVAEMDDKQVIEMHNYCTSVYEEG  837

Query  780   DARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGA  601
             DARSALI MLQSL+HAKNGVD+VSGTRVKSHFAKP WR VYK+IAL H D+++GVFYCGA
Sbjct  838   DARSALIAMLQSLNHAKNGVDVVSGTRVKSHFAKPIWRQVYKKIALRHPDARIGVFYCGA  897

Query  600   PALTTELRQLALDFSRKTSTKFDFHKENF  514
             PALT ELRQLALDFS KTST+FDFHKENF
Sbjct  898   PALTKELRQLALDFSHKTSTEFDFHKENF  926



>ref|XP_010259644.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Nelumbo 
nucifera]
 ref|XP_010259645.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Nelumbo 
nucifera]
Length=890

 Score =   314 bits (804),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 172/198 (87%), Gaps = 3/198 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaa---deeeggvenggaATKNF  928
             YGAPAQDYK+YDV+LLVGLGIGATP+ISIVKD++NN+      +E    V +     K F
Sbjct  693   YGAPAQDYKEYDVLLLVGLGIGATPLISIVKDVLNNIKQQNDVEEGAVEVGSKDNKKKPF  752

Query  927   RTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQ  748
              TK+AYFYWVTREQGSF+WF+G++NEVAE D  GVIE+HNYCTSVYEEGDARSALITMLQ
Sbjct  753   ATKRAYFYWVTREQGSFEWFRGVLNEVAEYDRDGVIELHNYCTSVYEEGDARSALITMLQ  812

Query  747   SLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLA  568
             SLHHAK+GVDIVSGT+VK+HFA+PNWRNV+K +A+NHTD +VGVFYCGAP LT ELR+LA
Sbjct  813   SLHHAKSGVDIVSGTQVKTHFARPNWRNVFKHVAVNHTDQRVGVFYCGAPGLTGELRRLA  872

Query  567   LDFSRKTSTKFDFHKENF  514
              DFSRKT+T+FDFHKENF
Sbjct  873   QDFSRKTTTRFDFHKENF  890



>gb|KJB19751.1| hypothetical protein B456_003G117900 [Gossypium raimondii]
Length=919

 Score =   314 bits (804),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 174/214 (81%), Gaps = 19/214 (9%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT------  937
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIV+N+ +  E+E    +           
Sbjct  706   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVHNIRSMAEDEDEELSSALENGVAINN  765

Query  936   -------------KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTS  796
                          +NF+TK+AYFYWVTREQGSFDWFKGIMNEVAEMD+  VIE+HNYCTS
Sbjct  766   KTSSRSPPNPKTRENFKTKRAYFYWVTREQGSFDWFKGIMNEVAEMDHDHVIELHNYCTS  825

Query  795   VYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGV  616
             VYEEGDARSALITMLQSL+HAKNGVD+VSGTRVKSHFAKPNWR+VYK IA+NH +++VGV
Sbjct  826   VYEEGDARSALITMLQSLNHAKNGVDVVSGTRVKSHFAKPNWRSVYKHIAVNHNNARVGV  885

Query  615   FYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             FYCGAPALT  L QLA DFS KTSTKFDFHKENF
Sbjct  886   FYCGAPALTKVLSQLASDFSHKTSTKFDFHKENF  919



>ref|XP_006437008.1| hypothetical protein CICLE_v10030649mg [Citrus clementina]
 gb|ESR50248.1| hypothetical protein CICLE_v10030649mg [Citrus clementina]
Length=929

 Score =   314 bits (804),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 163/218 (75%), Positives = 176/218 (81%), Gaps = 23/218 (11%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT------  937
             YGAPAQDYK+Y+VVLLVGLGIGATPMISIVKDIVNNM A +EEE      G  T      
Sbjct  712   YGAPAQDYKEYEVVLLVGLGIGATPMISIVKDIVNNMKAIEEEEENDLENGRDTGVNTTS  771

Query  936   -----------------KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHN  808
                                FRT++AYFYWVTREQGSFDWFKG+MNEVAE+D+  VIE+HN
Sbjct  772   SSSTTTTSPSSSGHRRRDQFRTRRAYFYWVTREQGSFDWFKGVMNEVAELDHNNVIELHN  831

Query  807   YCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDS  628
             YCTSVYEEGDARSALI MLQSL+HAKNGVD+VSGTRVKSHFAKPNWRNVYKR+ALNH DS
Sbjct  832   YCTSVYEEGDARSALIAMLQSLNHAKNGVDVVSGTRVKSHFAKPNWRNVYKRVALNHPDS  891

Query  627   KVGVFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             +VGVFYCGAPALT ELR LALDFS KTSTKFDFHKENF
Sbjct  892   RVGVFYCGAPALTKELRHLALDFSHKTSTKFDFHKENF  929



>gb|AAS15724.1| respiratory burst oxidase protein C [Arabidopsis thaliana]
Length=905

 Score =   313 bits (803),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 171/201 (85%), Gaps = 6/201 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeg------gvenggaAT  937
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIVNN+ A ++ +         E   +  
Sbjct  705   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNIKAKEQAQLNRMENGTSEPQRSKK  764

Query  936   KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALIT  757
             ++FRT++AYFYWVTREQGSFDWFK IMNEVAE D   VIEMHNYCTSVYEEGDARSALI 
Sbjct  765   ESFRTRRAYFYWVTREQGSFDWFKNIMNEVAERDANRVIEMHNYCTSVYEEGDARSALIH  824

Query  756   MLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELR  577
             MLQSL+HAKNGVDIVSGTRV SHFAKPNWRNVYKRIA++H ++KV VFYCGAPALT ELR
Sbjct  825   MLQSLNHAKNGVDIVSGTRVMSHFAKPNWRNVYKRIAMDHPNTKVRVFYCGAPALTKELR  884

Query  576   QLALDFSRKTSTKFDFHKENF  514
              LALDF+ KTST+F FHKENF
Sbjct  885   HLALDFTHKTSTRFSFHKENF  905



>ref|XP_006485050.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Citrus 
sinensis]
Length=929

 Score =   314 bits (804),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 163/218 (75%), Positives = 176/218 (81%), Gaps = 23/218 (11%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT------  937
             YGAPAQDYK+Y+VVLLVGLGIGATPMISIVKDIVNNM A +EEE      G  T      
Sbjct  712   YGAPAQDYKEYEVVLLVGLGIGATPMISIVKDIVNNMKAIEEEEENDLENGRDTGVNTTS  771

Query  936   -----------------KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHN  808
                                FRT++AYFYWVTREQGSFDWFKG+MNEVAE+D+  VIE+HN
Sbjct  772   SSSTTTTSPSSSGHRRRDQFRTRRAYFYWVTREQGSFDWFKGVMNEVAELDHNNVIELHN  831

Query  807   YCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDS  628
             YCTSVYEEGDARSALI MLQSL+HAKNGVD+VSGTRVKSHFAKPNWRNVYKR+ALNH DS
Sbjct  832   YCTSVYEEGDARSALIAMLQSLNHAKNGVDVVSGTRVKSHFAKPNWRNVYKRVALNHPDS  891

Query  627   KVGVFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             +VGVFYCGAPALT ELR LALDFS KTSTKFDFHKENF
Sbjct  892   RVGVFYCGAPALTKELRHLALDFSHKTSTKFDFHKENF  929



>ref|XP_009353482.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Pyrus 
x bretschneideri]
Length=962

 Score =   314 bits (805),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 173/215 (80%), Gaps = 20/215 (9%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaA-------  940
             YGAPAQDYKKYDVVLLVGLGIGATPM+SIVKDI+NNM    +E+   E+   +       
Sbjct  748   YGAPAQDYKKYDVVLLVGLGIGATPMVSIVKDIINNMKMKSKEDDDSESALESGRATPNA  807

Query  939   -------------TKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCT  799
                           K F+T+KAY+YWVTREQGSF+WFKGI+NEVA+MD +GVIEMHNYCT
Sbjct  808   SSHDNSDSGKNKSNKGFKTRKAYYYWVTREQGSFEWFKGILNEVADMDEKGVIEMHNYCT  867

Query  798   SVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVG  619
             SVYEEGDARSALI MLQSLHHAKNGVD+VSGTRVKSHFAKPNWR VYK IA +H  S+VG
Sbjct  868   SVYEEGDARSALIAMLQSLHHAKNGVDVVSGTRVKSHFAKPNWRQVYKDIARHHPGSRVG  927

Query  618   VFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             VFYCGAPALT  L++LALDFS KT+TKF+FHKENF
Sbjct  928   VFYCGAPALTKGLKELALDFSHKTTTKFEFHKENF  962



>ref|XP_003532261.1| PREDICTED: respiratory burst oxidase homolog protein C-like isoform 
1 [Glycine max]
Length=888

 Score =   312 bits (800),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 156/195 (80%), Positives = 173/195 (89%), Gaps = 4/195 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDY++Y+VVLLVGLGIGATPMISI+KD+VNN  A DEEEGG E       +F+T+
Sbjct  698   YGAPAQDYREYEVVLLVGLGIGATPMISILKDMVNNFKANDEEEGGQER----VSDFKTR  753

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             +AYFYWVTREQGSFDWFKG+MNEVAE D R VIE+H+YCTSVYEEGDARSALI MLQSL+
Sbjct  754   RAYFYWVTREQGSFDWFKGVMNEVAEEDRRKVIELHSYCTSVYEEGDARSALIAMLQSLN  813

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             HAKNGVDIVSGTRV SHFAKPNWR+VYKRIALNH D++VGVFYCG  ALT ELRQLALDF
Sbjct  814   HAKNGVDIVSGTRVMSHFAKPNWRSVYKRIALNHPDARVGVFYCGPSALTHELRQLALDF  873

Query  558   SRKTSTKFDFHKENF  514
             S  TSTK+DFHKENF
Sbjct  874   SHNTSTKYDFHKENF  888



>ref|XP_007225362.1| hypothetical protein PRUPE_ppa000883mg [Prunus persica]
 gb|EMJ26561.1| hypothetical protein PRUPE_ppa000883mg [Prunus persica]
Length=971

 Score =   313 bits (803),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 150/217 (69%), Positives = 169/217 (78%), Gaps = 22/217 (10%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaa--------------------  979
             YGAPAQDYKKYDVVLLVGLGIGATPM+SIVKDI+NNM                       
Sbjct  755   YGAPAQDYKKYDVVLLVGLGIGATPMVSIVKDIINNMKMKGKEDDDSILESSLEMGRVSG  814

Query  978   --deeeggvenggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNY  805
                           + K F+T+KAY+YWVTREQGSF+WFKGI+NEVA+MD +GVIE+HNY
Sbjct  815   NPSTPNHSSSGKNKSNKGFKTRKAYYYWVTREQGSFEWFKGILNEVADMDEKGVIEIHNY  874

Query  804   CTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSK  625
             CTSVYEEGDARSALI MLQSLHHAKNGVD+VSGTRVKSHFAKPNWR VYK IA +H DS+
Sbjct  875   CTSVYEEGDARSALIAMLQSLHHAKNGVDVVSGTRVKSHFAKPNWRQVYKDIARHHPDSR  934

Query  624   VGVFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             VGVFYCGAPALT +L++LAL FS KT+TKF+FHKENF
Sbjct  935   VGVFYCGAPALTKDLKELALHFSHKTTTKFEFHKENF  971



>gb|EYU24549.1| hypothetical protein MIMGU_mgv1a001003mg [Erythranthe guttata]
Length=916

 Score =   312 bits (800),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 153/210 (73%), Positives = 173/210 (82%), Gaps = 15/210 (7%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadee---------------eg  964
             YGAP QDYK YDVVLLVGLGIGATPMIS+VKDIVNNM A DE                + 
Sbjct  707   YGAPTQDYKDYDVVLLVGLGIGATPMISVVKDIVNNMKALDEAGENENAALEGGTHKRKK  766

Query  963   gvenggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEE  784
              V N  +  ++F+T++AYFYWVTREQGSFDWFKG+MNEVAEMD++GVIEMHNYCTSVYEE
Sbjct  767   TVSNSPSDKQDFKTRRAYFYWVTREQGSFDWFKGVMNEVAEMDHKGVIEMHNYCTSVYEE  826

Query  783   GDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCG  604
             GDARSALI MLQS++HAKNGVD+VSGTRVKSHFAKPNWR VYK IA+NH +++VGVFYCG
Sbjct  827   GDARSALIAMLQSINHAKNGVDVVSGTRVKSHFAKPNWREVYKSIAVNHPNARVGVFYCG  886

Query  603   APALTTELRQLALDFSRKTSTKFDFHKENF  514
             AP    ELRQLA DFS KT+TKF+FHKENF
Sbjct  887   APPPVRELRQLASDFSHKTTTKFEFHKENF  916



>ref|XP_008222292.1| PREDICTED: respiratory burst oxidase homolog protein D [Prunus 
mume]
Length=971

 Score =   313 bits (802),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 151/217 (70%), Positives = 170/217 (78%), Gaps = 22/217 (10%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTa---------------------  982
             YGAPAQDYKKYDVVLLVGLGIGATPM+SIVKDI+NNM                       
Sbjct  755   YGAPAQDYKKYDVVLLVGLGIGATPMVSIVKDIINNMKMKGKDDDDSILESSLEMGRVSG  814

Query  981   -adeeeggvenggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNY  805
              +     G      + K F+T+KAY+YWVTREQGSF+WFKGI+NEVA+MD +GVIE+HNY
Sbjct  815   NSSTPNHGSSGKNKSNKGFKTRKAYYYWVTREQGSFEWFKGILNEVADMDEKGVIEIHNY  874

Query  804   CTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSK  625
             CTSVYEEGDARSALI MLQSLHHAKNGVD+VSGTRVKSHFAKPNWR VYK IA  H DS+
Sbjct  875   CTSVYEEGDARSALIAMLQSLHHAKNGVDVVSGTRVKSHFAKPNWRQVYKDIARRHPDSR  934

Query  624   VGVFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             VGVFYCGAPALT +L++LAL FS KT+TKF+FHKENF
Sbjct  935   VGVFYCGAPALTKDLKELALHFSHKTTTKFEFHKENF  971



>ref|XP_010482026.1| PREDICTED: respiratory burst oxidase homolog protein D [Camelina 
sativa]
Length=923

 Score =   312 bits (799),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 169/198 (85%), Gaps = 3/198 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaa---deeeggvenggaATKNF  928
             YGAPAQDYKKYDVVLLVGLGIGATPMISI+KDI+NNM +     + E    N    +K F
Sbjct  726   YGAPAQDYKKYDVVLLVGLGIGATPMISILKDIINNMKSPDRDSDIENNNSNNNNNSKGF  785

Query  927   RTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQ  748
             +T+KAYFYWVTREQGSF+WFKGIM+EV+E+D+ G+IE+HNYCTSVYEEGDAR ALI MLQ
Sbjct  786   KTRKAYFYWVTREQGSFEWFKGIMDEVSELDDEGIIELHNYCTSVYEEGDARVALIAMLQ  845

Query  747   SLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLA  568
             SL HAKNGVD+VSGTRVKSHFAKPNWR VYK++A++H   ++GVFYCG P +  EL+ LA
Sbjct  846   SLQHAKNGVDVVSGTRVKSHFAKPNWRQVYKKVAVHHPGKRIGVFYCGMPGMVKELKNLA  905

Query  567   LDFSRKTSTKFDFHKENF  514
             LDFSRKT+TKFDFHKENF
Sbjct  906   LDFSRKTTTKFDFHKENF  923



>ref|XP_009359839.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Pyrus 
x bretschneideri]
Length=964

 Score =   313 bits (801),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 152/215 (71%), Positives = 172/215 (80%), Gaps = 20/215 (9%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaA-------  940
             YGAPAQDYKKYDVVLLVGLGIGATPM+SIVKDI+NN+     E+   E+   +       
Sbjct  750   YGAPAQDYKKYDVVLLVGLGIGATPMVSIVKDIINNIKMKSREDDDSESALESGRATPNA  809

Query  939   -------------TKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCT  799
                           K F+T+KAY+YWVTREQGSF+WFKGI+NEVA+MD +GVIE+HNYCT
Sbjct  810   SSHNNSSSGKNRSNKGFKTRKAYYYWVTREQGSFEWFKGILNEVADMDEKGVIEIHNYCT  869

Query  798   SVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVG  619
             SVYEEGDARSALI MLQSLHHAKNGVD+VSGTRVKSHFAKPNWR VYK IA  H DS+VG
Sbjct  870   SVYEEGDARSALIAMLQSLHHAKNGVDVVSGTRVKSHFAKPNWRQVYKDIARRHPDSRVG  929

Query  618   VFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             VFYCGAPALT +L++LAL FS KT+TKFDFHKENF
Sbjct  930   VFYCGAPALTKDLKELALYFSHKTTTKFDFHKENF  964



>ref|NP_199602.1| respiratory burst oxidase-D [Arabidopsis thaliana]
 sp|Q9FIJ0.1|RBOHD_ARATH RecName: Full=Respiratory burst oxidase homolog protein D; AltName: 
Full=NADPH oxidase RBOHD; Short=AtRBOHD [Arabidopsis 
thaliana]
 gb|AAL11618.1|AF424625_1 AT5g47910/MCA23_25 [Arabidopsis thaliana]
 dbj|BAB11338.1| respiratory burst oxidase protein [Arabidopsis thaliana]
 gb|AAO11567.1| At5g47910/MCA23_25 [Arabidopsis thaliana]
 gb|AED95593.1| respiratory burst oxidase-D [Arabidopsis thaliana]
Length=921

 Score =   312 bits (799),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 144/196 (73%), Positives = 166/196 (85%), Gaps = 1/196 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMT-aadeeeggvenggaATKNFRT  922
             YGAPAQDYKKYDVVLLVGLGIGATPMISI+KDI+NNM     + +    N    +K F+T
Sbjct  726   YGAPAQDYKKYDVVLLVGLGIGATPMISILKDIINNMKGPDRDSDIENNNSNNNSKGFKT  785

Query  921   KKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSL  742
             +KAYFYWVTREQGSF+WFKGIM+E++E+D  G+IE+HNYCTSVYEEGDAR ALI MLQSL
Sbjct  786   RKAYFYWVTREQGSFEWFKGIMDEISELDEEGIIELHNYCTSVYEEGDARVALIAMLQSL  845

Query  741   HHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALD  562
              HAKNGVD+VSGTRVKSHFAKPNWR VYK+IA+ H   ++GVFYCG P +  EL+ LALD
Sbjct  846   QHAKNGVDVVSGTRVKSHFAKPNWRQVYKKIAVQHPGKRIGVFYCGMPGMIKELKNLALD  905

Query  561   FSRKTSTKFDFHKENF  514
             FSRKT+TKFDFHKENF
Sbjct  906   FSRKTTTKFDFHKENF  921



>ref|XP_008369593.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Malus 
domestica]
Length=965

 Score =   313 bits (801),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 152/215 (71%), Positives = 172/215 (80%), Gaps = 20/215 (9%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaA-------  940
             YGAPAQDYKKYDVVLLVGLGIGATPM+SIVKDI+NN+     E+   E+   +       
Sbjct  751   YGAPAQDYKKYDVVLLVGLGIGATPMVSIVKDIINNIKMKSREDDDSESALESGRATPNA  810

Query  939   -------------TKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCT  799
                           K F+T+KAY+YWVTREQGSF+WFKGI+NEVA+MD +GVIE+HNYCT
Sbjct  811   PSHNNSSSGKNKSNKGFKTRKAYYYWVTREQGSFEWFKGILNEVADMDEKGVIEIHNYCT  870

Query  798   SVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVG  619
             SVYEEGDARSALI MLQSLHHAKNGVD+VSGTRVKSHFAKPNWR VYK IA  H DS+VG
Sbjct  871   SVYEEGDARSALIAMLQSLHHAKNGVDVVSGTRVKSHFAKPNWRQVYKDIARRHPDSRVG  930

Query  618   VFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             VFYCGAPALT +L++LAL FS KT+TKFDFHKENF
Sbjct  931   VFYCGAPALTKDLKELALYFSHKTTTKFDFHKENF  965



>gb|KHN17442.1| Respiratory burst oxidase like protein C [Glycine soja]
Length=898

 Score =   311 bits (798),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 170/196 (87%), Gaps = 1/196 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggv-enggaATKNFRT  922
             YGAPAQDY++Y+VVLLVGLGIGATPMISI+KD+VNN  A DEEEG           +F+T
Sbjct  703   YGAPAQDYREYEVVLLVGLGIGATPMISILKDMVNNFKAIDEEEGIGGAKSPTRLSDFKT  762

Query  921   KKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSL  742
              +AYFYWVTREQGSFDWFKG+MNEVAE D R VIE+H+YCTSVYEEGDARSALI MLQSL
Sbjct  763   SRAYFYWVTREQGSFDWFKGVMNEVAEEDRRKVIELHSYCTSVYEEGDARSALIAMLQSL  822

Query  741   HHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALD  562
             +HAKNGVDIVSGTRV SHFAKPNWR+VYKRIALNH D++VGVFYCG  ALT ELRQLALD
Sbjct  823   NHAKNGVDIVSGTRVMSHFAKPNWRSVYKRIALNHPDARVGVFYCGPSALTHELRQLALD  882

Query  561   FSRKTSTKFDFHKENF  514
             FS  TSTK+DFHKENF
Sbjct  883   FSHNTSTKYDFHKENF  898



>ref|XP_002268641.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Vitis 
vinifera]
Length=922

 Score =   312 bits (799),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 174/208 (84%), Gaps = 13/208 (6%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT------  937
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDI+NNM A +E++  ++            
Sbjct  715   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIINNMKAKEEDKEDIQIRVETIPDHDNG  774

Query  936   -------KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGD  778
                    + F+TK+AY+YWVTREQGSF+WFKGIMNEVAEMD +GV+E+HNYCTSV+EEGD
Sbjct  775   DRKKKNKRTFKTKRAYYYWVTREQGSFEWFKGIMNEVAEMDEKGVVELHNYCTSVFEEGD  834

Query  777   ARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAP  598
             ARSALITMLQ+L+HAKNGVD+VSGTRVKSHFA+PNWR V K IAL H DS+VGVFYCGAP
Sbjct  835   ARSALITMLQTLYHAKNGVDVVSGTRVKSHFARPNWRQVLKNIALQHPDSRVGVFYCGAP  894

Query  597   ALTTELRQLALDFSRKTSTKFDFHKENF  514
              LT EL++LAL FS KT+TKFDFHKENF
Sbjct  895   GLTKELQKLALYFSHKTTTKFDFHKENF  922



>gb|AAC39479.1| respiratory burst oxidase protein D [Arabidopsis thaliana]
Length=921

 Score =   312 bits (799),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 144/196 (73%), Positives = 166/196 (85%), Gaps = 1/196 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMT-aadeeeggvenggaATKNFRT  922
             YGAPAQDYKKYDVVLLVGLGIGATPMISI+KDI+NNM     + +    N    +K F+T
Sbjct  726   YGAPAQDYKKYDVVLLVGLGIGATPMISILKDIINNMKGPDRDSDIENNNSNNNSKGFKT  785

Query  921   KKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSL  742
             +KAYFYWVTREQGSF+WFKGIM+E++E+D  G+IE+HNYCTSVYEEGDAR ALI MLQSL
Sbjct  786   RKAYFYWVTREQGSFEWFKGIMDEISELDEEGIIELHNYCTSVYEEGDARVALIAMLQSL  845

Query  741   HHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALD  562
              HAKNGVD+VSGTRVKSHFAKPNWR VYK+IA+ H   ++GVFYCG P +  EL+ LALD
Sbjct  846   QHAKNGVDVVSGTRVKSHFAKPNWRQVYKKIAVQHPGKRIGVFYCGMPGMIKELKNLALD  905

Query  561   FSRKTSTKFDFHKENF  514
             FSRKT+TKFDFHKENF
Sbjct  906   FSRKTTTKFDFHKENF  921



>ref|XP_003525163.2| PREDICTED: respiratory burst oxidase homolog protein C-like isoform 
3 [Glycine max]
Length=898

 Score =   311 bits (798),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 170/196 (87%), Gaps = 1/196 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggv-enggaATKNFRT  922
             YGAPAQDY++Y+VVLLVGLGIGATPMISI+KD+VNN  A DEEEG           +F+T
Sbjct  703   YGAPAQDYREYEVVLLVGLGIGATPMISILKDMVNNFKAIDEEEGIGGAKSPTRLSDFKT  762

Query  921   KKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSL  742
              +AYFYWVTREQGSFDWFKG+MNEVAE D R VIE+H+YCTSVYEEGDARSALI MLQSL
Sbjct  763   SRAYFYWVTREQGSFDWFKGVMNEVAEEDRRKVIELHSYCTSVYEEGDARSALIAMLQSL  822

Query  741   HHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALD  562
             +HAKNGVDIVSGTRV SHFAKPNWR+VYKRIALNH D++VGVFYCG  ALT ELRQLALD
Sbjct  823   NHAKNGVDIVSGTRVMSHFAKPNWRSVYKRIALNHPDARVGVFYCGPSALTHELRQLALD  882

Query  561   FSRKTSTKFDFHKENF  514
             FS  TSTK+DFHKENF
Sbjct  883   FSHNTSTKYDFHKENF  898



>ref|XP_010438870.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Camelina 
sativa]
Length=924

 Score =   311 bits (798),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 170/199 (85%), Gaps = 4/199 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTa----adeeeggvenggaATKN  931
             YGAPAQDYKKYDVVLLVGLGIGATPMISI+KDI+NNM +    +D E     N    +K 
Sbjct  726   YGAPAQDYKKYDVVLLVGLGIGATPMISILKDIINNMKSPERDSDIENNNSNNNNNNSKG  785

Query  930   FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITML  751
             F+T+KAYFYWVTREQGSF+WFKGIM+EV+E+D+ G+IE+HNYCTSVYEEGDAR ALI ML
Sbjct  786   FKTRKAYFYWVTREQGSFEWFKGIMDEVSELDDEGIIELHNYCTSVYEEGDARVALIAML  845

Query  750   QSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQL  571
             QSL HAKNGVD+VSGTRVKSHFAKPNWR VYK++A++H   ++GVFYCG P +  EL+ L
Sbjct  846   QSLQHAKNGVDVVSGTRVKSHFAKPNWRQVYKKVAVHHPGKRIGVFYCGMPGMVKELKNL  905

Query  570   ALDFSRKTSTKFDFHKENF  514
             ALDFSRKT+TKFDFHKENF
Sbjct  906   ALDFSRKTTTKFDFHKENF  924



>ref|XP_008378424.1| PREDICTED: respiratory burst oxidase homolog protein D-like [Malus 
domestica]
Length=962

 Score =   311 bits (798),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 152/215 (71%), Positives = 173/215 (80%), Gaps = 20/215 (9%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaA-------  940
             YGAPAQDYKKYDVVLLVGLGIGATPM+SIVKDI+NNM    +E+   E+   +       
Sbjct  748   YGAPAQDYKKYDVVLLVGLGIGATPMVSIVKDIINNMKMKGKEDDDSESALESGRATPNA  807

Query  939   -------------TKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCT  799
                           K F+T+KAY+YWVTREQGSF+WFKGI+NEVA+MD +GVIEMHNYCT
Sbjct  808   SSHNNSNTGKNKSNKGFKTRKAYYYWVTREQGSFEWFKGILNEVADMDEKGVIEMHNYCT  867

Query  798   SVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVG  619
             SVYEEGDARSALI MLQSLHHAKNGVD+VSGTRVKSHFAKPNWR VYK IA +H  S+VG
Sbjct  868   SVYEEGDARSALIAMLQSLHHAKNGVDVVSGTRVKSHFAKPNWRQVYKDIARHHPGSRVG  927

Query  618   VFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             VFYCGAPALT +L++LAL FS KT+TKF+FHKENF
Sbjct  928   VFYCGAPALTKDLKELALYFSHKTTTKFEFHKENF  962



>ref|XP_008375433.1| PREDICTED: respiratory burst oxidase homolog protein C [Malus 
domestica]
Length=941

 Score =   311 bits (796),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 169/218 (78%), Gaps = 23/218 (11%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaa--------------------  979
             YGAPAQ+YK Y+VVLLVGLGIGATPMISI+KDIVNN+ A                     
Sbjct  724   YGAPAQEYKTYEVVLLVGLGIGATPMISILKDIVNNIKAMEEEEEDNALENGGGGGGGTK  783

Query  978   ---deeeggvenggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHN  808
                   +    +      NF+TK+AYFYWVTREQGSFDWFKG MNEVAE+D+  VIE HN
Sbjct  784   LPHKSSKTHAGSTSVGHHNFKTKRAYFYWVTREQGSFDWFKGAMNEVAELDHNRVIEFHN  843

Query  807   YCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDS  628
             YCTSVYEEGDARSALI MLQSL HAKNGVDIVSGTRVKSHFAKPNWR VYKRIAL+HTD+
Sbjct  844   YCTSVYEEGDARSALIAMLQSLSHAKNGVDIVSGTRVKSHFAKPNWREVYKRIALDHTDA  903

Query  627   KVGVFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             +VGVFYCG PALT ELRQL+LDFS KTST+F+FHKENF
Sbjct  904   RVGVFYCGPPALTEELRQLSLDFSHKTSTRFEFHKENF  941



>dbj|BAJ94299.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97805.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=925

 Score =   310 bits (794),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/197 (74%), Positives = 169/197 (86%), Gaps = 2/197 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaad--eeeggvenggaATKNFR  925
             YGAPAQDYK+YDVVLLVGLGIGATPMISI+KDI+NNM   D   E G   +   +  +F+
Sbjct  729   YGAPAQDYKQYDVVLLVGLGIGATPMISIIKDIINNMKRLDGDIESGSPSDRSVSAASFQ  788

Query  924   TKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQS  745
             T++AYFYWVTRE+GSFDWF+G+M+EVAE D +G+IE+HNYCTSVYEEGDARSALI MLQS
Sbjct  789   TRRAYFYWVTREEGSFDWFRGVMDEVAESDKKGIIELHNYCTSVYEEGDARSALIAMLQS  848

Query  744   LHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLAL  565
             L+HAK+GVD+VSGTRVK+HFA+PNWR VYK IAL H   +VGVFYCGAP L  ELRQLA 
Sbjct  849   LNHAKHGVDVVSGTRVKTHFARPNWRKVYKDIALKHAGQRVGVFYCGAPVLIKELRQLAQ  908

Query  564   DFSRKTSTKFDFHKENF  514
             DFSRKTSTKF+FHKENF
Sbjct  909   DFSRKTSTKFEFHKENF  925



>ref|XP_003556516.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Glycine 
max]
Length=889

 Score =   309 bits (792),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 165/195 (85%), Gaps = 0/195 (0%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDYK Y+V+LLVGLGIGATP+ISI+KD++NN+    + E G        K F TK
Sbjct  695   YGAPAQDYKNYEVILLVGLGIGATPLISILKDVLNNIKQHKDVEEGAVEKDNKRKPFATK  754

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             +AYFYWVTRE+GSF+WFKG+MNEV E D  GVIE+HNYCTSVYEEGDARSALITMLQSLH
Sbjct  755   RAYFYWVTREEGSFEWFKGVMNEVEENDKEGVIELHNYCTSVYEEGDARSALITMLQSLH  814

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             HAKNGVDIVSGTRVK+HFA+PNWRNV+K  A+ H D +VGVFYCGA  L  EL++L+LDF
Sbjct  815   HAKNGVDIVSGTRVKTHFARPNWRNVFKHAAIKHPDQRVGVFYCGAHGLVGELKRLSLDF  874

Query  558   SRKTSTKFDFHKENF  514
             SRKTSTKFDFHKENF
Sbjct  875   SRKTSTKFDFHKENF  889



>ref|XP_006844712.1| PREDICTED: respiratory burst oxidase homolog protein C [Amborella 
trichopoda]
 gb|ERN06387.1| hypothetical protein AMTR_s00016p00250800 [Amborella trichopoda]
Length=917

 Score =   310 bits (794),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 171/205 (83%), Gaps = 10/205 (5%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeee----------ggveng  949
             YGAP+QDYKKYDVVLLVGLGIGATP +SIVKDI+NN+ A++EEE                
Sbjct  713   YGAPSQDYKKYDVVLLVGLGIGATPCVSIVKDIMNNIRASEEEEREEKDLERGGALRTTA  772

Query  948   gaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARS  769
                 K F+T++AYFYWVTREQGSF+WFKG+MNEVAE D  GVIE HNYCTSVYEEGDARS
Sbjct  773   TPTKKKFKTQRAYFYWVTREQGSFEWFKGVMNEVAEADQNGVIEFHNYCTSVYEEGDARS  832

Query  768   ALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALT  589
             ALI MLQSLHHAK+GVDIVSGTRVK+HFA+PNWR  +KRIA+NH + +VGVFYCGAPALT
Sbjct  833   ALIAMLQSLHHAKSGVDIVSGTRVKTHFARPNWRAQFKRIAINHREKRVGVFYCGAPALT  892

Query  588   TELRQLALDFSRKTSTKFDFHKENF  514
              ELR L+L+FSRKT+T+FDFHKENF
Sbjct  893   GELRHLSLEFSRKTTTRFDFHKENF  917



>dbj|BAJ86360.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=925

 Score =   310 bits (794),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 145/197 (74%), Positives = 168/197 (85%), Gaps = 2/197 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaad--eeeggvenggaATKNFR  925
             YGAPAQDYK+YDVVLLVGLGIGATPMISI+KDI+NNM   D     G   +   +  +F+
Sbjct  729   YGAPAQDYKQYDVVLLVGLGIGATPMISIIKDIINNMKRLDGDIGSGSPSDRSVSAASFQ  788

Query  924   TKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQS  745
             T++AYFYWVTRE+GSFDWF+G+M+EVAE D +G+IE+HNYCTSVYEEGDARSALI MLQS
Sbjct  789   TRRAYFYWVTREEGSFDWFRGVMDEVAESDKKGIIELHNYCTSVYEEGDARSALIAMLQS  848

Query  744   LHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLAL  565
             L+HAK+GVD+VSGTRVK+HFA+PNWR VYK IAL H   +VGVFYCGAP L  ELRQLA 
Sbjct  849   LNHAKHGVDVVSGTRVKTHFARPNWRKVYKDIALKHAGQRVGVFYCGAPVLIKELRQLAQ  908

Query  564   DFSRKTSTKFDFHKENF  514
             DFSRKTSTKF+FHKENF
Sbjct  909   DFSRKTSTKFEFHKENF  925



>gb|AEX56133.1| NADPH oxidase [Phaseolus vulgaris]
Length=930

 Score =   310 bits (794),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 175/208 (84%), Gaps = 13/208 (6%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKN----  931
             YGAPAQDYK+Y+VVLLVGLGIGATPMISIVKDIVNNM A +EEEG     G + K+    
Sbjct  723   YGAPAQDYKQYEVVLLVGLGIGATPMISIVKDIVNNMKAMEEEEGRNMEEGESGKSARTT  782

Query  930   ---------FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGD  778
                      F T++AYFYWVTREQGSFDWFKG+MNEVAE D++GVIE+HNYCTSVYEEGD
Sbjct  783   PQKKNGVNKFNTRRAYFYWVTREQGSFDWFKGVMNEVAEEDHKGVIELHNYCTSVYEEGD  842

Query  777   ARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAP  598
             ARSALI MLQSL+HAKNGVDIVSGTRVKSHFAKPNWR+VYKRIA+ +  ++VGVFYCG P
Sbjct  843   ARSALIAMLQSLNHAKNGVDIVSGTRVKSHFAKPNWRSVYKRIAVTYPRARVGVFYCGPP  902

Query  597   ALTTELRQLALDFSRKTSTKFDFHKENF  514
             ALT EL QLA DFSR T+T++DFHKENF
Sbjct  903   ALTKELGQLASDFSRNTTTRYDFHKENF  930



>ref|XP_007137830.1| hypothetical protein PHAVU_009G159200g [Phaseolus vulgaris]
 gb|ESW09824.1| hypothetical protein PHAVU_009G159200g [Phaseolus vulgaris]
Length=930

 Score =   310 bits (793),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 175/208 (84%), Gaps = 13/208 (6%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKN----  931
             YGAPAQDYK+Y+VVLLVGLGIGATPMISIVKDIVNNM A +EEEG     G + K+    
Sbjct  723   YGAPAQDYKQYEVVLLVGLGIGATPMISIVKDIVNNMKAMEEEEGRNMEEGESGKSARTT  782

Query  930   ---------FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGD  778
                      F T++AYFYWVTREQGSFDWFKG+MNEVAE D++GVIE+HNYCTSVYEEGD
Sbjct  783   PQKKNGVNKFNTRRAYFYWVTREQGSFDWFKGVMNEVAEEDHKGVIELHNYCTSVYEEGD  842

Query  777   ARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAP  598
             ARSALI MLQSL+HAKNGVDIVSGTRVKSHFAKPNWR+VYKRIA+ +  ++VGVFYCG P
Sbjct  843   ARSALIAMLQSLNHAKNGVDIVSGTRVKSHFAKPNWRSVYKRIAVTYPRARVGVFYCGPP  902

Query  597   ALTTELRQLALDFSRKTSTKFDFHKENF  514
             ALT EL QLA DFSR T+T++DFHKENF
Sbjct  903   ALTKELGQLASDFSRNTTTRYDFHKENF  930



>ref|XP_003591142.1| Respiratory burst oxidase-like protein [Medicago truncatula]
 gb|AES61393.1| respiratory burst oxidase-like protein [Medicago truncatula]
Length=885

 Score =   309 bits (791),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 167/200 (84%), Gaps = 5/200 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKN----  931
             YGAPAQDYK Y+V+LLVGLGIGATP+ISI+KD++NN+   +E+        +  KN    
Sbjct  686   YGAPAQDYKNYEVLLLVGLGIGATPLISILKDVLNNIKQQEEDLEEGGEVESGVKNNKKR  745

Query  930   -FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITM  754
              F TK+AYFYWVTREQGSF+WFKG+MNEVAE D  GVIE+HNYCTSVYEEGDARSALITM
Sbjct  746   PFATKRAYFYWVTREQGSFEWFKGVMNEVAENDKEGVIELHNYCTSVYEEGDARSALITM  805

Query  753   LQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQ  574
             LQSLHHAKNGVD+VS TRVK+HFA+PNWRNVYK +AL H + KVGVFYCGA  L  ELR+
Sbjct  806   LQSLHHAKNGVDVVSETRVKTHFARPNWRNVYKHVALKHPEKKVGVFYCGAHGLVGELRK  865

Query  573   LALDFSRKTSTKFDFHKENF  514
             L+LDFSRKT TKFDFHKENF
Sbjct  866   LSLDFSRKTGTKFDFHKENF  885



>ref|XP_009390376.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Musa 
acuminata subsp. malaccensis]
Length=909

 Score =   309 bits (791),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 145/195 (74%), Positives = 168/195 (86%), Gaps = 0/195 (0%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDY+KY+VVLLVGL IGATP ISIVKDI+NN+   D EEGG         +FRT+
Sbjct  715   YGAPAQDYEKYEVVLLVGLAIGATPFISIVKDILNNIKQRDVEEGGGGRSSTEANSFRTR  774

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             +AYFYWVTREQ SF+WF+G+M+EVAE D +GVIE+HNYCTSVYEEGDAR+ALI MLQSL+
Sbjct  775   RAYFYWVTREQDSFEWFRGVMDEVAEADAQGVIELHNYCTSVYEEGDARAALIAMLQSLN  834

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             +AK+GVD+V+GTRVKSHFA+PNWRNVYKRIALNH D ++GVFYCG P L  ELRQLA DF
Sbjct  835   YAKHGVDVVAGTRVKSHFARPNWRNVYKRIALNHPDQRIGVFYCGKPTLVKELRQLAQDF  894

Query  558   SRKTSTKFDFHKENF  514
             S KT+TKFDFHKENF
Sbjct  895   SHKTTTKFDFHKENF  909



>gb|EPS73914.1| hypothetical protein M569_00842 [Genlisea aurea]
Length=887

 Score =   308 bits (788),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 165/195 (85%), Gaps = 1/195 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAP QDYK+Y+VVLLVGLGIGATPMIS+VKDIVN   + D      E+G   ++ F+T+
Sbjct  694   YGAPTQDYKEYEVVLLVGLGIGATPMISVVKDIVNRSLSEDSSSNSAESGRGGSR-FKTR  752

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             +AYFYWVTREQGSFDWFK +MNEV+E D  G IEMHNYCTSVYEEGDARSALITMLQ L+
Sbjct  753   RAYFYWVTREQGSFDWFKSVMNEVSETDRGGAIEMHNYCTSVYEEGDARSALITMLQQLN  812

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             HAKNGVDIVSGTRV SHFAKPNWR VYKRIALNH +++VGVFYCGAP    ELRQLA DF
Sbjct  813   HAKNGVDIVSGTRVMSHFAKPNWRTVYKRIALNHPETRVGVFYCGAPPPVKELRQLASDF  872

Query  558   SRKTSTKFDFHKENF  514
             S KTSTKFDFHKENF
Sbjct  873   SHKTSTKFDFHKENF  887



>gb|KHN09692.1| Respiratory burst oxidase like protein C [Glycine soja]
Length=939

 Score =   308 bits (790),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 170/214 (79%), Gaps = 19/214 (9%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaa-------------------d  976
             YGAPAQDYK+Y+VVLLVGLGIGATPMISI+KDIVNNM A                     
Sbjct  726   YGAPAQDYKQYEVVLLVGLGIGATPMISILKDIVNNMKAMEEEEGSNIEEGGASSGFGNK  785

Query  975   eeeggvenggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTS  796
                G   +  + + NF T++AYFYWVTREQGSFDWFKG+MNEVAE D+RGVIE+HNYCTS
Sbjct  786   SPRGSSPHKKSGSSNFNTRRAYFYWVTREQGSFDWFKGVMNEVAEEDHRGVIELHNYCTS  845

Query  795   VYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGV  616
             VYEEGDARSALI MLQSL+HAKNGVDIVSGTRVKSHFAKPNWR VYKRIA++H  S+VGV
Sbjct  846   VYEEGDARSALIAMLQSLNHAKNGVDIVSGTRVKSHFAKPNWRAVYKRIAVSHPRSRVGV  905

Query  615   FYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             FYCG PALT +L QLA DFS  T+TK+DFHKENF
Sbjct  906   FYCGPPALTKQLGQLASDFSHNTNTKYDFHKENF  939



>ref|XP_003526909.1| PREDICTED: respiratory burst oxidase homolog protein C-like isoform 
1 [Glycine max]
Length=941

 Score =   308 bits (790),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 170/214 (79%), Gaps = 19/214 (9%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaa-------------------d  976
             YGAPAQDYK+Y+VVLLVGLGIGATPMISI+KDIVNNM A                     
Sbjct  728   YGAPAQDYKQYEVVLLVGLGIGATPMISILKDIVNNMKAMEEEEGSNIEEGGASSGFGNK  787

Query  975   eeeggvenggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTS  796
                G   +  + + NF T++AYFYWVTREQGSFDWFKG+MNEVAE D+RGVIE+HNYCTS
Sbjct  788   SPRGSSPHKKSGSSNFNTRRAYFYWVTREQGSFDWFKGVMNEVAEEDHRGVIELHNYCTS  847

Query  795   VYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGV  616
             VYEEGDARSALI MLQSL+HAKNGVDIVSGTRVKSHFAKPNWR VYKRIA++H  S+VGV
Sbjct  848   VYEEGDARSALIAMLQSLNHAKNGVDIVSGTRVKSHFAKPNWRAVYKRIAVSHPRSRVGV  907

Query  615   FYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             FYCG PALT +L QLA DFS  T+TK+DFHKENF
Sbjct  908   FYCGPPALTKQLGQLASDFSHNTNTKYDFHKENF  941



>ref|XP_010442849.1| PREDICTED: respiratory burst oxidase homolog protein C isoform 
X2 [Camelina sativa]
Length=922

 Score =   308 bits (788),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 154/210 (73%), Positives = 171/210 (81%), Gaps = 15/210 (7%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeg------gvenggaAT  937
             YGAPAQDYKKY+VVLLVGLGIGATPMISIVKDIVNN+ A ++ +         E      
Sbjct  713   YGAPAQDYKKYEVVLLVGLGIGATPMISIVKDIVNNIKAKEQAQLNRMENGTSEPQRNKK  772

Query  936   KNFRTKKAYFYWVTRE---------QGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEE  784
             ++FRT++AYFYWVTRE         QGSFDWFK IMNEVAE D   VIE+HNYCTSVYEE
Sbjct  773   ESFRTRRAYFYWVTREAYFYWVTREQGSFDWFKNIMNEVAERDTNRVIELHNYCTSVYEE  832

Query  783   GDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCG  604
             GDARSALI MLQSL+HAKNGVDIVSGTRV SHFAKPNWRNVYKRIA++H ++KVGVFYCG
Sbjct  833   GDARSALIHMLQSLNHAKNGVDIVSGTRVMSHFAKPNWRNVYKRIAMDHPNTKVGVFYCG  892

Query  603   APALTTELRQLALDFSRKTSTKFDFHKENF  514
             APALT ELR LALDF+ KTST+F FHKENF
Sbjct  893   APALTKELRHLALDFTHKTSTRFSFHKENF  922



>gb|KHN31235.1| Respiratory burst oxidase like protein C [Glycine soja]
Length=928

 Score =   308 bits (789),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 170/213 (80%), Gaps = 18/213 (8%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaa------------------de  973
             YGAPAQDYK+Y+VVLLVGLGIGATPMISI+KDIVNNM A                     
Sbjct  716   YGAPAQDYKQYEVVLLVGLGIGATPMISILKDIVNNMKAMEEEEETNIEEGTNSGFGNKS  775

Query  972   eeggvenggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSV  793
               G   +   ++ NF T++AYFYWVTREQGSFDWFKG+MNEVAE D++GVIE+HNYCTSV
Sbjct  776   PRGSSPHKKNSSSNFNTRRAYFYWVTREQGSFDWFKGVMNEVAEEDHKGVIELHNYCTSV  835

Query  792   YEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVF  613
             YEEGDARSALI MLQSL+HAKNGVDIVSGTRVKSHFAKPNWR VYKRIA++H  ++VGVF
Sbjct  836   YEEGDARSALIAMLQSLNHAKNGVDIVSGTRVKSHFAKPNWRAVYKRIAVSHPRARVGVF  895

Query  612   YCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             YCG PALT EL QLA DFS  T+TK+DFHKENF
Sbjct  896   YCGPPALTKELGQLASDFSHNTNTKYDFHKENF  928



>ref|XP_003522455.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Glycine 
max]
Length=928

 Score =   308 bits (788),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 170/213 (80%), Gaps = 18/213 (8%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaa------------------de  973
             YGAPAQDYK+Y+VVLLVGLGIGATPMISI+KDIVNNM A                     
Sbjct  716   YGAPAQDYKQYEVVLLVGLGIGATPMISILKDIVNNMKAMEEEEETNIEEGTNSGFGNKS  775

Query  972   eeggvenggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSV  793
               G   +   ++ NF T++AYFYWVTREQGSFDWFKG+MNEVAE D++GVIE+HNYCTSV
Sbjct  776   PRGSSPHKKNSSSNFNTRRAYFYWVTREQGSFDWFKGVMNEVAEEDHKGVIELHNYCTSV  835

Query  792   YEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVF  613
             YEEGDARSALI MLQSL+HAKNGVDIVSGTRVKSHFAKPNWR VYKRIA++H  ++VGVF
Sbjct  836   YEEGDARSALIAMLQSLNHAKNGVDIVSGTRVKSHFAKPNWRAVYKRIAVSHPRARVGVF  895

Query  612   YCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             YCG PALT EL QLA DFS  T+TK+DFHKENF
Sbjct  896   YCGPPALTKELGQLASDFSHNTNTKYDFHKENF  928



>ref|XP_009404193.1| PREDICTED: respiratory burst oxidase homolog protein B [Musa 
acuminata subsp. malaccensis]
Length=938

 Score =   308 bits (788),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 150/222 (68%), Positives = 168/222 (76%), Gaps = 27/222 (12%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKN----  931
             YGAPAQDYKKY+VVLLVGLGIGATP ISIVKDIVNNM   +    G              
Sbjct  717   YGAPAQDYKKYEVVLLVGLGIGATPFISIVKDIVNNMKQLESLGLGDVEEQDLENRGGGS  776

Query  930   -----------------------FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVI  820
                                    FRT++AYFYWVTREQ SF+WF+G+MNEVAE D +GVI
Sbjct  777   NSNSGHHKRGGSTSTSVSVSTSSFRTRRAYFYWVTREQDSFEWFRGVMNEVAETDKKGVI  836

Query  819   EMHNYCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALN  640
             E+HNYCTSVYEEGDARSALI MLQSL+HAK+GVD+VSGTRVKSHFA+PNWRNVYKRIALN
Sbjct  837   ELHNYCTSVYEEGDARSALIAMLQSLNHAKHGVDVVSGTRVKSHFARPNWRNVYKRIALN  896

Query  639   HTDSKVGVFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             H + ++GVFYCGAPALT ELRQLA DF+ KT+TKFDFHKENF
Sbjct  897   HREKRIGVFYCGAPALTKELRQLAQDFTHKTTTKFDFHKENF  938



>ref|XP_007030987.1| Respiratory burst oxidase B [Theobroma cacao]
 gb|EOY11489.1| Respiratory burst oxidase B [Theobroma cacao]
Length=889

 Score =   306 bits (785),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 171/197 (87%), Gaps = 2/197 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKN--FR  925
             YGAPAQDYKKYDV+LLVGLGIGATP+ISIVKD++NN+    E E G+ENG    K   F 
Sbjct  693   YGAPAQDYKKYDVLLLVGLGIGATPLISIVKDVLNNIKQQKEMEEGIENGVKNNKRKPFA  752

Query  924   TKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQS  745
             TK+AYFYWVTREQGSF+WF+G+MNEVAE D   +IE+HNYCTSV+EEGDARSALITMLQS
Sbjct  753   TKRAYFYWVTREQGSFEWFRGVMNEVAEYDRDRMIELHNYCTSVFEEGDARSALITMLQS  812

Query  744   LHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLAL  565
             LHHAK+GVDIVSGTRVK+HFA+PNW  V+K +A+NH + +VGVFYCGAP LT ELR+LA 
Sbjct  813   LHHAKSGVDIVSGTRVKTHFARPNWHKVFKHVAVNHANQRVGVFYCGAPGLTGELRRLAQ  872

Query  564   DFSRKTSTKFDFHKENF  514
             DFSRKTSTKFDFHKENF
Sbjct  873   DFSRKTSTKFDFHKENF  889



>ref|XP_003536070.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Glycine 
max]
Length=888

 Score =   306 bits (785),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 145/195 (74%), Positives = 165/195 (85%), Gaps = 1/195 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDYK YDV+LLVGLGIGATP+ISI+KD++NN+    + E G        K F TK
Sbjct  695   YGAPAQDYKNYDVILLVGLGIGATPLISILKDVLNNIKQHKDVEEGEVEKDKR-KPFATK  753

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             +AYFYWVTRE+GSF+WFKG+MNEV E D  GVIE+HNYCTSVYEEGDARSALITMLQSLH
Sbjct  754   RAYFYWVTREEGSFEWFKGVMNEVEENDKEGVIELHNYCTSVYEEGDARSALITMLQSLH  813

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             HAKNGVDIVSGTRVK+HFA+PNWRNV+K  A+ H D +VGVFYCGA  L  EL++L+LDF
Sbjct  814   HAKNGVDIVSGTRVKTHFARPNWRNVFKHAAIKHPDQRVGVFYCGAHGLVGELKKLSLDF  873

Query  558   SRKTSTKFDFHKENF  514
             SRKTSTKFDFHKENF
Sbjct  874   SRKTSTKFDFHKENF  888



>ref|XP_011036858.1| PREDICTED: respiratory burst oxidase homolog protein B [Populus 
euphratica]
 ref|XP_011036859.1| PREDICTED: respiratory burst oxidase homolog protein B [Populus 
euphratica]
Length=886

 Score =   306 bits (783),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 147/198 (74%), Positives = 168/198 (85%), Gaps = 3/198 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKN---F  928
             YGAPAQDYKKYDV+LLVGLGIGATP+ISIVKD++NN+    E E G+   G    N   F
Sbjct  689   YGAPAQDYKKYDVLLLVGLGIGATPLISIVKDVLNNIKQQKEMEEGLVESGIKGNNRKPF  748

Query  927   RTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQ  748
              TK+AYFYWVTREQGSF+WF+G+MNEVA+ D   VIE+HNYCTSVYEEGDARSALITMLQ
Sbjct  749   ATKRAYFYWVTREQGSFEWFRGVMNEVADYDQDRVIELHNYCTSVYEEGDARSALITMLQ  808

Query  747   SLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLA  568
             SL HAK+GVDIVS TRVK+HFA+PNWR V+K +A+NH D +VGVFYCGAP LT ELR+LA
Sbjct  809   SLQHAKSGVDIVSETRVKTHFARPNWRKVFKHVAVNHPDQRVGVFYCGAPGLTGELRRLA  868

Query  567   LDFSRKTSTKFDFHKENF  514
              DFSRKT+TKFDFHKENF
Sbjct  869   QDFSRKTTTKFDFHKENF  886



>ref|XP_010269487.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Nelumbo 
nucifera]
Length=908

 Score =   306 bits (784),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 145/201 (72%), Positives = 166/201 (83%), Gaps = 6/201 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggve------nggaAT  937
             YGAPAQDYK+YDV+LLVGLGIGATP+ISIVKD++NN+    + E G              
Sbjct  708   YGAPAQDYKEYDVLLLVGLGIGATPLISIVKDVLNNIKQQKDIEEGSVVQSGGGAKSNKK  767

Query  936   KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALIT  757
             K F TK+AYFYWVTREQGSF+WF+G++NEVAE D  GVIE+HNYCTSVYEEGDARSALI 
Sbjct  768   KPFATKQAYFYWVTREQGSFEWFRGVLNEVAEYDRDGVIELHNYCTSVYEEGDARSALIA  827

Query  756   MLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELR  577
             MLQSL HAK GVDIVSGTRVK+HFA+PNWRNV+K +A+NH D +VGVFYCGAP LT ELR
Sbjct  828   MLQSLQHAKYGVDIVSGTRVKTHFARPNWRNVFKHVAVNHPDQRVGVFYCGAPGLTGELR  887

Query  576   QLALDFSRKTSTKFDFHKENF  514
             +LA DFSRKT TKF+FHKENF
Sbjct  888   RLARDFSRKTPTKFEFHKENF  908



>ref|XP_002512422.1| respiratory burst oxidase, putative [Ricinus communis]
 gb|EEF49874.1| respiratory burst oxidase, putative [Ricinus communis]
Length=888

 Score =   306 bits (783),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 170/199 (85%), Gaps = 4/199 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggven----ggaATKN  931
             YGAPAQDYKKYDV+LLVGLGIGATP+ISIVKD++NN+    E+E G+       G+  K 
Sbjct  690   YGAPAQDYKKYDVLLLVGLGIGATPLISIVKDVLNNIKQQKEKEEGIVENGINKGSKRKP  749

Query  930   FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITML  751
             F T++AYFYWVTREQGSF+WFKG+MNEVAE D   VIE+HNYCTSVYEEGDARSALITML
Sbjct  750   FATRRAYFYWVTREQGSFEWFKGVMNEVAEYDQDKVIELHNYCTSVYEEGDARSALITML  809

Query  750   QSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQL  571
             QS+ HAKNGVDIVS TRV++HFA+PNWR V+K +A+N+ D +VGVFYCGAP LT ELR+L
Sbjct  810   QSIQHAKNGVDIVSETRVRTHFARPNWRKVFKHVAINYPDQRVGVFYCGAPGLTGELRRL  869

Query  570   ALDFSRKTSTKFDFHKENF  514
             A DFSRKTSTKFDFHKENF
Sbjct  870   AQDFSRKTSTKFDFHKENF  888



>ref|XP_008807835.1| PREDICTED: respiratory burst oxidase homolog protein B-like isoform 
X3 [Phoenix dactylifera]
Length=929

 Score =   306 bits (785),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 150/217 (69%), Positives = 167/217 (77%), Gaps = 22/217 (10%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggven-----------  952
             YGAPAQDYKKYDVVLLVGLGIGATP ISI+KDIVNNM   + E                 
Sbjct  713   YGAPAQDYKKYDVVLLVGLGIGATPFISILKDIVNNMKQLESEGLLDSEGDRDLEGAGGS  772

Query  951   ---ggaATKNFRTKKAY--------FYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNY  805
                    +  F T  AY        FYWVTREQGSF+WF+G+MNEVAE D +G+IE+H Y
Sbjct  773   SHRPSGTSSTFTTAPAYTKKGTPGYFYWVTREQGSFEWFRGVMNEVAETDKKGMIELHTY  832

Query  804   CTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSK  625
             CTSVYEEGDARSALITMLQSL+HAK+GVD+VSGTRVKSHFA+PNWRNVYKRIALNH D +
Sbjct  833   CTSVYEEGDARSALITMLQSLNHAKHGVDVVSGTRVKSHFARPNWRNVYKRIALNHRDQR  892

Query  624   VGVFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             +GVFYCGAP LT +LRQLA DFSRKT+TKFDFHKENF
Sbjct  893   IGVFYCGAPTLTKQLRQLAQDFSRKTTTKFDFHKENF  929



>gb|KJB45301.1| hypothetical protein B456_007G299500 [Gossypium raimondii]
Length=884

 Score =   305 bits (782),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 148/195 (76%), Positives = 171/195 (88%), Gaps = 3/195 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDYKKYDV+LLVGLGIGATP+ISIVKD++NN+   +E E GV+N     K F TK
Sbjct  693   YGAPAQDYKKYDVLLLVGLGIGATPLISIVKDVLNNIKQQNEIEEGVKNKR---KPFATK  749

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             +AYFYWVTREQGSF+WF+G+MNEVAE D   +IE+HNYCTSVYEEGDARSALITMLQSL 
Sbjct  750   RAYFYWVTREQGSFEWFRGVMNEVAEYDRDRMIELHNYCTSVYEEGDARSALITMLQSLQ  809

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             HAK+GVDIVSGT+VK+HFA+PNW  V+K +A+NHTD +VGVFYCGAP LT ELR+LA +F
Sbjct  810   HAKSGVDIVSGTQVKTHFARPNWHKVFKHVAVNHTDKRVGVFYCGAPGLTGELRRLAQEF  869

Query  558   SRKTSTKFDFHKENF  514
             SRKTSTKFDFHKENF
Sbjct  870   SRKTSTKFDFHKENF  884



>ref|XP_007144946.1| hypothetical protein PHAVU_007G196800g [Phaseolus vulgaris]
 gb|ESW16940.1| hypothetical protein PHAVU_007G196800g [Phaseolus vulgaris]
Length=890

 Score =   305 bits (782),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 148/198 (75%), Positives = 169/198 (85%), Gaps = 3/198 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT---KNF  928
             YGAPAQDYK YDV+LLVGLGIGATP+ISI+KD++NN+    +EE GV   G      K F
Sbjct  693   YGAPAQDYKNYDVILLVGLGIGATPLISILKDVLNNIKQHQDEEEGVVESGVKDNKRKPF  752

Query  927   RTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQ  748
              TK+AYFYWVTRE+GSF+WFKG+MNEVAE D  GVIE+HNYCTSVYEEGDARSALITMLQ
Sbjct  753   ATKRAYFYWVTREEGSFEWFKGVMNEVAENDKEGVIELHNYCTSVYEEGDARSALITMLQ  812

Query  747   SLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLA  568
             SLHHAKNGVDIVSGTRVK+HFA+PNWRNV+K  AL H + +VGVFYCGA  L  EL++L+
Sbjct  813   SLHHAKNGVDIVSGTRVKTHFARPNWRNVFKHAALKHPNQRVGVFYCGAHGLVGELKRLS  872

Query  567   LDFSRKTSTKFDFHKENF  514
             LDFSRKT+TKFDFHKENF
Sbjct  873   LDFSRKTTTKFDFHKENF  890



>ref|XP_007210905.1| hypothetical protein PRUPE_ppa000984mg [Prunus persica]
 gb|EMJ12104.1| hypothetical protein PRUPE_ppa000984mg [Prunus persica]
Length=941

 Score =   305 bits (782),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 167/211 (79%), Gaps = 16/211 (8%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATK-----  934
             YGAPAQDYK Y+VVLLVGLGIGATPMISI+KD+VNN+ A +EE   +             
Sbjct  731   YGAPAQDYKNYEVVLLVGLGIGATPMISILKDVVNNIKAMEEEGEDMGALENGAPSRISK  790

Query  933   -----------NFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYE  787
                        NF+TK+AYFYWVTREQGSFDWFKG MNEVAE+D+  VIE HNYCTSVYE
Sbjct  791   VGSGSSQLGLHNFKTKRAYFYWVTREQGSFDWFKGAMNEVAELDHNRVIEFHNYCTSVYE  850

Query  786   EGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYC  607
             EGDARSALI MLQSL HAKNGVDIVSGTRVKSHFAKPNWR VYKRIAL+H ++ VGVFYC
Sbjct  851   EGDARSALIHMLQSLSHAKNGVDIVSGTRVKSHFAKPNWREVYKRIALDHANATVGVFYC  910

Query  606   GAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             G PAL  ELRQL+ DFS KT+T+FDFHKENF
Sbjct  911   GLPALANELRQLSHDFSHKTTTQFDFHKENF  941



>ref|XP_010929525.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Elaeis 
guineensis]
Length=934

 Score =   305 bits (781),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/218 (67%), Positives = 170/218 (78%), Gaps = 23/218 (11%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKN----  931
             YGAPAQDYKKY+VVLLVGLGIGATP ISIVKDIVNNM   + E      G    ++    
Sbjct  717   YGAPAQDYKKYEVVLLVGLGIGATPFISIVKDIVNNMKQLESEGLLDSEGDQDLESAVGG  776

Query  930   -------------------FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHN  808
                                FRT++AYFYWVTREQGSF+WF+G+MNEVAE D +G+IE+H 
Sbjct  777   ESRSTKRAAGSSHRPGGGTFRTRRAYFYWVTREQGSFEWFRGVMNEVAETDKKGLIELHT  836

Query  807   YCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDS  628
             YCTSVYEEGDARSALI MLQSL+HAK+GVD+VSGTRV++HFA+PNWRNVYKRIALNH D 
Sbjct  837   YCTSVYEEGDARSALIAMLQSLNHAKHGVDVVSGTRVRAHFARPNWRNVYKRIALNHRDQ  896

Query  627   KVGVFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             ++GVFYCGAP LT ELR LA DFSRKT+TKF+F+KENF
Sbjct  897   RIGVFYCGAPTLTKELRHLAQDFSRKTTTKFEFNKENF  934



>gb|ABG35768.1| NOX3 [Striga asiatica]
Length=542

 Score =   295 bits (756),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 162/201 (81%), Gaps = 15/201 (7%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTa---------------adeeeg  964
             YGAP QDYK YDVVLLVGLGIGATPMIS+VKDIVNN+ A               A     
Sbjct  316   YGAPTQDYKDYDVVLLVGLGIGATPMISVVKDIVNNIKAMDEEEGGATRGSTPNASPLST  375

Query  963   gvenggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEE  784
                  G+  ++F+T++AYFYWVTREQGSFDWFKG+MNEV+EMD++GVIEMHNYCTSVYEE
Sbjct  376   PRRKSGSDRRDFKTRRAYFYWVTREQGSFDWFKGVMNEVSEMDHKGVIEMHNYCTSVYEE  435

Query  783   GDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCG  604
             GDARSALITMLQSL+HAKNGVD+VSGTRVKSHFAKPNWR VYKRIALNH  ++VGVFYCG
Sbjct  436   GDARSALITMLQSLNHAKNGVDVVSGTRVKSHFAKPNWRTVYKRIALNHPTARVGVFYCG  495

Query  603   APALTTELRQLALDFSRKTST  541
             AP    ELRQLA DFS +T+T
Sbjct  496   APPPVKELRQLASDFSHRTTT  516



>ref|XP_004495711.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Cicer 
arietinum]
Length=879

 Score =   303 bits (777),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 145/198 (73%), Positives = 166/198 (84%), Gaps = 3/198 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggven---ggaATKNF  928
             YGAPAQDYK Y+V+LLVGLGIGATP+ISI+KD++NN+   ++ E GV          K F
Sbjct  682   YGAPAQDYKNYEVLLLVGLGIGATPLISILKDVLNNIKQQEDLEEGVIENGIKNNKKKPF  741

Query  927   RTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQ  748
              TK+AYFYWVTREQGSF+WFKG+MNEVAE D  GVIE+HNYCTSVYEEGDARSALITMLQ
Sbjct  742   ATKRAYFYWVTREQGSFEWFKGVMNEVAENDKEGVIELHNYCTSVYEEGDARSALITMLQ  801

Query  747   SLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLA  568
             S+HHAKNGVD+VS TRVK+HFA+PNWRNVYK +AL H D +VGVFYCG   L  ELR+L+
Sbjct  802   SIHHAKNGVDVVSETRVKTHFARPNWRNVYKHVALKHPDKRVGVFYCGTHGLVGELRKLS  861

Query  567   LDFSRKTSTKFDFHKENF  514
             LDFSRKT TKFDFHKENF
Sbjct  862   LDFSRKTGTKFDFHKENF  879



>ref|XP_008239295.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Prunus 
mume]
Length=940

 Score =   304 bits (779),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 168/211 (80%), Gaps = 16/211 (8%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATK-----  934
             YGAPAQDYK Y+VVLLVGLGIGATPMISI+KDIVNN+ A +EE   ++            
Sbjct  730   YGAPAQDYKNYEVVLLVGLGIGATPMISILKDIVNNIKAIEEEGEDMDALENGAPSRISK  789

Query  933   -----------NFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYE  787
                        NF+TK+AYFYWVTREQGSFDWFKG MNEVAE+D+  VIE HNYCTSVYE
Sbjct  790   VGSGSSQLGLHNFKTKRAYFYWVTREQGSFDWFKGAMNEVAELDHNRVIEFHNYCTSVYE  849

Query  786   EGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYC  607
             EGDARSALI MLQ+L HAKNGVDIVSGTRVKSHFAKPNWR VYKRIAL+HT++ VGVFYC
Sbjct  850   EGDARSALIHMLQTLSHAKNGVDIVSGTRVKSHFAKPNWREVYKRIALDHTNATVGVFYC  909

Query  606   GAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             G PA   ELRQL+ DFS KT+T+FDFHKENF
Sbjct  910   GLPAPANELRQLSHDFSHKTTTQFDFHKENF  940



>ref|XP_006283129.1| hypothetical protein CARUB_v10004156mg [Capsella rubella]
 gb|EOA16027.1| hypothetical protein CARUB_v10004156mg [Capsella rubella]
Length=813

 Score =   302 bits (773),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 144/199 (72%), Positives = 164/199 (82%), Gaps = 4/199 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaA----TKN  931
             YGAPAQDYKKY+VVLLVGLGIGATPMISI+KDI+NNM A +  +       +      + 
Sbjct  615   YGAPAQDYKKYEVVLLVGLGIGATPMISIIKDIINNMEAKEHAQLNQPGKNSQHGKIIET  674

Query  930   FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITML  751
             FRT+KAYFYWVTREQGS+DWFK IMNE+AE D   +IE+HNYCTSVYEEGD RSALI ML
Sbjct  675   FRTRKAYFYWVTREQGSYDWFKNIMNEIAERDKSKIIELHNYCTSVYEEGDVRSALIHML  734

Query  750   QSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQL  571
             QSL+HAK+G+DIVSGTRV SHFAKPNW NVYK+IA++H  S VGVFYCGAPALT ELR L
Sbjct  735   QSLNHAKSGLDIVSGTRVMSHFAKPNWENVYKQIAMDHPGSNVGVFYCGAPALTKELRHL  794

Query  570   ALDFSRKTSTKFDFHKENF  514
             AL+F+ KT TKF FHKENF
Sbjct  795   ALEFTHKTRTKFSFHKENF  813



>ref|XP_006382490.1| respiratory burst oxidase protein B [Populus trichocarpa]
 gb|ERP60287.1| respiratory burst oxidase protein B [Populus trichocarpa]
Length=876

 Score =   303 bits (776),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 146/198 (74%), Positives = 168/198 (85%), Gaps = 3/198 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaA---TKNF  928
             YGAPAQDYKKYDV+LLVGLGIGATP+ISIVKD++NN+    E E G+   G      K F
Sbjct  679   YGAPAQDYKKYDVLLLVGLGIGATPLISIVKDVLNNIKQQKEMEEGLVESGIKGNYRKPF  738

Query  927   RTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQ  748
              TK+AYFYWVTREQGSF+WF+G+MNEVA+ D   VIE+HNYCTSVYEEGDARSALITMLQ
Sbjct  739   ATKRAYFYWVTREQGSFEWFRGVMNEVADYDQDRVIELHNYCTSVYEEGDARSALITMLQ  798

Query  747   SLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLA  568
             SL HAK+GVDIVS TRVK+HFA+PNWR V+K +A+N+ D +VGVFYCGAP LT ELR+LA
Sbjct  799   SLQHAKSGVDIVSETRVKTHFARPNWRKVFKHVAVNYPDQRVGVFYCGAPGLTGELRRLA  858

Query  567   LDFSRKTSTKFDFHKENF  514
              DFSRKT+TKFDFHKENF
Sbjct  859   QDFSRKTTTKFDFHKENF  876



>ref|XP_011082784.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Sesamum 
indicum]
Length=921

 Score =   303 bits (776),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 170/214 (79%), Gaps = 19/214 (9%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaade------------------  973
             YGAP QDYK YDVVLLVGLGIGATPMIS+VKDIVNN+ A +E                  
Sbjct  708   YGAPTQDYKDYDVVLLVGLGIGATPMISVVKDIVNNIKAMEEDENAVEGVGGGNGPPSTH  767

Query  972   -eeggvenggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTS  796
                      G+  ++FRT++AYFYWVTREQGSF+WFKG+MNEVAEMD++ VIEMHNYCTS
Sbjct  768   LTPKRKTGSGSGRQDFRTRRAYFYWVTREQGSFEWFKGVMNEVAEMDHKRVIEMHNYCTS  827

Query  795   VYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGV  616
             VYEEGDARSALI MLQS++HAKNGVDIVSGTRV SHFAKPNW++VYK IALNH +++VGV
Sbjct  828   VYEEGDARSALIAMLQSINHAKNGVDIVSGTRVMSHFAKPNWKSVYKGIALNHPNARVGV  887

Query  615   FYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             FYCGAP    EL+QLA DFS KTSTKF+FHKENF
Sbjct  888   FYCGAPPPVKELKQLAYDFSHKTSTKFEFHKENF  921



>ref|XP_010549734.1| PREDICTED: respiratory burst oxidase homolog protein B [Tarenaya 
hassleriana]
Length=899

 Score =   303 bits (775),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 170/196 (87%), Gaps = 1/196 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM-TaadeeeggvenggaATKNFRT  922
             YGAPAQDY+ YDV+LLVGLGIGATP+ISI+KD++NN+ T    E+G   +   A K+F T
Sbjct  704   YGAPAQDYRNYDVLLLVGLGIGATPLISIIKDVINNIKTQKSIEDGSGNDHKNAKKHFAT  763

Query  921   KKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSL  742
             K+ YFYWVTREQGSF+WF+ +MNEVAE D   +IE+HNYCTSVYEEGDARSALITMLQSL
Sbjct  764   KRVYFYWVTREQGSFEWFREVMNEVAEYDTDRIIELHNYCTSVYEEGDARSALITMLQSL  823

Query  741   HHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALD  562
             HHAKNGVDIVSGTRV++HFA+PNWR+V+K +A+NH D ++GVFYCG P+LT ELR+L+ D
Sbjct  824   HHAKNGVDIVSGTRVRTHFARPNWRSVFKHVAVNHVDQRIGVFYCGRPSLTGELRRLSQD  883

Query  561   FSRKTSTKFDFHKENF  514
             FSRKT+TKF+FHKENF
Sbjct  884   FSRKTTTKFEFHKENF  899



>ref|XP_010438933.1| PREDICTED: putative respiratory burst oxidase homolog protein 
G [Camelina sativa]
Length=429

 Score =   291 bits (744),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 163/199 (82%), Gaps = 4/199 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATK----N  931
             YGAPAQDYKKY+VVLL+GLGIGATPMISI+KDI+NN    ++     +      +     
Sbjct  231   YGAPAQDYKKYEVVLLIGLGIGATPMISIIKDIINNTETKEQLSQMEKGSQQKPQVKKET  290

Query  930   FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITML  751
             F+T++AYFYWVT+E+G+FDWFK IMNE+AE D   VIE+HN+CTSVYEEGD RSALI ML
Sbjct  291   FKTRRAYFYWVTKEEGTFDWFKNIMNEIAERDTSKVIELHNHCTSVYEEGDVRSALIRML  350

Query  750   QSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQL  571
             QSL++AKNG+DIV+GTRV SHFA+PNW+NVYK+IA++H  + VGVFYCGAP LT ELR L
Sbjct  351   QSLNYAKNGLDIVAGTRVMSHFARPNWKNVYKQIAMDHPGANVGVFYCGAPVLTKELRHL  410

Query  570   ALDFSRKTSTKFDFHKENF  514
             AL+F+ KTST+F FHKENF
Sbjct  411   ALEFTHKTSTRFSFHKENF  429



>ref|XP_009360267.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Pyrus 
x bretschneideri]
 ref|XP_009360299.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Pyrus 
x bretschneideri]
Length=947

 Score =   303 bits (777),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 169/219 (77%), Gaps = 24/219 (11%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM----------------------T  985
             YGAPAQ+YK Y+VVLLVGLGIGATPMISI+KDIVNN+                      T
Sbjct  729   YGAPAQEYKTYEVVLLVGLGIGATPMISILKDIVNNIKAMEEEEEDNALENDGGGGDGGT  788

Query  984   aadeeeggvenggaATK--NFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMH  811
                 +      G A T+  NF+ K+AYFYWVTREQ SFDWFKG MNEVAE+D+  VIE H
Sbjct  789   KLPHKSSKTHTGSAFTRHHNFQIKRAYFYWVTREQDSFDWFKGAMNEVAELDHNRVIEFH  848

Query  810   NYCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTD  631
             NYCTSVYEEGDARSALI MLQSL HAKNGVDIVSGTRVKSHFAKPNWR VYKRIAL+HTD
Sbjct  849   NYCTSVYEEGDARSALIAMLQSLSHAKNGVDIVSGTRVKSHFAKPNWREVYKRIALDHTD  908

Query  630   SKVGVFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             + VGVFYCG PALT +LRQL+LDFS KTST+F+FHKENF
Sbjct  909   ATVGVFYCGPPALTEKLRQLSLDFSHKTSTRFEFHKENF  947



>emb|CDX70035.1| BnaA10g23840D [Brassica napus]
Length=886

 Score =   302 bits (773),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 163/195 (84%), Gaps = 0/195 (0%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDYK ++VVLLVGLGIGATPMISIVKDI+NN+    + E G  +    ++ FRTK
Sbjct  692   YGAPAQDYKNFEVVLLVGLGIGATPMISIVKDIINNIKGNGDIEEGRNSNRRQSETFRTK  751

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             +AYFYWVTREQGSFDWFK +M+EVA  D   VIE+HNYCTSVYEEGDARSALITMLQSLH
Sbjct  752   RAYFYWVTREQGSFDWFKNVMDEVALTDRNKVIELHNYCTSVYEEGDARSALITMLQSLH  811

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             HAK+GVD+VSGTRV SHFA+PNWR+VYKRIA+ H  ++VGVFYCGA  L  ELR LALDF
Sbjct  812   HAKHGVDVVSGTRVMSHFARPNWRSVYKRIAVKHPKTRVGVFYCGAAGLVKELRHLALDF  871

Query  558   SRKTSTKFDFHKENF  514
             S  TSTKF FHKENF
Sbjct  872   SHNTSTKFCFHKENF  886



>ref|XP_008797083.1| PREDICTED: respiratory burst oxidase homolog protein C [Phoenix 
dactylifera]
Length=934

 Score =   303 bits (775),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/220 (67%), Positives = 168/220 (76%), Gaps = 25/220 (11%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATK-----  934
             YGAPAQDYK Y+VVLLVGLGIGATP ISIVKDI NNM   + E      G    +     
Sbjct  715   YGAPAQDYKNYEVVLLVGLGIGATPFISIVKDIANNMKQLESEGLLDSEGDRDLEGGVGG  774

Query  933   --------------------NFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEM  814
                                  FRT++AYFYWVTREQGSF+WF+G+MNEVAE D +G+IE+
Sbjct  775   DDGSSSSKRAGGSSQRHGGTTFRTRRAYFYWVTREQGSFEWFRGVMNEVAETDKKGMIEL  834

Query  813   HNYCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHT  634
             H YCTSVYEEGDARSALI MLQSL+HAK+GVD+VSGTRVKSHFA+P+WRNVYKRIALNH 
Sbjct  835   HTYCTSVYEEGDARSALIAMLQSLNHAKHGVDVVSGTRVKSHFARPHWRNVYKRIALNHR  894

Query  633   DSKVGVFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             D ++GVFYCGAP LT ELRQLA DFSRKT+TKFDF+KENF
Sbjct  895   DQRIGVFYCGAPTLTKELRQLAHDFSRKTTTKFDFNKENF  934



>ref|XP_010032776.1| PREDICTED: respiratory burst oxidase homolog protein D [Eucalyptus 
grandis]
 gb|KCW52247.1| hypothetical protein EUGRSUZ_J01662 [Eucalyptus grandis]
Length=967

 Score =   303 bits (775),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 172/221 (78%), Gaps = 26/221 (12%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKN----  931
             YGAPAQDY+KY+VVLLVGLGIGATPM+SIVKDI+NN+   + E+  + +  +  +     
Sbjct  747   YGAPAQDYQKYEVVLLVGLGIGATPMVSIVKDIINNIKVKENEQDHMGSLESGGRPVSPL  806

Query  930   ----------------------FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIE  817
                                   F+T+KAYFYWVTREQGSF+WFKGIM+EVA MD R VIE
Sbjct  807   TPDDSNSHYPKAGHRSSHGRGAFKTRKAYFYWVTREQGSFEWFKGIMDEVAGMDERQVIE  866

Query  816   MHNYCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNH  637
             +HNYCTSV+EEGDARSALI MLQ+L+HAK+GVD+VSGTRV SHFAKPNWR VYK+IAL+H
Sbjct  867   LHNYCTSVFEEGDARSALIAMLQTLNHAKHGVDVVSGTRVMSHFAKPNWRQVYKKIALHH  926

Query  636   TDSKVGVFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
              D +VGVFYCGAPALT EL  LALDFSRKTSTKFDFHKENF
Sbjct  927   PDKRVGVFYCGAPALTKELNHLALDFSRKTSTKFDFHKENF  967



>gb|EEC68302.1| hypothetical protein OsI_36373 [Oryza sativa Indica Group]
Length=983

 Score =   303 bits (776),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 150/233 (64%), Positives = 173/233 (74%), Gaps = 38/233 (16%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeg----gvenggaATKN  931
             YGAPAQDYK+YD+VLLVGLGIGATPMISI+KDI+NNM   D +         +  +A   
Sbjct  751   YGAPAQDYKQYDIVLLVGLGIGATPMISIIKDIINNMRQLDGDLEDGDGNDNSVSSAAAA  810

Query  930   FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITML  751
             F+T++AYFYWVTREQGSF+WF+G+M+EVAE D +GVIE+HNYCTSVYEEGDARSALI ML
Sbjct  811   FKTRRAYFYWVTREQGSFEWFRGVMDEVAETDKKGVIELHNYCTSVYEEGDARSALIAML  870

Query  750   QSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKV-----------------  622
             QSL+HAK+GVD+VSGTRVK+HFA+PNWRNVYKRIALNH D +V                 
Sbjct  871   QSLNHAKHGVDVVSGTRVKTHFARPNWRNVYKRIALNHRDQRVADGDKHDQSFEVECSIG  930

Query  621   -----------------GVFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
                              GVFYCGAP LT ELR+LA DFSRKTSTKFDFHKENF
Sbjct  931   SSDGLGAAVIKVEQEPAGVFYCGAPVLTKELRELAQDFSRKTSTKFDFHKENF  983



>ref|XP_008450637.1| PREDICTED: respiratory burst oxidase homolog protein B isoform 
X1 [Cucumis melo]
Length=889

 Score =   301 bits (771),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 166/195 (85%), Gaps = 2/195 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDYK+YDV+LLVGLGIGATP+ISIVKD++NN+   ++++          K F TK
Sbjct  697   YGAPAQDYKQYDVLLLVGLGIGATPLISIVKDVLNNI--KEQKDIENGVADKQAKPFVTK  754

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             +AYFYWVTREQGSF+WF+G+M+EVAE D   VIE+HNYCTSVYEEGDARSALITMLQ L+
Sbjct  755   RAYFYWVTREQGSFEWFRGVMDEVAENDRDRVIELHNYCTSVYEEGDARSALITMLQDLN  814

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             HAKNGVDIVSGTRVK+HFA+PNWRNV K +A+NH D +VGVFYCGA  L  ELR+L+ DF
Sbjct  815   HAKNGVDIVSGTRVKTHFARPNWRNVLKHVAVNHPDQRVGVFYCGAQGLVGELRRLSQDF  874

Query  558   SRKTSTKFDFHKENF  514
             SRKT+TKFDFHKENF
Sbjct  875   SRKTTTKFDFHKENF  889



>ref|XP_010523340.1| PREDICTED: respiratory burst oxidase homolog protein A isoform 
X1 [Tarenaya hassleriana]
Length=895

 Score =   301 bits (771),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 144/206 (70%), Positives = 163/206 (79%), Gaps = 11/206 (5%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM-----------Taadeeeggven  952
             YGAPAQDYKK++VVLLVGLGIGATPMISIV+DIVNN+                      +
Sbjct  690   YGAPAQDYKKFEVVLLVGLGIGATPMISIVRDIVNNIRSKGDEDSAGRMTRSRNVIIPSS  749

Query  951   ggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDAR  772
                  + FRT++AYFYWVTREQGSF+WFK +M+E AE D   VIEMHNYCTSVYEEGDAR
Sbjct  750   PARKREGFRTRRAYFYWVTREQGSFEWFKNVMDEAAEPDLNNVIEMHNYCTSVYEEGDAR  809

Query  771   SALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPAL  592
             SALI MLQSL+HAKNGVD+VSGTRV SHFAKPNWR+V+KR+A+ H  ++VGVFYCGAPAL
Sbjct  810   SALIAMLQSLNHAKNGVDVVSGTRVMSHFAKPNWRSVFKRVAVKHPKTRVGVFYCGAPAL  869

Query  591   TTELRQLALDFSRKTSTKFDFHKENF  514
             T ELR LALDFS KTSTKF FHKENF
Sbjct  870   TKELRHLALDFSHKTSTKFSFHKENF  895



>ref|XP_004135613.1| PREDICTED: respiratory burst oxidase homolog protein B isoform 
X1 [Cucumis sativus]
 gb|KGN66068.1| hypothetical protein Csa_1G569450 [Cucumis sativus]
Length=889

 Score =   301 bits (770),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 167/195 (86%), Gaps = 2/195 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDYK+YDV+LLVGLGIGATP+ISIVKD++NN+   D+++     G    K F TK
Sbjct  697   YGAPAQDYKQYDVLLLVGLGIGATPLISIVKDVLNNI--KDQKDIENGVGDKQAKPFVTK  754

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             +AYFYWVTREQGSF+WF+G+M+EVAE D   VIE+HNYCTSVYEEGDARSALITMLQ L+
Sbjct  755   RAYFYWVTREQGSFEWFRGVMDEVAENDRDRVIELHNYCTSVYEEGDARSALITMLQDLN  814

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             HAKNGVDIVSGTRVK+HFA+PNWRNV K +A+NH D +VGVFYCGA  L  ELR+L+ DF
Sbjct  815   HAKNGVDIVSGTRVKTHFARPNWRNVLKHVAVNHPDQRVGVFYCGAQGLVGELRRLSQDF  874

Query  558   SRKTSTKFDFHKENF  514
             SRKT+TKFDFHKENF
Sbjct  875   SRKTTTKFDFHKENF  889



>gb|KJB07927.1| hypothetical protein B456_001G053300 [Gossypium raimondii]
Length=907

 Score =   301 bits (770),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 169/216 (78%), Gaps = 21/216 (10%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTa---------------------  982
             YGAPAQDYKKY++VLL+GLGIGATPMISIVKDIVNN+ A                     
Sbjct  692   YGAPAQDYKKYEIVLLIGLGIGATPMISIVKDIVNNIKAKEEQEGEEEEDNMNALENGNG  751

Query  981   adeeeggvenggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYC  802
             A   +  + N     +NF+T++AYFYWVTREQ SFDWFKGIMNEVAEMD   VIE+HNYC
Sbjct  752   AAINKTSLSNSKRRLENFKTRRAYFYWVTREQESFDWFKGIMNEVAEMDRNHVIELHNYC  811

Query  801   TSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKV  622
             TSVYEEGDA SALITMLQ+L+HAKNGVD+VSGT VKSHFAKP+WR VYK+IA+ H +++V
Sbjct  812   TSVYEEGDACSALITMLQALNHAKNGVDVVSGTIVKSHFAKPDWRRVYKQIAVKHNNARV  871

Query  621   GVFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             GVFYCG PAL  ELRQLA DFSR TSTKFDFHKENF
Sbjct  872   GVFYCGIPALIEELRQLASDFSRNTSTKFDFHKENF  907



>emb|CDP15485.1| unnamed protein product [Coffea canephora]
Length=879

 Score =   299 bits (766),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 167/198 (84%), Gaps = 3/198 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggven---ggaATKNF  928
             YGAPAQDYKKYD++LLVGLGIGATP+ISIVKD++NN+    E E G+          K F
Sbjct  682   YGAPAQDYKKYDILLLVGLGIGATPLISIVKDVLNNIKQQKEIEEGLAENGLKDIKKKPF  741

Query  927   RTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQ  748
               ++AYFYWVTR+QGSF+WF+G+MN+VAE D  G+IE+HNYCTSVYEEGDARSALITMLQ
Sbjct  742   AARRAYFYWVTRDQGSFEWFRGVMNDVAEHDKEGLIELHNYCTSVYEEGDARSALITMLQ  801

Query  747   SLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLA  568
             ++ HAK+G+DIVSGTRVK+HFA+PNWR V+K +A+NH D K+GVFYCG P+L  ++RQLA
Sbjct  802   AIQHAKSGIDIVSGTRVKTHFARPNWRQVFKHVAVNHADQKIGVFYCGPPSLVADMRQLA  861

Query  567   LDFSRKTSTKFDFHKENF  514
              DFSRKT+TKF+FHKENF
Sbjct  862   QDFSRKTTTKFEFHKENF  879



>gb|ADR70881.1| respiratory burst oxidase B [Manihot esculenta]
Length=885

 Score =   299 bits (766),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 166/198 (84%), Gaps = 3/198 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaA---TKNF  928
             YGAPAQDYK YDV+LLVGLGIGATP+ISIVKD++NN+    E E G+   G      K F
Sbjct  688   YGAPAQDYKNYDVLLLVGLGIGATPLISIVKDVLNNIKQQKEIEEGMVESGIKGNKRKPF  747

Query  927   RTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQ  748
              TK+AYFYWVTREQGSF+WF+G+MNEVA+ D   VIE+HNYCTSVYEEGDARSALI MLQ
Sbjct  748   ATKRAYFYWVTREQGSFEWFRGVMNEVADYDQDRVIELHNYCTSVYEEGDARSALIAMLQ  807

Query  747   SLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLA  568
             SL HAKNGVD+VS TRVK+HFA+PNWR V+K +A+N+ + KVGVFYCGAP LT ELR+LA
Sbjct  808   SLQHAKNGVDVVSETRVKTHFARPNWRKVFKHVAVNYPNQKVGVFYCGAPGLTGELRRLA  867

Query  567   LDFSRKTSTKFDFHKENF  514
              DFSRKT+TKFDFHKENF
Sbjct  868   QDFSRKTTTKFDFHKENF  885



>ref|XP_004503856.1| PREDICTED: respiratory burst oxidase homolog protein C-like [Cicer 
arietinum]
Length=933

 Score =   300 bits (767),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 170/204 (83%), Gaps = 9/204 (4%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKN----  931
             YGAPAQ Y++Y+VVLLVGLGIGATPMISI+KD+VNN  A +EE+      G+   N    
Sbjct  730   YGAPAQKYREYEVVLLVGLGIGATPMISILKDMVNNFKAMEEEDEFSIEEGSPMTNNQKD  789

Query  930   -----FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSA  766
                  F+T++AYFYWVTREQGSFDWFKG+MNEVAE D RG+IE+H+YCTSVYE+GDARSA
Sbjct  790   TRFNDFKTRRAYFYWVTREQGSFDWFKGVMNEVAEEDRRGLIELHSYCTSVYEQGDARSA  849

Query  765   LITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTT  586
             LI M+QS++HAK GVD+VSGTRVKSHFAKPNWR+VYKRIALNH +++VGVFYCG   LT 
Sbjct  850   LIAMVQSINHAKKGVDVVSGTRVKSHFAKPNWRSVYKRIALNHPEARVGVFYCGPSTLTH  909

Query  585   ELRQLALDFSRKTSTKFDFHKENF  514
             EL QLALDFS  TSTK+DFHKENF
Sbjct  910   ELHQLALDFSHNTSTKYDFHKENF  933



>ref|XP_010491345.1| PREDICTED: respiratory burst oxidase homolog protein A-like [Camelina 
sativa]
Length=891

 Score =   299 bits (765),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 163/206 (79%), Gaps = 11/206 (5%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM-----------Taadeeeggven  952
             YGAPAQDYKK+DVVLLVGLGIGATPMISIVKDI+NN+           +          +
Sbjct  686   YGAPAQDYKKFDVVLLVGLGIGATPMISIVKDIINNLKGNGEGSNRRQSPIHNMVSPPLS  745

Query  951   ggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDAR  772
                 ++ FRTK+AYFYWVTREQGSFDWFK +M+EVAE D   VIE+HNYCTSVYEEGDAR
Sbjct  746   PARKSEAFRTKRAYFYWVTREQGSFDWFKNVMDEVAETDRNNVIELHNYCTSVYEEGDAR  805

Query  771   SALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPAL  592
             SALITMLQSL+HAKNGVD+VSGT V SHFA+PNWR+V+KRIA+ H  ++VGVFYCGA  L
Sbjct  806   SALITMLQSLNHAKNGVDVVSGTHVMSHFARPNWRSVFKRIAVKHPKTRVGVFYCGAAGL  865

Query  591   TTELRQLALDFSRKTSTKFDFHKENF  514
               ELR L+LDFS KTSTKF FHKENF
Sbjct  866   VKELRHLSLDFSHKTSTKFIFHKENF  891



>ref|XP_007147029.1| hypothetical protein PHAVU_006G090200g [Phaseolus vulgaris]
 gb|AEX56132.1| NADPH oxidase [Phaseolus vulgaris]
 gb|ESW19023.1| hypothetical protein PHAVU_006G090200g [Phaseolus vulgaris]
Length=881

 Score =   299 bits (765),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 166/197 (84%), Gaps = 2/197 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKN--FR  925
             YGAPAQDYK Y+V+LLVGLGIGATP+ISI+KD++NNM    + E G+   G   K   F 
Sbjct  685   YGAPAQDYKNYEVILLVGLGIGATPLISILKDVLNNMKQQKDLEEGIVESGVKNKRKPFA  744

Query  924   TKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQS  745
             T +AYFYWVTREQGSF+WFKG+M+EVAE D  G+IE+HNYCTSVYEEGDARSALITMLQS
Sbjct  745   TNRAYFYWVTREQGSFEWFKGVMDEVAEYDKDGIIELHNYCTSVYEEGDARSALITMLQS  804

Query  744   LHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLAL  565
             LHHAK+GVDIVSGTRVK+HFA+PNWR+V+K  AL H   +VGVFYCGA  L  EL++L+L
Sbjct  805   LHHAKSGVDIVSGTRVKTHFARPNWRSVFKHTALKHPGKRVGVFYCGAHTLVGELKRLSL  864

Query  564   DFSRKTSTKFDFHKENF  514
             DFSRKT+TKFDFHKENF
Sbjct  865   DFSRKTNTKFDFHKENF  881



>ref|XP_008800853.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Phoenix 
dactylifera]
Length=880

 Score =   298 bits (764),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 164/195 (84%), Gaps = 0/195 (0%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDY+ YDV+LL+GLGIGATP+ISI+KD++NN+       G VE G    K F T+
Sbjct  686   YGAPAQDYRNYDVLLLIGLGIGATPLISILKDVLNNIKQNGVVAGDVEGGNKLKKAFMTQ  745

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             +AYFYWVTRE+GSF+WF+G+MNEVAE D  GVIE+HN+CTSVYEEGDARSALI MLQ+LH
Sbjct  746   RAYFYWVTREEGSFEWFRGVMNEVAEKDKDGVIELHNHCTSVYEEGDARSALIVMLQALH  805

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             HAKNGVDIVSGTRVK+HFA+PNWRNV+K +A+NH   +VGVFYCG   L  ELR+LA DF
Sbjct  806   HAKNGVDIVSGTRVKTHFARPNWRNVFKHVAINHQKQRVGVFYCGQQTLVAELRRLAQDF  865

Query  558   SRKTSTKFDFHKENF  514
             S KT+TKFDFHKENF
Sbjct  866   SHKTNTKFDFHKENF  880



>ref|XP_010931626.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Elaeis 
guineensis]
Length=885

 Score =   298 bits (764),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 165/195 (85%), Gaps = 0/195 (0%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDY+KYDV+LL+GLGIGATP+ISI+KD++NN+       G VE G    K F T+
Sbjct  691   YGAPAQDYRKYDVLLLIGLGIGATPLISILKDVLNNIKQNGAVAGDVEGGNKPKKAFMTQ  750

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             +AYFYWVTRE+GSF+WF+G+MNEVAE D  GVIE+HN+CTSVYEEGDARSALI MLQ+LH
Sbjct  751   RAYFYWVTREEGSFEWFRGVMNEVAEKDKDGVIELHNHCTSVYEEGDARSALIVMLQALH  810

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             HAKNGVDIVSGTRVK+HFA+PNWRNV+K +A+NH + +VGVFYCG   L  ELR+LA DF
Sbjct  811   HAKNGVDIVSGTRVKTHFARPNWRNVFKHVAVNHQNQRVGVFYCGQQTLVAELRRLAQDF  870

Query  558   SRKTSTKFDFHKENF  514
             S KT+TKF FHKENF
Sbjct  871   SHKTNTKFQFHKENF  885



>ref|XP_012089018.1| PREDICTED: respiratory burst oxidase homolog protein B [Jatropha 
curcas]
 gb|KDP23484.1| hypothetical protein JCGZ_23317 [Jatropha curcas]
Length=891

 Score =   298 bits (764),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 166/198 (84%), Gaps = 3/198 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaA---TKNF  928
             YGAPAQDYKKYDV+LLVGLGIGATP+ISI+KD++NN+    + E G+   G      K F
Sbjct  694   YGAPAQDYKKYDVLLLVGLGIGATPLISIIKDVLNNIKQQKDLEEGIVESGIKGNKRKPF  753

Query  927   RTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQ  748
              TK AYFYWVTREQGSF+WF+G+MNEVA+ D   VIE+HNYCTSVYEEGDARSALITMLQ
Sbjct  754   ATKHAYFYWVTREQGSFEWFRGVMNEVADYDQDRVIELHNYCTSVYEEGDARSALITMLQ  813

Query  747   SLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLA  568
             SL HAKNGVD+VS TRVK+HFA+PNWR V+K +A+N+ D +VGVFYCGAP LT EL +LA
Sbjct  814   SLQHAKNGVDVVSETRVKTHFARPNWRKVFKHVAVNYPDQRVGVFYCGAPGLTGELTRLA  873

Query  567   LDFSRKTSTKFDFHKENF  514
              DFSRKT+TKFDFHKENF
Sbjct  874   HDFSRKTTTKFDFHKENF  891



>gb|KHN03979.1| Respiratory burst oxidase like protein B [Glycine soja]
Length=777

 Score =   296 bits (758),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 166/197 (84%), Gaps = 2/197 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKN--FR  925
             YGAPAQDYK Y+V+LLVGLGIGATP+ISI+KD++NNM    + E G+   G   K   F 
Sbjct  581   YGAPAQDYKNYEVILLVGLGIGATPLISILKDVLNNMKQQKDIEEGMVESGVKNKRKPFA  640

Query  924   TKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQS  745
             T +AYFYWVTREQGSF+WFKG+M++VAE D  G+IE+HNYCTSVYEEGDARSALITMLQS
Sbjct  641   TNRAYFYWVTREQGSFEWFKGVMDDVAEYDKDGIIELHNYCTSVYEEGDARSALITMLQS  700

Query  744   LHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLAL  565
             LHHAK+GVDIVSGTRVK+HFA+PNWR+V+K  AL H   +VGVFYCGA  L  EL++L+L
Sbjct  701   LHHAKSGVDIVSGTRVKTHFARPNWRSVFKHTALKHPGKRVGVFYCGAHTLVGELKRLSL  760

Query  564   DFSRKTSTKFDFHKENF  514
             DFSRKT+TKFDFHKENF
Sbjct  761   DFSRKTNTKFDFHKENF  777



>ref|XP_010674039.1| PREDICTED: respiratory burst oxidase homolog protein B [Beta 
vulgaris subsp. vulgaris]
Length=887

 Score =   298 bits (763),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 166/197 (84%), Gaps = 2/197 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggven--ggaATKNFR  925
             YGAPAQDYKKYDV+LLVGLGIGATP+ISI+KD++ ++    + E G+ +       K F 
Sbjct  691   YGAPAQDYKKYDVLLLVGLGIGATPLISILKDVLYHIKQQKDVEKGIADDFNVHKKKPFL  750

Query  924   TKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQS  745
              K+AYFYWVTREQGSFDWF+ +MNEVAE D   VIE+HNYCTSVYEEGDARSALI MLQS
Sbjct  751   VKRAYFYWVTREQGSFDWFRSVMNEVAENDRDNVIELHNYCTSVYEEGDARSALIAMLQS  810

Query  744   LHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLAL  565
             LHHAKNG+DIVSG++VK+HFA+PNWR V+K +A+NHTD +VGVFYCGAP LT +LR L+ 
Sbjct  811   LHHAKNGMDIVSGSKVKTHFARPNWRAVFKHVAINHTDKRVGVFYCGAPGLTQQLRHLSH  870

Query  564   DFSRKTSTKFDFHKENF  514
             DFSRKTSTKFDFHKENF
Sbjct  871   DFSRKTSTKFDFHKENF  887



>ref|XP_004230232.1| PREDICTED: respiratory burst oxidase homolog protein B [Solanum 
lycopersicum]
Length=865

 Score =   297 bits (761),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 139/195 (71%), Positives = 163/195 (84%), Gaps = 2/195 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDYKKYDVVLLVGLGIGATP+ISIVKD++NN+    + E G +    +   F TK
Sbjct  673   YGAPAQDYKKYDVVLLVGLGIGATPLISIVKDVLNNINQQKDIEDGTKGSKKSP--FATK  730

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             +AYFYWVTREQGSF+WFKG+M+EV+E D  G+IE+HNYCTSVYEEGDARSALITMLQS+H
Sbjct  731   RAYFYWVTREQGSFEWFKGVMDEVSENDQEGLIELHNYCTSVYEEGDARSALITMLQSIH  790

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
              AK+GVDIVSGTRVK+HFA+PNWR V+KR+ +NH D K+GVFYCG   L  ELR L+ DF
Sbjct  791   QAKSGVDIVSGTRVKTHFARPNWRQVFKRVTINHPDQKIGVFYCGPQGLVGELRHLSQDF  850

Query  558   SRKTSTKFDFHKENF  514
             S KT TKF+FHKENF
Sbjct  851   SHKTDTKFEFHKENF  865



>ref|XP_009402525.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Musa 
acuminata subsp. malaccensis]
Length=891

 Score =   298 bits (762),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 161/197 (82%), Gaps = 2/197 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKN--FR  925
             YGAPAQDY+ YDV+LL+GLGIGATP+ISIVKD++NN+                 K   F 
Sbjct  695   YGAPAQDYEHYDVLLLIGLGIGATPLISIVKDVLNNVEQKKTTAAADVESATKAKKKPFM  754

Query  924   TKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQS  745
              ++AYFYWVTRE+GSF+WF+GIMNEVAE D  GVIE+HN+CTSVYEEGDARSALI MLQ+
Sbjct  755   AQRAYFYWVTREEGSFEWFRGIMNEVAEKDKDGVIELHNHCTSVYEEGDARSALIVMLQA  814

Query  744   LHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLAL  565
             LHHAKNGVDIVSGTRVK+HFA+PNWRNV+KRIA+NH + +VGVFYCG P +  ELR+L+ 
Sbjct  815   LHHAKNGVDIVSGTRVKTHFARPNWRNVFKRIAINHPNQRVGVFYCGDPMVIGELRRLSQ  874

Query  564   DFSRKTSTKFDFHKENF  514
             DFS KTSTKF FHKENF
Sbjct  875   DFSHKTSTKFVFHKENF  891



>gb|EYU26891.1| hypothetical protein MIMGU_mgv1a001109mg [Erythranthe guttata]
Length=887

 Score =   298 bits (762),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 166/202 (82%), Gaps = 7/202 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggv-------enggaA  940
             YGAPAQDYKKYD+VLL+GLGIGATP+ISIVKD++NN+    + E G        ++    
Sbjct  686   YGAPAQDYKKYDIVLLIGLGIGATPLISIVKDVLNNIKQQKDIEKGSPLLENNIKSDKKK  745

Query  939   TKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALI  760
             T NF T++AYFYWVTREQGSF+WF+G+MNEVAE D+  VIE+HN+CTSVYEEGDARSALI
Sbjct  746   TSNFATRRAYFYWVTREQGSFEWFRGVMNEVAENDHDSVIELHNHCTSVYEEGDARSALI  805

Query  759   TMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTEL  580
              MLQSL HAK G+DIVSGTRVK+HFA+P+WR V+K +A+NH   +VGVFYCG P L  EL
Sbjct  806   AMLQSLEHAKTGLDIVSGTRVKTHFARPDWRRVFKNVAVNHAGQRVGVFYCGPPTLVGEL  865

Query  579   RQLALDFSRKTSTKFDFHKENF  514
             R+LA DFSRKTSTKFDFHKENF
Sbjct  866   RRLAHDFSRKTSTKFDFHKENF  887



>ref|XP_003630437.1| Respiratory burst oxidase-like protein [Medicago truncatula]
 gb|AET04913.1| respiratory burst oxidase-like protein D [Medicago truncatula]
Length=898

 Score =   298 bits (762),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 171/204 (84%), Gaps = 9/204 (4%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT------  937
             YGAPAQDY++Y+VVLLVGLGIGATPMISI+KD+VNN  A +EE+G     G+        
Sbjct  695   YGAPAQDYREYEVVLLVGLGIGATPMISILKDMVNNFKAMEEEDGFAMEEGSPMTPNQKD  754

Query  936   ---KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSA  766
                 +F+T++AYFYWVTREQGSFDWFKG+MN+V E D RG+IE+H+YCTSVYE+GDARSA
Sbjct  755   SRFSDFKTRRAYFYWVTREQGSFDWFKGVMNDVPEEDRRGLIELHSYCTSVYEQGDARSA  814

Query  765   LITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTT  586
             LI M+QS++HAK+GVD+VSGTRV SHFAKPNWR VYKRIALNH +++VGVFYCG   LT 
Sbjct  815   LIAMVQSINHAKHGVDVVSGTRVMSHFAKPNWRTVYKRIALNHPEAQVGVFYCGPSTLTH  874

Query  585   ELRQLALDFSRKTSTKFDFHKENF  514
             ELRQL+LDFS  TSTKFDFHKENF
Sbjct  875   ELRQLSLDFSHNTSTKFDFHKENF  898



>gb|AAC39475.1| respiratory burst oxidase protein A [Arabidopsis thaliana]
Length=902

 Score =   298 bits (762),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 164/206 (80%), Gaps = 11/206 (5%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM-----------Taadeeeggven  952
             YGAPAQDYKK++VVLLVGLGIGATPMISIV DI+NN+           +          +
Sbjct  697   YGAPAQDYKKFEVVLLVGLGIGATPMISIVSDIINNLKGVEEGSNRRQSPIHNMVTPPVS  756

Query  951   ggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDAR  772
                 ++ FRTK+AYFYWVTREQGSFDWFK +M+EV E D + VIE+HNYCTSVYEEGDAR
Sbjct  757   PSRKSETFRTKRAYFYWVTREQGSFDWFKNVMDEVTETDRKNVIELHNYCTSVYEEGDAR  816

Query  771   SALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPAL  592
             SALITMLQSL+HAK+GVD+VSGTRV SHFA+PNWR+V+KRIA+NH  ++VGVFYCGA  L
Sbjct  817   SALITMLQSLNHAKHGVDVVSGTRVMSHFARPNWRSVFKRIAVNHPKTRVGVFYCGAAGL  876

Query  591   TTELRQLALDFSRKTSTKFDFHKENF  514
               ELR L+LDFS KTSTKF FHKENF
Sbjct  877   VKELRHLSLDFSHKTSTKFIFHKENF  902



>ref|NP_196356.1| Respiratory burst oxidase-A [Arabidopsis thaliana]
 sp|O81209.2|RBOHA_ARATH RecName: Full=Respiratory burst oxidase homolog protein A; AltName: 
Full=NADPH oxidase RBOHA; Short=AtRBOHA [Arabidopsis 
thaliana]
 emb|CAB87928.1| respiratory burst oxidase protein A [Arabidopsis thaliana]
 gb|AAO41907.1| putative respiratory burst oxidase protein A [Arabidopsis thaliana]
 gb|AED91151.1| Respiratory burst oxidase-A [Arabidopsis thaliana]
Length=902

 Score =   298 bits (762),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 164/206 (80%), Gaps = 11/206 (5%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM-----------Taadeeeggven  952
             YGAPAQDYKK++VVLLVGLGIGATPMISIV DI+NN+           +          +
Sbjct  697   YGAPAQDYKKFEVVLLVGLGIGATPMISIVSDIINNLKGVEEGSNRRQSPIHNMVTPPVS  756

Query  951   ggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDAR  772
                 ++ FRTK+AYFYWVTREQGSFDWFK +M+EV E D + VIE+HNYCTSVYEEGDAR
Sbjct  757   PSRKSETFRTKRAYFYWVTREQGSFDWFKNVMDEVTETDRKNVIELHNYCTSVYEEGDAR  816

Query  771   SALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPAL  592
             SALITMLQSL+HAK+GVD+VSGTRV SHFA+PNWR+V+KRIA+NH  ++VGVFYCGA  L
Sbjct  817   SALITMLQSLNHAKHGVDVVSGTRVMSHFARPNWRSVFKRIAVNHPKTRVGVFYCGAAGL  876

Query  591   TTELRQLALDFSRKTSTKFDFHKENF  514
               ELR L+LDFS KTSTKF FHKENF
Sbjct  877   VKELRHLSLDFSHKTSTKFIFHKENF  902



>ref|XP_004304974.1| PREDICTED: respiratory burst oxidase homolog protein B [Fragaria 
vesca subsp. vesca]
Length=879

 Score =   297 bits (760),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 165/197 (84%), Gaps = 2/197 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATK--NFR  925
             YGAPAQDYK Y+V+LLVGLGIGATP+ISIVKD++NN+    E E  +       +   F 
Sbjct  683   YGAPAQDYKNYEVLLLVGLGIGATPLISIVKDVLNNIKRQKELEAQMLVENGVKRKSTFA  742

Query  924   TKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQS  745
             TK+AYFYW+TREQGSF+WF+G+MNEVAE D  G+IE+HNYCTSVYEEGDARSALITMLQS
Sbjct  743   TKRAYFYWITREQGSFEWFRGVMNEVAENDLDGLIELHNYCTSVYEEGDARSALITMLQS  802

Query  744   LHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLAL  565
             ++HAKNGVD+VSGTRVK+HFA+PNWRNV+K +A+ H D +VGVFYCGA  L  EL++LA 
Sbjct  803   INHAKNGVDVVSGTRVKTHFARPNWRNVFKHVAVKHPDQRVGVFYCGAHGLVGELKRLAQ  862

Query  564   DFSRKTSTKFDFHKENF  514
             DFSRKT TKFDFHKENF
Sbjct  863   DFSRKTETKFDFHKENF  879



>ref|XP_010423214.1| PREDICTED: respiratory burst oxidase homolog protein A-like isoform 
X1 [Camelina sativa]
 ref|XP_010423215.1| PREDICTED: respiratory burst oxidase homolog protein A-like isoform 
X2 [Camelina sativa]
 ref|XP_010423216.1| PREDICTED: respiratory burst oxidase homolog protein A-like isoform 
X3 [Camelina sativa]
Length=891

 Score =   297 bits (761),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 163/206 (79%), Gaps = 11/206 (5%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM-----------Taadeeeggven  952
             YGAPAQDYKK++VVLLVGLGIGATPMISIVKDI+NN+           +          +
Sbjct  686   YGAPAQDYKKFEVVLLVGLGIGATPMISIVKDIINNLKGNGEGSNRRQSPIHNMVSPPLS  745

Query  951   ggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDAR  772
                 ++ FRTK+AYFYWVTREQGSFDWFK +M+EVAE D   VIE+HNYCTSVYEEGDAR
Sbjct  746   PARKSEAFRTKRAYFYWVTREQGSFDWFKNVMDEVAETDRNNVIELHNYCTSVYEEGDAR  805

Query  771   SALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPAL  592
             SALITMLQSL+HAKNGVD+VSGT V SHFA+PNWR+V+KRIA+ H  ++VGVFYCGA  L
Sbjct  806   SALITMLQSLNHAKNGVDVVSGTHVMSHFARPNWRSVFKRIAVKHPKTRVGVFYCGAAGL  865

Query  591   TTELRQLALDFSRKTSTKFDFHKENF  514
               ELR L+LDFS KTSTKF FHKENF
Sbjct  866   VKELRHLSLDFSHKTSTKFIFHKENF  891



>ref|XP_003554649.1| PREDICTED: respiratory burst oxidase homolog protein B-like isoform 
1 [Glycine max]
Length=887

 Score =   297 bits (761),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 165/198 (83%), Gaps = 3/198 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT---KNF  928
             YGAPAQDYK Y+V+LLVGLGIGATP+ISI+KD++NNM    + E  +   G      K F
Sbjct  690   YGAPAQDYKNYEVILLVGLGIGATPLISILKDVLNNMKQQKDIEEAMVESGVKNNKRKPF  749

Query  927   RTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQ  748
              T +AYFYWVTREQGSF+WFKG+M++VAE D  G+IE+HNYCTSVYEEGDARSALITMLQ
Sbjct  750   ATNRAYFYWVTREQGSFEWFKGVMDDVAEYDKDGIIELHNYCTSVYEEGDARSALITMLQ  809

Query  747   SLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLA  568
             SLHHAK+GVDIVSGTRVK+HFA+PNWR+V+K  AL H   +VGVFYCGA  L  EL++L+
Sbjct  810   SLHHAKSGVDIVSGTRVKTHFARPNWRSVFKHTALKHPGKRVGVFYCGAHTLVGELKRLS  869

Query  567   LDFSRKTSTKFDFHKENF  514
             LDFSRKT+TKFDFHKENF
Sbjct  870   LDFSRKTNTKFDFHKENF  887



>gb|KHN43296.1| Respiratory burst oxidase like protein B [Glycine soja]
Length=866

 Score =   296 bits (759),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/198 (71%), Positives = 166/198 (84%), Gaps = 3/198 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT---KNF  928
             YGAPAQDYK Y+V+LLVGLGIGATP+ISI+KD++NNM    + E G+   G      K F
Sbjct  669   YGAPAQDYKNYEVILLVGLGIGATPLISILKDVLNNMKQQKDIEEGMVESGVKNNKRKPF  728

Query  927   RTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQ  748
              T +AYFYWVTREQGSF+WFKG+M++VAE D  G+IE+HNYCTSVYEEGDARSALITMLQ
Sbjct  729   ATNRAYFYWVTREQGSFEWFKGVMDDVAEYDKDGIIELHNYCTSVYEEGDARSALITMLQ  788

Query  747   SLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLA  568
             SLHHAK+GVDIVSGTRVK+HFA+PNWR+V+K  AL H   +VGVFYCGA  L  EL++L+
Sbjct  789   SLHHAKSGVDIVSGTRVKTHFARPNWRSVFKHTALKHPGKRVGVFYCGAHTLVGELKRLS  848

Query  567   LDFSRKTSTKFDFHKENF  514
             LDFSRKT+TKFDFHKENF
Sbjct  849   LDFSRKTNTKFDFHKENF  866



>ref|XP_003521697.1| PREDICTED: respiratory burst oxidase homolog protein B-like isoform 
1 [Glycine max]
Length=885

 Score =   297 bits (760),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 166/197 (84%), Gaps = 2/197 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKN--FR  925
             YGAPAQDYK Y+V+LLVGLGIGATP+ISI+KD++NNM    + E G+   G   K   F 
Sbjct  689   YGAPAQDYKNYEVILLVGLGIGATPLISILKDVLNNMKQQKDIEEGMVESGVKNKRKPFA  748

Query  924   TKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQS  745
             T +AYFYWVTREQGSF+WFKG+M++VAE D  G+IE+HNYCTSVYEEGDARSALITMLQS
Sbjct  749   TNRAYFYWVTREQGSFEWFKGVMDDVAEYDKDGIIELHNYCTSVYEEGDARSALITMLQS  808

Query  744   LHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLAL  565
             LHHAK+GVDIVSGTRVK+HFA+PNWR+V+K  AL H   +VGVFYCGA  L  EL++L+L
Sbjct  809   LHHAKSGVDIVSGTRVKTHFARPNWRSVFKHTALKHPGKRVGVFYCGAHTLVGELKRLSL  868

Query  564   DFSRKTSTKFDFHKENF  514
             DFSRKT+TKFDFHKENF
Sbjct  869   DFSRKTNTKFDFHKENF  885



>ref|NP_001170285.1| uncharacterized protein LOC100384248 [Zea mays]
 gb|ACN36476.1| unknown [Zea mays]
Length=294

 Score =   281 bits (718),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 159/197 (81%), Gaps = 2/197 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKN--FR  925
             YGAPAQDY++YDV+LL+GLGIGATP+ISIVKD++N+        G    G    K   F 
Sbjct  98    YGAPAQDYREYDVLLLIGLGIGATPLISIVKDVLNHTQHGGSVSGTEPEGSGKAKKRPFM  157

Query  924   TKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQS  745
             TK+AYFYWVTRE+GSF+WF+G+MNEVAE D  GVIE+HN+C+SVYEEGDARSALI MLQ 
Sbjct  158   TKRAYFYWVTREEGSFEWFRGVMNEVAEKDKDGVIELHNHCSSVYEEGDARSALIVMLQE  217

Query  744   LHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLAL  565
             L HAK GVDI+SGT VK+HFA+PNWR+V+K +A+NH + +VGVFYCG P L  +LRQ + 
Sbjct  218   LQHAKKGVDILSGTSVKTHFARPNWRSVFKHVAVNHENQRVGVFYCGEPVLVPQLRQWSA  277

Query  564   DFSRKTSTKFDFHKENF  514
             DF+ KT+TKF+FHKENF
Sbjct  278   DFTHKTNTKFEFHKENF  294



>gb|AEX56131.1| NADPH oxidase [Phaseolus vulgaris]
Length=876

 Score =   296 bits (759),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 165/200 (83%), Gaps = 5/200 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeegg-----venggaATK  934
             YGAPAQDY++Y+VVLLVGLGIGATPMISIVKD+V  +   +EEE             +  
Sbjct  677   YGAPAQDYREYEVVLLVGLGIGATPMISIVKDMVKMLKEIEEEEERGMEEGAAGAVKSDD  736

Query  933   NFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITM  754
              F+T++AYFYWVTREQGSFDWFKG+MNEVAE D + VIE+H+YCTSVYEEGDARSALI M
Sbjct  737   EFKTRRAYFYWVTREQGSFDWFKGVMNEVAEEDRKKVIELHSYCTSVYEEGDARSALIAM  796

Query  753   LQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQ  574
             LQS++HAKNG+DIVSGTRV SHFAKP+WRNV+KRIALNH   +VGVFYCG   LT ELRQ
Sbjct  797   LQSINHAKNGLDIVSGTRVMSHFAKPDWRNVFKRIALNHPHGRVGVFYCGPSNLTRELRQ  856

Query  573   LALDFSRKTSTKFDFHKENF  514
             L+LDFS  TSTKFDFHKENF
Sbjct  857   LSLDFSHNTSTKFDFHKENF  876



>ref|XP_007159934.1| hypothetical protein PHAVU_002G279700g [Phaseolus vulgaris]
 gb|ESW31928.1| hypothetical protein PHAVU_002G279700g [Phaseolus vulgaris]
Length=899

 Score =   297 bits (760),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/200 (72%), Positives = 165/200 (83%), Gaps = 5/200 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeegg-----venggaATK  934
             YGAPAQDY++Y+VVLLVGLGIGATPMISIVKD+V  +   +EEE             +  
Sbjct  700   YGAPAQDYREYEVVLLVGLGIGATPMISIVKDMVKMLKEIEEEEERGMEEGAAGAVKSDD  759

Query  933   NFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITM  754
              F+T++AYFYWVTREQGSFDWFKG+MNEVAE D + VIE+H+YCTSVYEEGDARSALI M
Sbjct  760   EFKTRRAYFYWVTREQGSFDWFKGVMNEVAEEDRKKVIELHSYCTSVYEEGDARSALIAM  819

Query  753   LQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQ  574
             LQS++HAKNG+DIVSGTRV SHFAKP+WRNV+KRIALNH   +VGVFYCG   LT ELRQ
Sbjct  820   LQSINHAKNGLDIVSGTRVMSHFAKPDWRNVFKRIALNHPHGRVGVFYCGPSNLTRELRQ  879

Query  573   LALDFSRKTSTKFDFHKENF  514
             L+LDFS  TSTKFDFHKENF
Sbjct  880   LSLDFSHNTSTKFDFHKENF  899



>ref|XP_008246416.1| PREDICTED: respiratory burst oxidase homolog protein B isoform 
X2 [Prunus mume]
Length=893

 Score =   296 bits (757),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 167/203 (82%), Gaps = 8/203 (4%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT------  937
             YGAPAQDYK+Y+V+LLVGLGIGATP+ISIVKD++ N+    E E    N           
Sbjct  691   YGAPAQDYKEYEVLLLVGLGIGATPLISIVKDVLTNIKQQKETEDHRGNMVENNGANKDN  750

Query  936   --KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSAL  763
               K+F TK+AYFYW+TREQGSF+WF+G+M+EVAE D  GVIE+HNYCTSVYEEGDARSAL
Sbjct  751   KRKSFVTKRAYFYWITREQGSFEWFRGVMDEVAENDKDGVIELHNYCTSVYEEGDARSAL  810

Query  762   ITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTE  583
             ITMLQSL+HAKNGVDIVSGTRVK+HFA+PNWRNV+K +A+ HT+ +VGVFYCGA  L  E
Sbjct  811   ITMLQSLNHAKNGVDIVSGTRVKTHFARPNWRNVFKHVAVKHTNQRVGVFYCGAHGLVGE  870

Query  582   LRQLALDFSRKTSTKFDFHKENF  514
             L++LA DFSRKT TKFDFHKENF
Sbjct  871   LKRLAQDFSRKTETKFDFHKENF  893



>ref|XP_008246413.1| PREDICTED: respiratory burst oxidase homolog protein B isoform 
X1 [Prunus mume]
Length=894

 Score =   296 bits (757),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 142/203 (70%), Positives = 167/203 (82%), Gaps = 8/203 (4%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT------  937
             YGAPAQDYK+Y+V+LLVGLGIGATP+ISIVKD++ N+    E E    N           
Sbjct  692   YGAPAQDYKEYEVLLLVGLGIGATPLISIVKDVLTNIKQQKETEDHRGNMVENNGANKDN  751

Query  936   --KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSAL  763
               K+F TK+AYFYW+TREQGSF+WF+G+M+EVAE D  GVIE+HNYCTSVYEEGDARSAL
Sbjct  752   KRKSFVTKRAYFYWITREQGSFEWFRGVMDEVAENDKDGVIELHNYCTSVYEEGDARSAL  811

Query  762   ITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTE  583
             ITMLQSL+HAKNGVDIVSGTRVK+HFA+PNWRNV+K +A+ HT+ +VGVFYCGA  L  E
Sbjct  812   ITMLQSLNHAKNGVDIVSGTRVKTHFARPNWRNVFKHVAVKHTNQRVGVFYCGAHGLVGE  871

Query  582   LRQLALDFSRKTSTKFDFHKENF  514
             L++LA DFSRKT TKFDFHKENF
Sbjct  872   LKRLAQDFSRKTETKFDFHKENF  894



>ref|XP_010041041.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Eucalyptus 
grandis]
Length=889

 Score =   296 bits (757),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 167/198 (84%), Gaps = 3/198 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT---KNF  928
             YGAPAQDYK YDV+LLVGLGIGATP+ISIVKD++NN+    E E G+   GA +   K F
Sbjct  692   YGAPAQDYKNYDVLLLVGLGIGATPLISIVKDVLNNIKQQKEMEKGIVESGAKSNKRKPF  751

Query  927   RTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQ  748
              T++AYFYWVTREQGSF+WF+G+MNEVAE D  GVIE+HNYCTSVYEEGDARSALI MLQ
Sbjct  752   LTRRAYFYWVTREQGSFEWFRGVMNEVAENDRDGVIELHNYCTSVYEEGDARSALIAMLQ  811

Query  747   SLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLA  568
             SL+HAKNGVDIVSGTRV++HFA+PNWRNV+K +A+NH D +VGVFYCG   +  E+R+LA
Sbjct  812   SLNHAKNGVDIVSGTRVRTHFARPNWRNVFKHVAVNHPDERVGVFYCGVQGVVGEMRRLA  871

Query  567   LDFSRKTSTKFDFHKENF  514
              DFS KT+TKF FHKENF
Sbjct  872   QDFSHKTTTKFYFHKENF  889



>ref|XP_010025215.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Eucalyptus 
grandis]
 gb|KCW61820.1| hypothetical protein EUGRSUZ_H04514 [Eucalyptus grandis]
Length=889

 Score =   296 bits (757),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 167/198 (84%), Gaps = 3/198 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT---KNF  928
             YGAPAQDYK YDV+LLVGLGIGATP+ISIVKD++NN+    E E G+   GA +   K F
Sbjct  692   YGAPAQDYKNYDVLLLVGLGIGATPLISIVKDVLNNIKQQKEMEKGIVESGAKSNKRKPF  751

Query  927   RTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQ  748
              T++AYFYWVTREQGSF+WF+G+MNEVAE D  GVIE+HNYCTSVYEEGDARSALI MLQ
Sbjct  752   LTRRAYFYWVTREQGSFEWFRGVMNEVAENDRDGVIELHNYCTSVYEEGDARSALIAMLQ  811

Query  747   SLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLA  568
             SL+HAKNGVDIVSGTRV++HFA+PNWRNV+K +A+NH D +VGVFYCG   +  E+R+LA
Sbjct  812   SLNHAKNGVDIVSGTRVRTHFARPNWRNVFKHVAVNHPDERVGVFYCGVQGVVGEMRRLA  871

Query  567   LDFSRKTSTKFDFHKENF  514
              DFS KT+TKF FHKENF
Sbjct  872   QDFSHKTTTKFYFHKENF  889



>ref|XP_004494602.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Cicer 
arietinum]
Length=891

 Score =   295 bits (756),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 164/198 (83%), Gaps = 3/198 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT---KNF  928
             YGAPAQDYK Y+V+LLVGLGIGATP+ISI+KD++NNM    + E GV   G      K F
Sbjct  694   YGAPAQDYKDYEVILLVGLGIGATPLISILKDVLNNMKQQKDIEQGVVESGVKNNKRKPF  753

Query  927   RTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQ  748
              T +AYFYWVTREQGSF+WFKG+M+EVAE D   +IE+HNYCTSVYEEGDARSALITMLQ
Sbjct  754   ATNRAYFYWVTREQGSFEWFKGVMDEVAEYDKDRIIELHNYCTSVYEEGDARSALITMLQ  813

Query  747   SLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLA  568
             SLHHAK+GVDIVSGTRVK+HFAKPNWR V+K+ AL H    VGVFYCG P L  EL++L+
Sbjct  814   SLHHAKSGVDIVSGTRVKTHFAKPNWRTVFKQTALKHPGKTVGVFYCGIPGLVGELKRLS  873

Query  567   LDFSRKTSTKFDFHKENF  514
             LDFSRKT+TKF+FHKENF
Sbjct  874   LDFSRKTNTKFEFHKENF  891



>ref|XP_002865538.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41797.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=630

 Score =   290 bits (741),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 160/201 (80%), Gaps = 6/201 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeg------gvenggaAT  937
             YGAPAQDYKKY+VVLL+GLGIGATPMISI+KDI+NN    +  +                
Sbjct  430   YGAPAQDYKKYEVVLLIGLGIGATPMISIIKDIINNTETKELSQVDLGKVGSQHEPQGEK  489

Query  936   KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALIT  757
             + F+T++AYFYWVTREQGS+DWFK IMNE+AE D   VIE+HNYCTSVYEEGD RSA I 
Sbjct  490   ETFKTRRAYFYWVTREQGSYDWFKNIMNEIAERDKNKVIELHNYCTSVYEEGDVRSAFIH  549

Query  756   MLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELR  577
             MLQSL+HAK+G+DIVSGT+V S+FAKPNW N+YK+IA++H  S VGVFYCGAPALT ELR
Sbjct  550   MLQSLNHAKSGLDIVSGTKVMSYFAKPNWENIYKQIAMDHPGSNVGVFYCGAPALTKELR  609

Query  576   QLALDFSRKTSTKFDFHKENF  514
              LAL+F+ KT T+F FHKENF
Sbjct  610   NLALEFAHKTRTRFSFHKENF  630



>ref|NP_194239.2| riboflavin synthase-like superfamily protein [Arabidopsis thaliana]
 sp|Q9SW17.2|RBOHG_ARATH RecName: Full=Putative respiratory burst oxidase homolog protein 
G; AltName: Full=NADPH oxidase RBOHG; Short=AtRBOHG [Arabidopsis 
thaliana]
 gb|AEE85005.1| riboflavin synthase-like superfamily protein [Arabidopsis thaliana]
Length=849

 Score =   294 bits (753),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 164/199 (82%), Gaps = 4/199 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATK----N  931
             YGAPAQDYKKY+VVLL+GLGIGATPMISI+KDI+NN    ++     +      +     
Sbjct  651   YGAPAQDYKKYEVVLLIGLGIGATPMISIIKDIINNTETKEQLSQMEKGSPQEQQGNKET  710

Query  930   FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITML  751
             F+T++AYFYWVT+EQG+FDWFK IMNE+AE D   VIE+HN+CTSVYEEGD RSALI ML
Sbjct  711   FKTRRAYFYWVTKEQGTFDWFKNIMNEIAERDKSKVIELHNHCTSVYEEGDVRSALIRML  770

Query  750   QSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQL  571
             QSL++AKNG+DIV+GTRV SHFA+PNW+NVYK+IA++H  + VGVFYCGAP LT ELRQL
Sbjct  771   QSLNYAKNGLDIVAGTRVMSHFARPNWKNVYKQIAMDHPGANVGVFYCGAPVLTKELRQL  830

Query  570   ALDFSRKTSTKFDFHKENF  514
             AL+F+ KTST+F FHKENF
Sbjct  831   ALEFTHKTSTRFSFHKENF  849



>ref|XP_010452698.1| PREDICTED: respiratory burst oxidase homolog protein A [Camelina 
sativa]
Length=891

 Score =   295 bits (755),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 161/206 (78%), Gaps = 11/206 (5%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM-----------Taadeeeggven  952
             YGAPAQDYKK++VVLLVGLGIGATPMISIVKDI+NN+           +          +
Sbjct  686   YGAPAQDYKKFEVVLLVGLGIGATPMISIVKDIINNLKGNGESSNRRQSPIHNMVSPPLS  745

Query  951   ggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDAR  772
                 +  FRTK+AYFYWVTREQGSFDWFK +M+EVAE D   VIE+HNYCTSVYEEGDAR
Sbjct  746   PARKSDAFRTKRAYFYWVTREQGSFDWFKNVMDEVAETDRNNVIELHNYCTSVYEEGDAR  805

Query  771   SALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPAL  592
             SALITMLQSL+HAKNGVD+VSGT V SHFAKPNWR+V+KRIA+ H  ++VGVFYCGA  L
Sbjct  806   SALITMLQSLNHAKNGVDVVSGTHVMSHFAKPNWRSVFKRIAVKHPKTRVGVFYCGAAGL  865

Query  591   TTELRQLALDFSRKTSTKFDFHKENF  514
               ELR L+ DFS KTSTKF FHKENF
Sbjct  866   VKELRHLSQDFSHKTSTKFIFHKENF  891



>emb|CAB36751.1| respiratory burst oxidase-like protein [Arabidopsis thaliana]
 emb|CAB79418.1| respiratory burst oxidase-like protein [Arabidopsis thaliana]
Length=863

 Score =   295 bits (754),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 164/199 (82%), Gaps = 4/199 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATK----N  931
             YGAPAQDYKKY+VVLL+GLGIGATPMISI+KDI+NN    ++     +      +     
Sbjct  665   YGAPAQDYKKYEVVLLIGLGIGATPMISIIKDIINNTETKEQLSQMEKGSPQEQQGNKET  724

Query  930   FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITML  751
             F+T++AYFYWVT+EQG+FDWFK IMNE+AE D   VIE+HN+CTSVYEEGD RSALI ML
Sbjct  725   FKTRRAYFYWVTKEQGTFDWFKNIMNEIAERDKSKVIELHNHCTSVYEEGDVRSALIRML  784

Query  750   QSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQL  571
             QSL++AKNG+DIV+GTRV SHFA+PNW+NVYK+IA++H  + VGVFYCGAP LT ELRQL
Sbjct  785   QSLNYAKNGLDIVAGTRVMSHFARPNWKNVYKQIAMDHPGANVGVFYCGAPVLTKELRQL  844

Query  570   ALDFSRKTSTKFDFHKENF  514
             AL+F+ KTST+F FHKENF
Sbjct  845   ALEFTHKTSTRFSFHKENF  863



>ref|NP_001190833.1| riboflavin synthase-like superfamily protein [Arabidopsis thaliana]
 gb|AEE85006.1| riboflavin synthase-like superfamily protein [Arabidopsis thaliana]
Length=837

 Score =   294 bits (752),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 135/199 (68%), Positives = 164/199 (82%), Gaps = 4/199 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATK----N  931
             YGAPAQDYKKY+VVLL+GLGIGATPMISI+KDI+NN    ++     +      +     
Sbjct  639   YGAPAQDYKKYEVVLLIGLGIGATPMISIIKDIINNTETKEQLSQMEKGSPQEQQGNKET  698

Query  930   FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITML  751
             F+T++AYFYWVT+EQG+FDWFK IMNE+AE D   VIE+HN+CTSVYEEGD RSALI ML
Sbjct  699   FKTRRAYFYWVTKEQGTFDWFKNIMNEIAERDKSKVIELHNHCTSVYEEGDVRSALIRML  758

Query  750   QSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQL  571
             QSL++AKNG+DIV+GTRV SHFA+PNW+NVYK+IA++H  + VGVFYCGAP LT ELRQL
Sbjct  759   QSLNYAKNGLDIVAGTRVMSHFARPNWKNVYKQIAMDHPGANVGVFYCGAPVLTKELRQL  818

Query  570   ALDFSRKTSTKFDFHKENF  514
             AL+F+ KTST+F FHKENF
Sbjct  819   ALEFTHKTSTRFSFHKENF  837



>emb|CAM35833.1| respiratory burst oxidase homologue [Medicago truncatula]
Length=716

 Score =   291 bits (745),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 164/198 (83%), Gaps = 3/198 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT---KNF  928
             YGAPAQDYK Y+V+LLVGLGIGATP+ISI+KD++NNM    + E GV   G      K F
Sbjct  519   YGAPAQDYKDYEVILLVGLGIGATPLISILKDVLNNMKQQKDIEQGVVESGVKNNKRKPF  578

Query  927   RTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQ  748
              T +AYFYWVTREQGSF+WFKG+M+E+A+ D  G+IE+HNYCTSVYEEGDARSALITMLQ
Sbjct  579   ATNRAYFYWVTREQGSFEWFKGVMDEIADYDKDGLIELHNYCTSVYEEGDARSALITMLQ  638

Query  747   SLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLA  568
             SLHHAK+GVDIVSGTRVK+HFA+PNWR V+K  AL H   +VGVFYCGA  L  +L+ L+
Sbjct  639   SLHHAKSGVDIVSGTRVKTHFARPNWRTVFKHTALKHPGKRVGVFYCGAAGLVGQLKSLS  698

Query  567   LDFSRKTSTKFDFHKENF  514
             LDFSRKT+TKF+FHKENF
Sbjct  699   LDFSRKTNTKFEFHKENF  716



>ref|XP_007206556.1| hypothetical protein PRUPE_ppa019730mg [Prunus persica]
 gb|EMJ07755.1| hypothetical protein PRUPE_ppa019730mg [Prunus persica]
Length=893

 Score =   295 bits (754),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 167/203 (82%), Gaps = 8/203 (4%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT------  937
             YGAPAQDYK+Y+V+LLVGLGIGATP+ISIVKD++ N+    E E    N           
Sbjct  691   YGAPAQDYKEYEVLLLVGLGIGATPLISIVKDVLTNIKQQKETEDHQGNMVENNGDNKDN  750

Query  936   --KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSAL  763
               K+F TK+AYFYW+TREQGSF+WF+G+M+EVAE D  GVIE+HNYCTSVYEEGDARSAL
Sbjct  751   KRKSFVTKRAYFYWITREQGSFEWFRGVMDEVAENDKDGVIELHNYCTSVYEEGDARSAL  810

Query  762   ITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTE  583
             ITMLQSL+HAKNGVDIVSGTRVK+HFA+PNWRNV+K +A+ HT+ +VGVFYCGA  L  E
Sbjct  811   ITMLQSLNHAKNGVDIVSGTRVKTHFARPNWRNVFKHVAVKHTNQRVGVFYCGAHGLVGE  870

Query  582   LRQLALDFSRKTSTKFDFHKENF  514
             L++L+ DFSRKT TKFDFHKENF
Sbjct  871   LKRLSQDFSRKTETKFDFHKENF  893



>ref|XP_009611315.1| PREDICTED: respiratory burst oxidase homolog protein B [Nicotiana 
tomentosiformis]
Length=866

 Score =   294 bits (752),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 161/195 (83%), Gaps = 0/195 (0%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDYKKYDVVLLVGLGIGATP+ISIVKD++NN+    + E G+   G     F TK
Sbjct  672   YGAPAQDYKKYDVVLLVGLGIGATPLISIVKDVLNNIKQQKDLEDGLIESGTKKSPFATK  731

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             +AYFYWVTREQGSF+WFKG+M+EV++ D  G+IE+HNYCTSVYEEGDARSALITMLQS+ 
Sbjct  732   RAYFYWVTREQGSFEWFKGVMDEVSQNDQEGLIELHNYCTSVYEEGDARSALITMLQSIQ  791

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
              AK+GVDIVSGTRVK+HFA+PNWR V+K + +NH D ++GVFYCG   L  ELR L+ DF
Sbjct  792   QAKSGVDIVSGTRVKTHFARPNWRQVFKHVTINHPDQRIGVFYCGPQGLVGELRHLSQDF  851

Query  558   SRKTSTKFDFHKENF  514
             S KT TKF+FHKENF
Sbjct  852   SHKTGTKFEFHKENF  866



>ref|NP_001274981.1| respiratory burst oxidase homolog protein B [Solanum tuberosum]
 sp|Q948T9.1|RBOHB_SOLTU RecName: Full=Respiratory burst oxidase homolog protein B; AltName: 
Full=NADPH oxidase RBOHB; AltName: Full=StRBOHB [Solanum 
tuberosum]
 dbj|BAB70751.1| respiratory burst oxidase homolog [Solanum tuberosum]
Length=867

 Score =   294 bits (752),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 161/195 (83%), Gaps = 2/195 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDYKKYDVVLLVGLGIGATP+ISIVKD++NN+      E G +    +   F TK
Sbjct  675   YGAPAQDYKKYDVVLLVGLGIGATPLISIVKDVLNNIKQQKNIEDGTKGSKRSP--FATK  732

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             +AYFYWVTREQGSF+WFKG+M+EV+E D  G+IE+HNYCTSVYEEGDARSALITMLQS+ 
Sbjct  733   RAYFYWVTREQGSFEWFKGVMDEVSENDQEGLIELHNYCTSVYEEGDARSALITMLQSIQ  792

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
              AK+GVDIVSGTRVK+HFA+PNWR V+KR+ +NH D ++GVFYCG   L  ELR L+ DF
Sbjct  793   QAKSGVDIVSGTRVKTHFARPNWRQVFKRVTINHPDQRIGVFYCGPQGLVGELRHLSQDF  852

Query  558   SRKTSTKFDFHKENF  514
             S KT TKF+FHKENF
Sbjct  853   SHKTGTKFEFHKENF  867



>emb|CDX98976.1| BnaC09g48590D [Brassica napus]
Length=908

 Score =   294 bits (752),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 161/211 (76%), Gaps = 16/211 (8%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM----------------Taadeee  967
             YGAPAQDYK ++VVLLVGLGIGATPMISIVKDI+NN+                +      
Sbjct  698   YGAPAQDYKNFEVVLLVGLGIGATPMISIVKDIINNIKGNGDIEEGRNSNRRQSPIHSMV  757

Query  966   ggvenggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYE  787
                 +    ++ FRTK+AYFYWVTREQGSFDWFK +M+EVA  D   VIE+HNYCTSVYE
Sbjct  758   TPPLSPARRSETFRTKRAYFYWVTREQGSFDWFKNVMDEVALTDRNKVIELHNYCTSVYE  817

Query  786   EGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYC  607
             EGDARSALITMLQSLHHAK+GVD+VSGTRV SHFA+PNWR+VYKRIA+ H  ++VGVFYC
Sbjct  818   EGDARSALITMLQSLHHAKHGVDVVSGTRVMSHFARPNWRSVYKRIAVKHPKTRVGVFYC  877

Query  606   GAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             GA  L  ELR LALDFS  TSTKF FHKENF
Sbjct  878   GAAGLVRELRHLALDFSHNTSTKFCFHKENF  908



>ref|NP_001167766.1| uncharacterized protein LOC100381459 [Zea mays]
 gb|ACN26017.1| unknown [Zea mays]
Length=398

 Score =   281 bits (719),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 163/196 (83%), Gaps = 9/196 (5%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDY+KYDV+LL+GLGIGATP+ISIVKD++NN++   +EE            F T+
Sbjct  211   YGAPAQDYRKYDVLLLIGLGIGATPLISIVKDVLNNISDNKDEEQ--------PAEFMTR  262

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRG-VIEMHNYCTSVYEEGDARSALITMLQSL  742
             + YFYW TRE+GSF+WF+G+MNEVAE D RG V+E+HN+CTSVYEEGDARSAL+ MLQ+L
Sbjct  263   RVYFYWCTREEGSFEWFRGVMNEVAERDARGDVVELHNHCTSVYEEGDARSALLVMLQAL  322

Query  741   HHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALD  562
             HHAK+GVD+VSGTRV++HFA+PNWR+V+KR+A NH   +VGVFYCG   +T ELR+L+ D
Sbjct  323   HHAKSGVDVVSGTRVRTHFARPNWRDVFKRVACNHQGQRVGVFYCGDQKVTPELRRLSQD  382

Query  561   FSRKTSTKFDFHKENF  514
             FS KT+TKF FHKENF
Sbjct  383   FSHKTTTKFVFHKENF  398



>ref|XP_009122345.1| PREDICTED: respiratory burst oxidase homolog protein A [Brassica 
rapa]
Length=902

 Score =   293 bits (751),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 161/211 (76%), Gaps = 16/211 (8%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM----------------Taadeee  967
             YGAPAQDYK ++VVLLVGLGIGATPMISIVKDI+NN+                +      
Sbjct  692   YGAPAQDYKNFEVVLLVGLGIGATPMISIVKDIINNIKGNGDIEEGRNSNRRQSPIHNMV  751

Query  966   ggvenggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYE  787
                 +    ++ FRTK+AYFYWVTREQGSFDWFK +M+EVA  D   VIE+HNYCTSVYE
Sbjct  752   TPPLSPARRSETFRTKRAYFYWVTREQGSFDWFKNVMDEVALTDRNKVIELHNYCTSVYE  811

Query  786   EGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYC  607
             EGDARSALITMLQSLHHAK+GVD+VSGTRV SHFA+PNWR+VYKRIA+ H  ++VGVFYC
Sbjct  812   EGDARSALITMLQSLHHAKHGVDVVSGTRVMSHFARPNWRSVYKRIAVKHPKTRVGVFYC  871

Query  606   GAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             GA  L  ELR LALDFS  TSTKF FHKENF
Sbjct  872   GAAGLVKELRHLALDFSHNTSTKFCFHKENF  902



>gb|EYU21750.1| hypothetical protein MIMGU_mgv1a001620mg [Erythranthe guttata]
Length=784

 Score =   291 bits (745),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 164/205 (80%), Gaps = 11/205 (5%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaad-----------eeeggven  952
             Y AP+QDY+ Y VVLL+GLGIG+TPMISI+KDIVNN+ + +                   
Sbjct  579   YAAPSQDYRNYGVVLLLGLGIGSTPMISIIKDIVNNIMSMEEEEEANSLEEGTAAPLKSR  638

Query  951   ggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDAR  772
               +   +F+T+KAYFYWV REQGSFDWFKG+++EVAE+D RG++EMHNYCTSVYEEGDAR
Sbjct  639   SDSGAHSFKTRKAYFYWVIREQGSFDWFKGVLDEVAELDTRGIVEMHNYCTSVYEEGDAR  698

Query  771   SALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPAL  592
             S +ITMLQSL+HAKNG+D+VSGTR+ SHF KPN+RN +K IALNH +++VGVFYCGAPAL
Sbjct  699   SVIITMLQSLNHAKNGLDVVSGTRITSHFGKPNFRNAFKGIALNHPNTRVGVFYCGAPAL  758

Query  591   TTELRQLALDFSRKTSTKFDFHKEN  517
               ELRQLA DFS KT+TKF+FHKEN
Sbjct  759   EPELRQLASDFSHKTTTKFEFHKEN  783



>ref|XP_002873307.1| respiratory burst oxidase protein A [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49566.1| respiratory burst oxidase protein A [Arabidopsis lyrata subsp. 
lyrata]
Length=897

 Score =   293 bits (750),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 163/206 (79%), Gaps = 11/206 (5%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM-----------Taadeeeggven  952
             YGAPAQDYKK++V+LLVGLGIGATPMISIVKDI+N++           +          +
Sbjct  692   YGAPAQDYKKFEVLLLVGLGIGATPMISIVKDIINHLKGVEEGSNRRQSPIHNMVTPPVS  751

Query  951   ggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDAR  772
                 ++ F TK+AYFYWVTREQGSFDWFK +M+EV E D   VIE+HNYCTSVYEEGDAR
Sbjct  752   PSRKSETFITKRAYFYWVTREQGSFDWFKNVMDEVTETDRNKVIELHNYCTSVYEEGDAR  811

Query  771   SALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPAL  592
             SALITMLQSL+HAK+GVD+VSGTRV SHFA+PNWR+V+KRIA+NH  +KVGVFYCGA  L
Sbjct  812   SALITMLQSLNHAKHGVDVVSGTRVMSHFARPNWRSVFKRIAVNHPKTKVGVFYCGAAGL  871

Query  591   TTELRQLALDFSRKTSTKFDFHKENF  514
               ELR L+LDFS KTSTKF FHKENF
Sbjct  872   VKELRHLSLDFSHKTSTKFTFHKENF  897



>ref|XP_002867627.1| hypothetical protein ARALYDRAFT_492327 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43886.1| hypothetical protein ARALYDRAFT_492327 [Arabidopsis lyrata subsp. 
lyrata]
Length=860

 Score =   292 bits (748),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 163/199 (82%), Gaps = 4/199 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggv----enggaATKN  931
             YGAPAQDYKKY+VVLL+GLGIGATPMISI+KDI+NN    ++         +      + 
Sbjct  662   YGAPAQDYKKYEVVLLIGLGIGATPMISIIKDIINNTETKEQLSQMEKGAPQEQQVKKET  721

Query  930   FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITML  751
             F+T++AYFYWVT+EQG+FDWFK +MNE+AE D   VIE+HN+CTSVYEEGD RSALI ML
Sbjct  722   FKTRRAYFYWVTKEQGTFDWFKNVMNEIAERDKSKVIELHNHCTSVYEEGDVRSALIRML  781

Query  750   QSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQL  571
             QSL++AKNG+DIV+GTRV SHFA+PNW+NVYK+IA++H  + VGVFYCGAP LT ELR L
Sbjct  782   QSLNYAKNGLDIVAGTRVMSHFARPNWKNVYKQIAMDHPGANVGVFYCGAPVLTKELRHL  841

Query  570   ALDFSRKTSTKFDFHKENF  514
             AL+F+ KTST+F FHKENF
Sbjct  842   ALEFTHKTSTRFSFHKENF  860



>gb|AAB70398.1| Strong similarity to Oryza NADPH oxidase (gb|X93301) [Arabidopsis 
thaliana]
Length=578

 Score =   285 bits (730),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 163/196 (83%), Gaps = 4/196 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNF-RT  922
             YGAPAQDY+ YDV+LLVGLGIGATP+ISI++D++NN+     +           KN+  T
Sbjct  386   YGAPAQDYRNYDVLLLVGLGIGATPLISIIRDVLNNI---KNQNSIERGTNQHIKNYVAT  442

Query  921   KKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSL  742
             K+AYFYWVTREQGS +WF  +MNEVAE D+ G+IE+HNYCTSVYEEGDARSALITMLQSL
Sbjct  443   KRAYFYWVTREQGSLEWFSEVMNEVAEYDSEGMIELHNYCTSVYEEGDARSALITMLQSL  502

Query  741   HHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALD  562
             HHAK+G+DIVSGTRV++HFA+PNWR+V+K +A+NH + +VGVFYCG   +  EL++LA D
Sbjct  503   HHAKSGIDIVSGTRVRTHFARPNWRSVFKHVAVNHVNQRVGVFYCGNTCIIGELKRLAQD  562

Query  561   FSRKTSTKFDFHKENF  514
             FSRKT+TKF+FHKENF
Sbjct  563   FSRKTTTKFEFHKENF  578



>ref|XP_003626253.1| Respiratory burst oxidase-like protein [Medicago truncatula]
 gb|AAW78864.1| respiratory burst oxidase 2 [Medicago truncatula]
 gb|ABN08032.1| Calcium-binding EF-hand; Ferric reductase-like transmembrane 
component [Medicago truncatula]
 gb|AES82471.1| respiratory burst oxidase-like protein [Medicago truncatula]
Length=895

 Score =   292 bits (748),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 164/198 (83%), Gaps = 3/198 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT---KNF  928
             YGAPAQDYK Y+V+LLVGLGIGATP+ISI+KD++NNM    + E GV   G      K F
Sbjct  698   YGAPAQDYKDYEVILLVGLGIGATPLISILKDVLNNMKQQKDIEQGVVESGVKNNKRKPF  757

Query  927   RTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQ  748
              T +AYFYWVTREQGSF+WFKG+M+E+A+ D  G+IE+HNYCTSVYEEGDARSALITMLQ
Sbjct  758   ATNRAYFYWVTREQGSFEWFKGVMDEIADYDKDGLIELHNYCTSVYEEGDARSALITMLQ  817

Query  747   SLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLA  568
             SLHHAK+GVDIVSGTRVK+HFA+PNWR V+K  AL H   +VGVFYCGA  L  +L+ L+
Sbjct  818   SLHHAKSGVDIVSGTRVKTHFARPNWRTVFKHTALKHPGKRVGVFYCGAAGLVGQLKSLS  877

Query  567   LDFSRKTSTKFDFHKENF  514
             LDFSRKT+TKF+FHKENF
Sbjct  878   LDFSRKTNTKFEFHKENF  895



>gb|AAW78863.1| respiratory burst oxidase 1 [Medicago truncatula]
Length=932

 Score =   293 bits (750),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 170/204 (83%), Gaps = 9/204 (4%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT------  937
             YGAPAQDY++Y+VVLLVGLGIGATPMISI+KD+VNN  A +EE+G     G+        
Sbjct  729   YGAPAQDYREYEVVLLVGLGIGATPMISILKDMVNNFKAMEEEDGFAMEEGSPMTPNQKD  788

Query  936   ---KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSA  766
                 +F+T++AYFYWVTREQGSFDWFKG+MN+VAE D RG+IE+H+YCTSVYE+GDARSA
Sbjct  789   SRFSDFKTRRAYFYWVTREQGSFDWFKGVMNDVAEEDRRGLIELHSYCTSVYEQGDARSA  848

Query  765   LITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTT  586
             LI M+QS++HAK+ VD+VS TRV SHFAKPNWR VYKRIALNH +++VGVFYCG   LT 
Sbjct  849   LIAMVQSINHAKHRVDVVSRTRVMSHFAKPNWRTVYKRIALNHPEAQVGVFYCGPSTLTH  908

Query  585   ELRQLALDFSRKTSTKFDFHKENF  514
             ELRQL+LDFS  TSTKFDFHKENF
Sbjct  909   ELRQLSLDFSHNTSTKFDFHKENF  932



>ref|XP_006399223.1| hypothetical protein EUTSA_v10012617mg [Eutrema salsugineum]
 gb|ESQ40676.1| hypothetical protein EUTSA_v10012617mg [Eutrema salsugineum]
Length=907

 Score =   292 bits (748),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 142/210 (68%), Positives = 162/210 (77%), Gaps = 15/210 (7%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNM---------------Taadeeeg  964
             YGAPAQDYK ++VVLLVGLGIGATPMISIVKDI+NN+               +       
Sbjct  698   YGAPAQDYKNFEVVLLVGLGIGATPMISIVKDIINNLKGNGEEEGRGSNGRWSPNHNMVT  757

Query  963   gvenggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEE  784
                +    ++ FRTK+AYFYWVTREQGSFDWFK +M+EVA  D   VIE+HNYCTSVYEE
Sbjct  758   PPLSPARKSEMFRTKRAYFYWVTREQGSFDWFKNVMDEVAITDRNKVIELHNYCTSVYEE  817

Query  783   GDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCG  604
             GDARSALITMLQSL+HAK+GVD+VSGTRV SHFA+PNWR+VYKRIA+ H  ++VGVFYCG
Sbjct  818   GDARSALITMLQSLNHAKHGVDVVSGTRVMSHFARPNWRSVYKRIAVKHPKTRVGVFYCG  877

Query  603   APALTTELRQLALDFSRKTSTKFDFHKENF  514
             A  L  ELR LALDFS KTSTKF FHKENF
Sbjct  878   AAGLVKELRDLALDFSHKTSTKFCFHKENF  907



>gb|AEP25512.1| putative respiratory burst oxidase-like protein A [Vicia faba]
Length=894

 Score =   292 bits (747),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 162/198 (82%), Gaps = 3/198 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT---KNF  928
             YGAPAQDYK Y+V+LLVGLGIGATP+ISI+KD++NNM    + E G           K F
Sbjct  697   YGAPAQDYKDYEVILLVGLGIGATPLISILKDVLNNMKQQKDIEQGGVESDVKNNKRKPF  756

Query  927   RTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQ  748
              T +AYFYWVTREQGSF+WFKG+M+E+A+ D  G+IE+HNYCTSVYEEGDARSALITMLQ
Sbjct  757   ATNRAYFYWVTREQGSFEWFKGVMDEIADYDKDGLIELHNYCTSVYEEGDARSALITMLQ  816

Query  747   SLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLA  568
             SLHHAK+GVDIVSGTRVK+HFA+PNWR V+K  AL H   +VGVFYCGA  L  +L+ L+
Sbjct  817   SLHHAKSGVDIVSGTRVKTHFARPNWRTVFKHTALKHPGKRVGVFYCGAAGLVGQLKSLS  876

Query  567   LDFSRKTSTKFDFHKENF  514
             LDFSRKT+TKF+FHKENF
Sbjct  877   LDFSRKTNTKFEFHKENF  894



>ref|XP_010448480.1| PREDICTED: putative respiratory burst oxidase homolog protein 
G [Camelina sativa]
Length=858

 Score =   291 bits (745),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 163/199 (82%), Gaps = 4/199 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATK----N  931
             YGAPAQDYKKY+VVLL+GLGIGATPMISI+KDI+NN    ++     +      +     
Sbjct  660   YGAPAQDYKKYEVVLLIGLGIGATPMISIIKDIINNTETKEQLSQMEKGSQQVPQVKKET  719

Query  930   FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITML  751
             F+T++AYFYWVT+E+G+FDWFK IMNE+AE D   VIE+HN+CTSVYEEGD RSALI ML
Sbjct  720   FKTRRAYFYWVTKEEGTFDWFKNIMNEIAERDTSKVIELHNHCTSVYEEGDVRSALIRML  779

Query  750   QSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQL  571
             QSL++AKNG+DIV+GTRV SHFA+PNW+NVYK+IA++H  + VGVFYCGAP LT ELR L
Sbjct  780   QSLNYAKNGLDIVAGTRVMSHFARPNWKNVYKQIAMDHPGANVGVFYCGAPVLTKELRHL  839

Query  570   ALDFSRKTSTKFDFHKENF  514
             AL+F+ KTST+F FHKENF
Sbjct  840   ALEFTHKTSTRFSFHKENF  858



>emb|CDY22644.1| BnaC08g42780D [Brassica napus]
Length=576

 Score =   284 bits (727),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 161/195 (83%), Gaps = 3/195 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDY+ YDV+LLVGLGIGATP+ISI+KD++NN+      E G  +    +    TK
Sbjct  385   YGAPAQDYRNYDVLLLVGLGIGATPLISILKDVLNNIKNHKSIEEGTSHNVNRSN---TK  441

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             +AYFYWVTREQGS +WF  +MNEVAE D+ G+IE+HNYCTSVYEEGDARSALITMLQSLH
Sbjct  442   RAYFYWVTREQGSLEWFSEVMNEVAEYDSEGIIELHNYCTSVYEEGDARSALITMLQSLH  501

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             HAKNG+DIVSGTRV++HFA+P+WR+V+K +A+NH + +VGVFYCG   +  EL+ LA DF
Sbjct  502   HAKNGIDIVSGTRVRTHFARPDWRSVFKHVAVNHINQRVGVFYCGKSCIIGELKGLAQDF  561

Query  558   SRKTSTKFDFHKENF  514
             SRKT TKF+FHKENF
Sbjct  562   SRKTLTKFEFHKENF  576



>ref|XP_010475733.1| PREDICTED: respiratory burst oxidase homolog protein B [Camelina 
sativa]
Length=844

 Score =   290 bits (741),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 165/196 (84%), Gaps = 1/196 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNF-RT  922
             YGAPAQDY+ YDV+LLVGLGIGATP+ISI++D++NN+      E G  N     KN+  T
Sbjct  649   YGAPAQDYRNYDVLLLVGLGIGATPLISIIRDVLNNIKNQKSIEQGTSNHNVPIKNYVAT  708

Query  921   KKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSL  742
             K+AYFYWVTREQGS +WF  +MNEVAE D+ G+IE+HNYCTSVYEEGDARSALITMLQSL
Sbjct  709   KRAYFYWVTREQGSLEWFSEVMNEVAEYDSEGMIELHNYCTSVYEEGDARSALITMLQSL  768

Query  741   HHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALD  562
             HHAK+G+DIVSGTRV++HFA+P+WR+V+K +A+NH + +VGVFYCG   +  EL++LA D
Sbjct  769   HHAKSGIDIVSGTRVRTHFARPDWRSVFKHVAVNHVNQRVGVFYCGNTCIIGELKKLAQD  828

Query  561   FSRKTSTKFDFHKENF  514
             FSRKT+TKF+FHKENF
Sbjct  829   FSRKTTTKFEFHKENF  844



>ref|XP_002863082.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39341.1| predicted protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=517

 Score =   281 bits (720),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 160/201 (80%), Gaps = 7/201 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggveng------gaAT  937
             YGAPAQDYKKY+VVLL+GLGIGATPMISI+KDI+NN    +  +  +          +  
Sbjct  318   YGAPAQDYKKYEVVLLIGLGIGATPMISIIKDIINNTETKELAQLDLAKVGSQHEPQSEK  377

Query  936   KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALIT  757
             + F+ ++AYFYWVTREQGS+DWFK IMNE+AE D   VIE+HNYCTSVYEEGD RSA I 
Sbjct  378   ETFKMRRAYFYWVTREQGSYDWFKNIMNEIAERDKNKVIELHNYCTSVYEEGDVRSAFIH  437

Query  756   MLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELR  577
             MLQSL+HAK+G+DIVSGT+V S+FAKPNW N+YK+IA++H  S V VFYCGAPALT ELR
Sbjct  438   MLQSLNHAKSGLDIVSGTKVMSYFAKPNWENIYKQIAMDHPGSNV-VFYCGAPALTKELR  496

Query  576   QLALDFSRKTSTKFDFHKENF  514
              LAL+F+ KT T+F FHKENF
Sbjct  497   NLALEFAHKTRTRFSFHKENF  517



>gb|EYU24552.1| hypothetical protein MIMGU_mgv1a001077mg [Erythranthe guttata]
Length=894

 Score =   290 bits (742),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 164/210 (78%), Gaps = 15/210 (7%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeegg--------------  961
             YGAP QDYK YDVVLLVGLGIGATPMIS+V+DI+NN+ + +EEE                
Sbjct  685   YGAPTQDYKDYDVVLLVGLGIGATPMISVVRDIINNIRSIEEEENSLEGGTRPPTPKQKT  744

Query  960   -venggaATKNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEE  784
                +  +    FRT+KAYFYWVTREQGSFDWFK +MNE AEMD++GVIEMHN+CTSVYE+
Sbjct  745   GSNSSSSHKHEFRTRKAYFYWVTREQGSFDWFKDVMNEAAEMDHKGVIEMHNHCTSVYED  804

Query  783   GDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCG  604
             GDARSALI MLQS++ AKNG+D+VSGTRV SHFAKPNWR VYKRIALNH ++ VGVF+CG
Sbjct  805   GDARSALIAMLQSIYLAKNGLDVVSGTRVVSHFAKPNWRTVYKRIALNHPETTVGVFFCG  864

Query  603   APALTTELRQLALDFSRKTSTKFDFHKENF  514
             APA   ELRQLA  FS  TST F FHKENF
Sbjct  865   APAPVKELRQLASYFSHSTSTTFVFHKENF  894



>emb|CDY06348.1| BnaA09g48550D [Brassica napus]
Length=816

 Score =   288 bits (738),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 162/195 (83%), Gaps = 3/195 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDY+ YDV+LLVGLGIGATP+ISI+KD++NN+      E G  +    +    TK
Sbjct  625   YGAPAQDYRNYDVLLLVGLGIGATPLISILKDVLNNIKNHKSIEEGTSHNVNRSN---TK  681

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             +AYFYWVTREQGS +WF  +MNEVAE D+ G+IE+HNYCTSVYEEGDARSALITMLQSLH
Sbjct  682   RAYFYWVTREQGSLEWFSEVMNEVAEYDSEGIIELHNYCTSVYEEGDARSALITMLQSLH  741

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             HAKNG+DIVSGTRV++HFA+P+WR+V+K +A+NH + +VGVFYCG   +  EL+ LA DF
Sbjct  742   HAKNGIDIVSGTRVRTHFARPDWRSVFKHVAVNHINQRVGVFYCGKSCIIGELKGLAQDF  801

Query  558   SRKTSTKFDFHKENF  514
             SRKTSTKF+FHKENF
Sbjct  802   SRKTSTKFEFHKENF  816



>ref|XP_010433689.1| PREDICTED: putative respiratory burst oxidase homolog protein 
G isoform X1 [Camelina sativa]
Length=851

 Score =   289 bits (739),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 163/199 (82%), Gaps = 4/199 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT----KN  931
             YGAPAQDYKKY+VVLL+GLGIGATPMISI+KDI+NN    ++     +          + 
Sbjct  653   YGAPAQDYKKYEVVLLIGLGIGATPMISIIKDIINNTETKEQLSRMEKGSQQEPHVKKET  712

Query  930   FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITML  751
             F+T++AYFYWVT+E+G+FDWFK IMNE+AE D   VIE+HN+CTSVYEEGD RSALI ML
Sbjct  713   FKTQRAYFYWVTKEEGTFDWFKNIMNEIAERDKSKVIELHNHCTSVYEEGDVRSALIRML  772

Query  750   QSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQL  571
             QSL++AKNG+DIV+GTRV SHFA+PNW+NVYK+IA++H  + VGVFYCGAP LT ELR L
Sbjct  773   QSLNYAKNGLDIVAGTRVMSHFARPNWKNVYKQIAMDHPGANVGVFYCGAPVLTKELRHL  832

Query  570   ALDFSRKTSTKFDFHKENF  514
             AL+F+ KT+T+F FHKENF
Sbjct  833   ALEFTHKTNTRFSFHKENF  851



>ref|XP_010433690.1| PREDICTED: putative respiratory burst oxidase homolog protein 
G isoform X2 [Camelina sativa]
Length=841

 Score =   288 bits (738),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 163/199 (82%), Gaps = 4/199 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT----KN  931
             YGAPAQDYKKY+VVLL+GLGIGATPMISI+KDI+NN    ++     +          + 
Sbjct  643   YGAPAQDYKKYEVVLLIGLGIGATPMISIIKDIINNTETKEQLSRMEKGSQQEPHVKKET  702

Query  930   FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITML  751
             F+T++AYFYWVT+E+G+FDWFK IMNE+AE D   VIE+HN+CTSVYEEGD RSALI ML
Sbjct  703   FKTQRAYFYWVTKEEGTFDWFKNIMNEIAERDKSKVIELHNHCTSVYEEGDVRSALIRML  762

Query  750   QSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQL  571
             QSL++AKNG+DIV+GTRV SHFA+PNW+NVYK+IA++H  + VGVFYCGAP LT ELR L
Sbjct  763   QSLNYAKNGLDIVAGTRVMSHFARPNWKNVYKQIAMDHPGANVGVFYCGAPVLTKELRHL  822

Query  570   ALDFSRKTSTKFDFHKENF  514
             AL+F+ KT+T+F FHKENF
Sbjct  823   ALEFTHKTNTRFSFHKENF  841



>ref|XP_009778242.1| PREDICTED: respiratory burst oxidase homolog protein B [Nicotiana 
sylvestris]
Length=872

 Score =   288 bits (738),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 159/198 (80%), Gaps = 3/198 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeee---ggvenggaATKNF  928
             YGAPAQDYKKYDVVLLVGLGIGATP+ISIVKD++NN+    + E         G     F
Sbjct  675   YGAPAQDYKKYDVVLLVGLGIGATPLISIVKDVLNNIKQQKDIEDGVIESGTKGTKRSPF  734

Query  927   RTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQ  748
              TK+AYFYWVTREQGSF+WFKG+M+EV++ D  G+IE+HNYCTSVYEEGDARSALITMLQ
Sbjct  735   ATKRAYFYWVTREQGSFEWFKGVMDEVSQNDQEGLIELHNYCTSVYEEGDARSALITMLQ  794

Query  747   SLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLA  568
             S+  AK+GVDIVSGTRVK+HFA+PNWR V+K + +NH D ++GVFYCG   L  ELR L+
Sbjct  795   SIQQAKSGVDIVSGTRVKTHFARPNWRQVFKHVTINHPDQRIGVFYCGPQGLVGELRHLS  854

Query  567   LDFSRKTSTKFDFHKENF  514
              DFS KT TKF+FHKENF
Sbjct  855   QDFSHKTGTKFEFHKENF  872



>ref|XP_006417613.1| hypothetical protein EUTSA_v10006793mg [Eutrema salsugineum]
 gb|ESQ35966.1| hypothetical protein EUTSA_v10006793mg [Eutrema salsugineum]
Length=838

 Score =   288 bits (736),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 163/195 (84%), Gaps = 3/195 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDY+ YDV+LLVGLGIGATP+ISI++D++NN+      E G  +    +    TK
Sbjct  647   YGAPAQDYRNYDVLLLVGLGIGATPLISILRDVLNNIKNQKSIEEGTSHYVHRSN---TK  703

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             +AYFYWVTREQGS +WF  +MNEVAE D+ G+IE+HNYCTSVYEEGDARSALITMLQSLH
Sbjct  704   RAYFYWVTREQGSLEWFSEVMNEVAEYDSEGIIELHNYCTSVYEEGDARSALITMLQSLH  763

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             HAKNG+DIVSGTRV++HFA+P+WR+V+K +A+NH + +VGVFYCG   +  EL++LA DF
Sbjct  764   HAKNGIDIVSGTRVRTHFARPDWRSVFKHVAVNHVNQRVGVFYCGRSCIIGELKRLAQDF  823

Query  558   SRKTSTKFDFHKENF  514
             SRKT+TKF+FHKENF
Sbjct  824   SRKTTTKFEFHKENF  838



>ref|XP_006306752.1| hypothetical protein CARUB_v10008289mg [Capsella rubella]
 gb|EOA39650.1| hypothetical protein CARUB_v10008289mg [Capsella rubella]
Length=854

 Score =   288 bits (736),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 163/196 (83%), Gaps = 1/196 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNF-RT  922
             YGAPAQDY+ YDV+LLVGLGIGATP+ISI++D++NN+      E    +     KN+  T
Sbjct  659   YGAPAQDYRNYDVLLLVGLGIGATPLISIIRDVLNNIKNQKSIEQAANHNVVPIKNYVAT  718

Query  921   KKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSL  742
             K+AYFYWVTREQGS +WF  +MNEVAE D+ G+IE+HNYCTSVYEEGDARSALITMLQSL
Sbjct  719   KRAYFYWVTREQGSLEWFSEVMNEVAEYDSEGMIELHNYCTSVYEEGDARSALITMLQSL  778

Query  741   HHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALD  562
             H AK+G+DIVSGTRV++HFA+P+WR+V+K +A+NH + +VGVFYCG   +  EL++LA D
Sbjct  779   HQAKSGIDIVSGTRVRTHFARPDWRSVFKHVAVNHVNQRVGVFYCGNTCIIGELKRLAQD  838

Query  561   FSRKTSTKFDFHKENF  514
             FSRKT+TKF+FHKENF
Sbjct  839   FSRKTTTKFEFHKENF  854



>ref|XP_010489693.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Camelina 
sativa]
Length=844

 Score =   287 bits (735),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 162/195 (83%), Gaps = 0/195 (0%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDY+ YDV+LLVGLGIGATP+ISI++D++NN+      E G  +         TK
Sbjct  650   YGAPAQDYRNYDVLLLVGLGIGATPLISIIRDVLNNIKNQKSIEQGTNHNVPIKNYVATK  709

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             +AYFYWVTREQGS +WF  +MNEVAE D+ G+IE+HNYCTSVYEEGDARSALITMLQSLH
Sbjct  710   RAYFYWVTREQGSLEWFSEVMNEVAEYDSEGMIELHNYCTSVYEEGDARSALITMLQSLH  769

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             HAK+G+DIVSGTRV++HFA+P+WR+V+K +A+NH + +VGVFYCG   +  EL++LA DF
Sbjct  770   HAKSGIDIVSGTRVRTHFARPDWRSVFKHVAVNHVNQRVGVFYCGNTCIIGELKRLAQDF  829

Query  558   SRKTSTKFDFHKENF  514
             SRKT+TKF+FHKENF
Sbjct  830   SRKTTTKFEFHKENF  844



>ref|XP_010458177.1| PREDICTED: respiratory burst oxidase homolog protein B-like [Camelina 
sativa]
Length=843

 Score =   287 bits (735),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 162/195 (83%), Gaps = 0/195 (0%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGAPAQDY+ YDV+LLVGLGIGATP+ISI++D++NN+      E G  +         TK
Sbjct  649   YGAPAQDYRNYDVLLLVGLGIGATPLISIIRDVLNNIKNQKSIEQGTNHNVPIKNYVATK  708

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             +AYFYWVTREQGS +WF  +MNEVAE D+ G+IE+HNYCTSVYEEGDARSALITMLQSLH
Sbjct  709   RAYFYWVTREQGSLEWFSEVMNEVAEYDSEGMIELHNYCTSVYEEGDARSALITMLQSLH  768

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             HAK+G+DIVSGTRV++HFA+P+WR+V+K +A+NH + +VGVFYCG   +  EL++LA DF
Sbjct  769   HAKSGIDIVSGTRVRTHFARPDWRSVFKHVAVNHVNQRVGVFYCGNTCIIGELKRLAQDF  828

Query  558   SRKTSTKFDFHKENF  514
             SRKT+TKF+FHKENF
Sbjct  829   SRKTTTKFEFHKENF  843



>ref|XP_002889733.1| hypothetical protein ARALYDRAFT_470991 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65992.1| hypothetical protein ARALYDRAFT_470991 [Arabidopsis lyrata subsp. 
lyrata]
Length=754

 Score =   285 bits (730),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 164/196 (84%), Gaps = 4/196 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNF-RT  922
             YGAPAQDY+ YDV+LLVGLGIGATP+ISI++D++NN+      E G        KN+  T
Sbjct  562   YGAPAQDYRHYDVLLLVGLGIGATPLISIIRDVLNNIKNQKSIEQGTNQH---IKNYVAT  618

Query  921   KKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSL  742
             K+AYFYWVTREQGS +WF  +MNEVAE D+ G+IE+HNYCTSVYEEGDARSALITMLQSL
Sbjct  619   KRAYFYWVTREQGSLEWFSEVMNEVAEYDSEGMIELHNYCTSVYEEGDARSALITMLQSL  678

Query  741   HHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALD  562
             HHAK+G+DIVSGTRV++HFA+P+WR+V+K +A+NH + +VGVFYCG   +  EL++LA D
Sbjct  679   HHAKSGIDIVSGTRVRTHFARPDWRSVFKHVAVNHVNQRVGVFYCGNTCIIGELKRLAQD  738

Query  561   FSRKTSTKFDFHKENF  514
             FSRKT+TKF+FHKENF
Sbjct  739   FSRKTTTKFEFHKENF  754



>ref|NP_973799.1| Respiratory burst oxidase-B [Arabidopsis thaliana]
 sp|Q9SBI0.1|RBOHB_ARATH RecName: Full=Respiratory burst oxidase homolog protein B; AltName: 
Full=NADPH oxidase RBOHB; Short=AtRBOHB [Arabidopsis 
thaliana]
 gb|AAC39476.1| respiratory burst oxidase protein B [Arabidopsis thaliana]
 gb|AEE28394.1| Respiratory burst oxidase-B [Arabidopsis thaliana]
Length=843

 Score =   287 bits (734),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/196 (67%), Positives = 163/196 (83%), Gaps = 4/196 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNF-RT  922
             YGAPAQDY+ YDV+LLVGLGIGATP+ISI++D++NN+     +           KN+  T
Sbjct  651   YGAPAQDYRNYDVLLLVGLGIGATPLISIIRDVLNNI---KNQNSIERGTNQHIKNYVAT  707

Query  921   KKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSL  742
             K+AYFYWVTREQGS +WF  +MNEVAE D+ G+IE+HNYCTSVYEEGDARSALITMLQSL
Sbjct  708   KRAYFYWVTREQGSLEWFSEVMNEVAEYDSEGMIELHNYCTSVYEEGDARSALITMLQSL  767

Query  741   HHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALD  562
             HHAK+G+DIVSGTRV++HFA+PNWR+V+K +A+NH + +VGVFYCG   +  EL++LA D
Sbjct  768   HHAKSGIDIVSGTRVRTHFARPNWRSVFKHVAVNHVNQRVGVFYCGNTCIIGELKRLAQD  827

Query  561   FSRKTSTKFDFHKENF  514
             FSRKT+TKF+FHKENF
Sbjct  828   FSRKTTTKFEFHKENF  843



>gb|ABG35769.1| NOX2 [Striga asiatica]
Length=528

 Score =   279 bits (713),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 162/210 (77%), Gaps = 15/210 (7%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT------  937
             YGAPAQDY+KYDV+LLVGLGIGATP ISI+KD++NN+   +E+     +    +      
Sbjct  319   YGAPAQDYRKYDVLLLVGLGIGATPFISILKDLLNNIVKMEEQADSTSDISRNSDQSVSS  378

Query  936   ---------KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEE  784
                      K  RT  AYFYWVTREQGSFDWFKG+MNEVAE+D RGVIEMHNY TSVYEE
Sbjct  379   FDSSNTKRRKTLRTTNAYFYWVTREQGSFDWFKGVMNEVAELDQRGVIEMHNYLTSVYEE  438

Query  783   GDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCG  604
             GDARSALITM+Q+L+HAKNGVDIVSGTRV++HFA+PNW+ V  +I   H ++++GVFYCG
Sbjct  439   GDARSALITMVQALNHAKNGVDIVSGTRVRTHFARPNWKKVLSKIGTKHANARIGVFYCG  498

Query  603   APALTTELRQLALDFSRKTSTKFDFHKENF  514
             AP L  EL QL  +++++ STKF+FHKE+F
Sbjct  499   APVLAKELNQLCYEYNQEGSTKFEFHKEHF  528



>ref|XP_006285093.1| hypothetical protein CARUB_v10006425mg [Capsella rubella]
 gb|EOA17991.1| hypothetical protein CARUB_v10006425mg [Capsella rubella]
Length=864

 Score =   286 bits (732),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 163/199 (82%), Gaps = 4/199 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATK----N  931
             YGAPAQDYKKY+VVLL+GLGIGATPMISI+K+I++N    ++     +      +     
Sbjct  666   YGAPAQDYKKYEVVLLIGLGIGATPMISIIKEIISNTETKEQLSQMEKGSKQEPQGKKET  725

Query  930   FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITML  751
             F+T++AYFYWVT+EQG+FDWFK IMNE+AE D   VI++HN+CTSVYEEGD RSALI M+
Sbjct  726   FKTRRAYFYWVTKEQGTFDWFKNIMNEIAERDKSKVIDLHNHCTSVYEEGDVRSALIRMI  785

Query  750   QSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQL  571
             QSL++AKNG+DIV+GTRV SHFA+PNW+NVYK+IA++H  + VGVFYCGAP LT ELR L
Sbjct  786   QSLNYAKNGLDIVAGTRVMSHFARPNWKNVYKQIAMDHPGANVGVFYCGAPVLTKELRHL  845

Query  570   ALDFSRKTSTKFDFHKENF  514
             AL+F+ KTST+F FHKENF
Sbjct  846   ALEFTHKTSTRFSFHKENF  864



>ref|XP_003567677.1| PREDICTED: respiratory burst oxidase homolog protein B [Brachypodium 
distachyon]
 ref|XP_010230866.1| PREDICTED: respiratory burst oxidase homolog protein B [Brachypodium 
distachyon]
Length=901

 Score =   286 bits (732),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 161/197 (82%), Gaps = 2/197 (1%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKN--FR  925
             YGAPAQDY++YDV+LL+GLGIGATP+ISIVKD++N++       G         K   F 
Sbjct  705   YGAPAQDYREYDVLLLIGLGIGATPLISIVKDVLNHLQRGGSVGGTEPEASGKPKKRPFM  764

Query  924   TKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQS  745
             TK+AYFYWVTRE+GSF+WF+G+MNEVAE D  GVIE+HN+C+SVY+EGDARSALI MLQ 
Sbjct  765   TKRAYFYWVTREEGSFEWFRGVMNEVAEKDKDGVIELHNHCSSVYQEGDARSALIVMLQE  824

Query  744   LHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLAL  565
             L HAK GVDI+SGT VK+HFA+PNWR+V+KR+A+NH + +VGVFYCG P L  +LRQL+ 
Sbjct  825   LQHAKKGVDILSGTSVKTHFARPNWRSVFKRVAVNHENQRVGVFYCGEPVLVPQLRQLSA  884

Query  564   DFSRKTSTKFDFHKENF  514
             DF+ KT+TKF+FHKENF
Sbjct  885   DFTHKTNTKFEFHKENF  901



>ref|XP_006413344.1| hypothetical protein EUTSA_v10024426mg [Eutrema salsugineum]
 gb|ESQ54797.1| hypothetical protein EUTSA_v10024426mg [Eutrema salsugineum]
Length=818

 Score =   285 bits (728),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 165/201 (82%), Gaps = 6/201 (3%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKN----  931
             YGAPAQDYKKY+VVLLVGLGIGATPMISI+KDI+NN  A ++ +      G+  ++    
Sbjct  618   YGAPAQDYKKYEVVLLVGLGIGATPMISIIKDIINNTDAKEQGQLNQMEKGSQKESQGKK  677

Query  930   --FRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALIT  757
               F+T++AYFYWVTREQGS+DWFK IMNE+AE D   VIE+HNYCTSVYEE DARSALI 
Sbjct  678   ERFKTRRAYFYWVTREQGSYDWFKNIMNEIAERDRSKVIELHNYCTSVYEEDDARSALIH  737

Query  756   MLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELR  577
             MLQS+ +AK+G DIVS TRVKSHFAKPNW +VYK++AL+H  + VGVFYCG+P LT ELR
Sbjct  738   MLQSISYAKSGRDIVSETRVKSHFAKPNWEDVYKQVALDHPGTNVGVFYCGSPVLTKELR  797

Query  576   QLALDFSRKTSTKFDFHKENF  514
             +LAL+F+ KT+T+F FHKENF
Sbjct  798   RLALEFTHKTNTRFTFHKENF  818



>ref|XP_008366996.1| PREDICTED: respiratory burst oxidase homolog protein A-like, 
partial [Malus domestica]
Length=484

 Score =   276 bits (706),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 163/215 (76%), Gaps = 20/215 (9%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaAT------  937
             YGAPAQDY+KYDV+LLVGLGIGATP ISI+KD++NN+   +E+   V +    +      
Sbjct  270   YGAPAQDYRKYDVLLLVGLGIGATPFISILKDLLNNIVKMEEQADSVSDFSRTSDLSSGS  329

Query  936   --------------KNFRTKKAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCT  799
                           K  +T  AYFYWVTREQGSFDWFKG+MNEVAE+D RGVIEMHNY T
Sbjct  330   IGSPNHNKVYPKRKKPLKTTNAYFYWVTREQGSFDWFKGVMNEVAELDQRGVIEMHNYLT  389

Query  798   SVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVG  619
             SVYEEGDARS LITM+Q+L+HAKNGVDIVSGTRV++HFA+PNW+ V+ + +  H ++++G
Sbjct  390   SVYEEGDARSTLITMVQALNHAKNGVDIVSGTRVRTHFARPNWKKVFSKTSSKHCNARIG  449

Query  618   VFYCGAPALTTELRQLALDFSRKTSTKFDFHKENF  514
             VFYCGAP L  EL QL  +F++K STKF+FHKE+F
Sbjct  450   VFYCGAPVLAKELSQLCYEFNQKGSTKFEFHKEHF  484



>ref|XP_009118326.1| PREDICTED: respiratory burst oxidase homolog protein B [Brassica 
rapa]
Length=846

 Score =   285 bits (728),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 161/195 (83%), Gaps = 3/195 (2%)
 Frame = -1

Query  1098  YGAPAQDYKKYDVVLLVGLGIGATPMISIVKDIVNNMTaadeeeggvenggaATKNFRTK  919
             YGA AQDY+ YDV+LLVGLGIGATP+ISI+KD++NN+      E G  +    +    TK
Sbjct  655   YGAQAQDYRNYDVLLLVGLGIGATPLISILKDVLNNIKNHKSIEEGTSHNVNRSN---TK  711

Query  918   KAYFYWVTREQGSFDWFKGIMNEVAEMDNRGVIEMHNYCTSVYEEGDARSALITMLQSLH  739
             +AYFYWVTREQGS +WF  +MNEVAE D+ G+IE+HNYCTSVYEEGDARSALITMLQSLH
Sbjct  712   RAYFYWVTREQGSLEWFSEVMNEVAEYDSEGIIELHNYCTSVYEEGDARSALITMLQSLH  771

Query  738   HAKNGVDIVSGTRVKSHFAKPNWRNVYKRIALNHTDSKVGVFYCGAPALTTELRQLALDF  559
             HAKNG+DIVSGTRV++HFA+P+WR+V+K +A+NH + +VGVFYCG   +  EL+ LA DF
Sbjct  772   HAKNGIDIVSGTRVRTHFARPDWRSVFKHVAVNHINQRVGVFYCGKSCIIGELKGLAQDF  831

Query  558   SRKTSTKFDFHKENF  514
             SRKTSTKF+FHKENF
Sbjct  832   SRKTSTKFEFHKENF  846



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2910162023800