BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13704

Length=691
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009790027.1|  PREDICTED: uncharacterized protein LOC104237...    175   1e-50   Nicotiana sylvestris
ref|XP_009790026.1|  PREDICTED: uncharacterized protein LOC104237...    174   3e-50   Nicotiana sylvestris
ref|XP_009629181.1|  PREDICTED: uncharacterized protein LOC104119393    170   2e-49   Nicotiana tomentosiformis
ref|XP_006346049.1|  PREDICTED: uncharacterized protein LOC102584377    159   5e-45   Solanum tuberosum [potatoes]
emb|CDP13616.1|  unnamed protein product                                158   6e-45   Coffea canephora [robusta coffee]
ref|XP_011099893.1|  PREDICTED: uncharacterized protein LOC105178184    158   1e-44   Sesamum indicum [beniseed]
ref|XP_010324213.1|  PREDICTED: uncharacterized protein LOC101260...    154   5e-43   Solanum lycopersicum
ref|XP_002269358.1|  PREDICTED: uncharacterized protein LOC100257623    148   1e-40   Vitis vinifera
gb|EYU30821.1|  hypothetical protein MIMGU_mgv1a014715mg                146   1e-39   Erythranthe guttata [common monkey flower]
ref|XP_012087432.1|  PREDICTED: uncharacterized protein LOC105646226    145   2e-39   Jatropha curcas
ref|XP_008226292.1|  PREDICTED: uncharacterized protein LOC103325877    136   2e-36   Prunus mume [ume]
emb|CBI21789.3|  unnamed protein product                                135   7e-36   Vitis vinifera
ref|XP_007212201.1|  hypothetical protein PRUPE_ppa012905mg             135   9e-36   Prunus persica
ref|XP_006584538.1|  PREDICTED: uncharacterized protein LOC100527...    134   1e-35   Glycine max [soybeans]
ref|XP_010246692.1|  PREDICTED: uncharacterized protein LOC104589...    134   2e-35   Nelumbo nucifera [Indian lotus]
ref|XP_010246691.1|  PREDICTED: uncharacterized protein LOC104589...    134   3e-35   
gb|KHN26803.1|  hypothetical protein glysoja_011395                     134   3e-35   Glycine soja [wild soybean]
ref|XP_006478017.1|  PREDICTED: uncharacterized protein LOC102631...    133   6e-35   Citrus sinensis [apfelsine]
gb|KDO53404.1|  hypothetical protein CISIN_1g032011mg                   132   6e-35   Citrus sinensis [apfelsine]
ref|XP_004294213.1|  PREDICTED: uncharacterized protein LOC101305830    132   1e-34   Fragaria vesca subsp. vesca
ref|NP_001236781.1|  uncharacterized protein LOC100527746               131   3e-34   Glycine max [soybeans]
ref|XP_008362430.1|  PREDICTED: uncharacterized protein LOC103426119    130   5e-34   
ref|XP_002317024.1|  SNARE-associated family protein                    129   7e-34   Populus trichocarpa [western balsam poplar]
ref|XP_006441030.1|  hypothetical protein CICLE_v10022701mg             129   2e-33   
ref|XP_004488839.1|  PREDICTED: uncharacterized protein LOC101502919    129   2e-33   Cicer arietinum [garbanzo]
ref|XP_011030726.1|  PREDICTED: uncharacterized protein LOC105130...    128   3e-33   Populus euphratica
ref|XP_009361765.1|  PREDICTED: uncharacterized protein LOC103951981    128   3e-33   Pyrus x bretschneideri [bai li]
ref|XP_002312031.2|  hypothetical protein POPTR_0008s04280g             129   3e-33   
ref|XP_007015232.1|  SNARE-associated protein-related isoform 4         127   5e-33   
ref|XP_010062708.1|  PREDICTED: uncharacterized protein LOC104450...    128   6e-33   Eucalyptus grandis [rose gum]
gb|KEH38361.1|  SNARE-associated-like protein                           127   7e-33   Medicago truncatula
ref|XP_008813839.1|  PREDICTED: uncharacterized protein LOC103724383    127   1e-32   Phoenix dactylifera
ref|XP_006478016.1|  PREDICTED: uncharacterized protein LOC102631...    127   1e-32   
gb|KHN27744.1|  hypothetical protein glysoja_025549                     127   1e-32   Glycine soja [wild soybean]
ref|XP_008444284.1|  PREDICTED: uncharacterized protein LOC103487651    126   2e-32   Cucumis melo [Oriental melon]
ref|XP_004144641.1|  PREDICTED: uncharacterized protein LOC101218072    126   2e-32   Cucumis sativus [cucumbers]
ref|XP_007015229.1|  SNARE-associated protein-related isoform 1         126   2e-32   
ref|XP_007015230.1|  SNARE-associated protein-related isoform 2         126   2e-32   
ref|XP_003546784.2|  PREDICTED: uncharacterized protein LOC100781060    125   3e-32   Glycine max [soybeans]
ref|XP_006836418.1|  PREDICTED: uncharacterized protein LOC18427302     127   4e-32   Amborella trichopoda
ref|XP_007015231.1|  SNARE-associated protein-related isoform 3         126   6e-32   
ref|XP_011030725.1|  PREDICTED: uncharacterized protein LOC105130...    124   6e-32   Populus euphratica
ref|XP_010667976.1|  PREDICTED: uncharacterized protein LOC104884...    124   7e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002513428.1|  conserved hypothetical protein                     124   9e-32   
ref|XP_002889229.1|  hypothetical protein ARALYDRAFT_316805             124   1e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_008775076.1|  PREDICTED: uncharacterized protein LOC103695503    124   1e-31   Phoenix dactylifera
gb|AAC17065.1|  YUP8H12R.31                                             124   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009106627.1|  PREDICTED: uncharacterized protein LOC103832...    123   2e-31   Brassica rapa
ref|XP_009385045.1|  PREDICTED: uncharacterized protein LOC103972432    122   3e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009106625.1|  PREDICTED: uncharacterized protein LOC103832...    122   3e-31   Brassica rapa
ref|XP_009412041.1|  PREDICTED: uncharacterized protein LOC103993631    123   3e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006389924.1|  hypothetical protein EUTSA_v10019307mg             122   4e-31   Eutrema salsugineum [saltwater cress]
ref|NP_178028.2|  SNARE-associated protein-like protein                 122   4e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010667978.1|  PREDICTED: uncharacterized protein LOC104884...    122   8e-31   Beta vulgaris subsp. vulgaris [field beet]
gb|AGU28426.1|  SNARE-associated protein-related protein                120   9e-31   Sinapis alba [bai jie]
gb|KFK42286.1|  hypothetical protein AALP_AA2G235900                    121   1e-30   Arabis alpina [alpine rockcress]
ref|XP_010926900.1|  PREDICTED: uncharacterized protein LOC105049063    121   2e-30   Elaeis guineensis
ref|XP_010531969.1|  PREDICTED: uncharacterized protein LOC104808...    120   3e-30   Tarenaya hassleriana [spider flower]
ref|XP_010531968.1|  PREDICTED: uncharacterized protein LOC104808...    121   3e-30   Tarenaya hassleriana [spider flower]
ref|XP_010472746.1|  PREDICTED: uncharacterized protein LOC104752335    119   4e-30   Camelina sativa [gold-of-pleasure]
emb|CDX88503.1|  BnaC06g39470D                                          119   5e-30   
gb|KHG08621.1|  SNARE-associated Snapin                                 118   4e-29   Gossypium arboreum [tree cotton]
ref|XP_010095375.1|  hypothetical protein L484_010905                   116   8e-29   
gb|KJB55464.1|  hypothetical protein B456_009G077700                    117   9e-29   Gossypium raimondii
ref|XP_009371387.1|  PREDICTED: uncharacterized protein LOC103960631    116   1e-28   Pyrus x bretschneideri [bai li]
ref|XP_010417524.1|  PREDICTED: uncharacterized protein LOC104703252    116   1e-28   Camelina sativa [gold-of-pleasure]
gb|KJB55466.1|  hypothetical protein B456_009G077700                    116   2e-28   Gossypium raimondii
ref|XP_011031813.1|  PREDICTED: LOW QUALITY PROTEIN: HBS1-like pr...    124   3e-28   Populus euphratica
ref|XP_003571349.1|  PREDICTED: uncharacterized protein LOC100833799    115   4e-28   Brachypodium distachyon [annual false brome]
dbj|BAJ91394.1|  predicted protein                                      114   1e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010429779.1|  PREDICTED: uncharacterized protein LOC104714192    110   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_004972945.1|  PREDICTED: uncharacterized protein LOC101757607    110   3e-26   
ref|XP_006659090.1|  PREDICTED: uncharacterized protein LOC102703418    108   8e-26   Oryza brachyantha
ref|NP_001144499.1|  uncharacterized protein LOC100277481               105   2e-24   
gb|AFW61295.1|  hypothetical protein ZEAMMB73_299655                    106   3e-24   
gb|EPS73251.1|  hypothetical protein M569_01509                         103   4e-24   Genlisea aurea
ref|XP_008677020.1|  PREDICTED: uncharacterized protein LOC100277...    106   1e-23   
ref|XP_008677018.1|  PREDICTED: uncharacterized protein LOC100277...    105   1e-23   
ref|XP_001770339.1|  predicted protein                                99.8    7e-23   
ref|NP_001175367.1|  Os08g0129900                                     99.0    4e-22   
gb|KGN54921.1|  hypothetical protein Csa_4G598520                     89.7    6e-19   Cucumis sativus [cucumbers]
ref|XP_002961298.1|  hypothetical protein SELMODRAFT_403072           90.5    1e-18   
ref|XP_008779254.1|  PREDICTED: uncharacterized protein LOC103698988  83.2    4e-17   
ref|XP_010324214.1|  PREDICTED: uncharacterized protein LOC101260...  65.5    3e-10   
ref|XP_007149268.1|  hypothetical protein PHAVU_005G055900g           55.5    5e-06   Phaseolus vulgaris [French bean]
ref|XP_007149269.1|  hypothetical protein PHAVU_005G056000g           50.8    5e-05   Phaseolus vulgaris [French bean]
dbj|GAM24750.1|  hypothetical protein SAMD00019534_079250             52.0    1e-04   Acytostelium subglobosum LB1
emb|CDX79289.1|  BnaC06g20140D                                        49.7    2e-04   



>ref|XP_009790027.1| PREDICTED: uncharacterized protein LOC104237552 isoform X2 [Nicotiana 
sylvestris]
Length=198

 Score =   175 bits (443),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +1

Query  43   MSDDVPENRLPDSTEDGIPSVAGDGNDDESNASTSPMGIGLSTLISSVIREFDSRADATS  222
            MS++VPE +  D+ E    SVA DG+DD S+AS S +  GLST+ISS+IREFD  A ATS
Sbjct  1    MSNEVPEKQPCDTAEHDPTSVAVDGDDDNSDASNSALAKGLSTIISSIIREFDDSAAATS  60

Query  223  RSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNI  402
            RSQDQLS  LDRLTGELDKLLEDAPLPFI+QHAARISGVRKR+TSLNS+LKSIQRR+DNI
Sbjct  61   RSQDQLSSTLDRLTGELDKLLEDAPLPFIMQHAARISGVRKRITSLNSLLKSIQRRLDNI  120

Query  403  DRMLLA  420
            D  L A
Sbjct  121  DHTLSA  126



>ref|XP_009790026.1| PREDICTED: uncharacterized protein LOC104237552 isoform X1 [Nicotiana 
sylvestris]
Length=204

 Score =   174 bits (441),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +1

Query  43   MSDDVPENRLPDSTEDGIPSVAGDGNDDESNASTSPMGIGLSTLISSVIREFDSRADATS  222
            MS++VPE +  D+ E    SVA DG+DD S+AS S +  GLST+ISS+IREFD  A ATS
Sbjct  1    MSNEVPEKQPCDTAEHDPTSVAVDGDDDNSDASNSALAKGLSTIISSIIREFDDSAAATS  60

Query  223  RSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNI  402
            RSQDQLS  LDRLTGELDKLLEDAPLPFI+QHAARISGVRKR+TSLNS+LKSIQRR+DNI
Sbjct  61   RSQDQLSSTLDRLTGELDKLLEDAPLPFIMQHAARISGVRKRITSLNSLLKSIQRRLDNI  120

Query  403  DRMLLA  420
            D  L A
Sbjct  121  DHTLSA  126



>ref|XP_009629181.1| PREDICTED: uncharacterized protein LOC104119393 [Nicotiana tomentosiformis]
Length=148

 Score =   170 bits (431),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 106/139 (76%), Gaps = 3/139 (2%)
 Frame = +1

Query  43   MSDDVPENRLPDSTEDGIPSVAGDGNDDESNASTSPMGIGLSTLISSVIREFDSRADATS  222
            MS++VPE +  D+ E    SVA DG  D S+ S S +  GLST+ISS+IREFD  A ATS
Sbjct  1    MSNEVPEKQPCDTAEHDPTSVAVDGVADNSDTSNSALAKGLSTIISSIIREFDDSAAATS  60

Query  223  RSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNI  402
            RSQDQLS  LDRLTGELDKLLEDAPLPFI+QHAARISGVRKR+TSLNS+LKSIQRR+DNI
Sbjct  61   RSQDQLSSTLDRLTGELDKLLEDAPLPFIMQHAARISGVRKRITSLNSLLKSIQRRLDNI  120

Query  403  DRML---LAENKMGEDGGQ  450
            D  L   L   K   DGG+
Sbjct  121  DHTLSAGLIHEKSTGDGGR  139



>ref|XP_006346049.1| PREDICTED: uncharacterized protein LOC102584377 [Solanum tuberosum]
Length=153

 Score =   159 bits (402),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 105/143 (73%), Gaps = 6/143 (4%)
 Frame = +1

Query  43   MSDDVPENRLPDSTEDGIPS--VAGDGNDDESNASTSPMGIGLSTLISSVIREFDSRADA  216
            MS++ PE    ++ E    S  V GDG +D ++ S S +  GLST+ISS+IREFD  A A
Sbjct  1    MSNEAPEKPPCNTPEHDSASTVVDGDGVNDNNDTSNSALAKGLSTIISSIIREFDGSAAA  60

Query  217  TSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVD  396
            TSRSQDQLS  LDRLTGELDKLLEDAPLPFI+QHAARISGVRKR+TSLNS+LKSIQRR+D
Sbjct  61   TSRSQDQLSSTLDRLTGELDKLLEDAPLPFIMQHAARISGVRKRITSLNSLLKSIQRRLD  120

Query  397  NIDRMLLA----ENKMGEDGGQH  453
            +ID  L A    E   G+ G  H
Sbjct  121  SIDHTLSAGLIHEQSTGDGGRDH  143



>emb|CDP13616.1| unnamed protein product [Coffea canephora]
Length=142

 Score =   158 bits (400),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 108/144 (75%), Gaps = 9/144 (6%)
 Frame = +1

Query  43   MSDDVPENRLPDST---EDGIPSVAGDGNDDESNASTSPMGIGLSTLISSVIREFDSRAD  213
            M+++ PE  L +S    E+  P+   DGND  S+  +S +G  LSTLIS++I++FD+RA+
Sbjct  1    MAEETPEGHLVESMSAEEEASPN-KNDGNDGTSSEESS-LGRCLSTLISTIIQDFDNRAE  58

Query  214  ATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRV  393
             T RSQDQLSFAL RLT ELD+LL+DAPLPF++QHAARISGVRKR TSLNSVLKSIQRR+
Sbjct  59   HTLRSQDQLSFALHRLTAELDQLLDDAPLPFVMQHAARISGVRKRFTSLNSVLKSIQRRI  118

Query  394  DNIDRML----LAENKMGEDGGQH  453
            DNIDR L    L E  + E GG H
Sbjct  119  DNIDRTLSAASLQEKVLTESGGTH  142



>ref|XP_011099893.1| PREDICTED: uncharacterized protein LOC105178184 [Sesamum indicum]
 ref|XP_011099894.1| PREDICTED: uncharacterized protein LOC105178184 [Sesamum indicum]
Length=149

 Score =   158 bits (399),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 109/146 (75%), Gaps = 9/146 (6%)
 Frame = +1

Query  43   MSDDVPENRLPDSTEDGI----PSVAGDGNDD-ESNASTSPMGIGLSTLISSVIREFDSR  207
            M+D  P++   DST  GI     +V+ D  DD  ++ S S +  GL +LISSV+  FDSR
Sbjct  1    MADGNPDDNQDDSTAVGISGDAAAVSRDKLDDITASNSNSAVAEGLYSLISSVLTGFDSR  60

Query  208  ADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQR  387
            A+AT+RSQDQL+F LDRLTGELDKLLEDAP PFI+QHAARISGVRKRV +LN+VLKS+QR
Sbjct  61   AEATARSQDQLAFTLDRLTGELDKLLEDAPSPFIMQHAARISGVRKRVKALNTVLKSVQR  120

Query  388  RVDNIDRMLLA----ENKMGEDGGQH  453
            R+DN+DRML A    E  +GE GGQ 
Sbjct  121  RIDNMDRMLSAGLSHEKLVGESGGQQ  146



>ref|XP_010324213.1| PREDICTED: uncharacterized protein LOC101260451 isoform X1 [Solanum 
lycopersicum]
Length=149

 Score =   154 bits (388),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 102/139 (73%), Gaps = 5/139 (4%)
 Frame = +1

Query  43   MSDDVPENRLPDSTEDGIPSVAGDGNDDESNASTSPMGIGLSTLISSVIREFDSRADATS  222
            MS++ P     D+ E    S   +G D  ++ S++ +  GLST+ISS+IREFD  A ATS
Sbjct  1    MSNEAPAKPPCDTPEHD--SAGVNGFDINNDTSSTALAKGLSTIISSLIREFDDSAAATS  58

Query  223  RSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNI  402
            RSQDQLS  LDRLTGELDKLLEDAPLPFI+QHAARISGVRKR+TSLNS+LKSIQRR+DNI
Sbjct  59   RSQDQLSSTLDRLTGELDKLLEDAPLPFIMQHAARISGVRKRITSLNSLLKSIQRRLDNI  118

Query  403  DRML---LAENKMGEDGGQ  450
            D  L   L   K   DGG+
Sbjct  119  DHTLSAGLLHEKSSGDGGR  137



>ref|XP_002269358.1| PREDICTED: uncharacterized protein LOC100257623 [Vitis vinifera]
 ref|XP_010645010.1| PREDICTED: uncharacterized protein LOC100257623 [Vitis vinifera]
Length=154

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 89/110 (81%), Gaps = 6/110 (5%)
 Frame = +1

Query  118  NDDESNAS---TSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLE  288
            NDDE+N S      +G  +S+++ SVIR+FDSRADA  RSQD LS  +DRLTGELDKLLE
Sbjct  36   NDDENNNSINTCESLGTAISSMLGSVIRDFDSRADAVIRSQDHLSLVIDRLTGELDKLLE  95

Query  289  DAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRML---LAENK  429
            DAPLPFI+QHAA+ISGVRKRV+SLNS+LKSIQRRVDNID ML   LA  K
Sbjct  96   DAPLPFIMQHAAKISGVRKRVSSLNSLLKSIQRRVDNIDGMLSMGLAHEK  145



>gb|EYU30821.1| hypothetical protein MIMGU_mgv1a014715mg [Erythranthe guttata]
 gb|EYU30822.1| hypothetical protein MIMGU_mgv1a014715mg [Erythranthe guttata]
Length=180

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 93/115 (81%), Gaps = 5/115 (4%)
 Frame = +1

Query  91   GIPSVAGDGNDDESN-----ASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALD  255
            G  +  G+  DD SN     +S S +  GL +LISSV+ +FDSRA+AT+ SQDQL+F+LD
Sbjct  48   GADTDGGEKCDDISNLITATSSNSSVAEGLYSLISSVMTDFDSRAEATASSQDQLAFSLD  107

Query  256  RLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRMLLA  420
            RLTGELDKLLEDAP PFI+QHAARISGV+KRV +LN+VLKS+QRR+DN+DRML A
Sbjct  108  RLTGELDKLLEDAPSPFIMQHAARISGVKKRVKALNTVLKSVQRRIDNMDRMLSA  162



>ref|XP_012087432.1| PREDICTED: uncharacterized protein LOC105646226 [Jatropha curcas]
 gb|KDP25131.1| hypothetical protein JCGZ_22666 [Jatropha curcas]
Length=160

 Score =   145 bits (365),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 99/132 (75%), Gaps = 1/132 (1%)
 Frame = +1

Query  22   SLGLSVTMSDDVPENRLPDSTE-DGIPSVAGDGNDDESNASTSPMGIGLSTLISSVIREF  198
            S+ +SV     V  N   DS E +     +    +DE N S+  +  GLST++++VIR+F
Sbjct  15   SVCISVEAERTVSSNGNKDSNEINSQEHKSKTNTEDEINKSSDALAKGLSTMLANVIRDF  74

Query  199  DSRADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKS  378
            DS+A  T +SQDQL+ A+DRLT ELD+LLEDAPLPFI+QHAA+ISGV+KRV+SLNS+LKS
Sbjct  75   DSKAQETLKSQDQLNSAIDRLTRELDQLLEDAPLPFIMQHAAKISGVKKRVSSLNSLLKS  134

Query  379  IQRRVDNIDRML  414
            IQRR+DN+DRML
Sbjct  135  IQRRIDNMDRML  146



>ref|XP_008226292.1| PREDICTED: uncharacterized protein LOC103325877 [Prunus mume]
Length=150

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +1

Query  151  MGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARI  330
            +   LS+ +S+VI+EFDS+A  TS SQDQLS +LDRLT ELDKLLEDAPLPFI+QHAA+I
Sbjct  38   LAKALSSTLSTVIKEFDSKAQQTSTSQDQLSQSLDRLTRELDKLLEDAPLPFIMQHAAKI  97

Query  331  SGVRKRVTSLNSVLKSIQRRVDNIDRML  414
            S VRKRV+SLNSVLKS+QRR+DNIDRML
Sbjct  98   SVVRKRVSSLNSVLKSVQRRLDNIDRML  125



>emb|CBI21789.3| unnamed protein product [Vitis vinifera]
Length=144

 Score =   135 bits (339),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 77/89 (87%), Gaps = 3/89 (3%)
 Frame = +1

Query  172  LISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGVRKRV  351
            ++ SVIR+FDSRADA  RSQD LS  +DRLTGELDKLLEDAPLPFI+QHAA+ISGVRKRV
Sbjct  1    MLGSVIRDFDSRADAVIRSQDHLSLVIDRLTGELDKLLEDAPLPFIMQHAAKISGVRKRV  60

Query  352  TSLNSVLKSIQRRVDNIDRML---LAENK  429
            +SLNS+LKSIQRRVDNID ML   LA  K
Sbjct  61   SSLNSLLKSIQRRVDNIDGMLSMGLAHGK  89



>ref|XP_007212201.1| hypothetical protein PRUPE_ppa012905mg [Prunus persica]
 gb|EMJ13400.1| hypothetical protein PRUPE_ppa012905mg [Prunus persica]
Length=150

 Score =   135 bits (339),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +1

Query  151  MGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARI  330
            +   LS+++++VI+EFDS+A  TS SQD LS +LDRLT ELDKLLEDAPLPFI+QHAA+I
Sbjct  38   LAKALSSMLTTVIKEFDSKAQQTSTSQDHLSQSLDRLTRELDKLLEDAPLPFIMQHAAKI  97

Query  331  SGVRKRVTSLNSVLKSIQRRVDNIDRML  414
            S VRKRV+SLNSVLKS+QRR+DNIDRML
Sbjct  98   SVVRKRVSSLNSVLKSVQRRLDNIDRML  125



>ref|XP_006584538.1| PREDICTED: uncharacterized protein LOC100527746 isoform X1 [Glycine 
max]
Length=154

 Score =   134 bits (338),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +1

Query  100  SVAGDGNDDESNASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDK  279
            S  G   DD+   S+  +  GLS+++SSVI +FD RA  T +SQ+ LS A+DRLTGELD+
Sbjct  39   SSHGSDGDDQLRQSSDVLAKGLSSMLSSVINDFDFRAQQTLQSQNHLSSAIDRLTGELDQ  98

Query  280  LLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRML  414
            LLEDAPLPFI+QHAA+IS VRKRV+SLNS+LKSIQ R+DNIDRML
Sbjct  99   LLEDAPLPFIMQHAAKISSVRKRVSSLNSLLKSIQGRIDNIDRML  143



>ref|XP_010246692.1| PREDICTED: uncharacterized protein LOC104589915 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010246693.1| PREDICTED: uncharacterized protein LOC104589915 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010246694.1| PREDICTED: uncharacterized protein LOC104589915 isoform X2 [Nelumbo 
nucifera]
 ref|XP_010246695.1| PREDICTED: uncharacterized protein LOC104589915 isoform X2 [Nelumbo 
nucifera]
Length=165

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +1

Query  124  DESNASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLP  303
            D S  S+  +  G+S+++ S+IR+FD RA+ T +SQDQ+ FA+DRLTGELD+LLEDAPLP
Sbjct  50   DLSFRSSEALAKGISSMLGSLIRDFDYRAENTLKSQDQVVFAVDRLTGELDRLLEDAPLP  109

Query  304  FIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRMLLA  420
            FI++HA++I GVRKRV+SLNS+LKSIQRR+DNIDRML A
Sbjct  110  FIMKHASKIVGVRKRVSSLNSLLKSIQRRIDNIDRMLSA  148



>ref|XP_010246691.1| PREDICTED: uncharacterized protein LOC104589915 isoform X1 [Nelumbo 
nucifera]
Length=168

 Score =   134 bits (337),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +1

Query  124  DESNASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLP  303
            D S  S+  +  G+S+++ S+IR+FD RA+ T +SQDQ+ FA+DRLTGELD+LLEDAPLP
Sbjct  50   DLSFRSSEALAKGISSMLGSLIRDFDYRAENTLKSQDQVVFAVDRLTGELDRLLEDAPLP  109

Query  304  FIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRMLLA  420
            FI++HA++I GVRKRV+SLNS+LKSIQRR+DNIDRML A
Sbjct  110  FIMKHASKIVGVRKRVSSLNSLLKSIQRRIDNIDRMLSA  148



>gb|KHN26803.1| hypothetical protein glysoja_011395 [Glycine soja]
Length=166

 Score =   134 bits (337),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +1

Query  100  SVAGDGNDDESNASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDK  279
            S  G   DD+   S+  +  GLS+++SSVI +FD RA  T +SQ+ LS A+DRLTGELD+
Sbjct  39   SSHGSDGDDQLRQSSDVLAKGLSSMLSSVINDFDFRAQQTLQSQNHLSSAIDRLTGELDQ  98

Query  280  LLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRML  414
            LLEDAPLPFI+QHAA+IS VRKRV+SLNS+LKSIQ R+DNIDRML
Sbjct  99   LLEDAPLPFIMQHAAKISSVRKRVSSLNSLLKSIQGRIDNIDRML  143



>ref|XP_006478017.1| PREDICTED: uncharacterized protein LOC102631365 isoform X2 [Citrus 
sinensis]
Length=167

 Score =   133 bits (335),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +1

Query  133  NASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIV  312
            N S+  + I LS+++++VI++FDS+A  T +SQDQL+ A+DRLTGELD+LLEDAPLPFI+
Sbjct  60   NKSSDALAIALSSMLTAVIKDFDSKAQDTLQSQDQLASAIDRLTGELDQLLEDAPLPFIM  119

Query  313  QHAARISGVRKRVTSLNSVLKSIQRRVDNIDRML  414
            Q+AA+ISGVRKRV+SLNS+LKSIQ+RVD IDR+L
Sbjct  120  QYAAKISGVRKRVSSLNSLLKSIQQRVDIIDRLL  153



>gb|KDO53404.1| hypothetical protein CISIN_1g032011mg [Citrus sinensis]
 gb|KDO53405.1| hypothetical protein CISIN_1g032011mg [Citrus sinensis]
 gb|KDO53406.1| hypothetical protein CISIN_1g032011mg [Citrus sinensis]
Length=149

 Score =   132 bits (333),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 84/94 (89%), Gaps = 0/94 (0%)
 Frame = +1

Query  133  NASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIV  312
            N S+  + I LS+++++VI++FDS+A  T +SQDQL+ A+DRLTGELD+LLEDAPLPFI+
Sbjct  42   NISSDALAIALSSMLTAVIKDFDSKAQDTLQSQDQLASAIDRLTGELDQLLEDAPLPFIM  101

Query  313  QHAARISGVRKRVTSLNSVLKSIQRRVDNIDRML  414
            Q+AA+ISGVRKRV+SLNS+LKSIQ+RVD IDR+L
Sbjct  102  QYAAKISGVRKRVSSLNSLLKSIQQRVDIIDRLL  135



>ref|XP_004294213.1| PREDICTED: uncharacterized protein LOC101305830 [Fragaria vesca 
subsp. vesca]
 ref|XP_011460867.1| PREDICTED: uncharacterized protein LOC101305830 [Fragaria vesca 
subsp. vesca]
Length=142

 Score =   132 bits (331),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +1

Query  139  STSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQH  318
            S+  +  GLS+ ++++I++FDS+A  T  SQDQLS ALDRLT ELDKLLEDAP+PFI+QH
Sbjct  30   SSEALAKGLSSTLAAIIKDFDSKAQQTFTSQDQLSQALDRLTRELDKLLEDAPMPFIMQH  89

Query  319  AARISGVRKRVTSLNSVLKSIQRRVDNIDRML  414
            AA+I+ VRKRV SLNSVLK++QRR+DNIDRML
Sbjct  90   AAKITAVRKRVLSLNSVLKNVQRRLDNIDRML  121



>ref|NP_001236781.1| uncharacterized protein LOC100527746 [Glycine max]
 gb|ACU16905.1| unknown [Glycine max]
Length=156

 Score =   131 bits (329),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 96/139 (69%), Gaps = 2/139 (1%)
 Frame = +1

Query  37   VTMSDDVPENRLPDSTEDGIPSVAGDGNDDESNASTSPMGIGLSTLISSVIREFDSRADA  216
             TM  +  ++ + +STE    S  G   DD+   S+  +  GLS+++SSVI +FD RA  
Sbjct  20   TTMEAEENDSVVVESTEPS--SSHGSDGDDQLRQSSDVLAKGLSSMLSSVINDFDFRAQQ  77

Query  217  TSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVD  396
            T +SQ+ LS A+D LTGELD+LLEDAPLPFI+QHAA+IS VRKRV+SLNS+LKSIQ R+D
Sbjct  78   TLQSQNHLSSAIDLLTGELDQLLEDAPLPFIMQHAAKISSVRKRVSSLNSLLKSIQGRID  137

Query  397  NIDRMLLAENKMGEDGGQH  453
            NIDRML      G +   H
Sbjct  138  NIDRMLSFGTTHGIEKNNH  156



>ref|XP_008362430.1| PREDICTED: uncharacterized protein LOC103426119 [Malus domestica]
Length=146

 Score =   130 bits (327),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 83/109 (76%), Gaps = 2/109 (2%)
 Frame = +1

Query  97   PSVAGDGNDDESN--ASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGE  270
             SV  D N++  N   ST  +   LS+ +++VI++FDS+A  T  SQD LS +LDRLT E
Sbjct  14   KSVTVDQNENAKNRLQSTEALAKALSSTLTTVIKDFDSKAQQTFASQDHLSQSLDRLTRE  73

Query  271  LDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRMLL  417
            LDKLL+DAP  FI+QHAA+IS VRKRV+SLNSVLKS+QRR+DNIDRML 
Sbjct  74   LDKLLDDAPFLFIMQHAAKISAVRKRVSSLNSVLKSVQRRLDNIDRMLF  122



>ref|XP_002317024.1| SNARE-associated family protein [Populus trichocarpa]
 gb|EEE97636.1| SNARE-associated family protein [Populus trichocarpa]
Length=137

 Score =   129 bits (325),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +1

Query  151  MGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARI  330
            +G  LST++++VI++ DS+A  T  SQD+L+ A+DRLT ELD+LLEDAPLPFI+QHAA+I
Sbjct  33   LGKALSTMLANVIKDLDSKAQDTLNSQDKLNSAIDRLTRELDQLLEDAPLPFIMQHAAKI  92

Query  331  SGVRKRVTSLNSVLKSIQRRVDNIDRML  414
            SGVRKRV+SLNSVLKSIQ+RVDNIDR+L
Sbjct  93   SGVRKRVSSLNSVLKSIQKRVDNIDRLL  120



>ref|XP_006441030.1| hypothetical protein CICLE_v10022701mg [Citrus clementina]
 ref|XP_006441031.1| hypothetical protein CICLE_v10022701mg [Citrus clementina]
 gb|ESR54270.1| hypothetical protein CICLE_v10022701mg [Citrus clementina]
 gb|ESR54271.1| hypothetical protein CICLE_v10022701mg [Citrus clementina]
Length=149

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 82/94 (87%), Gaps = 0/94 (0%)
 Frame = +1

Query  133  NASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIV  312
            N S+  + I LS+++++VI++FDS+A  T +SQDQL  A+DRLTGELD+LLEDAPLPFI+
Sbjct  42   NISSDALAIALSSMLTAVIKDFDSKAQDTLQSQDQLVSAIDRLTGELDQLLEDAPLPFIM  101

Query  313  QHAARISGVRKRVTSLNSVLKSIQRRVDNIDRML  414
            Q+AA+I GVRKRV+SLNS+LKSIQ+RVD IDR+L
Sbjct  102  QYAAKILGVRKRVSSLNSLLKSIQQRVDIIDRLL  135



>ref|XP_004488839.1| PREDICTED: uncharacterized protein LOC101502919 [Cicer arietinum]
Length=152

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +1

Query  73   PDSTEDGIPSVAGDGNDDESNASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFAL  252
            P S+  G  S   D + D    S+  +  GLS+++S+VIR+FD RA  T  SQ+ LS ++
Sbjct  24   PSSSRAGDNSSETDNSGDSLTKSSDLLAKGLSSILSTVIRDFDFRAQQTLMSQNHLSSSI  83

Query  253  DRLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRML  414
            DRLTGELD+LLEDAPLPFI+QHAA+IS VRKRV SLNS+LKSIQ R+DNIDR++
Sbjct  84   DRLTGELDQLLEDAPLPFIMQHAAKISSVRKRVLSLNSLLKSIQGRIDNIDRIM  137



>ref|XP_011030726.1| PREDICTED: uncharacterized protein LOC105130084 isoform X2 [Populus 
euphratica]
Length=133

 Score =   128 bits (321),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = +1

Query  151  MGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARI  330
            +G  LST++++VI++ DS+A  T  SQD+L+ A+DRLT ELD+LLE+APLPFI+QHAA+I
Sbjct  33   LGKALSTMLTNVIKDLDSKAQNTLNSQDKLNSAIDRLTRELDQLLEEAPLPFIMQHAAKI  92

Query  331  SGVRKRVTSLNSVLKSIQRRVDNIDRMLLAENKMGEDGGQH  453
            SGVR RV+SLNSVLKSIQ+RVDNID++L    K  +   QH
Sbjct  93   SGVRMRVSSLNSVLKSIQKRVDNIDQLLSVGKKTLDSSSQH  133



>ref|XP_009361765.1| PREDICTED: uncharacterized protein LOC103951981 [Pyrus x bretschneideri]
 ref|XP_009361766.1| PREDICTED: uncharacterized protein LOC103951981 [Pyrus x bretschneideri]
 ref|XP_009361767.1| PREDICTED: uncharacterized protein LOC103951981 [Pyrus x bretschneideri]
Length=146

 Score =   128 bits (321),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 83/109 (76%), Gaps = 2/109 (2%)
 Frame = +1

Query  97   PSVAGDGNDDESN--ASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGE  270
             SV  D N++  N   ST  +   LS+ +++VI++FDS+A  T  SQD LS +LDRLT E
Sbjct  14   KSVTVDQNENAKNRLQSTEALAKALSSTLTTVIKDFDSKAQQTFASQDHLSQSLDRLTRE  73

Query  271  LDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRMLL  417
            LDKLL+DAP  FI+QHAA+IS VRKRV+SLNSVL+S+QRR+DNIDRML 
Sbjct  74   LDKLLDDAPFLFIMQHAAKISAVRKRVSSLNSVLRSVQRRLDNIDRMLF  122



>ref|XP_002312031.2| hypothetical protein POPTR_0008s04280g [Populus trichocarpa]
 gb|EEE89398.2| hypothetical protein POPTR_0008s04280g [Populus trichocarpa]
Length=187

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 88/115 (77%), Gaps = 4/115 (3%)
 Frame = +1

Query  73   PDSTEDGIPSVAGDGNDDESNASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFAL  252
            PDS E+       +   +  N+ +  +G  LST++++VI++ DS+A  T  SQD+L+ A+
Sbjct  11   PDSNENN----PQESESESINSRSDALGKALSTMLATVIKDLDSKAQDTLNSQDKLNSAI  66

Query  253  DRLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRMLL  417
            DRLT ELD+LLEDAPLPFI+QHAA+ISGVRKRV+SLN VLKSIQ+RVDNIDR+L 
Sbjct  67   DRLTRELDQLLEDAPLPFIMQHAAKISGVRKRVSSLNFVLKSIQKRVDNIDRLLF  121



>ref|XP_007015232.1| SNARE-associated protein-related isoform 4, partial [Theobroma 
cacao]
 gb|EOY32851.1| SNARE-associated protein-related isoform 4, partial [Theobroma 
cacao]
Length=148

 Score =   127 bits (320),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 84/113 (74%), Gaps = 4/113 (4%)
 Frame = +1

Query  115  GNDDESNASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDA  294
             ND   N ST  +   LS++++S+I++FDS+A  T  SQD LS ++DRLT ELD+LLEDA
Sbjct  35   NNDPSDNDSTEALAKALSSMLTSLIKDFDSKAHDTLTSQDLLSSSIDRLTRELDQLLEDA  94

Query  295  PLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRMLLAENKMGEDGGQH  453
            PLPFI+QHAA+ S VRKRV SLN +LKSIQRR+DNIDRML     MG   G++
Sbjct  95   PLPFIMQHAAKFSNVRKRVFSLNLLLKSIQRRIDNIDRML----SMGLQHGEY  143



>ref|XP_010062708.1| PREDICTED: uncharacterized protein LOC104450021 isoform X1 [Eucalyptus 
grandis]
 gb|KCW69834.1| hypothetical protein EUGRSUZ_F03184 [Eucalyptus grandis]
Length=159

 Score =   128 bits (321),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 82/98 (84%), Gaps = 2/98 (2%)
 Frame = +1

Query  160  GLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGV  339
            G+S++++SVI++FD+RA  T +SQD LS ++DRLT ELD+LLEDAP PFI+QHAARIS V
Sbjct  62   GVSSVLASVIKDFDARAQGTLKSQDHLSSSIDRLTSELDRLLEDAPSPFIMQHAARISSV  121

Query  340  RKRVTSLNSVLKSIQRRVDNIDRML--LAENKMGEDGG  447
            RKRV+S+N+VL+SIQRR+DNIDRML   +  K   DGG
Sbjct  122  RKRVSSMNAVLRSIQRRLDNIDRMLSTASPPKKTTDGG  159



>gb|KEH38361.1| SNARE-associated-like protein [Medicago truncatula]
Length=152

 Score =   127 bits (320),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 86/112 (77%), Gaps = 7/112 (6%)
 Frame = +1

Query  100  SVAGDGNDDESNA-------STSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDR  258
            S AGD + +  NA       S+  +  GLS+++SSVI +FD RA  T  SQ+ LS ++DR
Sbjct  27   SHAGDNSSETENAAGDSLSKSSDVLAKGLSSILSSVITDFDFRAQQTLISQNHLSSSIDR  86

Query  259  LTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRML  414
            LTGELD+LLEDAPLPFI+QHAA+IS VRKRV+SLNS+LKSIQ R+DNIDR++
Sbjct  87   LTGELDQLLEDAPLPFIMQHAAKISSVRKRVSSLNSLLKSIQGRIDNIDRIM  138



>ref|XP_008813839.1| PREDICTED: uncharacterized protein LOC103724383 [Phoenix dactylifera]
Length=148

 Score =   127 bits (318),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +1

Query  160  GLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGV  339
             +ST + SV+REFD+RA+  +RSQD L  + DRLTGELDKL+EDAP+PFI+QHA +IS +
Sbjct  43   AISTTLGSVMREFDARAEGAARSQDHLLLSFDRLTGELDKLVEDAPMPFIMQHAVKISSI  102

Query  340  RKRVTSLNSVLKSIQRRVDNIDRML  414
            RKRV+SLN +LKSIQRR+DNIDRML
Sbjct  103  RKRVSSLNLLLKSIQRRIDNIDRML  127



>ref|XP_006478016.1| PREDICTED: uncharacterized protein LOC102631365 isoform X1 [Citrus 
sinensis]
Length=168

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 84/95 (88%), Gaps = 1/95 (1%)
 Frame = +1

Query  133  NASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTG-ELDKLLEDAPLPFI  309
            N S+  + I LS+++++VI++FDS+A  T +SQDQL+ A+DRLTG +LD+LLEDAPLPFI
Sbjct  60   NKSSDALAIALSSMLTAVIKDFDSKAQDTLQSQDQLASAIDRLTGGQLDQLLEDAPLPFI  119

Query  310  VQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRML  414
            +Q+AA+ISGVRKRV+SLNS+LKSIQ+RVD IDR+L
Sbjct  120  MQYAAKISGVRKRVSSLNSLLKSIQQRVDIIDRLL  154



>gb|KHN27744.1| hypothetical protein glysoja_025549 [Glycine soja]
Length=168

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = +1

Query  100  SVAGDGNDDESNASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDK  279
            S  G   DD    S+  +  GLS+++SSVI +FD RA  T +SQ+ LS A+DRLTGELD+
Sbjct  39   SSHGSDGDDHLRQSSDVLAKGLSSMLSSVISDFDFRAQQTLQSQNHLSSAIDRLTGELDQ  98

Query  280  LLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRML  414
            LLEDAPLPFI+Q AA+IS VRKRV+SLN +LKSIQ R+DNIDRML
Sbjct  99   LLEDAPLPFIMQQAAKISSVRKRVSSLNLLLKSIQGRIDNIDRML  143



>ref|XP_008444284.1| PREDICTED: uncharacterized protein LOC103487651 [Cucumis melo]
 ref|XP_008444285.1| PREDICTED: uncharacterized protein LOC103487651 [Cucumis melo]
 ref|XP_008444286.1| PREDICTED: uncharacterized protein LOC103487651 [Cucumis melo]
Length=154

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 86/107 (80%), Gaps = 2/107 (2%)
 Frame = +1

Query  112  DGNDDESN--ASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLL  285
            +GND E+    +++ +  GLS+++ ++IR+FDS+AD T +SQ+ LS +LDRLT ELD+LL
Sbjct  35   EGNDGENKNLGNSNALANGLSSMLINIIRDFDSKADDTLKSQNHLSSSLDRLTTELDQLL  94

Query  286  EDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRMLLAEN  426
            EDAP PFI+QHA+RIS VRKRV SLNS+L++IQRRVDNIDR +   N
Sbjct  95   EDAPFPFIMQHASRISNVRKRVLSLNSILRTIQRRVDNIDRAITMGN  141



>ref|XP_004144641.1| PREDICTED: uncharacterized protein LOC101218072 [Cucumis sativus]
Length=154

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 86/107 (80%), Gaps = 2/107 (2%)
 Frame = +1

Query  112  DGNDDESN--ASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLL  285
            +GND E+    +++ +  GLS+++ ++IR+FDS+AD T +SQ+ LS +LDRLT ELD+LL
Sbjct  35   EGNDSENKNLGNSNALANGLSSMLINIIRDFDSKADDTLKSQNHLSSSLDRLTTELDQLL  94

Query  286  EDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRMLLAEN  426
            EDAP PFI+QHA+RIS VRKRV SLNS+L++IQRR+DNIDR +   N
Sbjct  95   EDAPFPFIMQHASRISNVRKRVLSLNSILRTIQRRMDNIDRAITMGN  141



>ref|XP_007015229.1| SNARE-associated protein-related isoform 1 [Theobroma cacao]
 gb|EOY32848.1| SNARE-associated protein-related isoform 1 [Theobroma cacao]
Length=148

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +1

Query  115  GNDDESNASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDA  294
             ND   N ST  +   LS++++S+I++FDS+A  T  SQD LS ++DRLT ELD+LLEDA
Sbjct  35   NNDPSDNDSTEALAKALSSMLTSLIKDFDSKAHDTLTSQDLLSSSIDRLTRELDQLLEDA  94

Query  295  PLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRML  414
            PLPFI+QHAA+ S VRKRV SLN +LKSIQRR+DNIDRML
Sbjct  95   PLPFIMQHAAKFSNVRKRVFSLNLLLKSIQRRIDNIDRML  134



>ref|XP_007015230.1| SNARE-associated protein-related isoform 2, partial [Theobroma 
cacao]
 gb|EOY32849.1| SNARE-associated protein-related isoform 2, partial [Theobroma 
cacao]
Length=145

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +1

Query  115  GNDDESNASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDA  294
             ND   N ST  +   LS++++S+I++FDS+A  T  SQD LS ++DRLT ELD+LLEDA
Sbjct  32   NNDPSDNDSTEALAKALSSMLTSLIKDFDSKAHDTLTSQDLLSSSIDRLTRELDQLLEDA  91

Query  295  PLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRML  414
            PLPFI+QHAA+ S VRKRV SLN +LKSIQRR+DNIDRML
Sbjct  92   PLPFIMQHAAKFSNVRKRVFSLNLLLKSIQRRIDNIDRML  131



>ref|XP_003546784.2| PREDICTED: uncharacterized protein LOC100781060 [Glycine max]
Length=154

 Score =   125 bits (315),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = +1

Query  100  SVAGDGNDDESNASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDK  279
            S  G   DD    S+  +  GLS+++SSVI +FD RA  T +SQ+ LS  +DRLTGELD+
Sbjct  39   SSHGSDGDDHLRQSSDVLAKGLSSMLSSVISDFDFRAQQTLQSQNHLSSVIDRLTGELDQ  98

Query  280  LLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRML  414
            LLEDAPLPFI+Q AA+IS VRKRV+SLN +LKSIQ R+DNIDRML
Sbjct  99   LLEDAPLPFIMQQAAKISSVRKRVSSLNLLLKSIQGRIDNIDRML  143



>ref|XP_006836418.1| PREDICTED: uncharacterized protein LOC18427302 [Amborella trichopoda]
 gb|ERM99271.1| hypothetical protein AMTR_s00092p00154310 [Amborella trichopoda]
Length=201

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +1

Query  124  DESNASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLP  303
            D  N ST  M   +S++++SV+ EFD RA    RSQD L  ++DRLT ELDKLLEDAPLP
Sbjct  75   DGDNKSTEAMARAISSMLTSVMTEFDFRAGNVIRSQDMLGGSIDRLTLELDKLLEDAPLP  134

Query  304  FIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRMLLA  420
            F++QHAA+++GVRKR++SLNSVLK IQ R+DNIDRML A
Sbjct  135  FVMQHAAKLTGVRKRISSLNSVLKVIQHRIDNIDRMLSA  173



>ref|XP_007015231.1| SNARE-associated protein-related isoform 3, partial [Theobroma 
cacao]
 gb|EOY32850.1| SNARE-associated protein-related isoform 3, partial [Theobroma 
cacao]
Length=183

 Score =   126 bits (316),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +1

Query  115  GNDDESNASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDA  294
             ND   N ST  +   LS++++S+I++FDS+A  T  SQD LS ++DRLT ELD+LLEDA
Sbjct  70   NNDPSDNDSTEALAKALSSMLTSLIKDFDSKAHDTLTSQDLLSSSIDRLTRELDQLLEDA  129

Query  295  PLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRML  414
            PLPFI+QHAA+ S VRKRV SLN +LKSIQRR+DNIDRML
Sbjct  130  PLPFIMQHAAKFSNVRKRVFSLNLLLKSIQRRIDNIDRML  169



>ref|XP_011030725.1| PREDICTED: uncharacterized protein LOC105130084 isoform X1 [Populus 
euphratica]
Length=137

 Score =   124 bits (312),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +1

Query  151  MGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARI  330
            +G  LST++++VI++ DS+A  T  SQD+L+ A+DRLT ELD+LLE+APLPFI+QHAA+I
Sbjct  33   LGKALSTMLTNVIKDLDSKAQNTLNSQDKLNSAIDRLTRELDQLLEEAPLPFIMQHAAKI  92

Query  331  SGVRKRVTSLNSVLKSIQRRVDNIDRML  414
            SGVR RV+SLNSVLKSIQ+RVDNID++L
Sbjct  93   SGVRMRVSSLNSVLKSIQKRVDNIDQLL  120



>ref|XP_010667976.1| PREDICTED: uncharacterized protein LOC104884967 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010667977.1| PREDICTED: uncharacterized protein LOC104884967 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=145

 Score =   124 bits (312),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 90/131 (69%), Gaps = 6/131 (5%)
 Frame = +1

Query  76   DSTEDGIPSVAGDGNDDESNASTSPMGI--GLSTLISSVIREFDSRADATSRSQDQLSFA  249
            DS       +  + N    N + +P  +  G+ST+++ VI+ FDS+A+A S SQ  L  A
Sbjct  15   DSNSTNSAQLVNNVNHIHDNITGNPKALAEGISTMLADVIKGFDSKAEAASTSQHTLFSA  74

Query  250  LDRLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRML----L  417
            LDRLT ELD+LLEDAPLPFI+QHA ++S VR+RV SLNS+LKS+Q R+DNIDRM+    +
Sbjct  75   LDRLTAELDQLLEDAPLPFIMQHATKLSNVRRRVASLNSLLKSVQHRLDNIDRMMSIGSI  134

Query  418  AENKMGEDGGQ  450
            A+NK  + G +
Sbjct  135  ADNKSNKGGSK  145



>ref|XP_002513428.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48831.1| conserved hypothetical protein [Ricinus communis]
Length=147

 Score =   124 bits (312),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 90/129 (70%), Gaps = 13/129 (10%)
 Frame = +1

Query  67   RLPDSTEDGIPSVAGDGNDDESN-------------ASTSPMGIGLSTLISSVIREFDSR  207
            R+  ++ DG+ S   D +  E N              S+  +   LST++ S+IR+FDS+
Sbjct  5    RVRCNSTDGMDSAVSDNDATEDNPKGEQSIPKNDIKKSSDALAKALSTMLGSIIRDFDSK  64

Query  208  ADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQR  387
            A+ T +SQD L+ ++DRLT ELDKLLEDAP PFI+QHAA+IS VRKRV+SLN +LKS+Q+
Sbjct  65   AEDTFKSQDLLNSSIDRLTAELDKLLEDAPFPFIMQHAAKISAVRKRVSSLNFLLKSMQK  124

Query  388  RVDNIDRML  414
            R+DNIDR+L
Sbjct  125  RIDNIDRVL  133



>ref|XP_002889229.1| hypothetical protein ARALYDRAFT_316805 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65488.1| hypothetical protein ARALYDRAFT_316805 [Arabidopsis lyrata subsp. 
lyrata]
Length=138

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = +1

Query  73   PDSTEDGIPSVAGDGNDDESNASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFAL  252
             D+T     S A +  D +       M  GLS ++ SVI++FDSRA  T  SQD LS +L
Sbjct  13   ADATTSSCQSTAAE--DGQVGGGGEAMARGLSAMLESVIKDFDSRALDTLNSQDHLSGSL  70

Query  253  DRLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRMLLAENKM  432
            DRL  ELD+LLE+APLPFIVQHA+RIS V++RV+SLN VLKS+QRR+DNID ML A   +
Sbjct  71   DRLVQELDQLLENAPLPFIVQHASRISSVKQRVSSLNLVLKSVQRRIDNIDHMLSANTTL  130



>ref|XP_008775076.1| PREDICTED: uncharacterized protein LOC103695503 [Phoenix dactylifera]
 ref|XP_008775077.1| PREDICTED: uncharacterized protein LOC103695503 [Phoenix dactylifera]
Length=150

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +1

Query  160  GLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGV  339
             +S+ + SV+REFD+RA+  +RSQD+L  +LDR  GELDKLLEDAPLPFI+QHA +IS +
Sbjct  45   AISSTLGSVMREFDARAEGAARSQDELILSLDRFAGELDKLLEDAPLPFIMQHATKISSI  104

Query  340  RKRVTSLNSVLKSIQRRVDNIDRML  414
            RKRV++LN +LKSIQRR+DNIDRML
Sbjct  105  RKRVSALNLLLKSIQRRIDNIDRML  129



>gb|AAC17065.1| YUP8H12R.31 [Arabidopsis thaliana]
Length=149

 Score =   124 bits (310),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 83/121 (69%), Gaps = 2/121 (2%)
 Frame = +1

Query  73   PDSTEDGIPSVAGDGNDDESNASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFAL  252
             D+T     S   +  D +       M  GLS ++ SVI++FDS+A  T  SQD+LS +L
Sbjct  13   ADATTSSCQSTTAE--DGQCGGGGEAMARGLSAMLESVIKDFDSKALDTLNSQDELSGSL  70

Query  253  DRLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRMLLAENKM  432
            DRL  ELD+LLE+APLPFIVQHA+RIS V++RV+SLN VLKS+QRR+DNID ML A    
Sbjct  71   DRLVQELDQLLENAPLPFIVQHASRISSVKQRVSSLNLVLKSVQRRIDNIDHMLSANTTQ  130

Query  433  G  435
            G
Sbjct  131  G  131



>ref|XP_009106627.1| PREDICTED: uncharacterized protein LOC103832384 isoform X2 [Brassica 
rapa]
Length=135

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 79/99 (80%), Gaps = 2/99 (2%)
 Frame = +1

Query  148  PMGIGLSTLISSVIREFDSRA-DATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAA  324
             M  GLS ++ SVI+EFDS++ DA S SQD+LS +LDRL  ELD+LLE+APLPFIVQHA+
Sbjct  36   AMARGLSAMLESVIKEFDSKSLDALS-SQDKLSGSLDRLVQELDQLLENAPLPFIVQHAS  94

Query  325  RISGVRKRVTSLNSVLKSIQRRVDNIDRMLLAENKMGED  441
            RIS V++RV+S+N VLKSIQRR+DNID ML A N    D
Sbjct  95   RISSVKQRVSSMNLVLKSIQRRIDNIDHMLSANNIQASD  133



>ref|XP_009385045.1| PREDICTED: uncharacterized protein LOC103972432 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009385046.1| PREDICTED: uncharacterized protein LOC103972432 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009385047.1| PREDICTED: uncharacterized protein LOC103972432 [Musa acuminata 
subsp. malaccensis]
Length=141

 Score =   122 bits (307),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +1

Query  160  GLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGV  339
             +++ + +V+REFDSRA+   RSQD+LS +LDRL  ELDKLLEDAPLPFI+QHAA+IS +
Sbjct  44   AIASTLGAVMREFDSRAEGVDRSQDELSTSLDRLARELDKLLEDAPLPFIMQHAAKISAM  103

Query  340  RKRVTSLNSVLKSIQRRVDNIDRMLLA  420
            R+RV++LN +LKSIQRR+DN+DRML A
Sbjct  104  RRRVSALNLILKSIQRRIDNMDRMLFA  130



>ref|XP_009106625.1| PREDICTED: uncharacterized protein LOC103832384 isoform X1 [Brassica 
rapa]
 emb|CDX87410.1| BnaA07g34630D [Brassica napus]
Length=138

 Score =   122 bits (307),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 78/94 (83%), Gaps = 2/94 (2%)
 Frame = +1

Query  148  PMGIGLSTLISSVIREFDSRA-DATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAA  324
             M  GLS ++ SVI+EFDS++ DA S SQD+LS +LDRL  ELD+LLE+APLPFIVQHA+
Sbjct  36   AMARGLSAMLESVIKEFDSKSLDALS-SQDKLSGSLDRLVQELDQLLENAPLPFIVQHAS  94

Query  325  RISGVRKRVTSLNSVLKSIQRRVDNIDRMLLAEN  426
            RIS V++RV+S+N VLKSIQRR+DNID ML A N
Sbjct  95   RISSVKQRVSSMNLVLKSIQRRIDNIDHMLSANN  128



>ref|XP_009412041.1| PREDICTED: uncharacterized protein LOC103993631 [Musa acuminata 
subsp. malaccensis]
Length=145

 Score =   123 bits (308),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 82/106 (77%), Gaps = 8/106 (8%)
 Frame = +1

Query  97   PSVAGDGNDDESNASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELD  276
            P+   +G D  + A  S +G+        V+REFDSRA+ T+RSQD+LS +LDRLTGELD
Sbjct  30   PAAGHEGWDALARAIASTLGV--------VMREFDSRAEGTARSQDELSLSLDRLTGELD  81

Query  277  KLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRML  414
             LLEDAPLPFI+Q+AA+IS + KRV++LN +LKSIQRR+DN+D+ML
Sbjct  82   ILLEDAPLPFIMQYAAKISSLCKRVSALNLLLKSIQRRIDNMDQML  127



>ref|XP_006389924.1| hypothetical protein EUTSA_v10019307mg [Eutrema salsugineum]
 gb|ESQ27210.1| hypothetical protein EUTSA_v10019307mg [Eutrema salsugineum]
Length=137

 Score =   122 bits (307),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  MGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARI  330
            M  GLS ++ SVI++FDS+A  T  SQDQLS +LDRL  ELD+LLE+APLPFIVQHA+RI
Sbjct  34   MARGLSAMLESVIKDFDSQALDTLNSQDQLSGSLDRLVQELDQLLENAPLPFIVQHASRI  93

Query  331  SGVRKRVTSLNSVLKSIQRRVDNIDRMLLA  420
            S V++RV+SLN VLKSIQRR+DNID+ML A
Sbjct  94   SSVKQRVSSLNLVLKSIQRRIDNIDQMLSA  123



>ref|NP_178028.2| SNARE-associated protein-like protein [Arabidopsis thaliana]
 dbj|BAC42842.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63903.1| unknown protein [Arabidopsis thaliana]
 gb|AEE36200.1| SNARE-associated protein-like protein [Arabidopsis thaliana]
Length=138

 Score =   122 bits (307),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/100 (61%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +1

Query  121  DDESNASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPL  300
            D +       M  GLS ++ SVI++FDS+A  T  SQD+LS +LDRL  ELD+LLE+APL
Sbjct  27   DGQCGGGGEAMARGLSAMLESVIKDFDSKALDTLNSQDELSGSLDRLVQELDQLLENAPL  86

Query  301  PFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRMLLA  420
            PFIVQHA+RIS V++RV+SLN VLKS+QRR+DNID ML A
Sbjct  87   PFIVQHASRISSVKQRVSSLNLVLKSVQRRIDNIDHMLSA  126



>ref|XP_010667978.1| PREDICTED: uncharacterized protein LOC104884967 isoform X2 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010667979.1| PREDICTED: uncharacterized protein LOC104884967 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=144

 Score =   122 bits (305),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 82/115 (71%), Gaps = 2/115 (2%)
 Frame = +1

Query  76   DSTEDGIPSVAGDGNDDESNASTSPMGI--GLSTLISSVIREFDSRADATSRSQDQLSFA  249
            DS       +  + N    N + +P  +  G+ST+++ VI+ FDS+A+A S SQ  L  A
Sbjct  15   DSNSTNSAQLVNNVNHIHDNITGNPKALAEGISTMLADVIKGFDSKAEAASTSQHTLFSA  74

Query  250  LDRLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRML  414
            LDRLT ELD+LLEDAPLPFI+QHA ++S VR+RV SLNS+LKS+Q R+DNIDRM+
Sbjct  75   LDRLTAELDQLLEDAPLPFIMQHATKLSNVRRRVASLNSLLKSVQHRLDNIDRMM  129



>gb|AGU28426.1| SNARE-associated protein-related protein, partial [Sinapis alba]
Length=113

 Score =   120 bits (302),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +1

Query  139  STSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQH  318
            S   MG GLS ++ S+I+EF S+A+ T  SQDQLS +LDRL  ELD+LLE+APLPFIVQH
Sbjct  2    SGEAMGRGLSEMLESIIKEFGSKANDTFNSQDQLSGSLDRLVQELDQLLENAPLPFIVQH  61

Query  319  AARISGVRKRVTSLNSVLKSIQRRVDNIDRMLLAENKMGEDGGQH*GVS  465
            A+RIS V++RV+S+N VLKSIQRR+DNI   L   N + +   +   VS
Sbjct  62   ASRISSVKQRVSSMNLVLKSIQRRIDNIHHTLSTNNTLQDRNTEKAAVS  110



>gb|KFK42286.1| hypothetical protein AALP_AA2G235900 [Arabis alpina]
Length=128

 Score =   121 bits (303),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 81/105 (77%), Gaps = 9/105 (9%)
 Frame = +1

Query  100  SVAGDGNDDESNASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDK  279
            +V GDG           +  GLS+++ SVI++FDS+A  T  SQD+LS +LDRL  ELD+
Sbjct  18   TVEGDGE---------ALARGLSSMLESVIKDFDSKAIDTLNSQDKLSGSLDRLVQELDQ  68

Query  280  LLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRML  414
            LLE+APLPFIVQHA+RIS V++RV+SLN VLKS+QRR+DNID+M+
Sbjct  69   LLENAPLPFIVQHASRISSVKQRVSSLNLVLKSVQRRIDNIDQMI  113



>ref|XP_010926900.1| PREDICTED: uncharacterized protein LOC105049063 [Elaeis guineensis]
 ref|XP_010926901.1| PREDICTED: uncharacterized protein LOC105049063 [Elaeis guineensis]
 ref|XP_010926902.1| PREDICTED: uncharacterized protein LOC105049063 [Elaeis guineensis]
Length=149

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  163  LSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGVR  342
            +S+ +  V+REFD RA+  +RSQD+L  ++DRLTGELDKLLEDAPLPFI+QHA +IS + 
Sbjct  44   ISSTLGDVMREFDGRAEGAARSQDELIRSIDRLTGELDKLLEDAPLPFIMQHAMKISSIH  103

Query  343  KRVTSLNSVLKSIQRRVDNIDRML  414
            KRV++LN +LKSIQRR+DNIDRML
Sbjct  104  KRVSALNLLLKSIQRRIDNIDRML  127



>ref|XP_010531969.1| PREDICTED: uncharacterized protein LOC104808116 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010531970.1| PREDICTED: uncharacterized protein LOC104808116 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010531972.1| PREDICTED: uncharacterized protein LOC104808116 isoform X2 [Tarenaya 
hassleriana]
Length=150

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 90/137 (66%), Gaps = 12/137 (9%)
 Frame = +1

Query  76   DSTEDGIPSVAGDGNDDESNASTS------------PMGIGLSTLISSVIREFDSRADAT  219
            DS +D   S AGD     S+ + +             +  GLS ++ SVIR+FDS+A  T
Sbjct  11   DSADDSFASPAGDAVCHSSSTAAANDGVGIGGIGGGALARGLSAMLDSVIRDFDSKAQDT  70

Query  220  SRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDN  399
             RSQD+LS +L RL  ELD+LLE+APLPFIVQ+A+RIS VR+RV++LN VLK++QRR+DN
Sbjct  71   MRSQDELSDSLSRLIQELDQLLENAPLPFIVQNASRISSVRQRVSALNYVLKNVQRRIDN  130

Query  400  IDRMLLAENKMGEDGGQ  450
            ID+ML       E+G  
Sbjct  131  IDQMLSVCISHVEEGAH  147



>ref|XP_010531968.1| PREDICTED: uncharacterized protein LOC104808116 isoform X1 [Tarenaya 
hassleriana]
Length=170

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 90/137 (66%), Gaps = 12/137 (9%)
 Frame = +1

Query  76   DSTEDGIPSVAGDGNDDESNASTS------------PMGIGLSTLISSVIREFDSRADAT  219
            DS +D   S AGD     S+ + +             +  GLS ++ SVIR+FDS+A  T
Sbjct  31   DSADDSFASPAGDAVCHSSSTAAANDGVGIGGIGGGALARGLSAMLDSVIRDFDSKAQDT  90

Query  220  SRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDN  399
             RSQD+LS +L RL  ELD+LLE+APLPFIVQ+A+RIS VR+RV++LN VLK++QRR+DN
Sbjct  91   MRSQDELSDSLSRLIQELDQLLENAPLPFIVQNASRISSVRQRVSALNYVLKNVQRRIDN  150

Query  400  IDRMLLAENKMGEDGGQ  450
            ID+ML       E+G  
Sbjct  151  IDQMLSVCISHVEEGAH  167



>ref|XP_010472746.1| PREDICTED: uncharacterized protein LOC104752335 [Camelina sativa]
Length=137

 Score =   119 bits (299),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  MGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARI  330
            M  GLS ++ SVI++FDS++  T  SQD+LS +LDRL  ELD+LLE APLPFIVQHA+RI
Sbjct  31   MARGLSAMLESVIKDFDSKSLDTLNSQDKLSASLDRLVQELDQLLESAPLPFIVQHASRI  90

Query  331  SGVRKRVTSLNSVLKSIQRRVDNIDRMLLA  420
            + V++RV+SLN VLKSIQRR+DNID ML A
Sbjct  91   TSVKQRVSSLNLVLKSIQRRIDNIDHMLSA  120



>emb|CDX88503.1| BnaC06g39470D [Brassica napus]
Length=138

 Score =   119 bits (299),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +1

Query  163  LSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGVR  342
            LS ++ SVI+EFDS++  T  SQD+LS +LDRL  ELD+LLE+APLPFIVQHA+RIS V+
Sbjct  41   LSAMLESVIKEFDSKSIDTLSSQDKLSGSLDRLVQELDQLLENAPLPFIVQHASRISSVK  100

Query  343  KRVTSLNSVLKSIQRRVDNIDRMLLAEN  426
            +RV+S+N VLKSIQRR+DNID ML A N
Sbjct  101  QRVSSMNLVLKSIQRRIDNIDHMLSANN  128



>gb|KHG08621.1| SNARE-associated Snapin [Gossypium arboreum]
Length=154

 Score =   118 bits (295),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 84/120 (70%), Gaps = 6/120 (5%)
 Frame = +1

Query  97   PSVAGDGNDDESNASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELD  276
            P+   + N+D    ST  +   LS++++S+I++FDS+A  T  SQD LS ++DRLT ELD
Sbjct  38   PNPESESNND---LSTEALAKALSSMLTSLIKDFDSKALDTLASQDLLSSSIDRLTRELD  94

Query  277  KLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRML---LAENKMGEDGG  447
            +LLEDAP PFI+QHA + S VRKRV SLN +LKSIQRRVDNIDRML   L   K   +G 
Sbjct  95   QLLEDAPSPFIMQHAVKFSNVRKRVLSLNLLLKSIQRRVDNIDRMLSMGLQHEKTATEGS  154



>ref|XP_010095375.1| hypothetical protein L484_010905 [Morus notabilis]
 gb|EXB59794.1| hypothetical protein L484_010905 [Morus notabilis]
Length=131

 Score =   116 bits (291),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +1

Query  160  GLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGV  339
            GLS+++S++++++DS+A+   RSQ  LS +LDRLT ELD+LLEDAP+PFIVQ+A ++S V
Sbjct  21   GLSSMVSTLMKDYDSKAEDALRSQHYLSSSLDRLTRELDQLLEDAPVPFIVQYAGKVSSV  80

Query  340  RKRVTSLNSVLKSIQRRVDNIDRML  414
            RKRV++LNS+LKSI RR+DN+DRML
Sbjct  81   RKRVSTLNSLLKSIHRRLDNMDRML  105



>gb|KJB55464.1| hypothetical protein B456_009G077700 [Gossypium raimondii]
 gb|KJB55465.1| hypothetical protein B456_009G077700 [Gossypium raimondii]
 gb|KJB55467.1| hypothetical protein B456_009G077700 [Gossypium raimondii]
Length=157

 Score =   117 bits (292),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 81/111 (73%), Gaps = 5/111 (5%)
 Frame = +1

Query  127  ESN--ASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPL  300
            ESN   ST  +   LS++++S+I++FDS+A  T  SQD LS ++DRLT ELD+LLEDAP 
Sbjct  46   ESNNDLSTEALAKALSSMLTSLIKDFDSKALDTLASQDILSSSIDRLTRELDQLLEDAPS  105

Query  301  PFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRML---LAENKMGEDG  444
            PFI+QHA + S VRKRV SLN +LKSIQRRVDNIDRML   L   K   +G
Sbjct  106  PFIMQHAVKFSNVRKRVLSLNLLLKSIQRRVDNIDRMLSMGLQHEKTATEG  156



>ref|XP_009371387.1| PREDICTED: uncharacterized protein LOC103960631 [Pyrus x bretschneideri]
Length=150

 Score =   116 bits (291),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  166  STLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGVRK  345
            S+++++VI++FD +A  T  SQD LS +L RLT ELD LL+ AP PFI+QHAA+IS VRK
Sbjct  43   SSMLTTVIKDFDYKAQQTFASQDHLSQSLHRLTRELDTLLDAAPFPFIMQHAAKISAVRK  102

Query  346  RVTSLNSVLKSIQRRVDNIDRMLL  417
            RV+SLNSVLKS+QRR+DNIDRML 
Sbjct  103  RVSSLNSVLKSVQRRLDNIDRMLF  126



>ref|XP_010417524.1| PREDICTED: uncharacterized protein LOC104703252 [Camelina sativa]
Length=137

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +1

Query  163  LSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGVR  342
            LS ++ SVI++FDS+A  T  SQD+LS +LDRL  ELD+LLE+APLPFIVQHA+RI+ V+
Sbjct  36   LSAMLESVIKDFDSKALDTLNSQDKLSASLDRLIQELDQLLENAPLPFIVQHASRITSVK  95

Query  343  KRVTSLNSVLKSIQRRVDNIDRMLLA  420
            +RV+SLN VLKSIQRR+D+ID ML A
Sbjct  96   QRVSSLNLVLKSIQRRIDHIDHMLSA  121



>gb|KJB55466.1| hypothetical protein B456_009G077700 [Gossypium raimondii]
Length=168

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +1

Query  127  ESN--ASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPL  300
            ESN   ST  +   LS++++S+I++FDS+A  T  SQD LS ++DRLT ELD+LLEDAP 
Sbjct  46   ESNNDLSTEALAKALSSMLTSLIKDFDSKALDTLASQDILSSSIDRLTRELDQLLEDAPS  105

Query  301  PFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRML  414
            PFI+QHA + S VRKRV SLN +LKSIQRRVDNIDRML
Sbjct  106  PFIMQHAVKFSNVRKRVLSLNLLLKSIQRRVDNIDRML  143



>ref|XP_011031813.1| PREDICTED: LOW QUALITY PROTEIN: HBS1-like protein [Populus euphratica]
Length=1057

 Score =   124 bits (310),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 68/118 (58%), Positives = 87/118 (74%), Gaps = 12/118 (10%)
 Frame = +1

Query  97   PSVAGDGNDD--ESNAST----------SPMGIGLSTLISSVIREFDSRADATSRSQDQL  240
            PSV+  GN D  E+N               +G  LST+++SVI++ DS A  T  SQ++L
Sbjct  3    PSVSTGGNPDSNENNPQESESESNNSRSDALGKALSTMLASVIKDIDSEAQDTLNSQEKL  62

Query  241  SFALDRLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRML  414
            + A+DRLT ELD+LLEDA +PFI+QHAA+ISGVRKRV+SLNSVLKSIQ+RVDNIDR+L
Sbjct  63   NSAIDRLTRELDQLLEDALMPFIMQHAAKISGVRKRVSSLNSVLKSIQKRVDNIDRLL  120



>ref|XP_003571349.1| PREDICTED: uncharacterized protein LOC100833799 [Brachypodium 
distachyon]
Length=148

 Score =   115 bits (287),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/129 (47%), Positives = 85/129 (66%), Gaps = 11/129 (9%)
 Frame = +1

Query  52   DVPENRLPDSTE----DGIPSVAGDGNDDESNAS----TSPMGIGLSTLISSVIREFDSR  207
            D+P    P +T     DG P  AG+   D + A+       +   ++ ++   + E ++R
Sbjct  5    DLPAASCPTATTGVAGDGPPETAGE---DPATATHPERCEALAAAIAGVLGGALEEHEAR  61

Query  208  ADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQR  387
            A AT+RSQ +L+ A+DRL GELDKLLE+AP P I QHAARIS +RKRV +LN +L++IQR
Sbjct  62   AAATARSQGELAAAIDRLNGELDKLLENAPSPVIAQHAARISSIRKRVLALNMLLRAIQR  121

Query  388  RVDNIDRML  414
            R+DNIDRM+
Sbjct  122  RIDNIDRMV  130



>dbj|BAJ91394.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=157

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 85/130 (65%), Gaps = 9/130 (7%)
 Frame = +1

Query  52   DVPENRLPDSTEDG----IPSVAGDGNDDESNASTSP-----MGIGLSTLISSVIREFDS  204
            D+P    P +T  G     P   GDG   +++    P     +   ++ ++   + E ++
Sbjct  10   DLPTTSGPSATIAGGDERPPETTGDGGLGDADTRPHPDRCETLAAAIAGVLGGALEEHEA  69

Query  205  RADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQ  384
            RA+AT++SQ +L+ A+DRL GELDKLLE+AP P I QHAARIS +RKRV +LN +LKSIQ
Sbjct  70   RAEATAQSQAELATAIDRLNGELDKLLENAPSPVIAQHAARISSIRKRVLALNMLLKSIQ  129

Query  385  RRVDNIDRML  414
            RR+DNIDRM+
Sbjct  130  RRIDNIDRMI  139



>ref|XP_010429779.1| PREDICTED: uncharacterized protein LOC104714192 [Camelina sativa]
Length=131

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +1

Query  151  MGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARI  330
            M  GLS ++ SVI++FDS +     SQD+LS +LDRL  ELD+LLE+APLP IVQ A+RI
Sbjct  23   MARGLSAMLESVIKDFDSISLDALNSQDKLSASLDRLVQELDQLLENAPLPLIVQQASRI  82

Query  331  SGVRKRVTSLNSVLKSIQRRVDNIDRMLLA  420
            + V++RV+SLN VLKSIQRR+DNID ML A
Sbjct  83   TSVKQRVSSLNLVLKSIQRRIDNIDHMLSA  112



>ref|XP_004972945.1| PREDICTED: uncharacterized protein LOC101757607 [Setaria italica]
Length=145

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 85/124 (69%), Gaps = 9/124 (7%)
 Frame = +1

Query  70   LPDSTE---DGIPSVAGDGNDDESNASTSP------MGIGLSTLISSVIREFDSRADATS  222
            LP S+    D  P  AG G+  E   +  P      +   ++ ++   +RE ++RA AT+
Sbjct  6    LPSSSAAAGDRRPESAGHGSGAEDERAAYPPERCEALAAAIAGVLGGALREHEARAAATA  65

Query  223  RSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNI  402
            RSQD+++ A+DRL GELD+LLE+AP   I+QH+ARIS +RKR+++LN +LKSIQRR+DNI
Sbjct  66   RSQDEVAAAIDRLNGELDRLLENAPSLVIMQHSARISTIRKRISALNMLLKSIQRRIDNI  125

Query  403  DRML  414
            DR++
Sbjct  126  DRVI  129



>ref|XP_006659090.1| PREDICTED: uncharacterized protein LOC102703418 [Oryza brachyantha]
Length=138

 Score =   108 bits (270),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 80/114 (70%), Gaps = 8/114 (7%)
 Frame = +1

Query  97   PSVAGD-GNDDESNASTSP-------MGIGLSTLISSVIREFDSRADATSRSQDQLSFAL  252
            P+ A D   DDE   + +P       +   ++ ++   ++E ++ A AT+RSQD+L+ A+
Sbjct  7    PAAASDSAGDDEPATAPAPQPERCEALAAAIAGVLGGALQEHEASAAATARSQDELAAAV  66

Query  253  DRLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRML  414
            DRL GELDKLLE+AP P I+Q AARIS +RKRV +LN +L+SIQRR+DNIDR++
Sbjct  67   DRLNGELDKLLENAPSPVIMQQAARISSIRKRVLALNMLLRSIQRRIDNIDRIV  120



>ref|NP_001144499.1| uncharacterized protein LOC100277481 [Zea mays]
 gb|ACG40911.1| hypothetical protein [Zea mays]
Length=148

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 85/122 (70%), Gaps = 12/122 (10%)
 Frame = +1

Query  64   NRLPDSTEDGIPSVAGDGNDDESNASTSP-----MGIGLSTLISSVIREFDSRADATSRS  228
            +R P++ +DG       G  DE  A+  P     +   ++ +++  +RE + RA AT+RS
Sbjct  15   DRPPENADDG-------GVGDEHAAAPPPERCEALASAIAGVLAGALREHEERAAATARS  67

Query  229  QDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDR  408
            QD+++ A+DRL GELD+LLE+AP   I+ H+ARIS +RKR++++N +LKSIQRR+D++DR
Sbjct  68   QDEVAAAIDRLNGELDRLLENAPTMVIMHHSARISSIRKRISAMNMLLKSIQRRIDSMDR  127

Query  409  ML  414
            ++
Sbjct  128  II  129



>gb|AFW61295.1| hypothetical protein ZEAMMB73_299655 [Zea mays]
Length=211

 Score =   106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 86/122 (70%), Gaps = 12/122 (10%)
 Frame = +1

Query  64   NRLPDSTEDGIPSVAGDGNDDESNASTSPMGIG-----LSTLISSVIREFDSRADATSRS  228
            +R P++ +DG       G +DE  A+  P   G     ++ +++  +RE + RA AT+RS
Sbjct  78   DRPPENADDG-------GVEDERAAAPPPERCGALASAIAGVLAGALREHEERAAATARS  130

Query  229  QDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDR  408
            QD+++ A+DRL GELD+LLE+AP   I+ H+ARIS +RKR++++N +LKSIQRR+D++DR
Sbjct  131  QDEVAAAIDRLNGELDRLLENAPTMVIMHHSARISSIRKRISAMNMLLKSIQRRIDSMDR  190

Query  409  ML  414
            ++
Sbjct  191  II  192



>gb|EPS73251.1| hypothetical protein M569_01509, partial [Genlisea aurea]
Length=117

 Score =   103 bits (257),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 81/108 (75%), Gaps = 5/108 (5%)
 Frame = +1

Query  106  AGDGND--DESNAST---SPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGE  270
            AGD  D  DE+N S    S +   LS+LISS++ + DSRA AT+ SQDQL+ ALDRLT E
Sbjct  5    AGDRTDTVDETNTSCAVQSAVARSLSSLISSLLTDLDSRAGATACSQDQLTSALDRLTAE  64

Query  271  LDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRML  414
            LD LL+DAP PF++Q A RI  VR RV +LN+VLKSIQRR+DN+D+ML
Sbjct  65   LDVLLDDAPSPFMMQQATRICTVRSRVKALNTVLKSIQRRIDNMDQML  112



>ref|XP_008677020.1| PREDICTED: uncharacterized protein LOC100277481 isoform X2 [Zea 
mays]
Length=262

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 86/122 (70%), Gaps = 12/122 (10%)
 Frame = +1

Query  64   NRLPDSTEDGIPSVAGDGNDDESNASTSPMGIG-----LSTLISSVIREFDSRADATSRS  228
            +R P++ +DG       G +DE  A+  P   G     ++ +++  +RE + RA AT+RS
Sbjct  104  DRPPENADDG-------GVEDERAAAPPPERCGALASAIAGVLAGALREHEERAAATARS  156

Query  229  QDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDR  408
            QD+++ A+DRL GELD+LLE+AP   I+ H+ARIS +RKR++++N +LKSIQRR+D++DR
Sbjct  157  QDEVAAAIDRLNGELDRLLENAPTMVIMHHSARISSIRKRISAMNMLLKSIQRRIDSMDR  216

Query  409  ML  414
            ++
Sbjct  217  II  218



>ref|XP_008677018.1| PREDICTED: uncharacterized protein LOC100277481 isoform X1 [Zea 
mays]
 ref|XP_008677019.1| PREDICTED: uncharacterized protein LOC100277481 isoform X1 [Zea 
mays]
Length=266

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 86/122 (70%), Gaps = 12/122 (10%)
 Frame = +1

Query  64   NRLPDSTEDGIPSVAGDGNDDESNASTSPMGIG-----LSTLISSVIREFDSRADATSRS  228
            +R P++ +DG       G +DE  A+  P   G     ++ +++  +RE + RA AT+RS
Sbjct  104  DRPPENADDG-------GVEDERAAAPPPERCGALASAIAGVLAGALREHEERAAATARS  156

Query  229  QDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDR  408
            QD+++ A+DRL GELD+LLE+AP   I+ H+ARIS +RKR++++N +LKSIQRR+D++DR
Sbjct  157  QDEVAAAIDRLNGELDRLLENAPTMVIMHHSARISSIRKRISAMNMLLKSIQRRIDSMDR  216

Query  409  ML  414
            ++
Sbjct  217  II  218



>ref|XP_001770339.1| predicted protein [Physcomitrella patens]
 gb|EDQ64829.1| predicted protein, partial [Physcomitrella patens]
Length=95

 Score = 99.8 bits (247),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +1

Query  160  GLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGV  339
            GL+ ++  V+REFD+R +   +SQ  L+ ++DRLT ELDKLLED P+P + QHAA++S V
Sbjct  9    GLAAVLGPVVREFDARVEGALKSQSLLTGSIDRLTKELDKLLEDTPIPTVAQHAAKLSDV  68

Query  340  RKRVTSLNSVLKSIQRRVDNIDRML  414
            RKRV SL S L+ IQ R+ N+DRML
Sbjct  69   RKRVASLMSTLRVIQGRITNMDRML  93



>ref|NP_001175367.1| Os08g0129900 [Oryza sativa Japonica Group]
 dbj|BAC66718.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ05481.1| hypothetical protein OsI_27696 [Oryza sativa Indica Group]
 dbj|BAH94095.1| Os08g0129900 [Oryza sativa Japonica Group]
Length=138

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = +1

Query  163  LSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARISGVR  342
            ++ ++   ++E ++ A AT+RSQ +L+ A+DRL GELDKLLE+AP P I+Q A RI  +R
Sbjct  43   IAGVLGGALQEHEACAAATARSQGELAAAVDRLNGELDKLLENAPSPVIMQQATRICSIR  102

Query  343  KRVTSLNSVLKSIQRRVDNIDRML  414
            KRV +LN +L+SIQRR+DNIDR++
Sbjct  103  KRVLALNMLLRSIQRRIDNIDRIV  126



>gb|KGN54921.1| hypothetical protein Csa_4G598520 [Cucumis sativus]
Length=118

 Score = 89.7 bits (221),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 62/78 (79%), Gaps = 2/78 (3%)
 Frame = +1

Query  112  DGNDDESN--ASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLL  285
            +GND E+    +++ +  GLS+++ ++IR+FDS+AD T +SQ+ LS +LDRLT ELD+LL
Sbjct  35   EGNDSENKNLGNSNALANGLSSMLINIIRDFDSKADDTLKSQNHLSSSLDRLTTELDQLL  94

Query  286  EDAPLPFIVQHAARISGV  339
            EDAP PFI+QHA+RIS V
Sbjct  95   EDAPFPFIMQHASRISNV  112



>ref|XP_002961298.1| hypothetical protein SELMODRAFT_403072 [Selaginella moellendorffii]
 gb|EFJ38837.1| hypothetical protein SELMODRAFT_403072 [Selaginella moellendorffii]
Length=184

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 77/122 (63%), Gaps = 12/122 (10%)
 Frame = +1

Query  100  SVAGDGNDDESNAS---------TSP---MGIGLSTLISSVIREFDSRADATSRSQDQLS  243
            S +G   DD S+A          TSP   +G G + ++  VI + DS+ +A   SQD L+
Sbjct  61   SESGGAGDDGSSAGIFARGESSGTSPVDVIGTGRAAVLKGVIHDADSKFEAALASQDSLA  120

Query  244  FALDRLTGELDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRMLLAE  423
             ++DRLT  LDKLLED P+PF+ Q +AR+ G+RKRV SL+S L+ I+ R+ NI+  LL +
Sbjct  121  LSIDRLTRVLDKLLEDTPMPFLAQDSARVHGLRKRVLSLSSTLQIIRVRMKNIESALLHQ  180

Query  424  NK  429
            +K
Sbjct  181  SK  182



>ref|XP_008779254.1| PREDICTED: uncharacterized protein LOC103698988, partial [Phoenix 
dactylifera]
Length=69

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +1

Query  271  LDKLLEDAPLPFIVQHAARISGVRKRVTSLNSVLKSIQRRVDNIDRML  414
            LDKL+EDAP+PFI+QHA +IS +RKRV+SLN +LKSIQRR+DNIDRML
Sbjct  1    LDKLVEDAPMPFIMQHAVKISSIRKRVSSLNLLLKSIQRRIDNIDRML  48



>ref|XP_010324214.1| PREDICTED: uncharacterized protein LOC101260451 isoform X2 [Solanum 
lycopersicum]
Length=129

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 51/79 (65%), Gaps = 2/79 (3%)
 Frame = +1

Query  43   MSDDVPENRLPDSTEDGIPSVAGDGNDDESNASTSPMGIGLSTLISSVIREFDSRADATS  222
            MS++ P     D+ E    S   +G D  ++ S++ +  GLST+ISS+IREFD  A ATS
Sbjct  1    MSNEAPAKPPCDTPEHD--SAGVNGFDINNDTSSTALAKGLSTIISSLIREFDDSAAATS  58

Query  223  RSQDQLSFALDRLTGELDK  279
            RSQDQLS  LDRLTG L K
Sbjct  59   RSQDQLSSTLDRLTGGLPK  77



>ref|XP_007149268.1| hypothetical protein PHAVU_005G055900g, partial [Phaseolus vulgaris]
 gb|ESW21262.1| hypothetical protein PHAVU_005G055900g, partial [Phaseolus vulgaris]
Length=216

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  265  GELDKLLEDAPLPFIVQHAARISGVRKRV  351
             ELD+LLEDAPLPFI+QHAA+IS VRKRV
Sbjct  13   AELDQLLEDAPLPFIMQHAAKISSVRKRV  41



>ref|XP_007149269.1| hypothetical protein PHAVU_005G056000g, partial [Phaseolus vulgaris]
 gb|ESW21263.1| hypothetical protein PHAVU_005G056000g, partial [Phaseolus vulgaris]
Length=104

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +1

Query  115  GNDDESNASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTG  267
            G DD    S+  +  GLS+++S+VI +FD RA  T RSQD LS  LDRLTG
Sbjct  42   GADDSLRQSSDVLARGLSSMLSAVITDFDCRAHQTLRSQDHLSSVLDRLTG  92



>dbj|GAM24750.1| hypothetical protein SAMD00019534_079250 [Acytostelium subglobosum 
LB1]
Length=240

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = +1

Query  151  MGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRLTGELDKLLEDAPLPFIVQHAARI  330
            +G GL  LIS V++E D++     +SQ  LS  +D L+ +LD+      +P +  H  ++
Sbjct  25   LGNGLYLLISPVVKECDAKIQEVYQSQKNLSEQIDSLSNQLDQFNSLTQIPTLHPHIQKL  84

Query  331  SGVRKRVTSLNSVLKSIQRRVDNIDRMLLAENK  429
               R R+ ++NS L  I  R+D +   +L + +
Sbjct  85   LNARGRLLAINSKLTVIMGRMDKLSATVLQQQQ  117



>emb|CDX79289.1| BnaC06g20140D [Brassica napus]
Length=161

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +1

Query  136  ASTSPMGIGLSTLISSVIREFDSRADATSRSQDQLSFALDRL  261
             S   MG GLST++ S+I+EFDS+A+    SQDQLS +LDRL
Sbjct  37   GSGEAMGRGLSTMLESIIKEFDSKANDAFNSQDQLSGSLDRL  78



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1183832463410