BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13691

Length=914
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009603675.1|  PREDICTED: probable polygalacturonase              372   6e-123   
ref|XP_009767931.1|  PREDICTED: probable polygalacturonase              367   3e-121   Nicotiana sylvestris
emb|CDP12145.1|  unnamed protein product                                365   1e-120   Coffea canephora [robusta coffee]
ref|XP_011101030.1|  PREDICTED: probable polygalacturonase              365   3e-120   Sesamum indicum [beniseed]
ref|XP_004245522.1|  PREDICTED: probable polygalacturonase isofor...    364   9e-120   Solanum lycopersicum
ref|XP_006343870.1|  PREDICTED: probable polygalacturonase-like         362   4e-119   Solanum tuberosum [potatoes]
ref|XP_010325363.1|  PREDICTED: probable polygalacturonase isofor...    362   1e-118   Solanum lycopersicum
ref|XP_011073737.1|  PREDICTED: probable polygalacturonase              359   4e-118   Sesamum indicum [beniseed]
gb|AIU50439.1|  pectin lyase-like superfamily protein                   356   2e-117   Solanum lycopersicum
gb|AIU50429.1|  pectin lyase-like superfamily protein                   354   1e-116   Solanum tuberosum [potatoes]
gb|AIU50443.1|  pectin lyase-like superfamily protein                   348   2e-114   Lactuca sativa [cultivated lettuce]
ref|XP_010659126.1|  PREDICTED: probable polygalacturonase              346   5e-113   Vitis vinifera
gb|KDO76503.1|  hypothetical protein CISIN_1g0134022mg                  339   1e-112   Citrus sinensis [apfelsine]
gb|KDO76502.1|  hypothetical protein CISIN_1g0134022mg                  339   6e-112   Citrus sinensis [apfelsine]
ref|XP_006586032.1|  PREDICTED: probable polygalacturonase-like         342   1e-111   Glycine max [soybeans]
gb|KHM99685.1|  Putative polygalacturonase                              341   2e-111   Glycine soja [wild soybean]
gb|KHN12010.1|  Putative polygalacturonase                              342   3e-111   Glycine soja [wild soybean]
ref|XP_003545367.1|  PREDICTED: probable polygalacturonase              342   3e-111   Glycine max [soybeans]
gb|KDO76501.1|  hypothetical protein CISIN_1g0134022mg                  338   3e-111   Citrus sinensis [apfelsine]
gb|AIU50434.1|  pectin lyase-like superfamily protein                   335   3e-111   Artemisia annua [sweet Annie]
gb|AIU50442.1|  pectin lyase-like superfamily protein                   340   4e-111   Vitis vinifera
ref|XP_002509949.1|  Polygalacturonase precursor, putative              341   7e-111   Ricinus communis
ref|XP_003551949.1|  PREDICTED: probable polygalacturonase-like         340   8e-111   Glycine max [soybeans]
gb|KHN28527.1|  Putative polygalacturonase                              340   1e-110   Glycine soja [wild soybean]
ref|XP_006476397.1|  PREDICTED: probable polygalacturonase-like         340   1e-110   
ref|XP_006439367.1|  hypothetical protein CICLE_v10020162mg             340   1e-110   Citrus clementina [clementine]
ref|XP_004499965.1|  PREDICTED: probable polygalacturonase-like         338   8e-110   Cicer arietinum [garbanzo]
ref|XP_010266478.1|  PREDICTED: probable polygalacturonase              338   8e-110   Nelumbo nucifera [Indian lotus]
ref|XP_012086739.1|  PREDICTED: probable polygalacturonase              338   8e-110   Jatropha curcas
ref|XP_002304552.2|  glycoside hydrolase family 28 family protein       337   2e-109   Populus trichocarpa [western balsam poplar]
ref|XP_007209143.1|  hypothetical protein PRUPE_ppa005818mg             337   2e-109   Prunus persica
ref|XP_008239046.1|  PREDICTED: probable polygalacturonase              336   4e-109   Prunus mume [ume]
gb|KJB39696.1|  hypothetical protein B456_007G026000                    330   4e-109   Gossypium raimondii
gb|AIU50397.1|  pectin lyase-like superfamily protein                   335   5e-109   Aquilegia coerulea [Rocky Mountain columbine]
ref|XP_011022514.1|  PREDICTED: probable polygalacturonase              336   5e-109   Populus euphratica
gb|EPS61079.1|  hypothetical protein M569_13719                         335   7e-109   Genlisea aurea
gb|KEH33635.1|  polygalacturonase/glycoside hydrolase family protein    335   1e-108   Medicago truncatula
gb|EYU40022.1|  hypothetical protein MIMGU_mgv1a006305mg                333   4e-108   Erythranthe guttata [common monkey flower]
gb|AIU50408.1|  pectin lyase-like superfamily protein                   332   4e-108   Citrus clementina [clementine]
gb|AIU50426.1|  pectin lyase-like superfamily protein                   332   5e-108   Manihot esculenta [manioc]
ref|XP_007141479.1|  hypothetical protein PHAVU_008G199400g             333   5e-108   Phaseolus vulgaris [French bean]
ref|XP_004298894.1|  PREDICTED: probable polygalacturonase              332   1e-107   Fragaria vesca subsp. vesca
ref|XP_004491304.1|  PREDICTED: probable polygalacturonase-like         332   2e-107   Cicer arietinum [garbanzo]
gb|KJB39695.1|  hypothetical protein B456_007G026000                    328   2e-107   Gossypium raimondii
ref|XP_010261531.1|  PREDICTED: probable polygalacturonase              332   2e-107   Nelumbo nucifera [Indian lotus]
gb|AIU50435.1|  pectin lyase-like superfamily protein                   330   3e-107   Ricinus communis
gb|AIU50414.1|  pectin lyase-like superfamily protein                   329   5e-107   Glycine max [soybeans]
gb|AIU50431.1|  pectin lyase-like superfamily protein                   329   9e-107   Prunus persica
gb|KHG27846.1|  putative polygalacturonase                              329   9e-107   Gossypium arboreum [tree cotton]
gb|KJB39697.1|  hypothetical protein B456_007G026000                    330   1e-106   Gossypium raimondii
gb|AIU50430.1|  pectin lyase-like superfamily protein                   328   3e-106   Populus trichocarpa [western balsam poplar]
gb|AIU50410.1|  pectin lyase-like superfamily protein                   327   5e-106   Carica papaya [mamon]
ref|XP_007146299.1|  hypothetical protein PHAVU_006G028800g             328   6e-106   Phaseolus vulgaris [French bean]
ref|XP_010676306.1|  PREDICTED: probable polygalacturonase              328   7e-106   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003617307.1|  Glycoside hydrolase family 28 protein              325   7e-105   Medicago truncatula
gb|AIU50427.1|  pectin lyase-like superfamily protein                   323   9e-105   Erythranthe guttata [common monkey flower]
gb|AIU50446.1|  pectin lyase-like superfamily protein                   323   1e-104   Platanus x hispanica [London plane tree]
ref|XP_010925748.1|  PREDICTED: probable polygalacturonase              323   3e-104   
ref|XP_004143871.1|  PREDICTED: probable polygalacturonase              324   3e-104   Cucumis sativus [cucumbers]
ref|XP_008437386.1|  PREDICTED: probable polygalacturonase              323   3e-104   Cucumis melo [Oriental melon]
gb|AIU50433.1|  pectin lyase-like superfamily protein                   321   1e-103   Phaseolus vulgaris [French bean]
gb|AIU50409.1|  pectin lyase-like superfamily protein                   320   2e-103   Gossypium raimondii
gb|AIU50404.1|  pectin lyase-like superfamily protein                   320   2e-103   Pinellia ternata
gb|KJB24230.1|  hypothetical protein B456_004G134000                    321   3e-103   Gossypium raimondii
ref|XP_007040496.1|  Pectin lyase-like superfamily protein              319   2e-102   Theobroma cacao [chocolate]
gb|AIU50416.1|  pectin lyase-like superfamily protein                   317   3e-102   Buxus sinica
gb|AIU50407.1|  pectin lyase-like superfamily protein                   317   3e-102   Sarcandra glabra
gb|AIU50424.1|  pectin lyase-like superfamily protein                   317   6e-102   Medicago truncatula
gb|KHG21610.1|  putative polygalacturonase                              318   6e-102   Gossypium arboreum [tree cotton]
gb|AIU50418.1|  pectin lyase-like superfamily protein                   313   1e-100   Chloranthus japonicus
gb|AIU50422.1|  pectin lyase-like superfamily protein                   312   2e-100   Asparagus officinalis
gb|AIU50423.1|  pectin lyase-like superfamily protein                   312   2e-100   Aristolochia tagala
gb|AIU50405.1|  pectin lyase-like superfamily protein                   312   3e-100   Theobroma cacao [chocolate]
ref|XP_010541559.1|  PREDICTED: probable polygalacturonase isofor...    312   1e-99    Tarenaya hassleriana [spider flower]
gb|AIU50448.1|  pectin lyase-like superfamily protein                   310   3e-99    Houttuynia cordata [chameleon-plant]
ref|XP_008790157.1|  PREDICTED: probable polygalacturonase              311   3e-99    Phoenix dactylifera
ref|NP_199002.1|  pectin lyase-like superfamily protein                 311   4e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009404468.1|  PREDICTED: probable polygalacturonase              310   4e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010913844.1|  PREDICTED: probable polygalacturonase isofor...    307   5e-99    
ref|XP_010053124.1|  PREDICTED: probable polygalacturonase              310   5e-99    
ref|XP_006283728.1|  hypothetical protein CARUB_v10004799mg             310   6e-99    Capsella rubella
gb|AIU50400.1|  pectin lyase-like superfamily protein                   308   9e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009413832.1|  PREDICTED: probable polygalacturonase              309   1e-98    Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB39694.1|  hypothetical protein B456_007G026000                    309   1e-98    Gossypium raimondii
gb|AIU50399.1|  pectin lyase-like superfamily protein                   307   2e-98    Arabidopsis lyrata [lyrate rockcress]
gb|AIU50420.1|  pectin lyase-like superfamily protein                   307   3e-98    Chimonanthus praecox [wintersweet]
ref|XP_002868572.1|  glycoside hydrolase family 28 protein              308   4e-98    Arabidopsis lyrata subsp. lyrata
ref|XP_010055855.1|  PREDICTED: probable polygalacturonase              308   4e-98    Eucalyptus grandis [rose gum]
ref|XP_010448653.1|  PREDICTED: probable polygalacturonase              307   7e-98    Camelina sativa [gold-of-pleasure]
ref|NP_194113.1|  glycoside hydrolase family 28 protein / polygal...    307   8e-98    Arabidopsis thaliana [mouse-ear cress]
gb|AIU50437.1|  pectin lyase-like superfamily protein                   306   9e-98    Yucca filamentosa [Adam's-needle]
ref|XP_010924850.1|  PREDICTED: probable polygalacturonase              307   1e-97    Elaeis guineensis
ref|XP_010913831.1|  PREDICTED: probable polygalacturonase isofor...    307   1e-97    Elaeis guineensis
ref|XP_010439131.1|  PREDICTED: probable polygalacturonase              306   1e-97    Camelina sativa [gold-of-pleasure]
dbj|BAD61522.1|  polygalacturonase-like                                 300   1e-97    Oryza sativa Japonica Group [Japonica rice]
gb|KFK32989.1|  hypothetical protein AALP_AA6G314900                    306   2e-97    Arabis alpina [alpine rockcress]
gb|AIU50421.1|  pectin lyase-like superfamily protein                   305   2e-97    Pandanus utilis
ref|XP_002867688.1|  glycoside hydrolase family 28 protein              306   2e-97    
ref|XP_010433858.1|  PREDICTED: probable polygalacturonase              306   2e-97    Camelina sativa [gold-of-pleasure]
ref|XP_008810829.1|  PREDICTED: probable polygalacturonase              306   3e-97    Phoenix dactylifera
gb|AIU50441.1|  pectin lyase-like superfamily protein                   305   3e-97    Schrenkiella parvula
emb|CDY47619.1|  BnaA01g13460D                                          305   4e-97    Brassica napus [oilseed rape]
ref|XP_009380525.1|  PREDICTED: probable polygalacturonase              305   4e-97    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY03516.1|  BnaC01g15660D                                          305   4e-97    
gb|AIU50411.1|  pectin lyase-like superfamily protein                   304   5e-97    Capsella rubella
ref|XP_006283738.1|  hypothetical protein CARUB_v10004811mg             305   5e-97    Capsella rubella
ref|XP_009137402.1|  PREDICTED: probable polygalacturonase              305   5e-97    Brassica rapa
gb|AIU50402.1|  pectin lyase-like superfamily protein                   303   6e-97    Magnolia denudata [haku-mokuren]
ref|XP_006413510.1|  hypothetical protein EUTSA_v10025189mg             305   6e-97    Eutrema salsugineum [saltwater cress]
gb|ACC91250.1|  glycoside hydrolase family 28 protein                   305   9e-97    Arabidopsis halleri
emb|CDM83426.1|  unnamed protein product                                305   9e-97    Triticum aestivum [Canadian hard winter wheat]
gb|AIU50413.1|  pectin lyase-like superfamily protein                   302   2e-96    Eucalyptus grandis [rose gum]
ref|NP_001043594.2|  Os01g0618900                                       298   4e-96    
gb|AIU50445.1|  pectin lyase-like superfamily protein                   301   4e-96    Cinnamomum camphora
emb|CDX67513.1|  BnaA07g15530D                                          303   5e-96    
gb|AIU50425.1|  pectin lyase-like superfamily protein                   301   5e-96    Canna indica [canna]
dbj|BAJ89948.1|  predicted protein                                      303   6e-96    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94644.1|  predicted protein                                      302   6e-96    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009125202.1|  PREDICTED: probable polygalacturonase              302   6e-96    Brassica rapa
gb|AIU50403.1|  pectin lyase-like superfamily protein                   300   8e-96    Musa acuminata [banana]
ref|XP_006405300.1|  hypothetical protein EUTSA_v10027765mg             302   1e-95    Eutrema salsugineum [saltwater cress]
ref|XP_009137393.1|  PREDICTED: probable polygalacturonase              302   1e-95    Brassica rapa
ref|XP_010441363.1|  PREDICTED: probable polygalacturonase              301   1e-95    Camelina sativa [gold-of-pleasure]
emb|CDY10970.1|  BnaA03g46290D                                          301   1e-95    Brassica napus [oilseed rape]
emb|CDX94222.1|  BnaC07g38560D                                          301   1e-95    
gb|AAO62947.1|  putative polygalacturonase-like protein                 292   2e-95    Lactuca sativa [cultivated lettuce]
gb|AIU50450.1|  pectin lyase-like superfamily protein                   300   2e-95    Alisma plantago-aquatica
emb|CDY13383.1|  BnaC06g13740D                                          301   2e-95    Brassica napus [oilseed rape]
ref|XP_006654851.1|  PREDICTED: probable polygalacturonase-like         296   2e-95    
gb|AIU50401.1|  pectin lyase-like superfamily protein                   300   2e-95    Lilium brownii [Hong Kong lily]
ref|XP_004961056.1|  PREDICTED: probable polygalacturonase-like         301   2e-95    Setaria italica
ref|XP_010541551.1|  PREDICTED: probable polygalacturonase isofor...    301   2e-95    Tarenaya hassleriana [spider flower]
gb|KFK28938.1|  hypothetical protein AALP_AA7G068200                    300   3e-95    Arabis alpina [alpine rockcress]
ref|XP_010448059.1|  PREDICTED: probable polygalacturonase              300   4e-95    Camelina sativa [gold-of-pleasure]
gb|AIN44009.1|  polygalacturonase-like protein                          300   5e-95    Brassica juncea var. tumida [zha cai]
ref|XP_002441600.1|  hypothetical protein SORBIDRAFT_09g030140          298   2e-94    Sorghum bicolor [broomcorn]
gb|EAY85246.1|  hypothetical protein OsI_06620                          298   2e-94    Oryza sativa Indica Group [Indian rice]
gb|EAY74990.1|  hypothetical protein OsI_02888                          298   2e-94    Oryza sativa Indica Group [Indian rice]
ref|NP_001046468.1|  Os02g0256100                                       297   5e-94    
gb|EAY99223.1|  hypothetical protein OsI_21181                          296   3e-93    Oryza sativa Indica Group [Indian rice]
gb|AAT44156.1|  putative polygalacturonase                              296   3e-93    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006646109.1|  PREDICTED: probable polygalacturonase-like         295   3e-93    
ref|NP_001056466.1|  Os05g0587000                                       295   3e-93    
gb|AIU50415.1|  pectin lyase-like superfamily protein                   293   7e-93    Illicium henryi
ref|XP_003569374.1|  PREDICTED: probable polygalacturonase              293   3e-92    Brachypodium distachyon [annual false brome]
ref|NP_001141464.1|  uncharacterized protein LOC100273574 precursor     293   3e-92    Zea mays [maize]
ref|XP_009395761.1|  PREDICTED: probable polygalacturonase              293   4e-92    Musa acuminata subsp. malaccensis [pisang utan]
gb|AIU50432.1|  pectin lyase-like superfamily protein                   291   7e-92    Panicum virgatum
gb|ACN36471.1|  unknown                                                 288   9e-92    Zea mays [maize]
gb|AIU50440.1|  pectin lyase-like superfamily protein                   290   2e-91    Sorghum bicolor [broomcorn]
gb|AIU50436.1|  pectin lyase-like superfamily protein                   290   2e-91    Dioscorea oppositifolia
ref|XP_009396562.1|  PREDICTED: probable polygalacturonase              290   3e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002455965.1|  hypothetical protein SORBIDRAFT_03g028140          290   6e-91    Sorghum bicolor [broomcorn]
ref|NP_001170283.1|  uncharacterized protein LOC100384246 precursor     290   6e-91    Zea mays [maize]
ref|XP_004969187.1|  PREDICTED: probable polygalacturonase-like         288   2e-90    Setaria italica
ref|XP_004951285.1|  PREDICTED: probable polygalacturonase-like         288   3e-90    Setaria italica
ref|NP_001149385.1|  LOC100283011 precursor                             287   4e-90    
gb|AIU50438.1|  pectin lyase-like superfamily protein                   286   4e-90    Setaria italica
gb|AIU50449.1|  pectin lyase-like superfamily protein                   285   6e-90    Zea mays [maize]
ref|XP_002451891.1|  hypothetical protein SORBIDRAFT_04g009310          287   7e-90    Sorghum bicolor [broomcorn]
gb|AIU50444.1|  pectin lyase-like superfamily protein                   285   8e-90    Ceratophyllum platyacanthum subsp. oryzetorum
gb|AFW81284.1|  hypothetical protein ZEAMMB73_960645                    286   1e-89    
gb|AIU50451.1|  pectin lyase-like superfamily protein                   278   4e-87    Cabomba caroliniana
gb|EMT32528.1|  Putative polygalacturonase                              276   1e-85    
ref|XP_006837459.1|  PREDICTED: probable polygalacturonase              273   2e-84    Amborella trichopoda
gb|AIU50447.1|  pectin lyase-like superfamily protein                   268   3e-83    Ginkgo biloba [ginkgo]
gb|EAZ12715.1|  hypothetical protein OsJ_02632                          268   7e-83    Oryza sativa Japonica Group [Japonica rice]
gb|AIU50419.1|  pectin lyase-like superfamily protein                   264   4e-82    Ceratophyllum demersum [hornwort]
gb|AIU50428.1|  pectin lyase-like superfamily protein                   257   9e-82    Persea americana
gb|AIU50417.1|  pectin lyase-like superfamily protein                   264   2e-81    Iris japonica
gb|KHN38363.1|  Putative polygalacturonase                              254   1e-78    Glycine soja [wild soybean]
ref|XP_010527633.1|  PREDICTED: probable polygalacturonase              238   2e-74    Tarenaya hassleriana [spider flower]
ref|XP_011040145.1|  PREDICTED: probable polygalacturonase              233   7e-69    Populus euphratica
ref|XP_010909275.1|  PREDICTED: probable polygalacturonase isofor...    231   1e-68    
ref|XP_010909269.1|  PREDICTED: probable polygalacturonase isofor...    232   2e-68    Elaeis guineensis
ref|XP_006604763.1|  PREDICTED: probable polygalacturonase-like i...    230   9e-68    Glycine max [soybeans]
ref|XP_003554577.1|  PREDICTED: probable polygalacturonase-like i...    230   9e-68    Glycine max [soybeans]
gb|ABG34278.1|  polygalacturonase                                       225   1e-67    Eucalyptus globulus subsp. globulus
ref|XP_003626072.1|  Polygalacturonase                                  229   2e-67    Medicago truncatula
ref|NP_001241086.1|  uncharacterized protein LOC100817309 precursor     229   2e-67    Glycine max [soybeans]
ref|XP_006576263.1|  PREDICTED: uncharacterized protein LOC100817...    229   2e-67    Glycine max [soybeans]
ref|XP_011005969.1|  PREDICTED: probable polygalacturonase              229   2e-67    Populus euphratica
ref|XP_008788175.1|  PREDICTED: probable polygalacturonase              229   2e-67    Phoenix dactylifera
gb|KEH24447.1|  polygalacturonase/glycoside hydrolase family protein    229   2e-67    Medicago truncatula
ref|XP_006576262.1|  PREDICTED: uncharacterized protein LOC100817...    229   2e-67    Glycine max [soybeans]
ref|XP_002320934.2|  hypothetical protein POPTR_0014s10770g             228   4e-67    
gb|KHN14175.1|  Putative polygalacturonase                              229   4e-67    Glycine soja [wild soybean]
gb|KHN43408.1|  Putative polygalacturonase                              230   6e-67    Glycine soja [wild soybean]
ref|XP_002535132.1|  Polygalacturonase precursor, putative              228   7e-67    
ref|XP_009387922.1|  PREDICTED: probable polygalacturonase              227   8e-67    
ref|XP_002273855.2|  PREDICTED: probable polygalacturonase              227   1e-66    Vitis vinifera
ref|XP_010241442.1|  PREDICTED: probable polygalacturonase isofor...    224   2e-66    Nelumbo nucifera [Indian lotus]
ref|XP_004494475.1|  PREDICTED: probable polygalacturonase-like i...    226   2e-66    Cicer arietinum [garbanzo]
ref|XP_009412155.1|  PREDICTED: probable polygalacturonase              226   3e-66    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004494474.1|  PREDICTED: probable polygalacturonase-like i...    226   3e-66    Cicer arietinum [garbanzo]
ref|XP_010241441.1|  PREDICTED: probable polygalacturonase isofor...    226   5e-66    Nelumbo nucifera [Indian lotus]
ref|XP_003535296.2|  PREDICTED: probable polygalacturonase-like         225   5e-66    Glycine max [soybeans]
ref|XP_006386685.1|  hypothetical protein POPTR_0002s18800g             225   5e-66    
gb|EMS62381.1|  putative polygalacturonase                              219   6e-66    Triticum urartu
ref|XP_002989426.1|  hypothetical protein SELMODRAFT_129742             224   9e-66    
gb|KEH43186.1|  polygalacturonase/glycoside hydrolase family protein    223   1e-65    Medicago truncatula
ref|XP_010091430.1|  putative polygalacturonase                         224   2e-65    
gb|KCW46748.1|  hypothetical protein EUGRSUZ_K00562                     223   2e-65    Eucalyptus grandis [rose gum]
ref|XP_012083013.1|  PREDICTED: probable polygalacturonase              224   2e-65    Jatropha curcas
ref|XP_002962842.1|  hypothetical protein SELMODRAFT_78556              223   2e-65    
ref|XP_008227776.1|  PREDICTED: probable polygalacturonase              224   2e-65    
ref|XP_007221479.1|  hypothetical protein PRUPE_ppa005310mg             223   3e-65    Prunus persica
ref|XP_010035373.1|  PREDICTED: probable polygalacturonase              223   3e-65    Eucalyptus grandis [rose gum]
gb|AES61557.2|  polygalacturonase/glycoside hydrolase family protein    223   9e-65    Medicago truncatula
emb|CDX67875.1|  BnaA07g19150D                                          222   9e-65    
ref|XP_009104364.1|  PREDICTED: probable polygalacturonase              222   1e-64    Brassica rapa
emb|CDY25090.1|  BnaC06g18320D                                          221   1e-64    Brassica napus [oilseed rape]
ref|XP_004288344.1|  PREDICTED: probable polygalacturonase isofor...    222   1e-64    Fragaria vesca subsp. vesca
ref|XP_011467185.1|  PREDICTED: probable polygalacturonase isofor...    221   2e-64    Fragaria vesca subsp. vesca
ref|XP_009363066.1|  PREDICTED: probable polygalacturonase isofor...    221   2e-64    Pyrus x bretschneideri [bai li]
ref|XP_008381624.1|  PREDICTED: probable polygalacturonase              221   2e-64    Malus domestica [apple tree]
ref|XP_009363065.1|  PREDICTED: probable polygalacturonase isofor...    221   3e-64    Pyrus x bretschneideri [bai li]
ref|XP_003591306.1|  Polygalacturonase-like protein                     224   3e-64    
ref|XP_010544930.1|  PREDICTED: probable polygalacturonase              214   3e-64    Tarenaya hassleriana [spider flower]
gb|KHN00242.1|  Putative polygalacturonase                              220   6e-64    Glycine soja [wild soybean]
ref|XP_003519731.2|  PREDICTED: probable polygalacturonase-like i...    220   6e-64    Glycine max [soybeans]
ref|XP_010914786.1|  PREDICTED: probable polygalacturonase              219   1e-63    Elaeis guineensis
ref|XP_007051305.1|  Pectin lyase-like superfamily protein isoform 4    216   2e-63    
ref|XP_007145093.1|  hypothetical protein PHAVU_007G209200g             218   3e-63    Phaseolus vulgaris [French bean]
ref|XP_007163248.1|  hypothetical protein PHAVU_001G218400g             218   4e-63    Phaseolus vulgaris [French bean]
ref|XP_006656549.1|  PREDICTED: probable polygalacturonase-like         218   6e-63    Oryza brachyantha
ref|XP_006444619.1|  hypothetical protein CICLE_v10020035mg             217   6e-63    Citrus clementina [clementine]
ref|XP_001781065.1|  predicted protein                                  216   7e-63    
emb|CDY11403.1|  BnaA09g39690D                                          217   1e-62    Brassica napus [oilseed rape]
ref|XP_008810120.1|  PREDICTED: probable polygalacturonase isofor...    216   2e-62    Phoenix dactylifera
ref|XP_007160099.1|  hypothetical protein PHAVU_002G292300g             216   2e-62    Phaseolus vulgaris [French bean]
gb|KHN16795.1|  Putative polygalacturonase                              215   2e-62    Glycine soja [wild soybean]
ref|XP_009116889.1|  PREDICTED: probable polygalacturonase              216   2e-62    
gb|KHM99951.1|  Putative polygalacturonase                              215   2e-62    Glycine soja [wild soybean]
ref|XP_007051302.1|  Pectin lyase-like superfamily protein isoform 1    216   2e-62    
ref|XP_008810119.1|  PREDICTED: probable polygalacturonase isofor...    216   2e-62    Phoenix dactylifera
gb|KJB49712.1|  hypothetical protein B456_008G134500                    215   3e-62    Gossypium raimondii
ref|XP_006580552.1|  PREDICTED: probable polygalacturonase-like i...    215   4e-62    Glycine max [soybeans]
gb|KJB49711.1|  hypothetical protein B456_008G134500                    215   4e-62    Gossypium raimondii
ref|XP_002876663.1|  glycoside hydrolase family 28 protein              215   5e-62    
ref|XP_003525377.2|  PREDICTED: probable polygalacturonase-like i...    216   5e-62    Glycine max [soybeans]
ref|XP_003532926.1|  PREDICTED: probable polygalacturonase-like i...    216   5e-62    Glycine max [soybeans]
ref|XP_010933983.1|  PREDICTED: probable polygalacturonase isofor...    215   7e-62    Elaeis guineensis
ref|XP_006584731.1|  PREDICTED: probable polygalacturonase-like i...    215   8e-62    Glycine max [soybeans]
ref|XP_008807914.1|  PREDICTED: probable polygalacturonase              214   8e-62    
ref|XP_010679489.1|  PREDICTED: probable polygalacturonase isofor...    214   8e-62    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_567126.1|  pectin lyase-like superfamily protein                 214   9e-62    Arabidopsis thaliana [mouse-ear cress]
emb|CAB71871.1|  putative protein                                       214   9e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004955888.1|  PREDICTED: probable polygalacturonase-like i...    214   1e-61    Setaria italica
ref|XP_010679488.1|  PREDICTED: probable polygalacturonase isofor...    214   1e-61    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010933982.1|  PREDICTED: probable polygalacturonase isofor...    215   1e-61    Elaeis guineensis
gb|ABO31369.1|  polygalacturonase                                       206   1e-61    Gossypium hirsutum [American cotton]
emb|CDX76617.1|  BnaC08g32030D                                          213   2e-61    
ref|XP_004503680.1|  PREDICTED: probable polygalacturonase-like i...    214   2e-61    Cicer arietinum [garbanzo]
gb|AFK37962.1|  unknown                                                 213   2e-61    Lotus japonicus
ref|XP_006657587.1|  PREDICTED: probable polygalacturonase-like i...    213   2e-61    
ref|XP_008796910.1|  PREDICTED: probable polygalacturonase              213   2e-61    
ref|XP_010544928.1|  PREDICTED: probable polygalacturonase              213   2e-61    Tarenaya hassleriana [spider flower]
ref|XP_011463918.1|  PREDICTED: probable polygalacturonase isofor...    213   3e-61    Fragaria vesca subsp. vesca
ref|XP_006291055.1|  hypothetical protein CARUB_v10017170mg             213   4e-61    Capsella rubella
ref|NP_001148255.1|  polygalacturonase                                  213   4e-61    Zea mays [maize]
ref|XP_004298828.1|  PREDICTED: probable polygalacturonase isofor...    213   6e-61    Fragaria vesca subsp. vesca
ref|XP_009607671.1|  PREDICTED: probable polygalacturonase              212   6e-61    Nicotiana tomentosiformis
ref|XP_001755533.1|  predicted protein                                  210   7e-61    
ref|XP_006657586.1|  PREDICTED: probable polygalacturonase-like i...    212   7e-61    Oryza brachyantha
gb|AFK44529.1|  unknown                                                 212   8e-61    Lotus japonicus
gb|ACG41831.1|  glycoside hydrolase, family 28                          211   8e-61    Zea mays [maize]
ref|XP_002437680.1|  hypothetical protein SORBIDRAFT_10g000660          212   1e-60    Sorghum bicolor [broomcorn]
ref|XP_009613774.1|  PREDICTED: probable polygalacturonase              212   1e-60    Nicotiana tomentosiformis
ref|XP_010089056.1|  putative polygalacturonase                         211   1e-60    Morus notabilis
gb|KEH21119.1|  polygalacturonase/glycoside hydrolase family protein    211   2e-60    Medicago truncatula
gb|EYU46764.1|  hypothetical protein MIMGU_mgv1a0060621mg               207   2e-60    Erythranthe guttata [common monkey flower]
ref|XP_009792174.1|  PREDICTED: probable polygalacturonase              211   2e-60    Nicotiana sylvestris
ref|NP_001151164.1|  glycoside hydrolase, family 28 precursor           211   2e-60    Zea mays [maize]
ref|XP_003633958.1|  PREDICTED: probable polygalacturonase              211   2e-60    Vitis vinifera
gb|AFW75224.1|  glycoside hydrolase, family 28                          211   2e-60    
sp|A7PZL3.1|PGLR_VITVI  RecName: Full=Probable polygalacturonase;...    211   2e-60    Vitis vinifera
ref|XP_002459610.1|  hypothetical protein SORBIDRAFT_02g007470          211   2e-60    Sorghum bicolor [broomcorn]
ref|XP_002307030.2|  hypothetical protein POPTR_0005s06430g             211   3e-60    Populus trichocarpa [western balsam poplar]
ref|XP_009345122.1|  PREDICTED: probable polygalacturonase              211   3e-60    
ref|XP_011031186.1|  PREDICTED: probable polygalacturonase              211   4e-60    
ref|XP_009395433.1|  PREDICTED: probable polygalacturonase isofor...    211   4e-60    
ref|XP_001775589.1|  predicted protein                                  210   5e-60    
ref|XP_009395434.1|  PREDICTED: probable polygalacturonase isofor...    210   5e-60    
ref|XP_010413306.1|  PREDICTED: probable polygalacturonase              210   6e-60    
emb|CDP12065.1|  unnamed protein product                                209   6e-60    
ref|XP_002967047.1|  hypothetical protein SELMODRAFT_408393             209   7e-60    
ref|NP_001059282.1|  Os07g0245200                                       209   8e-60    
ref|XP_002875985.1|  glycoside hydrolase family 28 protein              209   1e-59    
ref|XP_002526639.1|  polygalacturonase, putative                        209   1e-59    
ref|XP_001756010.1|  predicted protein                                  207   1e-59    
ref|XP_006402409.1|  hypothetical protein EUTSA_v10005945mg             209   1e-59    
ref|XP_009772512.1|  PREDICTED: probable polygalacturonase              209   1e-59    
ref|XP_002509850.1|  polygalacturonase, putative                        209   1e-59    
ref|XP_011022627.1|  PREDICTED: probable polygalacturonase              209   1e-59    
ref|XP_010934935.1|  PREDICTED: probable polygalacturonase              208   2e-59    
ref|XP_002303605.2|  hypothetical protein POPTR_0003s13160g             209   2e-59    
ref|XP_012066566.1|  PREDICTED: probable polygalacturonase              209   2e-59    
ref|XP_010512598.1|  PREDICTED: probable polygalacturonase isofor...    208   2e-59    
ref|XP_010055093.1|  PREDICTED: probable polygalacturonase              208   2e-59    
gb|EEE66877.1|  hypothetical protein OsJ_23693                          209   3e-59    
ref|XP_008780530.1|  PREDICTED: probable polygalacturonase              200   3e-59    
ref|XP_006584015.1|  PREDICTED: probable polygalacturonase-like i...    206   3e-59    
ref|XP_002960960.1|  hypothetical protein SELMODRAFT_33152              206   4e-59    
gb|KHG23155.1|  putative polygalacturonase                              207   4e-59    
ref|XP_003557344.1|  PREDICTED: probable polygalacturonase              207   4e-59    
gb|KFK35396.1|  hypothetical protein AALP_AA5G279500                    207   4e-59    
gb|KFK35395.1|  hypothetical protein AALP_AA5G279500                    207   5e-59    
gb|EEC81792.1|  hypothetical protein OsI_25505                          208   5e-59    
ref|XP_007209970.1|  hypothetical protein PRUPE_ppa004996mg             207   6e-59    
ref|XP_010255225.1|  PREDICTED: probable polygalacturonase isofor...    207   6e-59    
ref|XP_010255224.1|  PREDICTED: probable polygalacturonase isofor...    207   6e-59    
ref|XP_004964293.1|  PREDICTED: probable polygalacturonase-like i...    207   6e-59    
gb|KJB24315.1|  hypothetical protein B456_004G138900                    207   6e-59    
ref|XP_010512597.1|  PREDICTED: probable polygalacturonase isofor...    209   6e-59    
gb|KJB20605.1|  hypothetical protein B456_003G155800                    206   7e-59    
gb|EMT27847.1|  Putative polygalacturonase                              202   7e-59    
ref|XP_004134229.1|  PREDICTED: probable polygalacturonase isofor...    206   7e-59    
gb|KJB24232.1|  hypothetical protein B456_004G134000                    204   7e-59    
ref|XP_001779181.1|  predicted protein                                  204   8e-59    
ref|XP_004964294.1|  PREDICTED: probable polygalacturonase-like i...    207   8e-59    
ref|XP_004964295.1|  PREDICTED: probable polygalacturonase-like i...    207   8e-59    
dbj|BAD67712.1|  putative polygalacturonase                             207   8e-59    
ref|XP_006372397.1|  glycoside hydrolase family 28 family protein       206   9e-59    
ref|XP_011651065.1|  PREDICTED: probable polygalacturonase isofor...    206   9e-59    
ref|XP_007051304.1|  Pectin lyase-like superfamily protein isoform 3    205   1e-58    
ref|XP_010255223.1|  PREDICTED: probable polygalacturonase isofor...    207   1e-58    
gb|KEH37171.1|  polygalacturonase/glycoside hydrolase family protein    204   1e-58    
gb|KJB52729.1|  hypothetical protein B456_008G274700                    206   1e-58    
gb|KHN02933.1|  Putative polygalacturonase                              206   1e-58    
ref|XP_003528627.1|  PREDICTED: probable polygalacturonase-like i...    206   1e-58    
ref|XP_008438914.1|  PREDICTED: probable polygalacturonase isofor...    206   1e-58    
gb|KJB20604.1|  hypothetical protein B456_003G155800                    206   1e-58    
ref|XP_008438913.1|  PREDICTED: probable polygalacturonase isofor...    206   1e-58    
ref|XP_009383010.1|  PREDICTED: probable polygalacturonase              203   1e-58    
ref|NP_001183080.1|  hypothetical protein precursor                     206   1e-58    
gb|EPS71449.1|  hypothetical protein M569_03308                         205   1e-58    
ref|NP_190464.1|  pectin lyase-like superfamily protein                 206   1e-58    
gb|ABR18040.1|  unknown                                                 206   2e-58    
ref|XP_006842393.1|  PREDICTED: probable polygalacturonase              206   2e-58    
gb|KJB24488.1|  hypothetical protein B456_004G147300                    206   2e-58    
gb|KDO86269.1|  hypothetical protein CISIN_1g0090751mg                  200   2e-58    
ref|XP_006365531.1|  PREDICTED: probable polygalacturonase-like         206   2e-58    
gb|KHG19694.1|  putative polygalacturonase                              206   2e-58    
ref|XP_010468984.1|  PREDICTED: probable polygalacturonase              206   2e-58    
ref|XP_002278930.1|  PREDICTED: probable polygalacturonase              206   2e-58    
ref|XP_002310517.2|  glycoside hydrolase family 28 family protein       205   2e-58    
ref|XP_009389852.1|  PREDICTED: probable polygalacturonase              206   2e-58    
gb|KJB24487.1|  hypothetical protein B456_004G147300                    206   2e-58    
ref|XP_009624281.1|  PREDICTED: probable polygalacturonase              205   2e-58    
ref|XP_011046019.1|  PREDICTED: probable polygalacturonase              205   2e-58    
ref|XP_004510753.1|  PREDICTED: probable polygalacturonase-like         206   2e-58    
gb|KJB24490.1|  hypothetical protein B456_004G147300                    206   2e-58    
ref|XP_008794781.1|  PREDICTED: probable polygalacturonase isofor...    205   3e-58    
ref|XP_009599786.1|  PREDICTED: probable polygalacturonase isofor...    205   3e-58    
ref|XP_011029346.1|  PREDICTED: probable polygalacturonase              205   3e-58    
ref|XP_004295492.1|  PREDICTED: probable polygalacturonase              206   3e-58    
gb|AIU50406.1|  pectin lyase-like superfamily protein                   201   3e-58    
ref|XP_008794778.1|  PREDICTED: probable polygalacturonase isofor...    206   3e-58    
ref|XP_011099733.1|  PREDICTED: probable polygalacturonase isofor...    205   3e-58    
gb|KJB24491.1|  hypothetical protein B456_004G147300                    205   3e-58    
ref|XP_009599780.1|  PREDICTED: probable polygalacturonase isofor...    205   3e-58    
ref|XP_006439488.1|  hypothetical protein CICLE_v10019941mg             205   4e-58    
ref|XP_002299511.1|  hypothetical protein POPTR_0001s09790g             205   4e-58    
gb|KEH37170.1|  polygalacturonase/glycoside hydrolase family protein    204   4e-58    
ref|XP_008794779.1|  PREDICTED: probable polygalacturonase isofor...    205   4e-58    
ref|XP_010271039.1|  PREDICTED: probable polygalacturonase isofor...    205   4e-58    
ref|XP_008794777.1|  PREDICTED: probable polygalacturonase isofor...    205   4e-58    
gb|KDO76318.1|  hypothetical protein CISIN_1g011659mg                   205   4e-58    
ref|XP_007040335.1|  Pectin lyase-like superfamily protein isoform 1    204   4e-58    
ref|XP_006840361.1|  PREDICTED: probable polygalacturonase              204   4e-58    
gb|EMS49882.1|  putative polygalacturonase                              202   4e-58    
ref|XP_008238946.1|  PREDICTED: probable polygalacturonase              205   5e-58    
ref|XP_010271038.1|  PREDICTED: probable polygalacturonase isofor...    205   5e-58    
ref|XP_010055091.1|  PREDICTED: probable polygalacturonase isofor...    205   5e-58    
ref|XP_010276903.1|  PREDICTED: probable polygalacturonase isofor...    204   5e-58    
ref|XP_009762711.1|  PREDICTED: probable polygalacturonase isofor...    204   5e-58    
gb|EPS72197.1|  hypothetical protein M569_02558                         204   5e-58    
ref|XP_010941157.1|  PREDICTED: probable polygalacturonase              204   7e-58    
ref|XP_010436419.1|  PREDICTED: probable polygalacturonase              201   7e-58    
ref|XP_010055092.1|  PREDICTED: probable polygalacturonase isofor...    204   7e-58    
gb|KJB34667.1|  hypothetical protein B456_006G077400                    200   7e-58    
ref|XP_006355845.1|  PREDICTED: probable polygalacturonase-like         204   7e-58    
ref|XP_009762710.1|  PREDICTED: probable polygalacturonase isofor...    204   7e-58    
gb|KJB34666.1|  hypothetical protein B456_006G077400                    200   7e-58    
ref|XP_009793676.1|  PREDICTED: probable polygalacturonase              204   8e-58    
ref|XP_009624502.1|  PREDICTED: probable polygalacturonase              207   8e-58    
ref|XP_011022938.1|  PREDICTED: probable polygalacturonase              204   8e-58    
ref|XP_010053221.1|  PREDICTED: probable polygalacturonase              204   9e-58    
ref|XP_004240097.1|  PREDICTED: probable polygalacturonase              204   9e-58    
ref|XP_004242037.1|  PREDICTED: probable polygalacturonase              204   1e-57    
dbj|BAK02492.1|  predicted protein                                      201   1e-57    
ref|XP_010270376.1|  PREDICTED: probable polygalacturonase              205   1e-57    
gb|EMS53988.1|  putative polygalacturonase                              201   1e-57    
emb|CDY70893.1|  BnaCnng70190D                                          201   1e-57    
ref|XP_010276902.1|  PREDICTED: probable polygalacturonase isofor...    204   1e-57    
dbj|BAJ88149.1|  predicted protein                                      199   1e-57    
emb|CDY69255.1|  BnaAnng29830D                                          201   1e-57    
gb|KJB41375.1|  hypothetical protein B456_007G102200                    200   1e-57    
gb|KHG15710.1|  hypothetical protein F383_10492                         203   2e-57    
gb|KHG15709.1|  hypothetical protein F383_10492                         203   2e-57    
ref|XP_006476506.1|  PREDICTED: probable polygalacturonase-like         203   2e-57    
ref|XP_009138190.1|  PREDICTED: probable polygalacturonase              203   2e-57    
ref|XP_010530415.1|  PREDICTED: probable polygalacturonase              202   2e-57    
ref|XP_003533597.1|  PREDICTED: probable polygalacturonase-like         203   2e-57    
ref|XP_010276899.1|  PREDICTED: probable polygalacturonase isofor...    203   2e-57    
ref|XP_012083329.1|  PREDICTED: probable polygalacturonase              203   3e-57    
gb|EYU23462.1|  hypothetical protein MIMGU_mgv1a006147mg                202   3e-57    
ref|XP_009137085.1|  PREDICTED: probable polygalacturonase              203   3e-57    
ref|XP_004487815.1|  PREDICTED: probable polygalacturonase-like         202   3e-57    
ref|XP_006345581.1|  PREDICTED: probable polygalacturonase-like i...    203   3e-57    
ref|XP_006464997.1|  PREDICTED: probable polygalacturonase-like i...    203   3e-57    
ref|XP_010027649.1|  PREDICTED: probable polygalacturonase              203   3e-57    
ref|XP_007138953.1|  hypothetical protein PHAVU_009G252200g             202   3e-57    
ref|XP_006345582.1|  PREDICTED: probable polygalacturonase-like i...    202   3e-57    
ref|XP_006386609.1|  hypothetical protein POPTR_0002s16390g             199   4e-57    
ref|XP_002443718.1|  hypothetical protein SORBIDRAFT_07g000740          202   4e-57    
ref|XP_006292567.1|  hypothetical protein CARUB_v10018803mg             202   4e-57    
gb|KDO50316.1|  hypothetical protein CISIN_1g020062mg                   198   5e-57    
ref|XP_010230291.1|  PREDICTED: probable polygalacturonase              201   6e-57    
ref|XP_003533248.1|  PREDICTED: probable polygalacturonase isofor...    201   6e-57    
ref|XP_006597719.1|  PREDICTED: probable polygalacturonase-like i...    201   6e-57    
ref|XP_006597720.1|  PREDICTED: probable polygalacturonase-like i...    201   6e-57    
ref|XP_011079616.1|  PREDICTED: probable polygalacturonase isofor...    201   7e-57    
ref|XP_011079615.1|  PREDICTED: probable polygalacturonase isofor...    201   7e-57    
ref|XP_003552411.1|  PREDICTED: probable polygalacturonase              202   7e-57    
ref|XP_012086833.1|  PREDICTED: probable polygalacturonase              201   8e-57    
ref|XP_002875935.1|  predicted protein                                  201   8e-57    
ref|XP_003592200.1|  Polygalacturonase-like protein                     201   8e-57    
gb|KJB41374.1|  hypothetical protein B456_007G102200                    201   8e-57    
ref|XP_009382257.1|  PREDICTED: probable polygalacturonase isofor...    201   9e-57    
ref|XP_010094123.1|  putative polygalacturonase                         201   9e-57    
ref|XP_009784607.1|  PREDICTED: probable polygalacturonase isofor...    201   9e-57    
gb|KJB41376.1|  hypothetical protein B456_007G102200                    201   9e-57    
gb|KHN26517.1|  Putative polygalacturonase                              201   9e-57    
ref|XP_006586911.1|  PREDICTED: probable polygalacturonase isofor...    201   9e-57    
ref|XP_008223260.1|  PREDICTED: probable polygalacturonase              201   1e-56    
ref|XP_008437531.1|  PREDICTED: probable polygalacturonase              201   1e-56    
ref|XP_006413548.1|  hypothetical protein EUTSA_v10025011mg             201   1e-56    
ref|XP_009363435.1|  PREDICTED: probable polygalacturonase              201   1e-56    
ref|XP_003550546.2|  PREDICTED: probable polygalacturonase-like         201   1e-56    
ref|XP_008232996.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    201   1e-56    
ref|XP_009784614.1|  PREDICTED: probable polygalacturonase isofor...    200   1e-56    
gb|ABG34277.1|  polygalacturonase                                       194   1e-56    
ref|XP_006659744.1|  PREDICTED: probable polygalacturonase-like         198   1e-56    
ref|XP_006283603.1|  hypothetical protein CARUB_v10004660mg             201   1e-56    
gb|KHN03332.1|  Putative polygalacturonase                              201   1e-56    
ref|XP_010519492.1|  PREDICTED: probable polygalacturonase              201   1e-56    
ref|XP_010439166.1|  PREDICTED: probable polygalacturonase              201   1e-56    
ref|XP_009137356.1|  PREDICTED: probable polygalacturonase              201   1e-56    
ref|XP_010676424.1|  PREDICTED: probable polygalacturonase              201   1e-56    
emb|CDY46115.1|  BnaA03g52530D                                          201   1e-56    
ref|XP_010550764.1|  PREDICTED: probable polygalacturonase              201   1e-56    
ref|XP_003592202.1|  hypothetical protein MTR_1g100060                  201   1e-56    
ref|XP_010448699.1|  PREDICTED: probable polygalacturonase              201   1e-56    
ref|XP_009604283.1|  PREDICTED: probable polygalacturonase              201   2e-56    
ref|XP_007151452.1|  hypothetical protein PHAVU_004G047700g             200   2e-56    
ref|XP_009793070.1|  PREDICTED: probable polygalacturonase              201   2e-56    
emb|CDY44105.1|  BnaA01g13130D                                          200   2e-56    
ref|XP_004985902.1|  PREDICTED: probable polygalacturonase-like         200   2e-56    
ref|XP_007139799.1|  hypothetical protein PHAVU_008G059700g             201   2e-56    
gb|KHG14610.1|  putative polygalacturonase                              200   2e-56    
ref|NP_001151102.1|  glycoside hydrolase, family 28 precursor           200   2e-56    
ref|XP_006491165.1|  PREDICTED: probable polygalacturonase-like         201   2e-56    
gb|EYU23746.1|  hypothetical protein MIMGU_mgv1a024920mg                201   2e-56    
ref|XP_006343936.1|  PREDICTED: probable polygalacturonase-like         200   3e-56    
ref|XP_010912866.1|  PREDICTED: probable polygalacturonase              200   3e-56    
ref|XP_006829063.1|  PREDICTED: probable polygalacturonase              200   3e-56    
ref|XP_010024977.1|  PREDICTED: probable polygalacturonase              199   3e-56    
ref|XP_002301370.1|  polygalacturonase-like family protein              200   3e-56    
gb|EPS71596.1|  hypothetical protein M569_03160                         201   3e-56    
gb|KCW90638.1|  hypothetical protein EUGRSUZ_A02742                     199   3e-56    
ref|XP_006362679.1|  PREDICTED: probable polygalacturonase-like         201   3e-56    
ref|XP_008795320.1|  PREDICTED: probable polygalacturonase              200   3e-56    
ref|XP_002869777.1|  glycoside hydrolase family 28 protein              200   3e-56    
ref|XP_002513653.1|  polygalacturonase, putative                        200   3e-56    
ref|XP_009122564.1|  PREDICTED: probable polygalacturonase              200   3e-56    
ref|XP_007223360.1|  hypothetical protein PRUPE_ppa005599mg             199   3e-56    
gb|KJB34665.1|  hypothetical protein B456_006G077400                    199   4e-56    
gb|AES62453.2|  pectin lyase superfamily protein                        201   4e-56    
ref|XP_006432212.1|  hypothetical protein CICLE_v10003286mg             200   4e-56    
ref|XP_004245570.1|  PREDICTED: probable polygalacturonase              200   4e-56    
ref|XP_011023292.1|  PREDICTED: probable polygalacturonase isofor...    199   5e-56    
ref|XP_006444979.1|  hypothetical protein CICLE_v10019597mg             201   5e-56    
gb|KJB11781.1|  hypothetical protein B456_001G158900                    199   5e-56    
ref|XP_011092828.1|  PREDICTED: probable polygalacturonase              200   5e-56    
ref|XP_011023291.1|  PREDICTED: probable polygalacturonase isofor...    199   6e-56    
ref|XP_007051731.1|  Polygalacturonase, putative isoform 1              199   6e-56    
gb|EAZ41253.1|  hypothetical protein OsJ_25761                          199   6e-56    
emb|CDX75352.1|  BnaA01g03500D                                          199   6e-56    
emb|CDX68976.1|  BnaC01g04770D                                          199   6e-56    
gb|KFK28901.1|  hypothetical protein AALP_AA7G062800                    199   6e-56    
gb|EAZ05322.1|  hypothetical protein OsI_27527                          199   6e-56    
ref|NP_001060796.1|  Os08g0107300                                       199   6e-56    
gb|AFK49026.1|  unknown                                                 197   7e-56    
ref|XP_009382256.1|  PREDICTED: probable polygalacturonase isofor...    199   7e-56    
ref|XP_010429342.1|  PREDICTED: probable polygalacturonase              199   7e-56    
ref|XP_002468601.1|  hypothetical protein SORBIDRAFT_01g048880          199   7e-56    
ref|NP_001048813.1|  Os03g0124900                                       198   7e-56    
ref|XP_004492778.1|  PREDICTED: probable polygalacturonase-like         199   7e-56    



>ref|XP_009603675.1| PREDICTED: probable polygalacturonase [Nicotiana tomentosiformis]
Length=448

 Score =   372 bits (954),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 184/225 (82%), Positives = 199/225 (88%), Gaps = 2/225 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSSHVCIEDSYIS GDDLVAVKSGWD+YGIAYGRPSHGITIRR+
Sbjct  220  ILAPADSPNTDGIDPDSSSHVCIEDSYISVGDDLVAVKSGWDQYGIAYGRPSHGITIRRI  279

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV DVLAEHI L NMGVGIHIKTN+GRGG+IRNIT SNVYME 
Sbjct  280  TGSSPFAGIAVGSETSGGVVDVLAEHINLFNMGVGIHIKTNIGRGGVIRNITVSNVYMEN  339

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
            TRTGI+IAGDVG HPDE FNPNA+P+V+ IKIKDVWGE+VLQ G IRG+  SPF+ ICLS
Sbjct  340  TRTGIKIAGDVGDHPDENFNPNALPVVKGIKIKDVWGEKVLQAGLIRGLKNSPFSGICLS  399

Query  338  NIHLNGAK-SLRNPPWKCSDASGAAVQVSPSPCSELT-RDQSGAC  210
            NI+L+G     RN PWKCSD SGAA+QVSP PCSELT   Q+GAC
Sbjct  400  NINLHGNNPGPRNSPWKCSDVSGAAIQVSPWPCSELTSSQQTGAC  444



>ref|XP_009767931.1| PREDICTED: probable polygalacturonase [Nicotiana sylvestris]
Length=454

 Score =   367 bits (943),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 180/221 (81%), Positives = 196/221 (89%), Gaps = 1/221 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSSHVCIEDSYIS GDDLVAVKSGWD+YGIAYGRPSHGITIRR+
Sbjct  220  ILAPADSPNTDGIDPDSSSHVCIEDSYISVGDDLVAVKSGWDQYGIAYGRPSHGITIRRI  279

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV DVLAEHI L +MGVGIHIKTN+GRGG+IRNIT SNVYME 
Sbjct  280  TGSSPFAGIAVGSETSGGVADVLAEHINLFDMGVGIHIKTNIGRGGVIRNITVSNVYMEN  339

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
            TRTGI+IAGDVG HPDE+FNPNA+P+V+ IKIKDVWGE+VLQ G IRG+  SPF+ ICLS
Sbjct  340  TRTGIKIAGDVGDHPDEKFNPNALPVVKGIKIKDVWGEKVLQAGLIRGLKNSPFSGICLS  399

Query  338  NIHLNGAK-SLRNPPWKCSDASGAAVQVSPSPCSELTRDQS  219
            NI+L+G     RN PWKCSD SGAA+QVSP PCSELT  Q 
Sbjct  400  NINLHGNNPGPRNSPWKCSDVSGAAIQVSPWPCSELTSSQQ  440



>emb|CDP12145.1| unnamed protein product [Coffea canephora]
Length=447

 Score =   365 bits (938),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 178/231 (77%), Positives = 199/231 (86%), Gaps = 1/231 (0%)
 Frame = -1

Query  899  LLFDMSPILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSH  720
            ++ +   ILAP DSPNTDGIDPDSS+HVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSH
Sbjct  213  VVINYVTILAPADSPNTDGIDPDSSTHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSH  272

Query  719  GITIRRVTGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITF  540
            GITIRRVTGSSPFAGIA+GSETSGG+ DVLAEHI L NMGVGIH+KTNVGRGG+IRNIT 
Sbjct  273  GITIRRVTGSSPFAGIAIGSETSGGIEDVLAEHINLYNMGVGIHLKTNVGRGGVIRNITV  332

Query  539  SNVYMEKTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSP  360
            SNVYM+  R GI+IAGDVG HPD  +NPNA+P+V+D+ IKDVWGE VLQ G I+G+  SP
Sbjct  333  SNVYMQNARKGIKIAGDVGDHPDTNYNPNALPVVKDVTIKDVWGEGVLQSGQIQGLKNSP  392

Query  359  FTNICLSNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRD-QSGAC  210
            FT ICLSNI+L G    RNPPWKCSD SGAAV+VSP PCSELT   Q+G+C
Sbjct  393  FTGICLSNINLQGNVGPRNPPWKCSDVSGAAVRVSPWPCSELTSTYQAGSC  443



>ref|XP_011101030.1| PREDICTED: probable polygalacturonase [Sesamum indicum]
Length=447

 Score =   365 bits (936),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 196/224 (88%), Gaps = 1/224 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSSHVCIED+YISTGDDL+AVKSGWDEYGIAYGRPSHGITIRRV
Sbjct  220  ILAPADSPNTDGIDPDSSSHVCIEDAYISTGDDLIAVKSGWDEYGIAYGRPSHGITIRRV  279

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV DVLAEHI L NMGVGIH+KTNVGRGG+IRNIT SNVYME 
Sbjct  280  TGSSPFAGIAVGSETSGGVEDVLAEHINLFNMGVGIHLKTNVGRGGVIRNITVSNVYMED  339

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+I+GDVG HPDE +N NA+P+++D+ IK++WGE+V QPG I G+  +PFT ICLS
Sbjct  340  ARKGIKISGDVGDHPDEYYNRNALPVLKDVVIKNIWGERVQQPGLIHGLKNAPFTGICLS  399

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT-RDQSGAC  210
            NIHL GA+  RN PW+CSD  GAAVQVSP PCS+LT   Q+GAC
Sbjct  400  NIHLRGARGPRNLPWQCSDVRGAAVQVSPWPCSQLTSHQQTGAC  443



>ref|XP_004245522.1| PREDICTED: probable polygalacturonase isoform X2 [Solanum lycopersicum]
Length=466

 Score =   364 bits (934),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 178/223 (80%), Positives = 193/223 (87%), Gaps = 0/223 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYIS GDDLVAVKSGWD+YGIAYGRPSHGITIRR+
Sbjct  229  ILAPADSPNTDGIDPDSSSNVCIEDSYISVGDDLVAVKSGWDQYGIAYGRPSHGITIRRI  288

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV DVLAEHI+L NMGVGIHIKTNVGRGG+IRNIT SNVYME 
Sbjct  289  TGSSPFAGIAVGSETSGGVVDVLAEHISLFNMGVGIHIKTNVGRGGMIRNITVSNVYMEN  348

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             RTGI+IAGDVG HPDE FNPNA+P+V+ IKIKDVWGE+VLQ G I G+  SPF+ ICLS
Sbjct  349  ARTGIKIAGDVGDHPDENFNPNALPVVKGIKIKDVWGEKVLQAGLIHGLKNSPFSGICLS  408

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQSGAC  210
            NI+L G    RN  WKCSD SGAA+QVSP PC+ELT  Q   C
Sbjct  409  NINLRGNPGPRNSIWKCSDVSGAAIQVSPFPCAELTSSQKTGC  451



>ref|XP_006343870.1| PREDICTED: probable polygalacturonase-like [Solanum tuberosum]
Length=447

 Score =   362 bits (929),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 177/224 (79%), Positives = 197/224 (88%), Gaps = 1/224 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYIS GDDLVAVKSGWD+YGIAYGRPSHGITIRR+
Sbjct  220  ILAPADSPNTDGIDPDSSSNVCIEDSYISVGDDLVAVKSGWDQYGIAYGRPSHGITIRRI  279

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV DVLAEHI+L NMGVGIHIKTN+GRGG+IRNIT SNVYME 
Sbjct  280  TGSSPFAGIAVGSETSGGVVDVLAEHISLFNMGVGIHIKTNIGRGGMIRNITVSNVYMEN  339

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             RTGI+IAGDVG HP+E FNPNA+P+V+ IKIKDVWGE+VLQ G I G+  SPF+ ICLS
Sbjct  340  ARTGIKIAGDVGDHPNENFNPNALPVVKGIKIKDVWGEKVLQAGLIHGLKNSPFSGICLS  399

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT-RDQSGAC  210
            NI+L+G    +N  WKCSD SGAA+QVSP PC+ELT   Q+GAC
Sbjct  400  NINLHGNPGSQNSIWKCSDVSGAAIQVSPFPCAELTSSQQTGAC  443



>ref|XP_010325363.1| PREDICTED: probable polygalacturonase isoform X1 [Solanum lycopersicum]
Length=476

 Score =   362 bits (928),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 177/220 (80%), Positives = 192/220 (87%), Gaps = 0/220 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYIS GDDLVAVKSGWD+YGIAYGRPSHGITIRR+
Sbjct  229  ILAPADSPNTDGIDPDSSSNVCIEDSYISVGDDLVAVKSGWDQYGIAYGRPSHGITIRRI  288

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV DVLAEHI+L NMGVGIHIKTNVGRGG+IRNIT SNVYME 
Sbjct  289  TGSSPFAGIAVGSETSGGVVDVLAEHISLFNMGVGIHIKTNVGRGGMIRNITVSNVYMEN  348

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             RTGI+IAGDVG HPDE FNPNA+P+V+ IKIKDVWGE+VLQ G I G+  SPF+ ICLS
Sbjct  349  ARTGIKIAGDVGDHPDENFNPNALPVVKGIKIKDVWGEKVLQAGLIHGLKNSPFSGICLS  408

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQS  219
            NI+L G    RN  WKCSD SGAA+QVSP PC+ELT  Q 
Sbjct  409  NINLRGNPGPRNSIWKCSDVSGAAIQVSPFPCAELTSSQK  448



>ref|XP_011073737.1| PREDICTED: probable polygalacturonase [Sesamum indicum]
 ref|XP_011073743.1| PREDICTED: probable polygalacturonase [Sesamum indicum]
Length=449

 Score =   359 bits (922),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 197/231 (85%), Gaps = 1/231 (0%)
 Frame = -1

Query  899  LLFDMSPILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSH  720
            ++ + + I+AP DSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPS 
Sbjct  215  VVINYATIVAPADSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSQ  274

Query  719  GITIRRVTGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITF  540
             ITIRRVTGSSPFAGIAVGSETSGGV DVLAEHI L NMG GIH+KTN+GRGG+IRNIT 
Sbjct  275  DITIRRVTGSSPFAGIAVGSETSGGVEDVLAEHINLFNMGFGIHLKTNIGRGGVIRNITI  334

Query  539  SNVYMEKTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSP  360
            SNVYM+K R GI+I+GDVG HPDE +NP A+P+++D+KIKDVWG++V QPG IRG+  +P
Sbjct  335  SNVYMDKARKGIKISGDVGDHPDENYNPKALPVLKDVKIKDVWGDRVQQPGLIRGLKDAP  394

Query  359  FTNICLSNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQS-GAC  210
            F+ ICLSNI L GA   R+ PW+CSD SG AVQVSP PCSELT  Q  GAC
Sbjct  395  FSGICLSNISLGGATGQRDLPWQCSDVSGGAVQVSPLPCSELTSSQQIGAC  445



>gb|AIU50439.1| pectin lyase-like superfamily protein, partial [Solanum lycopersicum]
Length=406

 Score =   356 bits (914),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 176/220 (80%), Positives = 191/220 (87%), Gaps = 5/220 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYIS GDDLVAVKSGWD+YGIAYGRPSHGITIRR+
Sbjct  192  ILAPADSPNTDGIDPDSSSNVCIEDSYISVGDDLVAVKSGWDQYGIAYGRPSHGITIRRI  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV DVLAEHI+L NMGVGIHIKTNVGRGG+IRNIT SNVYME 
Sbjct  252  TGSSPFAGIAVGSETSGGVVDVLAEHISLFNMGVGIHIKTNVGRGGMIRNITVSNVYMEN  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             RTGI+IAGDVG HPDE FNPNA+P+V+ IKIKDVWGE+VLQ G I G+  SPF+ ICLS
Sbjct  312  ARTGIKIAGDVGDHPDENFNPNALPVVKGIKIKDVWGEKVLQAGLIHGLKNSPFSGICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQS  219
            NI+L G     N  WKCSD SGAA+QVSP PC+ELT  Q 
Sbjct  372  NINLRG-----NSIWKCSDVSGAAIQVSPFPCAELTSSQK  406



>gb|AIU50429.1| pectin lyase-like superfamily protein, partial [Solanum tuberosum]
Length=406

 Score =   354 bits (909),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 174/220 (79%), Positives = 192/220 (87%), Gaps = 5/220 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYIS GDDLVAVKSGWD+YGIAYGRPSHGITIRR+
Sbjct  192  ILAPADSPNTDGIDPDSSSNVCIEDSYISVGDDLVAVKSGWDQYGIAYGRPSHGITIRRI  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV DVLAEHI+L NMGVGIHIKTN+GRGG+IRNIT SNVYME 
Sbjct  252  TGSSPFAGIAVGSETSGGVVDVLAEHISLFNMGVGIHIKTNIGRGGMIRNITVSNVYMEN  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             RTGI+IAGDVG HP+E FNPNA+P+V+ IKIKDVWGE+VLQ G I G+  SPF+ ICLS
Sbjct  312  ARTGIKIAGDVGDHPNENFNPNALPVVKGIKIKDVWGEKVLQAGLIHGLKNSPFSGICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQS  219
            NI+L+G     N  WKCSD SGAA+QVSP PC+ELT  Q 
Sbjct  372  NINLHG-----NSIWKCSDVSGAAIQVSPFPCAELTSSQQ  406



>gb|AIU50443.1| pectin lyase-like superfamily protein, partial [Lactuca sativa]
Length=406

 Score =   348 bits (894),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 170/215 (79%), Positives = 191/215 (89%), Gaps = 5/215 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPS+ ITIRR+
Sbjct  192  ILAPPDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSNDITIRRL  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGVT+VLAEHITL N G+GIH+KTN+GRGGIIRNIT SNV+M+K
Sbjct  252  TGSSPFAGIAVGSETSGGVTNVLAEHITLYNTGIGIHLKTNIGRGGIIRNITVSNVFMDK  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVG HPDE +NPNA+P+++ I+IK+VWGE V QPG I+G+  SPFT+ICLS
Sbjct  312  VRKGIKIAGDVGDHPDENYNPNALPVMKHIRIKNVWGENVQQPGLIQGLKNSPFTDICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            NI+L G     N PWKC+D SG AVQVSPSPCSEL
Sbjct  372  NINLFG-----NVPWKCADVSGGAVQVSPSPCSEL  401



>ref|XP_010659126.1| PREDICTED: probable polygalacturonase [Vitis vinifera]
 emb|CBI34471.3| unnamed protein product [Vitis vinifera]
Length=447

 Score =   346 bits (888),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 191/224 (85%), Gaps = 1/224 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYGRPS GITIRR+
Sbjct  220  ILAPHDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSSGITIRRI  279

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV +V AEHI L NMGVGIH+KTN+GRGG+IRNIT SNVYMEK
Sbjct  280  TGSSPFAGIAVGSETSGGVQNVFAEHINLYNMGVGIHLKTNIGRGGVIRNITVSNVYMEK  339

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             RTGI+IAGDVG HPD+ FNPNA+P+V+ + I+DVWG  VLQPG I G+  SPFT ICLS
Sbjct  340  ARTGIKIAGDVGDHPDDNFNPNALPVVKGVVIRDVWGLDVLQPGSIIGLKNSPFTGICLS  399

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTR-DQSGAC  210
             I+L+G       PWKCSD SGAAV VSP PCSELT   Q+G+C
Sbjct  400  KINLHGKIKPGTAPWKCSDVSGAAVGVSPWPCSELTSPGQTGSC  443



>gb|KDO76503.1| hypothetical protein CISIN_1g0134022mg [Citrus sinensis]
Length=280

 Score =   339 bits (869),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 168/224 (75%), Positives = 188/224 (84%), Gaps = 1/224 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYG PS GITIRRV
Sbjct  53   ILAPADSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGHPSSGITIRRV  112

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPF+GIAVGSETSGGV +VLAEHI L N+GVGIH+KTN+GRGG IRNIT S+VYME 
Sbjct  113  TGSSPFSGIAVGSETSGGVENVLAEHINLYNVGVGIHVKTNIGRGGFIRNITVSDVYMEN  172

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVG HPD++FNPNA+P+V  I IKDVWG +V Q G I+G+  SPFT ICLS
Sbjct  173  ARKGIKIAGDVGDHPDDKFNPNALPVVNGITIKDVWGTKVQQSGLIQGLKNSPFTGICLS  232

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL-TRDQSGAC  210
            NI+L G     +PP KCSD SG+A QV P PCSEL +  Q+GAC
Sbjct  233  NINLQGVAGPTSPPLKCSDVSGSAYQVKPWPCSELSSSQQTGAC  276



>gb|KDO76502.1| hypothetical protein CISIN_1g0134022mg [Citrus sinensis]
Length=328

 Score =   339 bits (870),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 168/224 (75%), Positives = 188/224 (84%), Gaps = 1/224 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYG PS GITIRRV
Sbjct  101  ILAPADSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGHPSSGITIRRV  160

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPF+GIAVGSETSGGV +VLAEHI L N+GVGIH+KTN+GRGG IRNIT S+VYME 
Sbjct  161  TGSSPFSGIAVGSETSGGVENVLAEHINLYNVGVGIHVKTNIGRGGFIRNITVSDVYMEN  220

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVG HPD++FNPNA+P+V  I IKDVWG +V Q G I+G+  SPFT ICLS
Sbjct  221  ARKGIKIAGDVGDHPDDKFNPNALPVVNGITIKDVWGTKVQQSGLIQGLKNSPFTGICLS  280

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL-TRDQSGAC  210
            NI+L G     +PP KCSD SG+A QV P PCSEL +  Q+GAC
Sbjct  281  NINLQGVAGPTSPPLKCSDVSGSAYQVKPWPCSELSSSQQTGAC  324



>ref|XP_006586032.1| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=443

 Score =   342 bits (878),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 164/223 (74%), Positives = 192/223 (86%), Gaps = 0/223 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYGRPS+GITIRR+
Sbjct  219  ILAPRDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSYGITIRRL  278

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGGV +VLAEHI L NMGVGIHIKTN GRGG+I+NIT ++VY+E 
Sbjct  279  TGSSPFAGIAIGSETSGGVENVLAEHINLFNMGVGIHIKTNSGRGGLIKNITVAHVYVEN  338

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVGGHPDE+FNPNA+P+V+ I IK+VWG +V Q G I G+  SPFT++CLS
Sbjct  339  ARQGIKIAGDVGGHPDEKFNPNALPVVKGITIKNVWGVRVNQAGLIHGLRNSPFTDVCLS  398

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQSGAC  210
            NI+ +G +  R+P WKCSD  G A QVSP PCS+L+  + G+C
Sbjct  399  NINFHGMRGPRSPSWKCSDVFGFAHQVSPWPCSQLSSQEPGSC  441



>gb|KHM99685.1| Putative polygalacturonase [Glycine soja]
Length=425

 Score =   341 bits (875),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/223 (74%), Positives = 192/223 (86%), Gaps = 0/223 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYGRPS+GITIRR+
Sbjct  201  ILAPRDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSYGITIRRL  260

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGGV +VLAEHI L NMGVGIHIKTN GRGG+I+NIT ++VY+E 
Sbjct  261  TGSSPFAGIAIGSETSGGVENVLAEHINLFNMGVGIHIKTNSGRGGLIKNITVAHVYVEN  320

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVGGHPDE+FNPNA+P+V+ I IK+VWG +V Q G I G+  SPFT++CLS
Sbjct  321  ARQGIKIAGDVGGHPDEKFNPNALPVVKGITIKNVWGVRVNQAGLIHGLRNSPFTDVCLS  380

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQSGAC  210
            NI+ +G +  R+P WKCSD  G A QVSP PCS+L+  + G+C
Sbjct  381  NINFHGMRGPRSPSWKCSDVFGFAHQVSPWPCSQLSSQEPGSC  423



>gb|KHN12010.1| Putative polygalacturonase [Glycine soja]
Length=446

 Score =   342 bits (876),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/223 (74%), Positives = 191/223 (86%), Gaps = 0/223 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYGRPS  ITIRR+
Sbjct  220  ILAPRDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSSDITIRRI  279

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGGV +VLAEHI L NMG+GIHIKTN GRGG I+NIT S+VYME+
Sbjct  280  TGSSPFAGIAIGSETSGGVENVLAEHINLYNMGIGIHIKTNTGRGGFIKNITMSHVYMEE  339

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GIRI+GDVG HPD++F+ NA+P+V+ + IK+VWG +VLQ G I+G+  SPFT+ICL 
Sbjct  340  ARKGIRISGDVGDHPDDKFDVNALPLVKGVTIKNVWGMKVLQAGLIQGLRNSPFTDICLY  399

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQSGAC  210
            +I+L+G    R PPWKCSD SG A QVSP PCSEL+ +Q G+C
Sbjct  400  DINLHGVTGPRTPPWKCSDVSGFAHQVSPWPCSELSSNQQGSC  442



>ref|XP_003545367.1| PREDICTED: probable polygalacturonase [Glycine max]
Length=446

 Score =   342 bits (876),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/223 (74%), Positives = 191/223 (86%), Gaps = 0/223 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYGRPS  ITIRR+
Sbjct  220  ILAPRDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSSDITIRRI  279

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGGV +VLAEHI L NMG+GIHIKTN GRGG I+NIT S+VYME+
Sbjct  280  TGSSPFAGIAIGSETSGGVENVLAEHINLYNMGIGIHIKTNTGRGGFIKNITMSHVYMEE  339

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GIRI+GDVG HPD++F+ NA+P+V+ + IK+VWG +VLQ G I+G+  SPFT+ICL 
Sbjct  340  ARKGIRISGDVGDHPDDKFDANALPLVKGVTIKNVWGMKVLQAGLIQGLRNSPFTDICLY  399

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQSGAC  210
            +I+L+G    R PPWKCSD SG A QVSP PCSEL+ +Q G+C
Sbjct  400  DINLHGVTGPRTPPWKCSDVSGFAHQVSPWPCSELSSNQQGSC  442



>gb|KDO76501.1| hypothetical protein CISIN_1g0134022mg, partial [Citrus sinensis]
Length=335

 Score =   338 bits (866),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 168/224 (75%), Positives = 188/224 (84%), Gaps = 1/224 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYG PS GITIRRV
Sbjct  108  ILAPADSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGHPSSGITIRRV  167

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPF+GIAVGSETSGGV +VLAEHI L N+GVGIH+KTN+GRGG IRNIT S+VYME 
Sbjct  168  TGSSPFSGIAVGSETSGGVENVLAEHINLYNVGVGIHVKTNIGRGGFIRNITVSDVYMEN  227

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVG HPD++FNPNA+P+V  I IKDVWG +V Q G I+G+  SPFT ICLS
Sbjct  228  ARKGIKIAGDVGDHPDDKFNPNALPVVNGITIKDVWGTKVQQSGLIQGLKNSPFTGICLS  287

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL-TRDQSGAC  210
            NI+L G     +PP KCSD SG+A QV P PCSEL +  Q+GAC
Sbjct  288  NINLQGVAGPTSPPLKCSDVSGSAYQVKPWPCSELSSSQQTGAC  331



>gb|AIU50434.1| pectin lyase-like superfamily protein, partial [Artemisia annua]
Length=277

 Score =   335 bits (860),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 191/215 (89%), Gaps = 5/215 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSSHVCIEDSYISTGDDL+AVKSGWD+YGIAYGRPS+ ITIRR+
Sbjct  63   ILAPADSPNTDGIDPDSSSHVCIEDSYISTGDDLIAVKSGWDQYGIAYGRPSNDITIRRI  122

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGVT+VLAEHITLS+ G+GIH+KTN+GRGGIIRNIT S+V+M+ 
Sbjct  123  TGSSPFAGIAVGSETSGGVTNVLAEHITLSHTGIGIHLKTNIGRGGIIRNITISDVFMDT  182

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVG HPD+ ++PNA+P+++ ++IK+VWGE+VL+ G I+G+  SPFT+ICLS
Sbjct  183  VRKGIKIAGDVGDHPDDNYDPNALPVLKHVRIKNVWGEKVLEAGLIKGLKNSPFTDICLS  242

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            N+HL G     + PW C+D SG +VQVSPSPCSEL
Sbjct  243  NVHLTG-----HGPWTCADVSGGSVQVSPSPCSEL  272



>gb|AIU50442.1| pectin lyase-like superfamily protein, partial [Vitis vinifera]
Length=406

 Score =   340 bits (872),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 170/216 (79%), Positives = 186/216 (86%), Gaps = 5/216 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYGRPS GITIRR+
Sbjct  192  ILAPHDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSSGITIRRI  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV +V AEHI L NMGVGIH+KTN+GRGG+IRNIT SNVYMEK
Sbjct  252  TGSSPFAGIAVGSETSGGVQNVFAEHINLYNMGVGIHLKTNIGRGGVIRNITVSNVYMEK  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             RTGI+IAGDVG HPD+ FNPNA+P+V+ + I+DVWG  VLQPG I G+  SPFT ICLS
Sbjct  312  ARTGIKIAGDVGDHPDDNFNPNALPVVKGVVIRDVWGLDVLQPGSIIGLKNSPFTGICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
             I+L+G       PWKCSD SGAAV VSP PCSELT
Sbjct  372  KINLHGTA-----PWKCSDVSGAAVGVSPWPCSELT  402



>ref|XP_002509949.1| Polygalacturonase precursor, putative [Ricinus communis]
 gb|EEF51336.1| Polygalacturonase precursor, putative [Ricinus communis]
Length=446

 Score =   341 bits (874),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 167/224 (75%), Positives = 192/224 (86%), Gaps = 1/224 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYGRPS  ITIRR+
Sbjct  219  ILAPHDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSSHITIRRI  278

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV  VLAE+I L +MGVG+H+KTN+GRGG IRNITFS+VYM+ 
Sbjct  279  TGSSPFAGIAVGSETSGGVEHVLAENINLYDMGVGLHVKTNIGRGGFIRNITFSDVYMKN  338

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVG HPD+ +NPNA+P+V+ I  + VWGE VLQPG I+G+  SPFT ICLS
Sbjct  339  ARKGIKIAGDVGDHPDDNYNPNALPVVKGIIFRGVWGENVLQPGAIQGLKSSPFTGICLS  398

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL-TRDQSGAC  210
            NI+L+G    R+ PWKCSD SGAA++VSP PCSEL T  Q+G+C
Sbjct  399  NINLHGVPGPRSTPWKCSDVSGAALEVSPFPCSELATTHQTGSC  442



>ref|XP_003551949.1| PREDICTED: probable polygalacturonase-like [Glycine max]
Length=442

 Score =   340 bits (873),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 164/223 (74%), Positives = 192/223 (86%), Gaps = 0/223 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYGRPS+GITIRRV
Sbjct  218  ILAPRDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSYGITIRRV  277

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGGV +VLAEHI L NMGVGIHIKTN GRGG+I+NIT ++VY+E 
Sbjct  278  TGSSPFAGIAIGSETSGGVENVLAEHINLFNMGVGIHIKTNSGRGGLIKNITVAHVYVEN  337

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVGGHPDE+FNPNA+P+V+ I IK+VWG +V Q G I G+  SPFT++CLS
Sbjct  338  ARQGIKIAGDVGGHPDEKFNPNALPVVKGITIKNVWGVKVNQAGLIHGLRNSPFTDVCLS  397

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQSGAC  210
            +I+ +G +  R+P WKCSD  G A QVSP PCS+L+  + G+C
Sbjct  398  DINFHGMEGPRSPSWKCSDVFGFAHQVSPWPCSQLSSQEPGSC  440



>gb|KHN28527.1| Putative polygalacturonase [Glycine soja]
Length=457

 Score =   340 bits (873),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 164/223 (74%), Positives = 192/223 (86%), Gaps = 0/223 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYGRPS+GITIRRV
Sbjct  233  ILAPRDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSYGITIRRV  292

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGGV +VLAEHI L NMGVGIHIKTN GRGG+I+NIT ++VY+E 
Sbjct  293  TGSSPFAGIAIGSETSGGVENVLAEHINLFNMGVGIHIKTNSGRGGLIKNITVAHVYVEN  352

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVGGHPDE+FNPNA+P+V+ I IK+VWG +V Q G I G+  SPFT++CLS
Sbjct  353  ARQGIKIAGDVGGHPDEKFNPNALPVVKGITIKNVWGVKVNQAGLIHGLRNSPFTDVCLS  412

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQSGAC  210
            +I+ +G +  R+P WKCSD  G A QVSP PCS+L+  + G+C
Sbjct  413  DINFHGMEGPRSPSWKCSDVFGFAHQVSPWPCSQLSSQEPGSC  455



>ref|XP_006476397.1| PREDICTED: probable polygalacturonase-like [Citrus sinensis]
Length=443

 Score =   340 bits (872),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 168/224 (75%), Positives = 189/224 (84%), Gaps = 1/224 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYG PS GITIRRV
Sbjct  216  ILAPADSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGHPSSGITIRRV  275

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPF+GIAVGSETSGGV +VLAEHI L N+GVGIH+KTN+GRGG IRNIT S+VYME 
Sbjct  276  TGSSPFSGIAVGSETSGGVENVLAEHINLYNVGVGIHVKTNIGRGGFIRNITVSDVYMEN  335

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVG HPD++FNPNA+P+V  I IKDVWG +V Q G I+G+  SPFT ICLS
Sbjct  336  ARKGIKIAGDVGDHPDDKFNPNALPVVNGITIKDVWGTKVQQSGLIQGLKNSPFTGICLS  395

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT-RDQSGAC  210
            NI+L+G     +PP KCSD SG+A QV P PCSEL+   Q+GAC
Sbjct  396  NINLHGVAGPTSPPLKCSDVSGSAYQVKPWPCSELSGSQQTGAC  439



>ref|XP_006439367.1| hypothetical protein CICLE_v10020162mg [Citrus clementina]
 gb|ESR52607.1| hypothetical protein CICLE_v10020162mg [Citrus clementina]
Length=443

 Score =   340 bits (871),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 168/224 (75%), Positives = 188/224 (84%), Gaps = 1/224 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYG PS GITIRRV
Sbjct  216  ILAPADSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGHPSSGITIRRV  275

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPF+GIAVGSETSGGV +VLAEHI L N+GVGIH+KTN+GRGG IRNIT S+VYME 
Sbjct  276  TGSSPFSGIAVGSETSGGVENVLAEHINLYNVGVGIHVKTNIGRGGFIRNITVSDVYMEN  335

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVG HPD++FNPNA+P+V  I IKDVWG +V Q G I+G+  SPFT ICLS
Sbjct  336  ARKGIKIAGDVGDHPDDKFNPNALPVVNGITIKDVWGTKVQQSGLIQGLKNSPFTGICLS  395

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL-TRDQSGAC  210
            NI+L G     +PP KCSD SG+A QV P PCSEL +  Q+GAC
Sbjct  396  NINLQGVAGPTSPPLKCSDVSGSAYQVKPWPCSELSSSQQTGAC  439



>ref|XP_004499965.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=449

 Score =   338 bits (867),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 161/223 (72%), Positives = 188/223 (84%), Gaps = 0/223 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGI+YGRPS+GITIRR+
Sbjct  223  ILAPRDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGISYGRPSYGITIRRL  282

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGGV ++LAEHI L NMGVGIHIKTN+GRGG I+NIT SNVY+E 
Sbjct  283  TGSSPFAGIAIGSETSGGVENILAEHINLFNMGVGIHIKTNIGRGGFIKNITVSNVYIEN  342

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVG HPDE F+PNA+P+V+ I +K+VWG +VLQ G I G+  SPFT IC  
Sbjct  343  ARQGIKIAGDVGDHPDENFDPNALPVVKGITVKNVWGVKVLQAGLIHGLRDSPFTEICFY  402

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQSGAC  210
            +I+ +G    R+PPWKCSD  G + QVSP PCS+L+  Q G+C
Sbjct  403  DINFHGVTGPRSPPWKCSDVFGFSHQVSPWPCSQLSSQQPGSC  445



>ref|XP_010266478.1| PREDICTED: probable polygalacturonase [Nelumbo nucifera]
Length=448

 Score =   338 bits (867),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 165/215 (77%), Positives = 187/215 (87%), Gaps = 0/215 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYI+TGDDLVAVKSGWDEYGIAYGRPS GITIRRV
Sbjct  221  ILAPFDSPNTDGIDPDSSSNVCIEDSYIATGDDLVAVKSGWDEYGIAYGRPSSGITIRRV  280

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPF+GIA+GSETSGGV DVLAE+I L NMG+GIH+KTN+GRGG IRNIT S+VYME 
Sbjct  281  TGSSPFSGIAIGSETSGGVEDVLAENINLYNMGIGIHLKTNIGRGGFIRNITVSDVYMEN  340

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             + GIRIAGDVG HPD++FNPNA+P+V  + IK+VWG +V Q G I+G+  SPFT ICLS
Sbjct  341  AQKGIRIAGDVGDHPDDKFNPNALPVVNGVMIKNVWGVKVQQSGSIQGLKNSPFTQICLS  400

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            NI+L GA +  + PWKCSD SGAAVQVSP PCSEL
Sbjct  401  NINLRGAVAPGSTPWKCSDVSGAAVQVSPWPCSEL  435



>ref|XP_012086739.1| PREDICTED: probable polygalacturonase [Jatropha curcas]
 gb|KDP25309.1| hypothetical protein JCGZ_20465 [Jatropha curcas]
Length=448

 Score =   338 bits (867),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 193/225 (86%), Gaps = 2/225 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDS+ISTGDDLVAVKSGWDEYGIAYGRPS GITIRR+
Sbjct  220  ILAPHDSPNTDGIDPDSSSNVCIEDSFISTGDDLVAVKSGWDEYGIAYGRPSSGITIRRI  279

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV +V AE+I L +MGVGIH+KTN+GRGG IRNIT S+VYME 
Sbjct  280  TGSSPFAGIAVGSETSGGVENVFAENINLYDMGVGIHVKTNIGRGGFIRNITVSDVYMEN  339

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVG HPD+ +NPNA+P+V+ I +K VWGE+VLQPG I+G+  SPFT ICLS
Sbjct  340  VRKGIKIAGDVGDHPDDDYNPNALPVVKGITLKGVWGEKVLQPGSIQGVKNSPFTGICLS  399

Query  338  NIHLNGAKSLRN-PPWKCSDASGAAVQVSPSPCSEL-TRDQSGAC  210
            NI+L+G    R+ PPWKCS  SGAA++VSP PCSEL T  Q G+C
Sbjct  400  NINLHGVPGPRSTPPWKCSYVSGAALEVSPWPCSELATTSQVGSC  444



>ref|XP_002304552.2| glycoside hydrolase family 28 family protein [Populus trichocarpa]
 gb|EEE79531.2| glycoside hydrolase family 28 family protein [Populus trichocarpa]
Length=447

 Score =   337 bits (864),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 164/224 (73%), Positives = 190/224 (85%), Gaps = 1/224 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYGRPS  ITIRR+
Sbjct  220  ILAPLDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSSDITIRRI  279

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPF+GIAVGSETSGGV +VL E++ L NMGVGIHIKTN+GRGG I+NIT ++VYME 
Sbjct  280  TGSSPFSGIAVGSETSGGVKNVLVENVNLYNMGVGIHIKTNIGRGGFIKNITVTDVYMEN  339

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVG HPD+ FNPNA+P+V  I +K +WGE+V QPG I+G+  SPFT ICLS
Sbjct  340  VRKGIKIAGDVGDHPDDSFNPNALPVVYGITLKSIWGEKVQQPGSIQGLKNSPFTGICLS  399

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTR-DQSGAC  210
            NI+L+G    R+ PWKCSD SG+A+ VSP PCSELT   Q+G+C
Sbjct  400  NINLHGVPGPRSSPWKCSDVSGSALLVSPWPCSELTSPHQTGSC  443



>ref|XP_007209143.1| hypothetical protein PRUPE_ppa005818mg [Prunus persica]
 gb|EMJ10342.1| hypothetical protein PRUPE_ppa005818mg [Prunus persica]
Length=442

 Score =   337 bits (863),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/222 (74%), Positives = 187/222 (84%), Gaps = 0/222 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDG+DPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYGRPS GITIRRV
Sbjct  215  ILAPYDSPNTDGVDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSSGITIRRV  274

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             GSSPFAGIA+GSETSGGV +VLAEHI L NMGVGIHIKTN+GRGG IRNIT S+VYME+
Sbjct  275  RGSSPFAGIAIGSETSGGVENVLAEHINLYNMGVGIHIKTNIGRGGFIRNITVSDVYMEE  334

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVG HPD+++N NA+P+V+ I +KD+WG QV Q G I G+  SPFT ICLS
Sbjct  335  VRRGIKIAGDVGDHPDDKYNQNALPVVKGITLKDIWGVQVQQAGVILGLKNSPFTGICLS  394

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQSGA  213
            NI+L+G    R+PPWKCSD SGAA  VSP  CSEL+  Q  +
Sbjct  395  NINLHGMTGSRSPPWKCSDISGAAHLVSPLQCSELSGAQQAS  436



>ref|XP_008239046.1| PREDICTED: probable polygalacturonase [Prunus mume]
Length=442

 Score =   336 bits (862),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 165/222 (74%), Positives = 185/222 (83%), Gaps = 0/222 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDG+DPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYGRPS GITIRRV
Sbjct  215  ILAPNDSPNTDGVDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSSGITIRRV  274

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             GSSPFAGIA+GSETSGGV +VLAEHI L NMGVGIHIKTN+GRG  IRNIT S+VYMEK
Sbjct  275  RGSSPFAGIAIGSETSGGVENVLAEHINLYNMGVGIHIKTNIGRGAFIRNITVSDVYMEK  334

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVG HPD+++N NA+P+V+ I +KDVWG Q  Q G I G+  SPFT ICLS
Sbjct  335  VRRGIKIAGDVGDHPDDKYNQNALPVVKGITLKDVWGVQAQQAGVILGLKNSPFTGICLS  394

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQSGA  213
            NI+L+G    R+PPWKCSD SGAA  VSP  CSEL+  Q  +
Sbjct  395  NINLHGMTGSRSPPWKCSDISGAAHLVSPLQCSELSSAQRAS  436



>gb|KJB39696.1| hypothetical protein B456_007G026000 [Gossypium raimondii]
Length=280

 Score =   330 bits (846),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 190/224 (85%), Gaps = 1/224 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAPTDSPNTDGIDPDSSS+VCIEDS+ISTGDDLVAVKSGWDEYGIAYGRPS  ITIRRV
Sbjct  53   ILAPTDSPNTDGIDPDSSSNVCIEDSFISTGDDLVAVKSGWDEYGIAYGRPSSHITIRRV  112

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV  VLAE+I + N G+G++IKTN+GRGG I+NIT S V+ME 
Sbjct  113  TGSSPFAGIAVGSETSGGVEHVLAENIVIYNSGIGVNIKTNIGRGGFIKNITVSQVFMEN  172

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             RTGI+I GD G HPD QFNPNA+P V+ + +K++WG +V + G I+G+  +PFTNICLS
Sbjct  173  VRTGIKITGDTGDHPDNQFNPNALPYVKGVTLKNIWGVKVQKAGSIQGLKNAPFTNICLS  232

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTR-DQSGAC  210
             I+L+G    R+PPWKCSD SGAA++VSPSPC++L+   QSG+C
Sbjct  233  KINLHGMTGPRSPPWKCSDVSGAAIEVSPSPCAQLSSPQQSGSC  276



>gb|AIU50397.1| pectin lyase-like superfamily protein, partial [Aquilegia coerulea]
Length=406

 Score =   335 bits (858),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 184/216 (85%), Gaps = 5/216 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGI YGR S+GITIRRV
Sbjct  192  ILAPADSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIKYGRKSYGITIRRV  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGGV +VLAEHI L NMG+GIH+KTN+GRGG I+NIT S+VYME 
Sbjct  252  TGSSPFAGIAIGSETSGGVENVLAEHINLFNMGLGIHVKTNIGRGGYIKNITISDVYMEN  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVG HPDE ++PNA+P+V  + ++++WGE+VLQPG I+G+  SPFT IC S
Sbjct  312  ARKGIKIAGDVGDHPDENYDPNALPVVHGVTMRNIWGEKVLQPGSIQGLKNSPFTGICFS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            NIHL+G      P WKCSD SG A  VSPSPC++LT
Sbjct  372  NIHLHGT-----PLWKCSDVSGTASAVSPSPCAQLT  402



>ref|XP_011022514.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=447

 Score =   336 bits (861),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 164/224 (73%), Positives = 190/224 (85%), Gaps = 1/224 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYGRPS  ITIRR+
Sbjct  220  ILAPLDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSSDITIRRI  279

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV +VL E+I+L NMGVGIHIKTN+GRGG I+NI+ ++VYME 
Sbjct  280  TGSSPFAGIAVGSETSGGVKNVLVENISLYNMGVGIHIKTNIGRGGFIKNISVTDVYMEN  339

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVG HPDE FNPNA+P+V  I +K +WGE+V  PG I+G+  SPFT ICLS
Sbjct  340  VRKGIKIAGDVGDHPDESFNPNALPVVYGITLKSIWGEKVQHPGSIQGLKNSPFTGICLS  399

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTR-DQSGAC  210
            NI+L+G    R+ PWKCSD SG+A+ VSP PCSEL+   Q+G+C
Sbjct  400  NINLHGVPGPRSSPWKCSDVSGSALLVSPWPCSELSSPHQTGSC  443



>gb|EPS61079.1| hypothetical protein M569_13719, partial [Genlisea aurea]
Length=416

 Score =   335 bits (858),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 188/220 (85%), Gaps = 1/220 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP+DSPNTDGIDPDSSS VCIEDS+ISTGDDLVA+KSGWDEYGI+Y RPS GITIRRV
Sbjct  194  ILAPSDSPNTDGIDPDSSSSVCIEDSFISTGDDLVAIKSGWDEYGISYNRPSRGITIRRV  253

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV DVLAEH+TL N+GVGIH+KTNVGRGGI+RNIT SNVYME 
Sbjct  254  TGSSPFAGIAVGSETSGGVEDVLAEHVTLFNVGVGIHLKTNVGRGGIVRNITVSNVYMEN  313

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVG HPD  ++P A+P + DI I++VWGE+VLQPG I G+  +PFT ICLS
Sbjct  314  ARLGIKIAGDVGDHPDGGYDPKALPELTDIVIRNVWGERVLQPGLIHGLKGAPFTGICLS  373

Query  338  NIHLNGAKSLRN-PPWKCSDASGAAVQVSPSPCSELTRDQ  222
            NIHL GA+   +  PW CSD SG+AVQVSP PC++LT  Q
Sbjct  374  NIHLIGAQGASDSKPWLCSDVSGSAVQVSPWPCAQLTVSQ  413



>gb|KEH33635.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=451

 Score =   335 bits (859),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 164/224 (73%), Positives = 189/224 (84%), Gaps = 1/224 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWD YGI+YGRPS+ ITIRR+
Sbjct  224  ILAPRDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDAYGISYGRPSNDITIRRI  283

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV +VLAEHI L NMGVGIHIKTN+GRGG+I+NIT SNVY+E 
Sbjct  284  TGSSPFAGIAVGSETSGGVQNVLAEHINLFNMGVGIHIKTNIGRGGLIKNITVSNVYIEN  343

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
            +R GI+IAGDVG HPDE FNPNA+P+V+ I IK VWG +VLQ G I G+  SPFT IC  
Sbjct  344  SRQGIKIAGDVGDHPDENFNPNALPVVKGITIKSVWGVKVLQAGLIHGLRNSPFTEICFY  403

Query  338  NIHLNGAK-SLRNPPWKCSDASGAAVQVSPSPCSELTRDQSGAC  210
            +I+L+G   S R+PPWKCSD  G + QVSP PCS+L+  + G+C
Sbjct  404  DINLHGETGSGRSPPWKCSDVFGFSKQVSPWPCSQLSSQEPGSC  447



>gb|EYU40022.1| hypothetical protein MIMGU_mgv1a006305mg [Erythranthe guttata]
Length=449

 Score =   333 bits (855),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 160/224 (71%), Positives = 190/224 (85%), Gaps = 1/224 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWD+YGI+Y RPS GITIRR+
Sbjct  222  ILAPADSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDQYGISYNRPSQGITIRRL  281

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV DV+AEHI LSNMG+GIH+KTN+GRGG+IRNI+ SNVYM K
Sbjct  282  TGSSPFAGIAVGSETSGGVADVIAEHINLSNMGIGIHLKTNIGRGGVIRNISISNVYMYK  341

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+I+GDVG HPDE ++ NA+P+++D+ IKDV G+ V QPG I G+ K+PF+ ICLS
Sbjct  342  ARKGIKISGDVGDHPDENYDRNALPVLKDVVIKDVSGDFVQQPGLIHGLKKAPFSGICLS  401

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQS-GAC  210
            N+ L G   +R+  W+CSD SG AV+VSP PC+ELT  Q  G+C
Sbjct  402  NVSLGGVVGVRDSGWQCSDVSGGAVRVSPLPCAELTSSQQIGSC  445



>gb|AIU50408.1| pectin lyase-like superfamily protein, partial [Citrus clementina]
 gb|AIU50412.1| pectin lyase-like superfamily protein, partial [Citrus sinensis]
Length=406

 Score =   332 bits (852),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 165/219 (75%), Positives = 184/219 (84%), Gaps = 5/219 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYG PS GITIRRV
Sbjct  192  ILAPADSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGHPSSGITIRRV  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPF+GIAVGSETSGGV +VLAEHI L N+GVGIH+KTN+GRGG IRNIT S+VYME 
Sbjct  252  TGSSPFSGIAVGSETSGGVENVLAEHINLYNVGVGIHVKTNIGRGGFIRNITVSDVYMEN  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVG HPD++FNPNA+P+V  I IKDVWG +V Q G I+G+  SPFT ICLS
Sbjct  312  ARKGIKIAGDVGDHPDDKFNPNALPVVNGITIKDVWGTKVQQSGLIQGLKNSPFTGICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQ  222
            NI+L G+     PP KCSD SG+A QV P PCSEL+  Q
Sbjct  372  NINLQGS-----PPLKCSDVSGSAYQVKPWPCSELSSSQ  405



>gb|AIU50426.1| pectin lyase-like superfamily protein, partial [Manihot esculenta]
Length=406

 Score =   332 bits (851),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 164/223 (74%), Positives = 190/223 (85%), Gaps = 5/223 (2%)
 Frame = -1

Query  899  LLFDMSPILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSH  720
            ++     ILAP DSPNTDGIDPDSS++VCIEDS+ISTGDDLVAVKSGWDEYGIAYGRPS 
Sbjct  185  VVIQFVTILAPPDSPNTDGIDPDSSTNVCIEDSFISTGDDLVAVKSGWDEYGIAYGRPSS  244

Query  719  GITIRRVTGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITF  540
            GITIRRVTGSSPFAGIAVGSETSGGV +VLAE+I L +MGVGIH+KTN+GRGG IRNIT 
Sbjct  245  GITIRRVTGSSPFAGIAVGSETSGGVENVLAENINLYDMGVGIHVKTNIGRGGFIRNITI  304

Query  539  SNVYMEKTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSP  360
            S+VYME  R GI+IAGDVG HPD++FNP A+P+V+ I +K VWGE+V QPG I+G+  SP
Sbjct  305  SDVYMENVRKGIKIAGDVGDHPDDKFNPYALPVVKGITLKGVWGEKVQQPGSIQGLKDSP  364

Query  359  FTNICLSNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            FT ICLSNI+L+G+      PWKCSD SGAA++VSP PCSELT
Sbjct  365  FTGICLSNINLHGST-----PWKCSDVSGAALEVSPWPCSELT  402



>ref|XP_007141479.1| hypothetical protein PHAVU_008G199400g [Phaseolus vulgaris]
 gb|ESW13473.1| hypothetical protein PHAVU_008G199400g [Phaseolus vulgaris]
Length=442

 Score =   333 bits (854),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 161/223 (72%), Positives = 187/223 (84%), Gaps = 0/223 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYG PS  ITIRRV
Sbjct  216  ILAPRDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGLPSSNITIRRV  275

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            +GSSPFAGIA+GSETSGGV +VLAEHI L  MG+GIHIKTN GRGG I+NIT S+VYME 
Sbjct  276  SGSSPFAGIAIGSETSGGVENVLAEHINLYKMGIGIHIKTNSGRGGFIKNITVSHVYMED  335

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GIRI+GDVG HPD++F+PNA+PIV+ + +K+VWG +VLQ G I+G+  SPF++ICL 
Sbjct  336  ARKGIRISGDVGDHPDDKFDPNALPIVKGVTMKNVWGVKVLQAGLIQGVKNSPFSDICLY  395

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQSGAC  210
            +I+L G    R PPWKCSD SG A QVSP PCSEL+ +  G+C
Sbjct  396  DINLGGVTGPRTPPWKCSDVSGFAHQVSPWPCSELSSNHQGSC  438



>ref|XP_004298894.1| PREDICTED: probable polygalacturonase [Fragaria vesca subsp. 
vesca]
 ref|XP_011463978.1| PREDICTED: probable polygalacturonase [Fragaria vesca subsp. 
vesca]
Length=443

 Score =   332 bits (852),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 165/223 (74%), Positives = 184/223 (83%), Gaps = 1/223 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWD+YGIAYGRPS  ITIRR+
Sbjct  216  ILAPADSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDQYGIAYGRPSSDITIRRI  275

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             GSSPFAGIAVGSETSGGV +V  EHI L N+GVGIHIKTN+GRGG IRNIT SNVYMEK
Sbjct  276  RGSSPFAGIAVGSETSGGVENVFVEHINLHNVGVGIHIKTNIGRGGFIRNITVSNVYMEK  335

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVG HPD  +NPNA+P+V+ I + D+WG QVLQ G I+G+  SPFT ICLS
Sbjct  336  ARKGIKIAGDVGDHPDNNYNPNALPVVKGITLTDIWGIQVLQAGLIQGLKNSPFTGICLS  395

Query  338  NIHLNGAK-SLRNPPWKCSDASGAAVQVSPSPCSELTRDQSGA  213
            NI+L+G   + R PPWKCSD SGAA  VSP  CSELT  Q  +
Sbjct  396  NINLHGMPGTSRTPPWKCSDISGAAHLVSPIQCSELTSAQHAS  438



>ref|XP_004491304.1| PREDICTED: probable polygalacturonase-like [Cicer arietinum]
Length=452

 Score =   332 bits (851),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 162/223 (73%), Positives = 184/223 (83%), Gaps = 0/223 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDG+DPDSSS+VCIEDSYIS GDDLVAVKSGWDEYGIAYG+PS  ITIRRV
Sbjct  222  ILAPRDSPNTDGVDPDSSSNVCIEDSYISNGDDLVAVKSGWDEYGIAYGQPSSNITIRRV  281

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             GSSPFAGIAVGSE SGGV +VLAEHI L NMG+GIHIKTN+GRGG I+NI  SNVYME 
Sbjct  282  NGSSPFAGIAVGSEASGGVENVLAEHINLQNMGIGIHIKTNIGRGGYIKNINVSNVYMEN  341

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
            TR GI+IAGDVG HPD++++ NA+PIV+ I I++VWG +VLQ G I GI  SPF++ICLS
Sbjct  342  TRKGIKIAGDVGDHPDDKYDKNAVPIVKGIVIENVWGVKVLQAGLITGIRNSPFSDICLS  401

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQSGAC  210
            NI+L+G    R P WKCS   G A QVSP PCSEL   QSG+C
Sbjct  402  NINLHGVVGTRAPTWKCSSVIGVAYQVSPLPCSELVSHQSGSC  444



>gb|KJB39695.1| hypothetical protein B456_007G026000 [Gossypium raimondii]
Length=343

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 190/224 (85%), Gaps = 1/224 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAPTDSPNTDGIDPDSSS+VCIEDS+ISTGDDLVAVKSGWDEYGIAYGRPS  ITIRRV
Sbjct  116  ILAPTDSPNTDGIDPDSSSNVCIEDSFISTGDDLVAVKSGWDEYGIAYGRPSSHITIRRV  175

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV  VLAE+I + N G+G++IKTN+GRGG I+NIT S V+ME 
Sbjct  176  TGSSPFAGIAVGSETSGGVEHVLAENIVIYNSGIGVNIKTNIGRGGFIKNITVSQVFMEN  235

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             RTGI+I GD G HPD QFNPNA+P V+ + +K++WG +V + G I+G+  +PFTNICLS
Sbjct  236  VRTGIKITGDTGDHPDNQFNPNALPYVKGVTLKNIWGVKVQKAGSIQGLKNAPFTNICLS  295

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTR-DQSGAC  210
             I+L+G    R+PPWKCSD SGAA++VSPSPC++L+   QSG+C
Sbjct  296  KINLHGMTGPRSPPWKCSDVSGAAIEVSPSPCAQLSSPQQSGSC  339



>ref|XP_010261531.1| PREDICTED: probable polygalacturonase [Nelumbo nucifera]
 ref|XP_010261532.1| PREDICTED: probable polygalacturonase [Nelumbo nucifera]
Length=447

 Score =   332 bits (851),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 165/224 (74%), Positives = 187/224 (83%), Gaps = 1/224 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYI+TGDD+VAVKSGWDEYGIAYGRPS  ITIRRV
Sbjct  220  ILAPGDSPNTDGIDPDSSSNVCIEDSYIATGDDMVAVKSGWDEYGIAYGRPSSNITIRRV  279

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGGV +VLAE+I L  MGVGIHIKTN+GRGG IRNIT S+VYME 
Sbjct  280  TGSSPFAGIAIGSETSGGVENVLAENINLYKMGVGIHIKTNIGRGGFIRNITVSDVYMEN  339

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVG HPD+ FNPNA+P+V+ I IK+VWG QV Q G I+G+  SPFT ICLS
Sbjct  340  ARKGIKIAGDVGDHPDDNFNPNALPVVKGITIKNVWGVQVQQSGSIQGLKNSPFTEICLS  399

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL-TRDQSGAC  210
            NI+L G       PWKCSD SGAA +VSP PCSEL ++  +G+C
Sbjct  400  NINLRGVLVPGTTPWKCSDVSGAAFEVSPWPCSELISKSGTGSC  443



>gb|AIU50435.1| pectin lyase-like superfamily protein, partial [Ricinus communis]
Length=406

 Score =   330 bits (846),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 185/215 (86%), Gaps = 5/215 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYGRPS  ITIRR+
Sbjct  192  ILAPHDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSSHITIRRI  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV  VLAE+I L +MGVG+H+KTN+GRGG IRNITFS+VYM+ 
Sbjct  252  TGSSPFAGIAVGSETSGGVEHVLAENINLYDMGVGLHVKTNIGRGGFIRNITFSDVYMKN  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVG HPD+ +NPNA+P+V+ I  + VWGE VLQPG I+G+  SPFT ICLS
Sbjct  312  ARKGIKIAGDVGDHPDDNYNPNALPVVKGIIFRGVWGENVLQPGAIQGLKSSPFTGICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            NI+L+G+      PWKCSD SGAA++VSP PCSEL
Sbjct  372  NINLHGST-----PWKCSDVSGAALEVSPFPCSEL  401



>gb|AIU50414.1| pectin lyase-like superfamily protein, partial [Glycine max]
Length=406

 Score =   329 bits (844),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 187/219 (85%), Gaps = 5/219 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYGRPS  ITIRR+
Sbjct  192  ILAPRDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSSDITIRRI  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGGV +VLAEHI L NMG+GIHIKTN GRGG I+NIT S+VYME+
Sbjct  252  TGSSPFAGIAIGSETSGGVENVLAEHINLYNMGIGIHIKTNTGRGGFIKNITMSHVYMEE  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GIRI+GDVG HPD++F+ NA+P+V+ + IK+VWG +VLQ G I+G+  SPFT+ICL 
Sbjct  312  ARKGIRISGDVGDHPDDKFDANALPLVKGVTIKNVWGMKVLQAGLIQGLRNSPFTDICLY  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQ  222
            +I+L+G      PPWKCSD SG A QVSP PCSEL+ +Q
Sbjct  372  DINLHGT-----PPWKCSDVSGFAHQVSPWPCSELSSNQ  405



>gb|AIU50431.1| pectin lyase-like superfamily protein, partial [Prunus persica]
Length=406

 Score =   329 bits (843),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 164/220 (75%), Positives = 185/220 (84%), Gaps = 5/220 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDG+DPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYGRPS GITIRRV
Sbjct  192  ILAPYDSPNTDGVDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSSGITIRRV  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             GSSPFAGIA+GSETSGGV +VLAEHI L NMGVGIHIKTN+GRGG IRNIT S+VYME+
Sbjct  252  RGSSPFAGIAIGSETSGGVENVLAEHINLYNMGVGIHIKTNIGRGGFIRNITVSDVYMEE  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVG HPD+++N NA+P+V+ I +KD+WG QV Q G I G+  SPFT ICLS
Sbjct  312  VRRGIKIAGDVGDHPDDKYNQNALPVVKGITLKDIWGVQVQQAGVILGLKNSPFTGICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQS  219
            NI+L+G+     PPWKCSD SGAA  VSP  CSEL+  Q 
Sbjct  372  NINLHGS-----PPWKCSDISGAAHLVSPLQCSELSGAQQ  406



>gb|KHG27846.1| putative polygalacturonase [Gossypium arboreum]
Length=404

 Score =   329 bits (843),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 158/224 (71%), Positives = 190/224 (85%), Gaps = 1/224 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAPTDSPNTDGIDPDSSS+VCIEDS+ISTGDDLVAVKSGWDEYGI YGRPS  ITIRRV
Sbjct  177  ILAPTDSPNTDGIDPDSSSNVCIEDSFISTGDDLVAVKSGWDEYGIGYGRPSSHITIRRV  236

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV  VLAE+I + N G+G++IKTN+GRGG I+NIT S V+ME 
Sbjct  237  TGSSPFAGIAVGSETSGGVEHVLAENIVIYNSGIGVNIKTNIGRGGFIKNITVSQVFMEN  296

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             RTGI+IAGD G HPD +FNPNA+P V+ + +K++WG +V + G I+G+  +PFTNICLS
Sbjct  297  VRTGIKIAGDTGDHPDNRFNPNALPYVKGVTLKNIWGVKVQKAGSIQGLKNAPFTNICLS  356

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTR-DQSGAC  210
             I+L+G    R+PPWKCSD SGAA++VSPSPC++L+   QSG+C
Sbjct  357  KINLHGMTGPRSPPWKCSDVSGAAIEVSPSPCAQLSSPQQSGSC  400



>gb|KJB39697.1| hypothetical protein B456_007G026000 [Gossypium raimondii]
Length=446

 Score =   330 bits (846),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 190/224 (85%), Gaps = 1/224 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAPTDSPNTDGIDPDSSS+VCIEDS+ISTGDDLVAVKSGWDEYGIAYGRPS  ITIRRV
Sbjct  219  ILAPTDSPNTDGIDPDSSSNVCIEDSFISTGDDLVAVKSGWDEYGIAYGRPSSHITIRRV  278

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV  VLAE+I + N G+G++IKTN+GRGG I+NIT S V+ME 
Sbjct  279  TGSSPFAGIAVGSETSGGVEHVLAENIVIYNSGIGVNIKTNIGRGGFIKNITVSQVFMEN  338

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             RTGI+I GD G HPD QFNPNA+P V+ + +K++WG +V + G I+G+  +PFTNICLS
Sbjct  339  VRTGIKITGDTGDHPDNQFNPNALPYVKGVTLKNIWGVKVQKAGSIQGLKNAPFTNICLS  398

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTR-DQSGAC  210
             I+L+G    R+PPWKCSD SGAA++VSPSPC++L+   QSG+C
Sbjct  399  KINLHGMTGPRSPPWKCSDVSGAAIEVSPSPCAQLSSPQQSGSC  442



>gb|AIU50430.1| pectin lyase-like superfamily protein, partial [Populus trichocarpa]
Length=406

 Score =   328 bits (840),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 184/216 (85%), Gaps = 5/216 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYGRPS  ITIRR+
Sbjct  192  ILAPLDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSSDITIRRI  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPF+GIAVGSETSGGV +VL E++ L NMGVGIHIKTN+GRGG I+NIT ++VYME 
Sbjct  252  TGSSPFSGIAVGSETSGGVKNVLVENVNLYNMGVGIHIKTNIGRGGFIKNITVTDVYMEN  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVG HPD+ FNPNA+P+V  I +K +WGE+V QPG I+G+  SPFT ICLS
Sbjct  312  VRKGIKIAGDVGDHPDDSFNPNALPVVYGITLKSIWGEKVQQPGSIQGLKNSPFTGICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            NI+L+G+      PWKCSD SG+A+ VSP PCSELT
Sbjct  372  NINLHGSS-----PWKCSDVSGSALLVSPWPCSELT  402



>gb|AIU50410.1| pectin lyase-like superfamily protein, partial [Carica papaya]
Length=405

 Score =   327 bits (838),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 187/215 (87%), Gaps = 5/215 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAPTDSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYGRPS GITIRR+
Sbjct  191  ILAPTDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSFGITIRRI  250

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGGV +VLAEHI L +MGVGI++KTN+GRGG+I NIT S+VYME 
Sbjct  251  TGSSPFAGIAIGSETSGGVLNVLAEHINLFDMGVGINVKTNIGRGGVIENITISDVYMEN  310

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             RTG++IAGD G HPD++FNPNA+P+V+ I IK+VWG +V + G I G+  SPFT ICL+
Sbjct  311  VRTGLKIAGDTGDHPDDKFNPNALPVVKGITIKNVWGVKVQRAGSILGLKDSPFTGICLA  370

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            N++L+G     +P WKCSD SGAA++VSP PCSEL
Sbjct  371  NVNLHG-----DPTWKCSDVSGAALKVSPWPCSEL  400



>ref|XP_007146299.1| hypothetical protein PHAVU_006G028800g [Phaseolus vulgaris]
 gb|ESW18293.1| hypothetical protein PHAVU_006G028800g [Phaseolus vulgaris]
Length=456

 Score =   328 bits (842),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 159/223 (71%), Positives = 187/223 (84%), Gaps = 0/223 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDG+DPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYGRPS GITIRR+
Sbjct  232  ILAPRDSPNTDGVDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSSGITIRRL  291

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV +VLAE+I L NMGVGIHIKTN GRGG I+NIT ++VY+E 
Sbjct  292  TGSSPFAGIAVGSETSGGVENVLAENINLFNMGVGIHIKTNKGRGGFIKNITVAHVYVEN  351

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVGGHPDE++NP+A+P+V+ I I++VWG +V + G I G+  SPFT++CLS
Sbjct  352  ARQGIKIAGDVGGHPDEKYNPDALPVVKGITIRNVWGVKVNRAGLINGLKNSPFTDVCLS  411

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQSGAC  210
             I+ +G    R P WKCSD SG A QVSP PCS+L   + G+C
Sbjct  412  VINFHGMAGSRAPNWKCSDVSGFAYQVSPWPCSQLHSQEPGSC  454



>ref|XP_010676306.1| PREDICTED: probable polygalacturonase [Beta vulgaris subsp. vulgaris]
Length=441

 Score =   328 bits (840),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 150/223 (67%), Positives = 189/223 (85%), Gaps = 2/223 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSY+STGDD+VA+KSGWDEYG+A+GRPS  ITIRR+
Sbjct  217  ILAPVDSPNTDGIDPDSSSNVCIEDSYVSTGDDMVAIKSGWDEYGLAFGRPSSDITIRRI  276

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPF+GIA+GSE SGGV +VLAEHI L NMGVGIH+KT VGRGG IRNIT +N+Y++ 
Sbjct  277  TGSSPFSGIAIGSEMSGGVENVLAEHINLFNMGVGIHLKTKVGRGGYIRNITVANIYIKN  336

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             + G++I+GDVG H D++F+P AIP+VQDI++K +WGE + QPG ++GI  +PFTNICLS
Sbjct  337  AKKGVKISGDVGDHADDKFDPKAIPVVQDIRMKSIWGENIQQPGLVKGIKNAPFTNICLS  396

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQSGAC  210
            +I+L G+  LR  PW+CSD  G++++VSP PCSEL    SG+C
Sbjct  397  DINLYGSFKLRTRPWECSDVEGSSLEVSPWPCSELL--SSGSC  437



>ref|XP_003617307.1| Glycoside hydrolase family 28 protein [Medicago truncatula]
 gb|AET00266.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=450

 Score =   325 bits (834),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 158/232 (68%), Positives = 190/232 (82%), Gaps = 2/232 (1%)
 Frame = -1

Query  899  LLFDMSPILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSH  720
            ++   + ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYGR S 
Sbjct  215  VVIRFATILAPRDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGRSSS  274

Query  719  GITIRRVTGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITF  540
             ITIRRV+GSSPFAGIAVGSETSGGV ++LAEHI L NMG+GIHIKTN+GRGG I+NI  
Sbjct  275  NITIRRVSGSSPFAGIAVGSETSGGVENILAEHINLYNMGIGIHIKTNIGRGGYIKNINV  334

Query  539  SNVYMEKTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSP  360
            SNVY+E  R GI+I+GDVG H D++++ NA+PIV+ I + +VWG +VLQ G I+G+  SP
Sbjct  335  SNVYIENARKGIKISGDVGDHADDKYDSNALPIVKGITMANVWGVKVLQAGLIKGMKHSP  394

Query  359  FTNICLSNIHLNGAKSLRN--PPWKCSDASGAAVQVSPSPCSELTRDQSGAC  210
            FT+ICLS+I+L+G    R+  P W+CSD SG A+QVSP PCSEL   Q G+C
Sbjct  395  FTDICLSDINLHGVNGTRSRTPSWQCSDVSGVALQVSPWPCSELISHQLGSC  446



>gb|AIU50427.1| pectin lyase-like superfamily protein, partial [Erythranthe guttata]
Length=406

 Score =   323 bits (829),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 157/219 (72%), Positives = 185/219 (84%), Gaps = 5/219 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWD+YGI+Y RPS GITIRR+
Sbjct  192  ILAPADSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDQYGISYNRPSQGITIRRL  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV DV+AEHI LSNMG+GIH+KTN+GRGG+IRNI+ SNVYM K
Sbjct  252  TGSSPFAGIAVGSETSGGVADVIAEHINLSNMGIGIHLKTNIGRGGVIRNISISNVYMYK  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+I+GDVG HPDE ++ NA+P+++D+ IKDV G+ V QPG I G+ K+PF+ ICLS
Sbjct  312  ARKGIKISGDVGDHPDENYDRNALPVLKDVVIKDVSGDFVQQPGLIHGLKKAPFSGICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQ  222
            N+ L G     +  W+CSD SG AV+VSP PC+ELT  Q
Sbjct  372  NVSLGG-----DSGWQCSDVSGGAVRVSPLPCAELTSSQ  405



>gb|AIU50446.1| pectin lyase-like superfamily protein, partial [Platanus x acerifolia]
Length=406

 Score =   323 bits (829),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 184/215 (86%), Gaps = 5/215 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP+DSPNTDGIDPDSSS+VCIEDSYI+TGDDLVAVKSGWDEYGIAYGR S GITIRR+
Sbjct  192  VLAPSDSPNTDGIDPDSSSNVCIEDSYIATGDDLVAVKSGWDEYGIAYGRRSSGITIRRI  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGGV + LAE+I L N G+GIH+KTNVGRGG+I+NIT S+V+ME 
Sbjct  252  TGSSPFAGIAIGSETSGGVENFLAENINLYNTGIGIHLKTNVGRGGVIKNITISDVFMEN  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GIRIAGDVG HPD+ FNPNA+P+V+ + IK+VWG +V QPG I+GI  SPFT ICLS
Sbjct  312  VRKGIRIAGDVGDHPDDYFNPNALPVVKGVTIKNVWGVKVQQPGSIQGIKNSPFTRICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            NI+L+G       PWKCSD SGAA+ V+P PCSEL
Sbjct  372  NINLHGTT-----PWKCSDVSGAAIGVNPWPCSEL  401



>ref|XP_010925748.1| PREDICTED: probable polygalacturonase [Elaeis guineensis]
 ref|XP_010925749.1| PREDICTED: probable polygalacturonase [Elaeis guineensis]
Length=441

 Score =   323 bits (829),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 162/224 (72%), Positives = 183/224 (82%), Gaps = 3/224 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVA+KSGWDEYGIAYGRPS GITIRR+
Sbjct  216  VLAPLDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAIKSGWDEYGIAYGRPSSGITIRRL  275

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPF+GIA+GSE SGGV +VL E+I+L N G+GIHIKTNVGRGG IRNITFS+V M K
Sbjct  276  TGSSPFSGIAIGSEASGGVENVLVENISLFNTGIGIHIKTNVGRGGYIRNITFSDVNMNK  335

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G+RIAGDVG HPDE+FNP AIP V D+ IK+VWG  V QPG I GI  SPFT ICL 
Sbjct  336  VRKGVRIAGDVGDHPDEKFNPYAIPTVDDVTIKNVWGTNVQQPGSIEGIKTSPFTRICLF  395

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTR-DQSGAC  210
            N+ L G    +N PWKC+  SGAA+ V P PC+ELTR  +SG C
Sbjct  396  NVKLWGGP--QNTPWKCAAVSGAALGVQPWPCTELTRTSESGFC  437



>ref|XP_004143871.1| PREDICTED: probable polygalacturonase [Cucumis sativus]
 gb|KGN50025.1| hypothetical protein Csa_5G150430 [Cucumis sativus]
Length=445

 Score =   324 bits (830),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 185/224 (83%), Gaps = 1/224 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDG+DPDSS++VCIEDSYISTGDDLVAVKSGWDEYGIAYGR S+ ITIRR+
Sbjct  218  ILAPRDSPNTDGVDPDSSNNVCIEDSYISTGDDLVAVKSGWDEYGIAYGRCSYDITIRRI  277

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            +GSSPFAG+AVGSE SGGV +VLAEH+   +MGVGI+IKTN+GRGG I+NIT SNVYME 
Sbjct  278  SGSSPFAGVAVGSEASGGVANVLAEHLNFYDMGVGINIKTNIGRGGFIKNITVSNVYMEN  337

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
            +R G++IAGD G HPD++F+PNA+PIV+DI IK++WG  V Q G I G+  SPFT ICLS
Sbjct  338  SRKGLKIAGDAGDHPDDKFDPNALPIVKDITIKNIWGVNVQQAGSIYGLRDSPFTGICLS  397

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTR-DQSGAC  210
            NI+L GA   R+ PW CS  SGAA  VSP PCSELT  DQ G C
Sbjct  398  NINLRGATRPRSVPWTCSYVSGAASLVSPWPCSELTSTDQDGLC  441



>ref|XP_008437386.1| PREDICTED: probable polygalacturonase [Cucumis melo]
Length=445

 Score =   323 bits (829),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 157/224 (70%), Positives = 185/224 (83%), Gaps = 1/224 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDG+DPDSS++VCIEDSYISTGDDLVAVKSGWDEYGIAYGR S+ ITIRR+
Sbjct  218  ILAPRDSPNTDGVDPDSSNNVCIEDSYISTGDDLVAVKSGWDEYGIAYGRSSYDITIRRI  277

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            +GSSPFAG+AVGSETSGGV +VLAEH+   +MGVGI+IKTN+GRGG I+NIT SNVYME 
Sbjct  278  SGSSPFAGVAVGSETSGGVANVLAEHLNFYDMGVGINIKTNIGRGGFIKNITVSNVYMEN  337

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
            +R G++IAGD G HPD++F+PNA+PIV+DI IK+ WG +V Q G I G+  SPFT ICLS
Sbjct  338  SRKGLKIAGDTGDHPDDKFDPNALPIVKDITIKNAWGVKVQQAGSIYGLRDSPFTGICLS  397

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTR-DQSGAC  210
            NI+  G    R+ PW CS  SGAA+ VSP PCSELT  +Q G C
Sbjct  398  NINFRGTTRPRSVPWTCSYVSGAALMVSPWPCSELTSTEQDGLC  441



>gb|AIU50433.1| pectin lyase-like superfamily protein, partial [Phaseolus vulgaris]
Length=406

 Score =   321 bits (822),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/219 (72%), Positives = 183/219 (84%), Gaps = 5/219 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYG PS  ITIRRV
Sbjct  192  ILAPRDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGLPSSNITIRRV  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            +GSSPFAGIA+GSETSGGV +VLAEHI L  MG+GIHIKTN GRGG I+NIT S+VYME 
Sbjct  252  SGSSPFAGIAIGSETSGGVENVLAEHINLYKMGIGIHIKTNSGRGGFIKNITVSHVYMED  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GIRI+GDVG HPD++F+PNA+PIV+ + +K+VWG +VLQ G I+G+  SPF++ICL 
Sbjct  312  ARKGIRISGDVGDHPDDKFDPNALPIVKGVTMKNVWGVKVLQAGLIQGVKNSPFSDICLY  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQ  222
            +I+L G      PPWKCSD SG A QVSP PCSEL+ + 
Sbjct  372  DINLGGT-----PPWKCSDVSGFAHQVSPWPCSELSSNH  405



>gb|AIU50409.1| pectin lyase-like superfamily protein, partial [Gossypium raimondii]
Length=406

 Score =   320 bits (821),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 155/219 (71%), Positives = 185/219 (84%), Gaps = 5/219 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAPTDSPNTDGIDPDSSS+VCIEDS+ISTGDDLVAVKSGWDEYGIAYGRPS  ITIRRV
Sbjct  192  ILAPTDSPNTDGIDPDSSSNVCIEDSFISTGDDLVAVKSGWDEYGIAYGRPSSHITIRRV  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV  VLAE+I + N G+G++IKTN+GRGG I+NIT S V+ME 
Sbjct  252  TGSSPFAGIAVGSETSGGVEHVLAENIVIYNSGIGVNIKTNIGRGGFIKNITVSQVFMEN  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             RTGI+I GD G HPD QFNPNA+P V+ + +K++WG +V + G I+G+  +PFTNICLS
Sbjct  312  VRTGIKITGDTGDHPDNQFNPNALPYVKGVTLKNIWGVKVQKAGSIQGLKNAPFTNICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQ  222
             I+L+G+     PPWKCSD SGAA++VSPSPC++L+  Q
Sbjct  372  KINLHGS-----PPWKCSDVSGAAIEVSPSPCAQLSSPQ  405



>gb|AIU50404.1| pectin lyase-like superfamily protein, partial [Pinellia ternata]
Length=406

 Score =   320 bits (820),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 182/216 (84%), Gaps = 5/216 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP+DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYG+A+ RPS+GITIRR+
Sbjct  192  ILAPSDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGMAFRRPSYGITIRRI  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGG+ +VL E+I LSNMG+GIHIKTNVGRGG I+NIT S+V M  
Sbjct  252  TGSSPFAGIAVGSETSGGIENVLVENINLSNMGIGIHIKTNVGRGGYIKNITISDVNMNT  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
            TR G+RIAG+VG HPD+ +NPNA+P V  I IK+VWG  VLQPG I+GI  SPFT +CLS
Sbjct  312  TRKGLRIAGNVGDHPDDNYNPNAVPFVDGITIKNVWGVNVLQPGTIQGIKGSPFTRVCLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            N+ L G       PWKC+D SGAA++V P PCSELT
Sbjct  372  NVKLWGEV-----PWKCTDVSGAALEVQPWPCSELT  402



>gb|KJB24230.1| hypothetical protein B456_004G134000 [Gossypium raimondii]
Length=448

 Score =   321 bits (823),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/224 (68%), Positives = 183/224 (82%), Gaps = 1/224 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDS+ISTGDDLVAVKSGWDEYGIAYGRPS  IT+RRV
Sbjct  221  ILAPPDSPNTDGIDPDSSSNVCIEDSFISTGDDLVAVKSGWDEYGIAYGRPSSYITVRRV  280

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGS+PFAG+AVGSETSGGV +VLAE+I L N GVG+HIKTN+GRGG+I+NIT S ++ME 
Sbjct  281  TGSTPFAGVAVGSETSGGVENVLAENINLYNSGVGVHIKTNIGRGGVIKNITVSELFMEN  340

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             RTGI++AGD G HPD  FNPNA+P V+D+ +K++WG  V + GW+ GI  + FT ICLS
Sbjct  341  VRTGIKVAGDTGDHPDNNFNPNALPYVKDLMLKNIWGVNVQRAGWMHGIENATFTGICLS  400

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTR-DQSGAC  210
            N+ L G    R P W C+   GAA++VSP PC+ELT  +QSG+C
Sbjct  401  NVTLQGTTGPRPPSWNCNAIRGAAIEVSPRPCAELTSVEQSGSC  444



>ref|XP_007040496.1| Pectin lyase-like superfamily protein [Theobroma cacao]
 gb|EOY24997.1| Pectin lyase-like superfamily protein [Theobroma cacao]
Length=448

 Score =   319 bits (818),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/224 (69%), Positives = 186/224 (83%), Gaps = 1/224 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDS+ISTGDDLVAVKSGWDEYGIAYGRPS  ITIRRV
Sbjct  221  ILAPPDSPNTDGIDPDSSSNVCIEDSFISTGDDLVAVKSGWDEYGIAYGRPSSCITIRRV  280

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TG+SPF+GIAVGSETSGGV +VLAE+I L N G+G+++KTN+GRGG I+NIT S V+ME 
Sbjct  281  TGTSPFSGIAVGSETSGGVENVLAENIVLYNTGIGVNVKTNIGRGGFIKNITVSEVFMEN  340

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             RTGI+IAGD G HPD  FNPNA+P V+ +  K++WG +V + G I+G+  +PFT ICLS
Sbjct  341  VRTGIKIAGDTGDHPDNNFNPNALPYVKGVTFKNIWGVKVQRAGSIQGLKNAPFTGICLS  400

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTR-DQSGAC  210
             ++L+G     +PPWKCSD SGAA++VSP PC+ELT   QSG+C
Sbjct  401  KVNLHGTTGPGSPPWKCSDVSGAAIEVSPWPCAELTSPQQSGSC  444



>gb|AIU50416.1| pectin lyase-like superfamily protein, partial [Buxus sinica]
Length=406

 Score =   317 bits (813),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 154/216 (71%), Positives = 179/216 (83%), Gaps = 5/216 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDS S VCIEDSYI+TGDD+VAVKSGWDEYGIA+GRPS  ITIRR+
Sbjct  192  ILAPYDSPNTDGIDPDSCSDVCIEDSYIATGDDMVAVKSGWDEYGIAFGRPSSSITIRRI  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGGV ++LAE+I L N+GVGIH+KTN+GRGG IRNIT S+VYME 
Sbjct  252  TGSSPFAGIAIGSETSGGVENILAENINLYNIGVGIHVKTNIGRGGFIRNITVSDVYMEN  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVG HPD++FNPNA+P+V  I I+ VWG +V QPG I+G+  SPFT ICLS
Sbjct  312  ARKGIKIAGDVGDHPDDKFNPNALPVVNGITIRRVWGVKVQQPGLIQGLKNSPFTGICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            NI+L+G       PWKCSD SG A+ V P PCS+ T
Sbjct  372  NINLHGGT-----PWKCSDVSGTAIVVKPWPCSQFT  402



>gb|AIU50407.1| pectin lyase-like superfamily protein, partial [Sarcandra glabra]
Length=406

 Score =   317 bits (812),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 179/215 (83%), Gaps = 5/215 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDS S+VCIED YISTGDDLVAVKSGWDEYGIAYGRPS  ITIRR+
Sbjct  192  ILAPQDSPNTDGIDPDSCSNVCIEDCYISTGDDLVAVKSGWDEYGIAYGRPSSYITIRRL  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGG+ +VLAEHI + N GVGIH+KTNVGRGG+IRNITF++VYME 
Sbjct  252  TGSSPFAGIAIGSETSGGIENVLAEHINIFNSGVGIHLKTNVGRGGVIRNITFTDVYMEN  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVG HPD++FNPNA+P V  + I++VWG  + QPG ++G+  SPFT ICLS
Sbjct  312  VRKGIKIAGDVGDHPDDKFNPNALPTVDGVTIRNVWGVNIQQPGSMQGLKNSPFTRICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            N++L G       PWKCSD SG+A+ V P PCSEL
Sbjct  372  NVNLRGGT-----PWKCSDVSGSALGVHPWPCSEL  401



>gb|AIU50424.1| pectin lyase-like superfamily protein, partial [Medicago truncatula]
Length=406

 Score =   317 bits (811),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 155/226 (69%), Positives = 185/226 (82%), Gaps = 5/226 (2%)
 Frame = -1

Query  899  LLFDMSPILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSH  720
            ++   + ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAYGR S 
Sbjct  185  VVIRFATILAPRDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYGRSSS  244

Query  719  GITIRRVTGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITF  540
             ITIRRV+GSSPFAGIAVGSETSGGV ++LAEHI L NMG+GIHIKTN+GRGG I+NI  
Sbjct  245  NITIRRVSGSSPFAGIAVGSETSGGVENILAEHINLYNMGIGIHIKTNIGRGGYIKNINV  304

Query  539  SNVYMEKTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSP  360
            SNVY+E  R GI+I+GDVG H D++++ NA+PIV+ I + +VWG +VLQ G I+G+  SP
Sbjct  305  SNVYIENARKGIKISGDVGDHADDKYDSNALPIVKGITMANVWGVKVLQAGLIKGMKHSP  364

Query  359  FTNICLSNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQ  222
            FT+ICLS+I+L+G      P W+CSD SG A+QVSP PCSEL   Q
Sbjct  365  FTDICLSDINLHGT-----PSWQCSDVSGVALQVSPWPCSELISHQ  405



>gb|KHG21610.1| putative polygalacturonase [Gossypium arboreum]
Length=448

 Score =   318 bits (814),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 150/224 (67%), Positives = 182/224 (81%), Gaps = 1/224 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            I+AP DSPNTDGIDPDSSS+VCIEDS+ISTGDDLVAVKSGWDEYGIAYGRPS  IT+RRV
Sbjct  221  IVAPPDSPNTDGIDPDSSSNVCIEDSFISTGDDLVAVKSGWDEYGIAYGRPSSYITVRRV  280

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGS+PFAG+AVGSETSGGV +VLAE+I L N GVG+HIKTN+GRGG+I+NIT S ++ME 
Sbjct  281  TGSTPFAGVAVGSETSGGVENVLAENINLYNSGVGVHIKTNIGRGGVIKNITVSELFMEN  340

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             RTGI++AGD G HPD  FNPNA+P V+D+ +K++WG  V + GW+ GI  + FT ICLS
Sbjct  341  VRTGIKVAGDTGDHPDNNFNPNALPYVKDLTLKNIWGVNVQRAGWMHGIENATFTGICLS  400

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTR-DQSGAC  210
            N+ L G    R P W C+   GAA++VSP PC+EL   +QSG+C
Sbjct  401  NVTLQGTTGPRPPSWNCNAIRGAAIEVSPRPCAELASVEQSGSC  444



>gb|AIU50418.1| pectin lyase-like superfamily protein, partial [Chloranthus japonicus]
Length=406

 Score =   313 bits (802),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 178/215 (83%), Gaps = 5/215 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIED YISTGDDLVAVKSGWDEYGIAYGRPS  ITIRR+
Sbjct  192  ILAPPDSPNTDGIDPDSSSNVCIEDCYISTGDDLVAVKSGWDEYGIAYGRPSSHITIRRL  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGG+ +VLAEH+ + N G+GIH+KTN GRGG+I+NIT ++VYME 
Sbjct  252  TGSSPFAGIAIGSETSGGIENVLAEHVNIFNCGIGIHVKTNAGRGGVIQNITVTDVYMEN  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GIRIAGDVG HPD++FNPNA+PIV  + I +VWG  V QPG ++GI  SPFT ICLS
Sbjct  312  VRKGIRIAGDVGDHPDDKFNPNALPIVDGVTIGNVWGVNVQQPGSMQGIKNSPFTRICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            N++L G       PWKCSD SG+A+ V P PC+EL
Sbjct  372  NVNLRGGT-----PWKCSDVSGSALGVHPWPCAEL  401



>gb|AIU50422.1| pectin lyase-like superfamily protein, partial [Asparagus officinalis]
Length=406

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 177/216 (82%), Gaps = 5/216 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYI+TGDDLVA+KSGWDEYGIAYGRPS GITIRRV
Sbjct  192  ILAPHDSPNTDGIDPDSSSNVCIEDSYIATGDDLVAIKSGWDEYGIAYGRPSSGITIRRV  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV +V  E+IT+ N G GIHIKTNVGRGG IRNIT ++V M +
Sbjct  252  TGSSPFAGIAVGSETSGGVENVWIENITIFNSGFGIHIKTNVGRGGYIRNITITDVKMTE  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G+RIAGDVG HPD++FNPNA+P V  + IK+VWGE+V QPG I+GI  SPFT ICL 
Sbjct  312  VRYGLRIAGDVGDHPDDKFNPNALPAVSGLMIKNVWGEEVQQPGLIKGIKNSPFTGICLY  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            N+ L     L   PWKC+D SG+A+ V P  CSELT
Sbjct  372  NVKL-----LNEVPWKCTDVSGSALVVQPGACSELT  402



>gb|AIU50423.1| pectin lyase-like superfamily protein, partial [Aristolochia 
tagala]
Length=406

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 152/220 (69%), Positives = 182/220 (83%), Gaps = 5/220 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDS+I+TGDDLVAVKSGWDEYGIAYGRPS GITIRR+
Sbjct  192  ILAPYDSPNTDGIDPDSSSNVCIEDSFIATGDDLVAVKSGWDEYGIAYGRPSDGITIRRL  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TG++PFAGIAVGSETSGGV +V+AEH+ L N GVGIH+KTN+GRGG+I+NIT S++YM++
Sbjct  252  TGTTPFAGIAVGSETSGGVMNVVAEHVNLFNSGVGIHLKTNIGRGGVIKNITCSDIYMDR  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVG HPD  +NPNA+P V  + +K++WG  VLQ G ++G+  SPFT ICLS
Sbjct  312  VRKGIKIAGDVGDHPDNGYNPNALPRVDGVTLKNIWGVNVLQAGSLQGLKGSPFTRICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQS  219
            N++L+GA S     WKC D SGAA  V PSPC EL   QS
Sbjct  372  NVNLSGAVS-----WKCGDISGAAQLVHPSPCQELITSQS  406



>gb|AIU50405.1| pectin lyase-like superfamily protein, partial [Theobroma cacao]
Length=406

 Score =   312 bits (799),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 151/220 (69%), Positives = 182/220 (83%), Gaps = 5/220 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDS+ISTGDDLVAVKSGWDEYGIAYGRPS  ITIRRV
Sbjct  192  ILAPPDSPNTDGIDPDSSSNVCIEDSFISTGDDLVAVKSGWDEYGIAYGRPSSCITIRRV  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TG+SPF+GIAVGSETSGGV +VLAE+I L N G+G+++KTN+GRGG I+NIT S V+ME 
Sbjct  252  TGTSPFSGIAVGSETSGGVENVLAENIVLYNTGIGVNVKTNIGRGGFIKNITVSEVFMEN  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             RTGI+IAGD G HPD  FNPNA+P V+ +  K++WG +V + G I+G+  +PFT ICLS
Sbjct  312  VRTGIKIAGDTGDHPDNNFNPNALPYVKGVTFKNIWGVKVQRAGSIQGLKNAPFTGICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQS  219
             ++L+G+     PPWKCSD SGAA++VSP PC+ELT  Q 
Sbjct  372  KVNLHGS-----PPWKCSDVSGAAIEVSPWPCAELTSPQQ  406



>ref|XP_010541559.1| PREDICTED: probable polygalacturonase isoform X2 [Tarenaya hassleriana]
Length=446

 Score =   312 bits (799),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 180/215 (84%), Gaps = 1/215 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIA+GRPS  ITIRR+
Sbjct  220  ILAPPDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAFGRPSSNITIRRI  279

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGG+ ++LA+HITLSNMGVG++IKTN+GRGG I+NI  S+VY+E 
Sbjct  280  TGSSPFAGIAIGSETSGGIKNILAQHITLSNMGVGVNIKTNIGRGGFIQNIRISDVYVEN  339

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGD G HPD  +NPNA+PIV+ IKI +VWG  VL  G IRG+  SPFT ICLS
Sbjct  340  ARYGIKIAGDTGDHPDGNYNPNALPIVKGIKINNVWGVNVLNAGSIRGLKGSPFTGICLS  399

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
             I+L+G  +   P WKCSD  G +++VSP PCSEL
Sbjct  400  EINLHGRWN-SYPTWKCSDVIGTSLKVSPWPCSEL  433



>gb|AIU50448.1| pectin lyase-like superfamily protein, partial [Houttuynia cordata]
Length=406

 Score =   310 bits (793),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 174/215 (81%), Gaps = 5/215 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS VCIEDSYI+TGDDLVAVKSGWDEYGIA+GRPS GITIRR+
Sbjct  192  ILAPYDSPNTDGIDPDSSSDVCIEDSYIATGDDLVAVKSGWDEYGIAFGRPSFGITIRRI  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGS+PFAGIA+GSE SGGV +V AEHI + N G+GIHIKTN GRGG I+NIT S+VYM+K
Sbjct  252  TGSTPFAGIAIGSEASGGVENVYAEHINILNSGIGIHIKTNTGRGGTIKNITVSDVYMDK  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+I+G+VG HPD  +NPNA+PIV  I IKDVWG  V Q G ++GI  SPFT ICLS
Sbjct  312  VRKGIKISGNVGDHPDNGYNPNALPIVDGITIKDVWGMNVEQAGSMQGIKNSPFTRICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            N+ L G        W+C D SGAA+QV PSPCSEL
Sbjct  372  NVKLFGGMM-----WQCGDISGAALQVKPSPCSEL  401



>ref|XP_008790157.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
 ref|XP_008790230.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
Length=442

 Score =   311 bits (796),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/224 (69%), Positives = 181/224 (81%), Gaps = 3/224 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP+DSPNTDGIDPDSSS+VCIEDSYISTGDDLVA+KSGWDEYGIAYG PS GITIRR+
Sbjct  217  VLAPSDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAIKSGWDEYGIAYGHPSSGITIRRL  276

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPF+GIA+GSE SGGV +VL E+I+L N G+GIHIKTNVGRGG IRNITF++V M  
Sbjct  277  TGSSPFSGIAIGSEASGGVENVLVENISLFNTGIGIHIKTNVGRGGYIRNITFADVNMNN  336

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G+RIAGDVG HPD++FNP AIP+V  + IK+VWG  V QPG I GI  SPFT ICL 
Sbjct  337  VRKGVRIAGDVGDHPDDKFNPYAIPVVDKVTIKNVWGINVQQPGSIEGIKTSPFTRICLF  396

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT-RDQSGAC  210
            N+ L G    +N PW+C+  SGAA+ V P PC+ELT   +SG C
Sbjct  397  NVKLWGRP--QNTPWECTAVSGAALGVQPWPCAELTGNSESGFC  438



>ref|NP_199002.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
 dbj|BAB10662.1| polygalacturonase-like protein [Arabidopsis thaliana]
 gb|AAT85725.1| At5g41870 [Arabidopsis thaliana]
 gb|AED94738.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
Length=449

 Score =   311 bits (796),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 184/225 (82%), Gaps = 4/225 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAPTDS NTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAY RPS  ITIRR+
Sbjct  223  ILAPTDSYNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYNRPSRDITIRRI  282

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGG+ +V  E+ITL N G+GIHIKTN+GRGG I+ IT S VY+EK
Sbjct  283  TGSSPFAGIAIGSETSGGIQNVTVENITLYNSGIGIHIKTNIGRGGSIQGITISGVYLEK  342

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             RTGI+I+GD G HPD++FN +A+PIV+ I IK+VWG +V + G ++G+  SPFTN+C S
Sbjct  343  VRTGIKISGDTGDHPDDKFNTSALPIVRGITIKNVWGIKVERAGMVQGLKDSPFTNLCFS  402

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL--TRDQSGAC  210
            N+ L G K  R+P WKCSD  GAA +V+P+PC EL  T  Q G+C
Sbjct  403  NVTLTGTK--RSPIWKCSDVVGAADKVNPTPCPELSATTQQGGSC  445



>ref|XP_009404468.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
 ref|XP_009404469.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=443

 Score =   310 bits (795),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 150/216 (69%), Positives = 179/216 (83%), Gaps = 3/216 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP+DSPNTDGIDPDSSS+VCIEDS+++TGDDLVAVKSGWDEYGIAYGRPS GIT+RR+
Sbjct  219  VLAPSDSPNTDGIDPDSSSNVCIEDSFVATGDDLVAVKSGWDEYGIAYGRPSSGITVRRL  278

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPF+GIA+GSETSGGV +VL E+I L ++G+GIHIKTNVGRGG IRNIT S+V M  
Sbjct  279  TGSSPFSGIAIGSETSGGVENVLVENINLYDVGIGIHIKTNVGRGGYIRNITISDVNMNN  338

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R  IRIAGDVG HPDE F+PNA+P V  + IK+VWGE+V QPG I GI  SPFT +CLS
Sbjct  339  VRKAIRIAGDVGDHPDENFDPNAVPTVDGVTIKNVWGEEVEQPGSIEGIKNSPFTRVCLS  398

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            N+ L G  +    PWKC+D +GAA+ V+P PC +LT
Sbjct  399  NVKLWGVGA---SPWKCTDVTGAALGVNPGPCPQLT  431



>ref|XP_010913844.1| PREDICTED: probable polygalacturonase isoform X2 [Elaeis guineensis]
Length=349

 Score =   307 bits (786),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/216 (70%), Positives = 172/216 (80%), Gaps = 1/216 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP DSPNTDGIDPDSS +VCIED YISTGDDLVAVKSGWDEYG+AY RPS GITIRR+
Sbjct  123  VLAPYDSPNTDGIDPDSSLNVCIEDCYISTGDDLVAVKSGWDEYGMAYARPSSGITIRRL  182

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV +VL E I + N G+GIHIKTN GRGG IRNIT S V +  
Sbjct  183  TGSSPFAGIAVGSETSGGVENVLVESIHIYNTGIGIHIKTNSGRGGYIRNITVSGVNLSN  242

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R  +RIAGDVG HPD+ +NPNA+PIV  + IKDVWG  + QPG I GI  SPFT +CLS
Sbjct  243  VRKALRIAGDVGDHPDDMYNPNALPIVNGLTIKDVWGVDIQQPGSIDGIKNSPFTGVCLS  302

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            N+ LNG  + R  PWKC+D SG A+ V PSPC+ELT
Sbjct  303  NVKLNGDGT-REVPWKCADVSGGALGVQPSPCTELT  337



>ref|XP_010053124.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 ref|XP_010053125.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 gb|KCW77376.1| hypothetical protein EUGRSUZ_D01730 [Eucalyptus grandis]
Length=449

 Score =   310 bits (795),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 150/215 (70%), Positives = 177/215 (82%), Gaps = 0/215 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDS+IS GDDLV+VKSGWDEYGI YGR S GITIRR+
Sbjct  220  ILAPYDSPNTDGIDPDSSSNVCIEDSHISVGDDLVSVKSGWDEYGIRYGRRSSGITIRRI  279

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGI+VGSETSGGV +V  E+I L N+G+GIHIKTN+GRGG IR+IT SNV+ME 
Sbjct  280  TGSSPFAGISVGSETSGGVENVWIENINLYNVGIGIHIKTNIGRGGFIRDITVSNVFMEN  339

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GIRI G+VG HPDE +NP+A+P V+ I+IKDVWG +V + G I+G+  +PFT ICLS
Sbjct  340  VRKGIRIMGNVGDHPDEYYNPSALPYVKGIRIKDVWGVKVQEAGLIQGLKNAPFTGICLS  399

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            NI+L+G    R   W CSD SGAA++VSP  CSEL
Sbjct  400  NIYLHGVPGQRRATWTCSDVSGAALEVSPGVCSEL  434



>ref|XP_006283728.1| hypothetical protein CARUB_v10004799mg [Capsella rubella]
 gb|EOA16626.1| hypothetical protein CARUB_v10004799mg [Capsella rubella]
Length=448

 Score =   310 bits (794),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 182/225 (81%), Gaps = 4/225 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAPTDS NTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAY RPS  ITIRR+
Sbjct  222  ILAPTDSYNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYNRPSRDITIRRI  281

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGG+ ++  E+ITL N G+GIHIKTN+GRGG I+ IT S VY+EK
Sbjct  282  TGSSPFAGIAIGSETSGGIQNITVENITLYNSGIGIHIKTNIGRGGSIQGITISGVYLEK  341

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             RTGI+I+GD G HPD+ FNP A+PIV+ I IK+VWG +V + G ++G+  SPFTN+C S
Sbjct  342  VRTGIKISGDTGNHPDDNFNPTALPIVRGITIKNVWGIKVERAGMVQGLKDSPFTNLCFS  401

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL--TRDQSGAC  210
            N+ L G KS  +P WKCS   GAA +V+P+PC EL  T  Q G+C
Sbjct  402  NVTLTGTKS--SPIWKCSYVVGAANKVNPTPCPELTATTQQGGSC  444



>gb|AIU50400.1| pectin lyase-like superfamily protein, partial [Arabidopsis thaliana]
Length=406

 Score =   308 bits (790),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 180/215 (84%), Gaps = 5/215 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS +VCIEDSYISTGDDLVA+KSGWD+YGIAYGRPS  ITIRR+
Sbjct  192  ILAPQDSPNTDGIDPDSSYNVCIEDSYISTGDDLVAIKSGWDQYGIAYGRPSSNITIRRI  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGG+ +++AEHITLSNMGVG++IKTN+GRGG I+NI  S+VY++ 
Sbjct  252  TGSSPFAGIAIGSETSGGIKNIIAEHITLSNMGVGVNIKTNIGRGGYIKNIKISDVYVDT  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             + GI+IAGD G HPDE +NPNA+P+V+ I IK+VWG  V   G I+G+  SPFT ICLS
Sbjct  312  AKYGIKIAGDTGDHPDENYNPNALPVVKGIHIKNVWGVNVRNAGSIQGLKGSPFTGICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
             I+L+G K+     WKCSD SG +++VSP PCSEL
Sbjct  372  EINLHGYKT-----WKCSDVSGTSLKVSPWPCSEL  401



>ref|XP_009413832.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
 ref|XP_009413833.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=445

 Score =   309 bits (792),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 157/224 (70%), Positives = 177/224 (79%), Gaps = 2/224 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP DSPNTDGIDPDSSS+VCIED++ISTGDDLVAVKSGWDEYGIAYGRPS GITIRR+
Sbjct  219  VLAPHDSPNTDGIDPDSSSNVCIEDAHISTGDDLVAVKSGWDEYGIAYGRPSSGITIRRL  278

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPF+G+A+GSETSGGV +VL E++ L + G+GIHIKTNVGRGG +RNIT  NV M K
Sbjct  279  TGSSPFSGVAIGSETSGGVENVLVENVNLYDTGIGIHIKTNVGRGGFVRNITVVNVSMNK  338

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GIRIAGDVG HPDE F+  AIP V  I IK+VWG  V QPG I+GI  SPFT ICLS
Sbjct  339  VRKGIRIAGDVGDHPDEYFDRRAIPTVDGITIKNVWGVDVQQPGSIQGIKNSPFTRICLS  398

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRD-QSGAC  210
            N+ L G    R+ PWKC D SGAA+ V P PCS L R   SG C
Sbjct  399  NVKLWGVAK-RSAPWKCVDVSGAALGVQPWPCSALARTISSGYC  441



>gb|KJB39694.1| hypothetical protein B456_007G026000 [Gossypium raimondii]
Length=427

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 177/212 (83%), Gaps = 3/212 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAPTDSPNTDGIDPDSSS+VCIEDS+ISTGDDLVAVKSGWDEYGIAYGRPS  ITIRRV
Sbjct  219  ILAPTDSPNTDGIDPDSSSNVCIEDSFISTGDDLVAVKSGWDEYGIAYGRPSSHITIRRV  278

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV  VLAE+I + N G+G++IKTN+GRGG I+NIT S V+ME 
Sbjct  279  TGSSPFAGIAVGSETSGGVEHVLAENIVIYNSGIGVNIKTNIGRGGFIKNITVSQVFMEN  338

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             RTGI+I GD G HPD QFNPNA+P V+ + +K++WG +V + G I+G+  +PFTNICLS
Sbjct  339  VRTGIKITGDTGDHPDNQFNPNALPYVKGVTLKNIWGVKVQKAGSIQGLKNAPFTNICLS  398

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPC  243
             I+L+G    R+PPWKCSD SGAA++    PC
Sbjct  399  KINLHGMTGPRSPPWKCSDVSGAAIE---RPC  427



>gb|AIU50399.1| pectin lyase-like superfamily protein, partial [Arabidopsis lyrata]
Length=406

 Score =   307 bits (787),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/215 (70%), Positives = 179/215 (83%), Gaps = 5/215 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS +VCIEDSYISTGDDLVA+KSGWDEYGIAYGRPS  ITIRR+
Sbjct  192  ILAPQDSPNTDGIDPDSSYNVCIEDSYISTGDDLVAIKSGWDEYGIAYGRPSSNITIRRI  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGG+ +++AEHITLSNMGVG++IKTN+GRGG I+NI  S+VY++ 
Sbjct  252  TGSSPFAGIAIGSETSGGIKNIVAEHITLSNMGVGVNIKTNIGRGGYIKNIKISDVYIDT  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             + GI+IAGD G HPDE +NPNA+PIV+ I IK+VWG  V   G I+G+  SPFT ICLS
Sbjct  312  AKYGIKIAGDTGDHPDENYNPNALPIVKGIHIKNVWGVNVRNAGSIQGLKGSPFTGICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
             I+L+G K+     WKCSD  G +++VSP PCSEL
Sbjct  372  EINLHGYKT-----WKCSDVIGTSLKVSPWPCSEL  401



>gb|AIU50420.1| pectin lyase-like superfamily protein, partial [Chimonanthus 
praecox]
Length=406

 Score =   307 bits (786),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 183/216 (85%), Gaps = 5/216 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIED +I+TGDDLVAVKSGWDEYGI+YGRPS+ ITIRR+
Sbjct  192  ILAPHDSPNTDGIDPDSSSNVCIEDCFIATGDDLVAVKSGWDEYGISYGRPSYDITIRRL  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             GSSPFAG+A+GSE SGGV +V AE+ITL + GVGIH+KTN+GRGGIIRNIT ++V+M+ 
Sbjct  252  RGSSPFAGVAIGSEASGGVHNVFAENITLYDTGVGIHVKTNIGRGGIIRNITVTDVHMDN  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI++AGDVG HPD++FNPNA+P V  I +K++WG +V Q G I+G+  SPFT ICLS
Sbjct  312  VRKGIKVAGDVGDHPDDKFNPNALPTVDGITVKNMWGVKVQQAGSIQGLKDSPFTRICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            +I+L G+      PWKCSD +GAA++V+PSPC+ELT
Sbjct  372  SINLGGSS-----PWKCSDITGAALEVNPSPCAELT  402



>ref|XP_002868572.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44831.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=449

 Score =   308 bits (789),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 182/225 (81%), Gaps = 4/225 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAPTDS NTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAY  PS  ITIRR+
Sbjct  223  ILAPTDSFNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYNLPSRDITIRRI  282

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGG+ +V  E+ITL N G+GIHIKTN+GRGG I+ IT S VY+EK
Sbjct  283  TGSSPFAGIAIGSETSGGIQNVTVENITLYNSGIGIHIKTNIGRGGSIQGITISGVYLEK  342

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             RTGI+I+GD G HPD++FN +A+PIV+ I IK+VWG +V + G ++G+  SPFTN+C S
Sbjct  343  VRTGIKISGDTGDHPDDKFNTSALPIVRGITIKNVWGIKVERAGMVQGLKDSPFTNLCFS  402

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL--TRDQSGAC  210
            N+ L G KS   P WKCSD  GAA +V+P+PC EL  T  Q G+C
Sbjct  403  NVTLTGTKS--TPIWKCSDVVGAASKVNPTPCPELTTTTQQGGSC  445



>ref|XP_010055855.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 gb|KCW72401.1| hypothetical protein EUGRSUZ_E00853 [Eucalyptus grandis]
Length=451

 Score =   308 bits (789),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 176/216 (81%), Gaps = 0/216 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYIS GDD+V+VKSGWDEYGIAYGRPS  ITIRR+
Sbjct  224  ILAPVDSPNTDGIDPDSSSNVCIEDSYISVGDDVVSVKSGWDEYGIAYGRPSSNITIRRL  283

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSE SGG+ +VL E++ L  +G+GIH+KTN GRG  IRNIT S+VY+E 
Sbjct  284  TGSSPFAGIAIGSEMSGGIENVLVENVNLYKVGIGIHVKTNSGRGAFIRNITVSDVYVED  343

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+I+GDVG HPD+ ++PNA+P+V  I +KD+ G  V Q G IRGI  SPFT +CLS
Sbjct  344  ARKGIKISGDVGDHPDDGYDPNALPVVTGILVKDMRGTNVQQAGLIRGIKNSPFTGLCLS  403

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            N++L+G    R  PW CSD SGAA +VSPSPCSELT
Sbjct  404  NVNLHGKPGPREDPWSCSDVSGAAFKVSPSPCSELT  439



>ref|XP_010448653.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=444

 Score =   307 bits (787),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 148/215 (69%), Positives = 180/215 (84%), Gaps = 1/215 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS +VCIEDSYISTGDDLVA+KSGWD+YGIAYGRPS  ITIRR+
Sbjct  218  ILAPQDSPNTDGIDPDSSVNVCIEDSYISTGDDLVAIKSGWDQYGIAYGRPSSNITIRRI  277

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGG+ +++AEHITLSNMGVG++IKTN+GRGG I+NI  SNVY++ 
Sbjct  278  TGSSPFAGIAIGSETSGGIKNIVAEHITLSNMGVGVNIKTNIGRGGYIKNIKISNVYVDT  337

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             + GI+IAGD G HPD  +NPNA+P+V+ I IK+VWG  V + G I+G+  SPFT ICLS
Sbjct  338  AKYGIKIAGDTGDHPDANYNPNALPVVKGIHIKNVWGVNVRKAGSIQGLKGSPFTGICLS  397

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
             I+L+G+ +     WKCSD  G +++VSPSPCSEL
Sbjct  398  EINLHGSLNTYR-TWKCSDVIGTSLKVSPSPCSEL  431



>ref|NP_194113.1| glycoside hydrolase family 28 protein / polygalacturonase (pectinase) 
family protein [Arabidopsis thaliana]
 emb|CAA23048.1| putative polygalacturonase [Arabidopsis thaliana]
 emb|CAB81300.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AAL32775.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AAM91193.1| putative polygalacturonase [Arabidopsis thaliana]
 gb|AEE84810.1| glycoside hydrolase family 28 protein / polygalacturonase (pectinase) 
family protein [Arabidopsis thaliana]
Length=444

 Score =   307 bits (786),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 148/215 (69%), Positives = 180/215 (84%), Gaps = 1/215 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS +VCIEDSYISTGDDLVA+KSGWD+YGIAYGRPS  ITIRR+
Sbjct  218  ILAPQDSPNTDGIDPDSSYNVCIEDSYISTGDDLVAIKSGWDQYGIAYGRPSSNITIRRI  277

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGG+ +++AEHITLSNMGVG++IKTN+GRGG I+NI  S+VY++ 
Sbjct  278  TGSSPFAGIAIGSETSGGIKNIIAEHITLSNMGVGVNIKTNIGRGGYIKNIKISDVYVDT  337

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             + GI+IAGD G HPDE +NPNA+P+V+ I IK+VWG  V   G I+G+  SPFT ICLS
Sbjct  338  AKYGIKIAGDTGDHPDENYNPNALPVVKGIHIKNVWGVNVRNAGSIQGLKGSPFTGICLS  397

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
             I+L+G+ +     WKCSD SG +++VSP PCSEL
Sbjct  398  EINLHGSLN-SYKTWKCSDVSGTSLKVSPWPCSEL  431



>gb|AIU50437.1| pectin lyase-like superfamily protein, partial [Yucca filamentosa]
Length=406

 Score =   306 bits (783),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 173/215 (80%), Gaps = 5/215 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGI+YGRPS GITIRRV
Sbjct  192  ILAPYDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGISYGRPSSGITIRRV  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFA IAVGSETSGGV +VL E++ + N G GIHIKTNVGRGG IRNIT + V M  
Sbjct  252  TGSSPFAAIAVGSETSGGVENVLVENVNIFNSGFGIHIKTNVGRGGYIRNITITEVNMNN  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G+RIAGDVG HPD++F+PNAIP+V  + IK+VWG  V QPG I+GI  SPFT ICL 
Sbjct  312  VRKGLRIAGDVGDHPDDKFSPNAIPVVSGLTIKNVWGMNVQQPGSIQGIKNSPFTGICLY  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            N+ L+        PWKC+D SG+A+ V P PCSEL
Sbjct  372  NVKLSNEV-----PWKCTDVSGSALVVQPGPCSEL  401



>ref|XP_010924850.1| PREDICTED: probable polygalacturonase [Elaeis guineensis]
Length=448

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/216 (69%), Positives = 171/216 (79%), Gaps = 3/216 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP DSPNTDG+DPDSS HVCIED +ISTGDDL+AVKSGWDEYGIAY  PS  +T+RR+
Sbjct  224  VLAPYDSPNTDGVDPDSSLHVCIEDCFISTGDDLIAVKSGWDEYGIAYAHPSSDVTVRRL  283

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV +VLAE I + N  VGIHIKTN GRGG IRNIT S V M  
Sbjct  284  TGSSPFAGIAVGSETSGGVENVLAERIHIYNTSVGIHIKTNSGRGGYIRNITISGVNMNH  343

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G+RI GDVGGHPD+++NPNA+P+V  + IK+VWG  + QPG I GI  SPFT ICLS
Sbjct  344  VRNGLRIKGDVGGHPDDKYNPNALPVVDGLTIKNVWGVDIQQPGLIEGIKNSPFTRICLS  403

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            NI LNGA  +   PWKC D SG A +V PSPC+ELT
Sbjct  404  NITLNGAGDV---PWKCKDVSGGAHKVQPSPCTELT  436



>ref|XP_010913831.1| PREDICTED: probable polygalacturonase isoform X1 [Elaeis guineensis]
 ref|XP_010913836.1| PREDICTED: probable polygalacturonase isoform X1 [Elaeis guineensis]
 ref|XP_010913839.1| PREDICTED: probable polygalacturonase isoform X1 [Elaeis guineensis]
Length=450

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/216 (70%), Positives = 172/216 (80%), Gaps = 1/216 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP DSPNTDGIDPDSS +VCIED YISTGDDLVAVKSGWDEYG+AY RPS GITIRR+
Sbjct  224  VLAPYDSPNTDGIDPDSSLNVCIEDCYISTGDDLVAVKSGWDEYGMAYARPSSGITIRRL  283

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIAVGSETSGGV +VL E I + N G+GIHIKTN GRGG IRNIT S V +  
Sbjct  284  TGSSPFAGIAVGSETSGGVENVLVESIHIYNTGIGIHIKTNSGRGGYIRNITVSGVNLSN  343

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R  +RIAGDVG HPD+ +NPNA+PIV  + IKDVWG  + QPG I GI  SPFT +CLS
Sbjct  344  VRKALRIAGDVGDHPDDMYNPNALPIVNGLTIKDVWGVDIQQPGSIDGIKNSPFTGVCLS  403

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            N+ LNG  + R  PWKC+D SG A+ V PSPC+ELT
Sbjct  404  NVKLNGDGT-REVPWKCADVSGGALGVQPSPCTELT  438



>ref|XP_010439131.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=444

 Score =   306 bits (785),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 180/215 (84%), Gaps = 1/215 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS +VCIEDSYISTGDDLVA+KSGWD+YGIAYGRPS  ITIRR+
Sbjct  218  ILAPQDSPNTDGIDPDSSVNVCIEDSYISTGDDLVAIKSGWDQYGIAYGRPSSNITIRRI  277

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGG+ +++AEHITLSNMGVG++IKTN+GRGG I+NI  SNVY++ 
Sbjct  278  TGSSPFAGIAIGSETSGGIKNIVAEHITLSNMGVGVNIKTNIGRGGYIKNIKISNVYVDT  337

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             + GI+IAGD G HPD  +NPNA+P+V+ I IK+VWG  + + G I+G+  SPFT ICLS
Sbjct  338  AKYGIKIAGDTGDHPDANYNPNALPVVKGIHIKNVWGVNIRKAGSIQGLKGSPFTGICLS  397

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
             I+L+G+ +     WKCSD  G +++VSPSPCSEL
Sbjct  398  EINLHGSLNTYR-TWKCSDVIGTSLKVSPSPCSEL  431



>dbj|BAD61522.1| polygalacturonase-like [Oryza sativa Japonica Group]
Length=261

 Score =   300 bits (768),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 174/216 (81%), Gaps = 2/216 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP DSPNTDGIDPDSSS+VCIED YISTGDDL+A+KSGWDEYG+AYGRPS  ITIRR+
Sbjct  36   VLAPHDSPNTDGIDPDSSSNVCIEDCYISTGDDLIAIKSGWDEYGMAYGRPSSHITIRRI  95

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAG AVGSETSGGV  VLAEH+   + G GIHIKTN GRGG IRN+T S+V ++ 
Sbjct  96   TGSSPFAGFAVGSETSGGVEHVLAEHLNFFSSGFGIHIKTNTGRGGFIRNVTVSDVTLDS  155

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G+RIAGDVGGHPD++++ NA+P+V  + IK+V G+ + + G I+GI  S F+ ICLS
Sbjct  156  VRYGLRIAGDVGGHPDDRYDRNALPVVDGLTIKNVQGQNIREAGSIKGIATSAFSRICLS  215

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            N+ LNG  ++R  PWKC   SGAA+ V PSPC+ELT
Sbjct  216  NVKLNGGAAVR--PWKCEAVSGAALDVQPSPCTELT  249



>gb|KFK32989.1| hypothetical protein AALP_AA6G314900 [Arabis alpina]
Length=443

 Score =   306 bits (784),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 182/225 (81%), Gaps = 4/225 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAPTDSPNTDGIDPDS S+VCIED+YISTGDDLVAVKSGWDEYGIAY RPS  ITIRR+
Sbjct  217  ILAPTDSPNTDGIDPDSCSNVCIEDAYISTGDDLVAVKSGWDEYGIAYNRPSRDITIRRI  276

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGGV ++  E+ITL N G+GIHIKTN+GRGG I+ I  S V+MEK
Sbjct  277  TGSSPFAGIAIGSETSGGVQNITVENITLYNSGIGIHIKTNIGRGGSIQGIKISGVHMEK  336

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             RTGI+I+GD G HPD++FNP+A+P+V+ I IK++WG +V + G ++G+  SPFTN+C S
Sbjct  337  VRTGIKISGDTGDHPDDKFNPSALPVVRGITIKNIWGIKVERAGTVQGLKDSPFTNLCFS  396

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL--TRDQSGAC  210
            N+ L G K   +P WKCSD  G+ V+V+P+PC EL  T  Q G C
Sbjct  397  NVTLTGTKG--SPIWKCSDVVGSTVKVNPTPCPELTATAQQGGTC  439



>gb|AIU50421.1| pectin lyase-like superfamily protein, partial [Pandanus utilis]
Length=406

 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 173/216 (80%), Gaps = 5/216 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS VCIEDS+ISTGDDLVAVKSGWDEYGI YGRPS GITIRR+
Sbjct  192  ILAPYDSPNTDGIDPDSSSEVCIEDSFISTGDDLVAVKSGWDEYGIVYGRPSSGITIRRL  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             GSSPFAG+AVGSE SGGV +VL E++ + N G+GIHIKTN GRGG IRNIT S+V M K
Sbjct  252  AGSSPFAGVAVGSENSGGVENVLVENLNIFNSGLGIHIKTNTGRGGYIRNITISDVNMNK  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             + GIRI GDVG HPD++FNPNA+P+V  + IK+VWG  + QPG I+GI  SPFT ICLS
Sbjct  312  VQKGIRIVGDVGDHPDDKFNPNALPVVDGVTIKNVWGVDIEQPGSIQGIKDSPFTRICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            N+ L G       PWKC D SGAA++V P PC+ELT
Sbjct  372  NVKLWGEV-----PWKCDDVSGAALEVQPWPCTELT  402



>ref|XP_002867688.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43947.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=444

 Score =   306 bits (784),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 179/215 (83%), Gaps = 1/215 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS +VCIEDSYISTGDDLVA+KSGWDEYGIAYGRPS  ITIRR+
Sbjct  218  ILAPQDSPNTDGIDPDSSYNVCIEDSYISTGDDLVAIKSGWDEYGIAYGRPSSNITIRRI  277

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGG+ +++AEHITLSNMGVG++IKTN+GRGG I+NI  S+VY++ 
Sbjct  278  TGSSPFAGIAIGSETSGGIKNIVAEHITLSNMGVGVNIKTNIGRGGYIKNIKISDVYIDT  337

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             + GI+IAGD G HPDE +NPNA+PIV+ I IK+VWG  V   G I+G+  SPFT ICLS
Sbjct  338  AKYGIKIAGDTGDHPDENYNPNALPIVKGIHIKNVWGVNVRNAGSIQGLKGSPFTGICLS  397

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
             I+L+G+ +     WKCSD  G +++VSP PCSEL
Sbjct  398  EINLHGSLN-SYKTWKCSDVIGTSLKVSPWPCSEL  431



>ref|XP_010433858.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=444

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 180/215 (84%), Gaps = 1/215 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS +VCIEDS+ISTGDDLVA+KSGWD+YGIAYGRPS  ITIRR+
Sbjct  218  ILAPQDSPNTDGIDPDSSVNVCIEDSFISTGDDLVAIKSGWDQYGIAYGRPSSNITIRRI  277

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGG+ +++AEHITLSNMGVG++IKTN+GRGG I+NI  SNVY++ 
Sbjct  278  TGSSPFAGIAIGSETSGGIKNIVAEHITLSNMGVGVNIKTNIGRGGYIKNIKISNVYVDT  337

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             + GI+IAGD G HPD  +NPNA+P+V+ I IK+VWG  V + G I+G+  SPFT ICLS
Sbjct  338  AKYGIKIAGDTGDHPDANYNPNALPVVKGIHIKNVWGVNVRKAGSIQGLKGSPFTGICLS  397

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
             I+L+G+ +     WKCSD  G +++VSPSPCSEL
Sbjct  398  EINLHGSLNTYR-TWKCSDVIGTSLKVSPSPCSEL  431



>ref|XP_008810829.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
 ref|XP_008810830.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
 ref|XP_008810831.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
Length=450

 Score =   306 bits (784),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 169/216 (78%), Gaps = 1/216 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP DSPNTDGIDPDSS +VCIED YISTGDDLVAVKSGWDEYG+AY  PS GIT+RR+
Sbjct  224  VLAPPDSPNTDGIDPDSSLNVCIEDCYISTGDDLVAVKSGWDEYGMAYAHPSSGITVRRL  283

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPF+GIA+GSETSGGV +VL E I + N G+GIHIKTN GRGG IRNIT S V +  
Sbjct  284  TGSSPFSGIAIGSETSGGVENVLVESIHIHNTGIGIHIKTNSGRGGFIRNITVSGVNLNN  343

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R  +RIAGDVGGHPD  +NPNA+PIV  + IKDVWG  + QPG + GI  SPFT ICLS
Sbjct  344  VRKAVRIAGDVGGHPDSMYNPNALPIVDALTIKDVWGVDIQQPGSMEGIKNSPFTRICLS  403

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            N+ LNG    R  PWKC D SG A +V PSPC+ELT
Sbjct  404  NVKLNG-DGAREVPWKCEDVSGGATEVQPSPCTELT  438



>gb|AIU50441.1| pectin lyase-like superfamily protein, partial [Schrenkiella 
parvula]
Length=406

 Score =   305 bits (780),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 148/215 (69%), Positives = 176/215 (82%), Gaps = 5/215 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGID DSS +VCIEDSYISTGDDLVA+KSGWDEYGIAYGRPS  ITIRR+
Sbjct  192  ILAPQDSPNTDGIDADSSFNVCIEDSYISTGDDLVAIKSGWDEYGIAYGRPSSNITIRRI  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGG+ +++AEHITL NMGVG++IKTN+GRGG I+NI  SNVY+E 
Sbjct  252  TGSSPFAGIAIGSETSGGIKNIVAEHITLFNMGVGVNIKTNIGRGGYIKNIRISNVYVEN  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI++AGD G HPD  +NPNA+PIV+ I IK++WG  V   G IRG+  SPFT ICLS
Sbjct  312  ARYGIKLAGDTGDHPDAYYNPNALPIVKGIHIKNIWGVNVQNAGSIRGLKGSPFTGICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
             I+L+G ++     WKCSD  G +++VSP PCSEL
Sbjct  372  EINLHGYRT-----WKCSDVIGTSLKVSPWPCSEL  401



>emb|CDY47619.1| BnaA01g13460D [Brassica napus]
Length=444

 Score =   305 bits (782),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 179/215 (83%), Gaps = 1/215 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVA+KSGWDEYGIA+GRPS  ITIRR+
Sbjct  218  ILAPQDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAIKSGWDEYGIAFGRPSSNITIRRI  277

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGS+PFAGIA+GSETSGG+ +++AEHI+LSNMGVG++IKTN+GRGG I+NI  SNVY+E 
Sbjct  278  TGSTPFAGIAIGSETSGGIKNIVAEHISLSNMGVGVNIKTNIGRGGYIKNIRISNVYVEN  337

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGD G HPD  +NPNA+P+V+ I I +VWG  V   G I+G+  SPFT ICLS
Sbjct  338  ARYGIKIAGDTGDHPDTYYNPNALPVVKGIHINNVWGVNVRNAGSIQGLKDSPFTGICLS  397

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
             I+++G+ +  N  WKCSD  G +++VSP PCSEL
Sbjct  398  EINIHGSLNT-NRTWKCSDVIGTSLKVSPWPCSEL  431



>ref|XP_009380525.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=446

 Score =   305 bits (782),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 170/216 (79%), Gaps = 0/216 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP DSPNTDGIDPDSSS+VCIED++I+TGDDLVA+KSGWDEYGIAYGRPS GITIRR+
Sbjct  219  VLAPYDSPNTDGIDPDSSSNVCIEDAHIATGDDLVAIKSGWDEYGIAYGRPSSGITIRRL  278

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             GSSPF+GIA+GSETSGGV +VL E+I L N G GIHIKTN GRGG IRN+T  NV M K
Sbjct  279  QGSSPFSGIAIGSETSGGVENVLVENINLYNTGFGIHIKTNAGRGGYIRNVTVVNVSMNK  338

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GIRIAGDVG HPDE FN  A+P V  + IK+VWG  + QPG I GI  SPFT ICLS
Sbjct  339  VRKGIRIAGDVGDHPDEYFNRYAMPTVDGVTIKNVWGVDIQQPGSIEGIRSSPFTRICLS  398

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            N+ L GA      PWKC D SGAA+ V P PCS+LT
Sbjct  399  NVKLWGALMHYEQPWKCMDVSGAALGVQPWPCSQLT  434



>emb|CDY03516.1| BnaC01g15660D [Brassica napus]
Length=444

 Score =   305 bits (782),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 179/215 (83%), Gaps = 1/215 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVA+KSGWDEYGIA+GRPS  ITIRR+
Sbjct  218  ILAPQDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAIKSGWDEYGIAFGRPSSNITIRRI  277

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGS+PFAGIA+GSETSGG+ +++AEHI+LSNMGVG++IKTN+GRGG I+NI  SNVY+E 
Sbjct  278  TGSTPFAGIAIGSETSGGIKNIVAEHISLSNMGVGVNIKTNIGRGGYIKNIKISNVYVEN  337

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGD G HPD  +NPNA+P+V+ I+I +VWG  V   G I+G+  SPFT ICLS
Sbjct  338  ARYGIKIAGDTGDHPDAYYNPNALPVVKGIRINNVWGVNVRNAGSIQGLKDSPFTGICLS  397

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
             I+++G+ +     WKCSD  G +++VSP PCSEL
Sbjct  398  EINIHGSLNTYR-TWKCSDVIGTSLKVSPWPCSEL  431



>gb|AIU50411.1| pectin lyase-like superfamily protein, partial [Capsella rubella]
Length=406

 Score =   304 bits (778),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 179/215 (83%), Gaps = 5/215 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS +VCIEDSYISTGDDLVA+KSGWD+YGIAYGRPS  ITIRR+
Sbjct  192  ILAPQDSPNTDGIDPDSSVNVCIEDSYISTGDDLVAIKSGWDQYGIAYGRPSSNITIRRI  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGG+ +++AEHITLSNMGVG++IKTN+GRGG I+NI  SNVY++ 
Sbjct  252  TGSSPFAGIAIGSETSGGIKNIVAEHITLSNMGVGVNIKTNIGRGGYIKNIRISNVYVDT  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             + GI+IAGD G HPD  +NPNA+P+V+ I IK+VWG  V + G I+G+  SPFT ICLS
Sbjct  312  AKYGIKIAGDTGDHPDANYNPNALPVVEGIHIKNVWGVNVRKAGSIQGLKGSPFTGICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
             I+L+G ++     WKC+D  G +++VSP PCSEL
Sbjct  372  EINLHGYRT-----WKCADVIGTSMKVSPWPCSEL  401



>ref|XP_006283738.1| hypothetical protein CARUB_v10004811mg [Capsella rubella]
 gb|EOA16636.1| hypothetical protein CARUB_v10004811mg [Capsella rubella]
Length=444

 Score =   305 bits (781),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 149/224 (67%), Positives = 183/224 (82%), Gaps = 2/224 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS +VCIEDSYISTGDDLVA+KSGWD+YGIAYGRPS  ITIRR+
Sbjct  218  ILAPQDSPNTDGIDPDSSVNVCIEDSYISTGDDLVAIKSGWDQYGIAYGRPSSNITIRRI  277

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGG+ +++AEHITLSNMGVG++IKTN+GRGG I+NI  SNVY++ 
Sbjct  278  TGSSPFAGIAIGSETSGGIKNIVAEHITLSNMGVGVNIKTNIGRGGYIKNIRISNVYVDT  337

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             + GI+IAGD G HPD  +NPNA+P+V+ I IK+VWG  V + G I+G+  SPFT ICLS
Sbjct  338  AKYGIKIAGDTGDHPDANYNPNALPVVEGIHIKNVWGVNVRKAGSIQGLKGSPFTGICLS  397

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL-TRDQSGAC  210
             I+L+G+ ++    WKC+D  G +++VSP PCSEL T   S  C
Sbjct  398  EINLHGSLNMYR-TWKCADVIGTSMKVSPWPCSELRTSGGSNVC  440



>ref|XP_009137402.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=444

 Score =   305 bits (781),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 179/215 (83%), Gaps = 1/215 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVA+KSGWDEYGIA+GRPS  ITIRR+
Sbjct  218  ILAPQDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAIKSGWDEYGIAFGRPSSNITIRRI  277

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGS+PFAGIA+GSETSGG+ +++AEHI+LSNMGVG++IKTN+GRGG I+NI  SNVY+E 
Sbjct  278  TGSTPFAGIAIGSETSGGIKNIVAEHISLSNMGVGVNIKTNIGRGGYIKNIRISNVYVEN  337

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGD G HPD  +NPNA+P+V+ I I +VWG  V   G I+G+  SPFT ICLS
Sbjct  338  ARYGIKIAGDTGDHPDAYYNPNALPVVKGIHINNVWGVNVRNAGSIQGLKDSPFTGICLS  397

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
             I+++G+ +  N  WKCSD  G +++VSP PCSEL
Sbjct  398  EINIHGSLNT-NRTWKCSDVIGTSLKVSPWPCSEL  431



>gb|AIU50402.1| pectin lyase-like superfamily protein, partial [Magnolia denudata]
Length=392

 Score =   303 bits (776),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 175/216 (81%), Gaps = 5/216 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS +VCIED YI+TGDDLVAVKSGWDEYGIAYGRPS GITIRR+
Sbjct  178  ILAPPDSPNTDGIDPDSSFNVCIEDCYIATGDDLVAVKSGWDEYGIAYGRPSSGITIRRL  237

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            +GS+PFAGIA+GSETSGGV +VLAE+++L N GVGIH+KTN+GRGG IRNIT  +V M+ 
Sbjct  238  SGSTPFAGIAIGSETSGGVENVLAENVSLFNTGVGIHVKTNIGRGGFIRNITVQDVRMDN  297

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVG HPD  FNPNA+PIV  + ++++WG  + QPG ++G+  SPFT ICLS
Sbjct  298  VRKGIKIAGDVGDHPDNNFNPNALPIVDGVMLRNLWGVNIQQPGVMQGLKNSPFTQICLS  357

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            N++  G        WKC+D SGAA+ V PSPC ELT
Sbjct  358  NVNFGGGAV-----WKCADISGAALGVEPSPCPELT  388



>ref|XP_006413510.1| hypothetical protein EUTSA_v10025189mg [Eutrema salsugineum]
 gb|ESQ54963.1| hypothetical protein EUTSA_v10025189mg [Eutrema salsugineum]
Length=449

 Score =   305 bits (781),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 150/216 (69%), Positives = 177/216 (82%), Gaps = 3/216 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGID DSS +VCIEDSYISTGDDLVA+KSGWDEYGIAYGRPS  ITIRR+
Sbjct  223  ILAPQDSPNTDGIDADSSFNVCIEDSYISTGDDLVAIKSGWDEYGIAYGRPSSNITIRRI  282

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGG+ +++AEHITL NMGVG++IKTN+GRGG I+NI  SNVY+E 
Sbjct  283  TGSSPFAGIAIGSETSGGIKNIVAEHITLFNMGVGVNIKTNIGRGGYIKNIRISNVYVEN  342

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI++AGD G HPD  +NPNA+PIV+ I IK++WG  V   G IRG+  SPFT ICLS
Sbjct  343  ARYGIKLAGDTGDHPDAYYNPNALPIVKGIHIKNIWGVNVQNAGSIRGLKGSPFTGICLS  402

Query  338  NIHLNGA-KSLRNPPWKCSDASGAAVQVSPSPCSEL  234
             I+L+G+  S R   WKCSD  G +++VSP PCSEL
Sbjct  403  EINLHGSLNSYRT--WKCSDVIGTSLKVSPWPCSEL  436



>gb|ACC91250.1| glycoside hydrolase family 28 protein [Arabidopsis halleri]
Length=444

 Score =   305 bits (780),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 148/215 (69%), Positives = 178/215 (83%), Gaps = 1/215 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS +VCIEDSYISTGDDLVA+KSGWDEYGIAYGRPS  ITIRR+
Sbjct  218  ILAPQDSPNTDGIDPDSSYNVCIEDSYISTGDDLVAIKSGWDEYGIAYGRPSSNITIRRI  277

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGG+ +++AEHITLSNMGVG++IKTN+GRGG I+NI  S+VY++ 
Sbjct  278  TGSSPFAGIAIGSETSGGIKNIVAEHITLSNMGVGVNIKTNIGRGGYIKNIKISDVYIDT  337

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             + GI+I GD G HPDE +NPNA+PIV+ I IK+VWG  V   G I+G+  SPFT ICLS
Sbjct  338  AKYGIKITGDTGDHPDENYNPNALPIVKGIHIKNVWGVNVRNAGSIQGLKGSPFTGICLS  397

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
             I+L+G+ +     WKCSD  G +++VSP PCSEL
Sbjct  398  EINLHGSLN-SYKTWKCSDVIGTSLKVSPWPCSEL  431



>emb|CDM83426.1| unnamed protein product [Triticum aestivum]
Length=450

 Score =   305 bits (780),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 176/216 (81%), Gaps = 2/216 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIED YISTGDDL+A+KSGWDEYGIAYGRPS  ITIRR+
Sbjct  225  ILAPHDSPNTDGIDPDSSSNVCIEDCYISTGDDLIAIKSGWDEYGIAYGRPSSDITIRRI  284

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAG +VGSETSGGV +VLAEH+   + G G+HIKTN GRGG IRNIT S+V ++ 
Sbjct  285  TGSSPFAGFSVGSETSGGVENVLAEHLNFYSSGFGVHIKTNSGRGGFIRNITVSDVVLDN  344

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G+RIAGDVGGHPDE++N NA+PIV  + IK+V G+ V + G I+GIP S F+ ICLS
Sbjct  345  VRYGLRIAGDVGGHPDERYNHNALPIVDSLTIKNVQGQNVREAGLIKGIPNSAFSRICLS  404

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            NI L+G+  +R  PWKC+  SG A+ V PSPC+ELT
Sbjct  405  NIKLHGSAPVR--PWKCAAVSGGALDVQPSPCTELT  438



>gb|AIU50413.1| pectin lyase-like superfamily protein, partial [Eucalyptus grandis]
Length=406

 Score =   302 bits (774),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 175/216 (81%), Gaps = 5/216 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYIS GDD+V+VKSGWDEYGIAYGRPS  ITIRR+
Sbjct  192  ILAPVDSPNTDGIDPDSSSNVCIEDSYISVGDDVVSVKSGWDEYGIAYGRPSSNITIRRL  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSE SGG+ +VL E++ L  +G+GIH+KTN GRG  IRNIT S+VY+E 
Sbjct  252  TGSSPFAGIAIGSEMSGGIENVLVENVNLYKVGIGIHVKTNSGRGAFIRNITVSDVYVED  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+I+GDVG HPD+ ++PNA+P+V  I +KD+ G  V Q G IRGI  SPFT +CLS
Sbjct  312  ARKGIKISGDVGDHPDDGYDPNALPVVTGILVKDMRGTNVQQAGLIRGIKNSPFTGLCLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            N++L+G       PW CSD SGAA +VSPSPCSELT
Sbjct  372  NVNLHGED-----PWSCSDVSGAAFKVSPSPCSELT  402



>ref|NP_001043594.2| Os01g0618900 [Oryza sativa Japonica Group]
 dbj|BAD61521.1| polygalacturonase-like [Oryza sativa Japonica Group]
 dbj|BAF05508.2| Os01g0618900 [Oryza sativa Japonica Group]
Length=308

 Score =   298 bits (763),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 174/216 (81%), Gaps = 2/216 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP DSPNTDGIDPDSSS+VCIED YISTGDDL+A+KSGWDEYG+AYGRPS  ITIRR+
Sbjct  83   VLAPHDSPNTDGIDPDSSSNVCIEDCYISTGDDLIAIKSGWDEYGMAYGRPSSHITIRRI  142

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAG AVGSETSGGV  VLAEH+   + G GIHIKTN GRGG IRN+T S+V ++ 
Sbjct  143  TGSSPFAGFAVGSETSGGVEHVLAEHLNFFSSGFGIHIKTNTGRGGFIRNVTVSDVTLDS  202

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G+RIAGDVGGHPD++++ NA+P+V  + IK+V G+ + + G I+GI  S F+ ICLS
Sbjct  203  VRYGLRIAGDVGGHPDDRYDRNALPVVDGLTIKNVQGQNIREAGSIKGIATSAFSRICLS  262

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            N+ LNG  ++R  PWKC   SGAA+ V PSPC+ELT
Sbjct  263  NVKLNGGAAVR--PWKCEAVSGAALDVQPSPCTELT  296



>gb|AIU50445.1| pectin lyase-like superfamily protein, partial [Cinnamomum camphora]
Length=406

 Score =   301 bits (772),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 179/215 (83%), Gaps = 5/215 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP DSPNTDGIDPDSS +VCIEDS+I+TGDD+VAVKSGWDEYGIAYGRPS+GITIRR+
Sbjct  192  VLAPHDSPNTDGIDPDSSVNVCIEDSFIATGDDMVAVKSGWDEYGIAYGRPSYGITIRRL  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSE SGGV +V AE+I+L NMGVGIH+KTN+GRGGII+NIT  +V+M+ 
Sbjct  252  TGSSPFAGIAIGSEASGGVLNVFAENISLFNMGVGIHVKTNIGRGGIIKNITVRDVHMDT  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GI+IAGDVGGHPDE+F+P A+P+V  I +K+V G +VLQPG ++G+   PFT ICL+
Sbjct  312  VRKGIKIAGDVGGHPDEKFDPTALPVVDSITVKNVVGVKVLQPGLLKGLKDLPFTRICLT  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
             I++    +     W+C D +GAA  V+PSPC+EL
Sbjct  372  GINMGNGSA-----WQCEDVTGAAYGVNPSPCTEL  401



>emb|CDX67513.1| BnaA07g15530D [Brassica napus]
Length=447

 Score =   303 bits (775),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 181/225 (80%), Gaps = 4/225 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAPTDSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAY RPS  ITIRR+
Sbjct  221  ILAPTDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYNRPSRDITIRRI  280

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGG+ +V  E+ITL N G+G+HIKTN+GRGG I+ IT S V++EK
Sbjct  281  TGSSPFAGIAIGSETSGGIQNVTVENITLYNSGIGVHIKTNIGRGGSIQGITVSGVHLEK  340

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             RTGI+I+GD G HPD++FN +A+P+V+ I IK+VWG +V + G ++G+  +PFTN+C S
Sbjct  341  VRTGIKISGDTGDHPDDKFNASALPVVRGITIKNVWGIKVERAGMVQGLKDAPFTNLCFS  400

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL--TRDQSGAC  210
            N+   G K   +P WKCSD  GAA +V+P+ C EL  T  Q G C
Sbjct  401  NVTFTGTKG--SPIWKCSDVVGAAEKVNPTACPELTSTSQQGGYC  443



>gb|AIU50425.1| pectin lyase-like superfamily protein, partial [Canna indica]
Length=406

 Score =   301 bits (771),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 174/220 (79%), Gaps = 5/220 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP DSPNTDGIDPDSSS+VCIED+++ TGDDLVA+KSGWDEYGIAYGRPS GITIRR+
Sbjct  192  VLAPRDSPNTDGIDPDSSSNVCIEDAHVLTGDDLVAIKSGWDEYGIAYGRPSSGITIRRL  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPF+GIA+GSETSGGV +VL E++ L N G+G+HIKTNVGRGG IRN+  ++V M K
Sbjct  252  TGSSPFSGIAIGSETSGGVENVLVENVNLYNTGIGLHIKTNVGRGGYIRNVRVTDVTMNK  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GIRIAGDVG HPDE F+ +AIP V  + IK+VWG  V QPG I GI  SPFT ICLS
Sbjct  312  VRKGIRIAGDVGDHPDEYFSRDAIPKVDGVTIKNVWGVGVQQPGSIEGIKNSPFTRICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQS  219
            N+ L G       PWKC+  SGAA+ V PSPCSEL R  S
Sbjct  372  NVKLWG-----RAPWKCAAVSGAALGVRPSPCSELARSAS  406



>dbj|BAJ89948.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   303 bits (775),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 175/216 (81%), Gaps = 2/216 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIED YISTGDDL+A+KSGWDEYGIAYGRPS  ITIRR+
Sbjct  225  ILAPHDSPNTDGIDPDSSSNVCIEDCYISTGDDLIAIKSGWDEYGIAYGRPSSDITIRRI  284

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAG +VGSETSGGV +VLAEH+   + G G+HIKTN GRGG IRNIT S+V ++ 
Sbjct  285  TGSSPFAGFSVGSETSGGVENVLAEHLNFYSSGFGVHIKTNSGRGGFIRNITVSDVILDN  344

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G+RIAGDVGGHPDE++N NA+PIV  + IK+V G+ + + G I+GIP S F+ ICLS
Sbjct  345  VRYGLRIAGDVGGHPDERYNHNALPIVDSLMIKNVQGQNIKEAGLIKGIPNSAFSRICLS  404

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            NI L+G+  +R  PWKC   SG A+ V PSPC+ELT
Sbjct  405  NIKLHGSAPVR--PWKCQAVSGGALDVQPSPCTELT  438



>dbj|BAJ94644.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91541.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87369.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88286.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   302 bits (774),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 175/216 (81%), Gaps = 2/216 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIED YISTGDDL+A+KSGWDEYGIAYGRPS  ITIRR+
Sbjct  225  ILAPHDSPNTDGIDPDSSSNVCIEDCYISTGDDLIAIKSGWDEYGIAYGRPSSDITIRRI  284

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAG +VGSETSGGV +VLAEH+   + G G+HIKTN GRGG IRNIT S+V ++ 
Sbjct  285  TGSSPFAGFSVGSETSGGVENVLAEHLNFYSSGFGVHIKTNSGRGGFIRNITVSDVILDN  344

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G+RIAGDVGGHPDE++N NA+PIV  + IK+V G+ + + G I+GIP S F+ ICLS
Sbjct  345  VRYGLRIAGDVGGHPDERYNHNALPIVDSLMIKNVQGQNIKEAGLIKGIPNSAFSRICLS  404

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            NI L+G+  +R  PWKC   SG A+ V PSPC+ELT
Sbjct  405  NIKLHGSAPVR--PWKCQAVSGGALDVQPSPCTELT  438



>ref|XP_009125202.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=447

 Score =   302 bits (774),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 181/225 (80%), Gaps = 4/225 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAPTDSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAY RPS  ITIRR+
Sbjct  221  ILAPTDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYNRPSRDITIRRI  280

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGG+ +V  E+ITL N G+G+HIKTN+GRGG I+ IT S V++EK
Sbjct  281  TGSSPFAGIAIGSETSGGIQNVTVENITLYNSGIGVHIKTNIGRGGSIQGITVSGVHLEK  340

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             RTGI+I+GD G HPD++FN +A+P+V+ I IK+VWG +V + G ++G+  +PFTN+C S
Sbjct  341  VRTGIKISGDTGDHPDDKFNVSALPVVRGITIKNVWGIKVERAGMVQGLKDAPFTNLCFS  400

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL--TRDQSGAC  210
            N+   G K   +P WKCSD  GAA +V+P+ C EL  T  Q G C
Sbjct  401  NVTFTGTKG--SPIWKCSDVVGAAEKVNPTACPELTSTSQQGGYC  443



>gb|AIU50403.1| pectin lyase-like superfamily protein, partial [Musa acuminata]
Length=396

 Score =   300 bits (769),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 150/216 (69%), Positives = 170/216 (79%), Gaps = 5/216 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP DSPNTDGIDPDSSS+VCIED++I+TGDDLVA+KSGWDEYGIAYGRPS GITIRR+
Sbjct  182  VLAPYDSPNTDGIDPDSSSNVCIEDAHIATGDDLVAIKSGWDEYGIAYGRPSSGITIRRL  241

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             GSSPF+GIA+GSETSGGV +VL E+I L N G GIHIKTN GRGG IRN+T  NV M K
Sbjct  242  QGSSPFSGIAIGSETSGGVENVLVENINLYNTGFGIHIKTNAGRGGYIRNVTVVNVSMNK  301

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GIRIAGDVG HPDE FN  A+P V  + IK+VWG  + QPG I GI  SPFT ICLS
Sbjct  302  VRKGIRIAGDVGDHPDEYFNRYAMPTVDGVTIKNVWGVDIQQPGSIEGIRSSPFTRICLS  361

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            N+ L G +     PWKC D SGAA+ V P PCS+LT
Sbjct  362  NVKLWGEQ-----PWKCMDVSGAALGVQPWPCSQLT  392



>ref|XP_006405300.1| hypothetical protein EUTSA_v10027765mg [Eutrema salsugineum]
 ref|XP_006405301.1| hypothetical protein EUTSA_v10027765mg [Eutrema salsugineum]
 gb|ESQ46753.1| hypothetical protein EUTSA_v10027765mg [Eutrema salsugineum]
 gb|ESQ46754.1| hypothetical protein EUTSA_v10027765mg [Eutrema salsugineum]
Length=447

 Score =   302 bits (773),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/223 (68%), Positives = 181/223 (81%), Gaps = 4/223 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAPTDSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAY RPS  ITIRR+
Sbjct  227  ILAPTDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYNRPSRDITIRRI  286

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGG+ +V  E+ITL + G+GIHIKTN+GRGG +  IT S V+MEK
Sbjct  287  TGSSPFAGIAIGSETSGGIQNVTVENITLYSSGIGIHIKTNIGRGGSVHGITISGVHMEK  346

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             RTGI+I+G+ G HPD++FN +A+PIV  I IK+VWG +V + G ++G+  SPFTN+CLS
Sbjct  347  VRTGIKISGNTGDHPDDRFNTSALPIVSGITIKNVWGIKVERAGMVQGLKDSPFTNLCLS  406

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL--TRDQSG  216
            N+ L G KS  +P WKCSD  GAA +V+P+ C EL  T  Q G
Sbjct  407  NVTLTGTKS--SPIWKCSDVVGAAEKVTPTACPELASTTQQGG  447



>ref|XP_009137393.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=451

 Score =   302 bits (773),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/223 (67%), Positives = 183/223 (82%), Gaps = 4/223 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS++VCIEDSYISTGDDLVA+KSGWDEYGIA+GRPS  ITIRR+
Sbjct  225  ILAPQDSPNTDGIDPDSSNNVCIEDSYISTGDDLVAIKSGWDEYGIAFGRPSSNITIRRI  284

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSP+AGIA+GSETSGG+ +++AEHI+LSNMG+G++IKTN+GRGG I+NI  SNVY+E 
Sbjct  285  TGSSPYAGIAIGSETSGGIKNIVAEHISLSNMGLGVNIKTNIGRGGYIKNIKISNVYVEN  344

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             + GI+IAGD G HPD  +NPNA+PIV+ I I +VWG  V   G I+G+  SPFT ICLS
Sbjct  345  AKYGIKIAGDTGDHPDAFYNPNALPIVKGIHINNVWGVNVQNAGSIQGLKGSPFTGICLS  404

Query  338  NIHLNGA-KSLRNPPWKCSDASGAAVQVSPSPCSELTRDQSGA  213
             I+L+G+  S R   WKCSD  G +++VSP PCSEL R  SG+
Sbjct  405  EINLHGSLNSYRT--WKCSDVIGTSLKVSPWPCSEL-RTTSGS  444



>ref|XP_010441363.1| PREDICTED: probable polygalacturonase [Camelina sativa]
 ref|XP_010441364.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=448

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 177/225 (79%), Gaps = 4/225 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAPTDS NTDGIDPDSSS+VCIEDSY+STGDDLVAVKSGWDEYGIAY R S  ITIRR+
Sbjct  222  ILAPTDSYNTDGIDPDSSSNVCIEDSYMSTGDDLVAVKSGWDEYGIAYNRSSRDITIRRI  281

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSS FAGIA+GSETSGG+ ++  E+ITL N G+GIHIKTN GRGG IR IT S VYME 
Sbjct  282  TGSSRFAGIAIGSETSGGIQNITVENITLYNSGIGIHIKTNTGRGGSIRGITISGVYMEN  341

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             RTGI+I+GD G HPD++FN  A+P+V  I IK+VWG +V + G I+G+  SPFTN+C S
Sbjct  342  VRTGIKISGDTGDHPDDKFNLTALPVVSGITIKNVWGIKVERAGMIQGLEDSPFTNLCFS  401

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL--TRDQSGAC  210
            N+ L G KS   P WKCSD  GAA +V+P+PC EL  T  Q G+C
Sbjct  402  NVTLTGTKS--PPTWKCSDVVGAAHKVNPTPCPELTATTQQGGSC  444



>emb|CDY10970.1| BnaA03g46290D [Brassica napus]
Length=451

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/222 (67%), Positives = 182/222 (82%), Gaps = 2/222 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS++VCIEDSYISTGDDLVA+KSGWDEYGIA+GRPS  ITIRR+
Sbjct  225  ILAPQDSPNTDGIDPDSSNNVCIEDSYISTGDDLVAIKSGWDEYGIAFGRPSSNITIRRI  284

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSP+AGIA+GSETSGG+ +++AEHI+LSNMGVG++IKTN+GRGG I+NI  SNVY+E 
Sbjct  285  TGSSPYAGIAIGSETSGGIKNIVAEHISLSNMGVGVNIKTNIGRGGYIKNIKISNVYVEN  344

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             + GI+IAGD G HPD  +NPNA+PIV+ I I +VWG  V   G I+G+  SPFT ICLS
Sbjct  345  AKYGIKIAGDTGDHPDAFYNPNALPIVKGIHINNVWGVNVQNAGSIQGLKGSPFTGICLS  404

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQSGA  213
             I+L+G+ +     WKCSD  G +++VSP PCSEL R  SG+
Sbjct  405  EINLHGSLN-SYLTWKCSDVIGTSLKVSPWPCSEL-RTTSGS  444



>emb|CDX94222.1| BnaC07g38560D [Brassica napus]
Length=451

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 179/216 (83%), Gaps = 3/216 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS++VCIEDSYISTGDDLVA+KSGWDEYGIA+GRPS  ITIRR+
Sbjct  225  ILAPQDSPNTDGIDPDSSNNVCIEDSYISTGDDLVAIKSGWDEYGIAFGRPSSNITIRRI  284

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSP+AGIA+GSETSGG+ +++AEHI+LSNMGVG++IKTN+GRGG I+NI  SNVY+E 
Sbjct  285  TGSSPYAGIAIGSETSGGIKNIVAEHISLSNMGVGVNIKTNIGRGGYIKNIKISNVYVEN  344

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             + GI+IAGD G HPD  +NPNA+PIV+ I I +VWG  V   G I+G+  SPFT ICLS
Sbjct  345  AKYGIKIAGDTGDHPDAFYNPNALPIVKGIHINNVWGVNVQNAGSIQGLKGSPFTGICLS  404

Query  338  NIHLNGA-KSLRNPPWKCSDASGAAVQVSPSPCSEL  234
             I+L+G+  S R   WKCSD  G +++VSP PCSEL
Sbjct  405  EINLHGSLNSYRT--WKCSDVIGTSLKVSPWPCSEL  438



>gb|AAO62947.1| putative polygalacturonase-like protein [Lactuca sativa]
 gb|AAO62948.1| putative polygalacturonase-like protein, partial [Lactuca sativa]
Length=193

 Score =   292 bits (748),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/193 (73%), Positives = 165/193 (85%), Gaps = 1/193 (1%)
 Frame = -1

Query  848  DGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRVTGSSPFAGIA  669
            DGIDPDSSSHVCIEDSYISTGDDLVAVKSGWD+YGI Y RPS+ ITIRR+TGSSPFAGIA
Sbjct  1    DGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDQYGIKYARPSNDITIRRLTGSSPFAGIA  60

Query  668  VGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEKTRTGIRIAGD  489
            +GSETSGGV +VLAEHITL NMG+GIH+KTN+GRGGIIRNIT S+VYM   R GI+I+ D
Sbjct  61   IGSETSGGVYNVLAEHITLKNMGIGIHLKTNIGRGGIIRNITVSDVYMVNVRKGIKISAD  120

Query  488  VGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLSNIHLNG-AKS  312
            VG HPD+ +NPNA+P+++ ++IK+VWG++V Q G I G+  SPFT+ICLSNI+L G   S
Sbjct  121  VGDHPDKNYNPNALPVLKHVRIKNVWGKKVQQAGLIHGLKNSPFTDICLSNINLQGPIIS  180

Query  311  LRNPPWKCSDASG  273
             RN PWKCS  SG
Sbjct  181  TRNVPWKCSYVSG  193



>gb|AIU50450.1| pectin lyase-like superfamily protein, partial [Alisma plantago-aquatica]
Length=406

 Score =   300 bits (768),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/215 (66%), Positives = 173/215 (80%), Gaps = 5/215 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP DSPNTDG+DPDSS++VCIEDS+ISTGDDLVA+KSGWDEYGIAYGRPS+GIT+RR+
Sbjct  192  VLAPYDSPNTDGVDPDSSTNVCIEDSFISTGDDLVAIKSGWDEYGIAYGRPSYGITVRRI  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSE SGGV +VL EHI + N G+G+HIKTN GRGG I+N+TFS+V +  
Sbjct  252  TGSSPFAGIAIGSEASGGVENVLVEHINIYNTGIGVHIKTNTGRGGYIKNVTFSDVILNN  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G+RIAG+VG HPD  FNP+A+P+V  + IK+V G +V QPG + GI  SPFT +CL 
Sbjct  312  VRKGVRIAGNVGDHPDNNFNPSAVPVVDGVTIKNVVGMKVQQPGTLIGIKDSPFTRVCLD  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            N+ L         PW+C+D SG AV+V PSPCSEL
Sbjct  372  NVKL-----YSEVPWQCTDVSGGAVEVQPSPCSEL  401



>emb|CDY13383.1| BnaC06g13740D [Brassica napus]
Length=445

 Score =   301 bits (771),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 178/216 (82%), Gaps = 2/216 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAPTDSPNTDGIDPDSSS++CIEDSYISTGDDLVAVKSGWDEYGIAY RPS  ITIRR+
Sbjct  219  ILAPTDSPNTDGIDPDSSSNMCIEDSYISTGDDLVAVKSGWDEYGIAYNRPSRDITIRRI  278

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGG+ +V  E+ITL N G+G+HIKTN+GRGG I+ IT S +++EK
Sbjct  279  TGSSPFAGIAIGSETSGGIQNVTVENITLYNSGIGVHIKTNIGRGGSIQGITVSGIHLEK  338

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             RTGI+I+GD G HPD++FN +A+P+VQ I IK+VWG +V + G ++G+  +PFTN+C S
Sbjct  339  VRTGIKISGDTGDHPDDKFNTSALPVVQGITIKNVWGIKVERAGMVQGLKDAPFTNLCFS  398

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            N+   G K   +P WKCSD  GAA +V+P+ C ELT
Sbjct  399  NVTFTGTKG--SPIWKCSDVVGAAEKVNPTACPELT  432



>ref|XP_006654851.1| PREDICTED: probable polygalacturonase-like [Oryza brachyantha]
Length=306

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 170/216 (79%), Gaps = 2/216 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP DSPNTDGIDPDSSS+VCIEDSYISTGDDL+++KSGWDEYGIA+GRPS GITIRR+
Sbjct  83   VLAPQDSPNTDGIDPDSSSNVCIEDSYISTGDDLISIKSGWDEYGIAFGRPSSGITIRRI  142

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGS PFAG AVGSETSGGV +V  EH+   +MGVGIHIKTN GRGG IRNIT S V ++ 
Sbjct  143  TGSGPFAGFAVGSETSGGVENVHVEHLNFFSMGVGIHIKTNSGRGGFIRNITVSEVTLDG  202

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G+RIAGDVGGHPD  +NP+ +P V  + IK+VWG+ + Q G IRGI  S F+ ICLS
Sbjct  203  ARYGLRIAGDVGGHPDASYNPSMLPAVDGVTIKNVWGQNIRQAGLIRGIRNSVFSRICLS  262

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            N+ L G+ S+   PWKC   SG A+ V P PC+ELT
Sbjct  263  NVKLYGSASV--GPWKCRAVSGGALDVQPLPCAELT  296



>gb|AIU50401.1| pectin lyase-like superfamily protein, partial [Lilium brownii]
Length=406

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 173/216 (80%), Gaps = 5/216 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP DSPNTDG+DPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGIAY RPS  IT+RR+
Sbjct  192  VLAPHDSPNTDGVDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGIAYNRPSSDITVRRI  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSP+AGIAVGSETSGGV ++  ++I + N G+GIHIKTNVGRGG I+NIT S+V M  
Sbjct  252  TGSSPYAGIAVGSETSGGVQNIFVQNINIFNSGIGIHIKTNVGRGGYIKNITISDVNMYN  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G++I GD G HPD++F+PNA+P+V  + I+DVWG  + QPG IRGI  +PFT ICLS
Sbjct  312  VRYGLKIEGDAGDHPDDKFDPNALPVVDGVTIRDVWGADIQQPGSIRGIKNAPFTRICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            N+  +        PWKC+D SGAA++V P PC+ELT
Sbjct  372  NVRFSAEV-----PWKCTDVSGAALEVQPGPCAELT  402



>ref|XP_004961056.1| PREDICTED: probable polygalacturonase-like [Setaria italica]
Length=445

 Score =   301 bits (771),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 175/224 (78%), Gaps = 3/224 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP DSPNTDGID DS ++VCIEDSYIS GDDL+++KSGWDEYGIA+GRPS GITIRR+
Sbjct  222  VLAPHDSPNTDGIDLDSCNNVCIEDSYISAGDDLISIKSGWDEYGIAFGRPSSGITIRRI  281

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGS PFAG AVGSETSGGV +VL EH+ L +MGVGIHIKTN GRGG IRNIT S V +  
Sbjct  282  TGSGPFAGFAVGSETSGGVENVLVEHLNLFSMGVGIHIKTNSGRGGFIRNITVSEVTLNG  341

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G+RIAGDVGGHPD  +NPN +P+V  + IK+VWG+ + Q G IRGI  S F+ ICLS
Sbjct  342  ARYGLRIAGDVGGHPDTSYNPNVLPVVHSVTIKNVWGQNIRQAGLIRGIRNSVFSRICLS  401

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL-TRDQSGAC  210
            N+ L G+ S+   PWKC D SG A+ V PSPC+EL +  ++G C
Sbjct  402  NVKLYGSASI--GPWKCRDVSGGALDVQPSPCTELASTSETGFC  443



>ref|XP_010541551.1| PREDICTED: probable polygalacturonase isoform X1 [Tarenaya hassleriana]
Length=463

 Score =   301 bits (772),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 154/232 (66%), Positives = 180/232 (78%), Gaps = 18/232 (8%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDP-----------------DSSSHVCIEDSYISTGDDLVAVKSGWDE  750
            ILAP DSPNTDGIDP                 DSSS+VCIEDSYISTGDDLVAVKSGWDE
Sbjct  220  ILAPPDSPNTDGIDPGTLNLVLMKTEPCFFALDSSSNVCIEDSYISTGDDLVAVKSGWDE  279

Query  749  YGIAYGRPSHGITIRRVTGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVG  570
            YGIA+GRPS  ITIRR+TGSSPFAGIA+GSETSGG+ ++LA+HITLSNMGVG++IKTN+G
Sbjct  280  YGIAFGRPSSNITIRRITGSSPFAGIAIGSETSGGIKNILAQHITLSNMGVGVNIKTNIG  339

Query  569  RGGIIRNITFSNVYMEKTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQP  390
            RGG I+NI  S+VY+E  R GI+IAGD G HPD  +NPNA+PIV+ IKI +VWG  VL  
Sbjct  340  RGGFIQNIRISDVYVENARYGIKIAGDTGDHPDGNYNPNALPIVKGIKINNVWGVNVLNA  399

Query  389  GWIRGIPKSPFTNICLSNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            G IRG+  SPFT ICLS I+L+G  +   P WKCSD  G +++VSP PCSEL
Sbjct  400  GSIRGLKGSPFTGICLSEINLHGRWN-SYPTWKCSDVIGTSLKVSPWPCSEL  450



>gb|KFK28938.1| hypothetical protein AALP_AA7G068200 [Arabis alpina]
Length=445

 Score =   300 bits (769),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 180/225 (80%), Gaps = 4/225 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS +VCIEDSYISTGDDLVA+KSGWDEYGIA+ RPS  ITIRR+
Sbjct  219  ILAPQDSPNTDGIDPDSSFNVCIEDSYISTGDDLVAIKSGWDEYGIAFNRPSSNITIRRI  278

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGG+ ++ AEHI+LSNMGVG++IKTN+GRGG I+NI  SNVY+E 
Sbjct  279  TGSSPFAGIAIGSETSGGIKNIFAEHISLSNMGVGVNIKTNIGRGGYIKNIKISNVYVEN  338

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             + GI+I G+ G HPD  +NPNA+PIV+ I IK+VWG  V   G I+G+  SPFT ICLS
Sbjct  339  AKYGIKINGETGDHPDANYNPNALPIVKGIHIKNVWGFNVQNAGSIQGLKGSPFTEICLS  398

Query  338  NIHLNGA-KSLRNPPWKCSDASGAAVQVSPSPCSEL-TRDQSGAC  210
             I+L+G+  S R   WKCSD  G +++VSP PCSEL T   S +C
Sbjct  399  EINLHGSLNSYRT--WKCSDVIGTSLKVSPWPCSELRTTGGSNSC  441



>ref|XP_010448059.1| PREDICTED: probable polygalacturonase [Camelina sativa]
Length=448

 Score =   300 bits (769),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 178/225 (79%), Gaps = 4/225 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAPTDS NTDGIDPDSSS+VCIEDSY+STGDDLVAVKSGWDEYGIAY R S  ITIRR+
Sbjct  222  ILAPTDSYNTDGIDPDSSSNVCIEDSYMSTGDDLVAVKSGWDEYGIAYNRSSRDITIRRI  281

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSS FAGIA+GSETSGG+ ++  E+ITL N G+GIHIKTN GRGG I+ IT S VYME 
Sbjct  282  TGSSRFAGIAIGSETSGGIQNITVENITLYNSGIGIHIKTNTGRGGSIQGITISGVYMEN  341

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             RTGI+I+GD G HPD++FN  A+P+V+ I IK+VWG +V + G I+G+  SPFTN+C S
Sbjct  342  VRTGIKISGDTGDHPDDKFNLTALPVVRGITIKNVWGIKVERAGMIQGLKDSPFTNLCFS  401

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL--TRDQSGAC  210
            N+ L G KS   P WKCSD  GAA +V+P+PC EL  T  Q G+C
Sbjct  402  NVTLTGTKS--PPTWKCSDVVGAAHKVNPTPCPELTATTQQGGSC  444



>gb|AIN44009.1| polygalacturonase-like protein [Brassica juncea var. tumida]
Length=451

 Score =   300 bits (769),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 178/216 (82%), Gaps = 3/216 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS++VCIEDSYISTGDDLVA+KSGWDEYGIA+GRPS  ITIRR+
Sbjct  225  ILAPQDSPNTDGIDPDSSNNVCIEDSYISTGDDLVAIKSGWDEYGIAFGRPSSNITIRRI  284

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSP+AGIA+GSETSGG+ +++AEHI+LSNMGVG++IKTN+GRGG I+NI  SNVY+E 
Sbjct  285  TGSSPYAGIAIGSETSGGIKNIVAEHISLSNMGVGVNIKTNIGRGGYIKNIKISNVYVEN  344

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             + GI+IAGD G HPD  +NP A+P+V+ I I +VWG  V   G I+G+  SPFT ICLS
Sbjct  345  AKYGIKIAGDTGDHPDAYYNPKALPVVKGIHINNVWGVNVQNAGSIQGLKGSPFTGICLS  404

Query  338  NIHLNGA-KSLRNPPWKCSDASGAAVQVSPSPCSEL  234
             I+L+G+  S R   WKCSD  G +++VSP PCSEL
Sbjct  405  EINLHGSLNSYRT--WKCSDVIGTSLKVSPWPCSEL  438



>ref|XP_002441600.1| hypothetical protein SORBIDRAFT_09g030140 [Sorghum bicolor]
 gb|EES20030.1| hypothetical protein SORBIDRAFT_09g030140 [Sorghum bicolor]
Length=439

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/224 (66%), Positives = 175/224 (78%), Gaps = 3/224 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP DSPNTDGID DSSS+VCIEDSYIS GDDL+++KSGWDEYGIA+GRPS GITIRR+
Sbjct  216  VLAPHDSPNTDGIDLDSSSNVCIEDSYISAGDDLISIKSGWDEYGIAFGRPSSGITIRRI  275

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGS PFAG AVGSETSGGV +VL EH+ L  MGVGIHIKTN GRGG IRNIT S V +  
Sbjct  276  TGSGPFAGFAVGSETSGGVENVLVEHLNLFGMGVGIHIKTNSGRGGFIRNITVSEVTLNG  335

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G+RIAGDVGGHPD  +NP+ +P+V  + IK+V G+ + Q G IRGI  S F+NICLS
Sbjct  336  ARYGLRIAGDVGGHPDASYNPSVLPVVNSVTIKNVLGQNIRQAGLIRGIRNSVFSNICLS  395

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL-TRDQSGAC  210
            N+ L G+ S+   PWKC   SGAA+ V PSPC+EL +  ++G C
Sbjct  396  NVKLYGSASI--GPWKCRAVSGAALDVQPSPCTELASTSETGFC  437



>gb|EAY85246.1| hypothetical protein OsI_06620 [Oryza sativa Indica Group]
Length=443

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/224 (67%), Positives = 172/224 (77%), Gaps = 3/224 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            I+AP DSPNTDG+DPDSS++VCIEDSYISTGDDLVA+KSGWDEYGIAYGRPS GITIRRV
Sbjct  220  IIAPHDSPNTDGVDPDSSTNVCIEDSYISTGDDLVAIKSGWDEYGIAYGRPSSGITIRRV  279

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             GSSPF+GIA+GSE SGGV+DVL E  ++ N G GIHIKTN+GRGG IRNIT  NV M  
Sbjct  280  RGSSPFSGIAIGSEASGGVSDVLVEDCSIFNSGYGIHIKTNIGRGGFIRNITVDNVRMNS  339

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G+RIAGDVG HPDE F+  A+P V  + IK+VWG  V QPG I GI  SPFT ICL+
Sbjct  340  VRNGLRIAGDVGDHPDEHFSQLALPTVDGVSIKNVWGVNVQQPGSIEGIRNSPFTRICLA  399

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRD-QSGAC  210
            N+ L G ++  N  WKC D  GAA+ V P PC+ELT    SG C
Sbjct  400  NVKLFGWRN--NAAWKCRDVHGAALGVQPGPCAELTTSLSSGFC  441



>gb|EAY74990.1| hypothetical protein OsI_02888 [Oryza sativa Indica Group]
Length=445

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 174/216 (81%), Gaps = 2/216 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP DSPNTDGIDPDSSS+VCIED YISTGDDL+A+KSGWDEYG+AYGRPS  ITIRR+
Sbjct  220  VLAPHDSPNTDGIDPDSSSNVCIEDCYISTGDDLIAIKSGWDEYGMAYGRPSSHITIRRI  279

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAG AVGSETSGGV  VLAEH+   + G GIHIKTN GRGG IRN+T S+V ++ 
Sbjct  280  TGSSPFAGFAVGSETSGGVEHVLAEHLNFFSSGFGIHIKTNTGRGGFIRNVTVSDVTLDS  339

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G+RIAGDVGGHPD++++ NA+P+V  + IK+V G+ + + G I+GI  S F+ ICLS
Sbjct  340  VRYGLRIAGDVGGHPDDRYDRNALPVVDGLTIKNVQGQNIREAGSIKGIATSAFSRICLS  399

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            N+ LNG  ++R  PWKC   SGAA+ V PSPC+ELT
Sbjct  400  NVKLNGGAAVR--PWKCEAVSGAALDVQPSPCTELT  433



>ref|NP_001046468.1| Os02g0256100 [Oryza sativa Japonica Group]
 dbj|BAD29699.1| putative polygalacturonase [Oryza sativa Japonica Group]
 dbj|BAD27952.1| putative polygalacturonase [Oryza sativa Japonica Group]
 dbj|BAF08382.1| Os02g0256100 [Oryza sativa Japonica Group]
 dbj|BAG87758.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87044.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56682.1| hypothetical protein OsJ_06128 [Oryza sativa Japonica Group]
Length=443

 Score =   297 bits (761),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 149/224 (67%), Positives = 172/224 (77%), Gaps = 3/224 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            I+AP DSPNTDG+DPDSS++VCIEDSYISTGDDLVA+KSGWDEYGIAYGRPS GITIRRV
Sbjct  220  IIAPHDSPNTDGVDPDSSTNVCIEDSYISTGDDLVAIKSGWDEYGIAYGRPSSGITIRRV  279

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             GSSPF+GIA+GSE SGGV++VL E  ++ N G GIHIKTN+GRGG IRNIT  NV M  
Sbjct  280  RGSSPFSGIAIGSEASGGVSNVLVEDCSIFNSGYGIHIKTNIGRGGFIRNITVDNVRMNS  339

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G+RIAGDVG HPDE F+  A+P V  + IK+VWG  V QPG I GI  SPFT ICL+
Sbjct  340  VRNGLRIAGDVGDHPDEHFSQLALPTVDAVSIKNVWGVNVQQPGSIEGIRNSPFTRICLA  399

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRD-QSGAC  210
            N+ L G ++  N  WKC D  GAA+ V P PC+ELT    SG C
Sbjct  400  NVKLFGWRN--NAAWKCRDVHGAALGVQPGPCAELTTSLSSGFC  441



>gb|EAY99223.1| hypothetical protein OsI_21181 [Oryza sativa Indica Group]
Length=448

 Score =   296 bits (757),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 169/216 (78%), Gaps = 2/216 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP DSPNTDGIDPDSSS+VCIEDSYISTGDDL+++KSGWDEYGIA+GRPS GITIRR+
Sbjct  225  VLAPHDSPNTDGIDPDSSSNVCIEDSYISTGDDLISIKSGWDEYGIAFGRPSSGITIRRI  284

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGS PFAG AVGSETSGGV +V  EH+    MGVGIH+KTN GRGG IRNIT S V +  
Sbjct  285  TGSGPFAGFAVGSETSGGVENVHVEHLNFFGMGVGIHVKTNSGRGGFIRNITVSEVTLNG  344

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G+RIAGDVGGHPD  ++P+ +P+V  + IK+VWG+ + Q G +RGI  S F+ ICLS
Sbjct  345  ARYGLRIAGDVGGHPDASYDPSKLPVVDGVTIKNVWGQNIRQAGLVRGIRDSVFSRICLS  404

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            N+ L G  S+   PWKC   SG A+ V PSPC+ELT
Sbjct  405  NVKLYGGDSV--GPWKCRAVSGGALDVQPSPCAELT  438



>gb|AAT44156.1| putative polygalacturonase [Oryza sativa Japonica Group]
Length=474

 Score =   296 bits (759),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 169/216 (78%), Gaps = 2/216 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP DSPNTDGIDPDSSS+VCIEDSYISTGDDL+++KSGWDEYGIA+GRPS GITIRR+
Sbjct  251  VLAPHDSPNTDGIDPDSSSNVCIEDSYISTGDDLISIKSGWDEYGIAFGRPSSGITIRRI  310

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGS PFAG AVGSETSGGV +V  EH+    MGVGIH+KTN GRGG IRNIT S V +  
Sbjct  311  TGSGPFAGFAVGSETSGGVENVHVEHLNFFGMGVGIHVKTNSGRGGFIRNITVSEVTLNG  370

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G+RIAGDVGGHPD  ++P+ +P+V  + IK+VWG+ + Q G +RGI  S F+ ICLS
Sbjct  371  ARYGLRIAGDVGGHPDASYDPSKLPVVDGVTIKNVWGQNIRQAGLVRGIRDSVFSRICLS  430

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            N+ L G  S+   PWKC   SG A+ V PSPC+ELT
Sbjct  431  NVKLYGGDSV--GPWKCRAVSGGALDVQPSPCAELT  464



>ref|XP_006646109.1| PREDICTED: probable polygalacturonase-like [Oryza brachyantha]
Length=444

 Score =   295 bits (756),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 172/216 (80%), Gaps = 2/216 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIED YISTGDDL+A+KSGWDEYG+AYGRPS  IT+RR+
Sbjct  219  ILAPHDSPNTDGIDPDSSSNVCIEDCYISTGDDLIAIKSGWDEYGMAYGRPSSHITVRRI  278

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAG AVGSETSGGV  +LAEH+   + G GIHIKTN GRGG IRN+T S+V ++ 
Sbjct  279  TGSSPFAGFAVGSETSGGVEHILAEHLNFVSSGFGIHIKTNTGRGGFIRNVTVSDVTLDT  338

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G+RIAGDVGGHPD++++ NA+P+V  + IK+V G+ + + G I+GI  S F+ ICLS
Sbjct  339  VRYGLRIAGDVGGHPDDRYDRNALPVVDGLTIKNVQGQNIREAGSIKGIATSAFSRICLS  398

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            N+  NG   +R  PWKC   SGAA+ V PSPC+ELT
Sbjct  399  NVKFNGGTPVR--PWKCEAVSGAALDVQPSPCTELT  432



>ref|NP_001056466.1| Os05g0587000 [Oryza sativa Japonica Group]
 dbj|BAF18380.1| Os05g0587000 [Oryza sativa Japonica Group]
 gb|EAZ10399.1| hypothetical protein OsJ_00232 [Oryza sativa Japonica Group]
Length=448

 Score =   295 bits (756),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 169/216 (78%), Gaps = 2/216 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP DSPNTDGIDPDSSS+VCIEDSYISTGDDL+++KSGWDEYGIA+GRPS GITIRR+
Sbjct  225  VLAPHDSPNTDGIDPDSSSNVCIEDSYISTGDDLISIKSGWDEYGIAFGRPSSGITIRRI  284

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGS PFAG AVGSETSGGV +V  EH+    MGVGIH+KTN GRGG IRNIT S V +  
Sbjct  285  TGSGPFAGFAVGSETSGGVENVHVEHLNFFGMGVGIHVKTNSGRGGFIRNITVSEVTLNG  344

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G+RIAGDVGGHPD  ++P+ +P+V  + IK+VWG+ + Q G +RGI  S F+ ICLS
Sbjct  345  ARYGLRIAGDVGGHPDASYDPSKLPVVDGVTIKNVWGQNIRQAGLVRGIRDSVFSRICLS  404

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            N+ L G  S+   PWKC   SG A+ V PSPC+ELT
Sbjct  405  NVKLYGGDSV--GPWKCRAVSGGALDVQPSPCAELT  438



>gb|AIU50415.1| pectin lyase-like superfamily protein, partial [Illicium henryi]
Length=406

 Score =   293 bits (750),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 171/216 (79%), Gaps = 5/216 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIED  ISTGDDLV++KSGWDEYGIAYGRPS  ITIRR+
Sbjct  192  ILAPLDSPNTDGIDPDSSSNVCIEDCSISTGDDLVSIKSGWDEYGIAYGRPSSDITIRRI  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            T SSPFAGIA+GSE SGGV +VL E+I + N G+GIH+KTN+GRGG IRNIT S VYME 
Sbjct  252  TCSSPFAGIAIGSEMSGGVRNVLVENINIFNAGIGIHLKTNLGRGGFIRNITISEVYMEN  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GIR AG+VG HPD+++NPNA+P+V  IK+ +VWG  V QPG I+G+  SPFT +C S
Sbjct  312  VRKGIRFAGNVGDHPDDKYNPNALPVVDGIKVTNVWGVNVQQPGSIQGLKDSPFTRLCFS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            NI+L+G+       W+C D SG+A+ V P  C ELT
Sbjct  372  NINLHGSSL-----WQCRDISGSALGVHPLACPELT  402



>ref|XP_003569374.1| PREDICTED: probable polygalacturonase [Brachypodium distachyon]
Length=448

 Score =   293 bits (750),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 171/216 (79%), Gaps = 2/216 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIED YISTGDDLVA+KSGWDEYGIAYGRPS  IT+RR+
Sbjct  223  ILAPHDSPNTDGIDPDSSSNVCIEDCYISTGDDLVAIKSGWDEYGIAYGRPSSDITVRRI  282

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAG AVGSETSGGV +VLAEH+   + G G+HIKTN GRGG IRN+T S+V ++ 
Sbjct  283  TGSSPFAGFAVGSETSGGVENVLAEHLNFFSSGFGVHIKTNSGRGGFIRNVTVSDVTLDN  342

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G+RIAGDVG HPDE +N NA+P V  + IK+V G+ + + G I+GI  S F+ ICLS
Sbjct  343  VRYGLRIAGDVGDHPDEHYNHNALPKVDSLTIKNVQGQNIKEAGSIKGIASSAFSRICLS  402

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            NI L+G+  +R  PWKC   SG A+ + PSPC+ELT
Sbjct  403  NIKLHGSVPVR--PWKCESVSGGALDLQPSPCTELT  436



>ref|NP_001141464.1| uncharacterized protein LOC100273574 precursor [Zea mays]
 ref|XP_008654580.1| PREDICTED: uncharacterized protein LOC100273574 isoform X1 [Zea 
mays]
 gb|ACF86427.1| unknown [Zea mays]
 gb|ACN28939.1| unknown [Zea mays]
 gb|AFW83292.1| hypothetical protein ZEAMMB73_881856 [Zea mays]
 gb|AFW83293.1| hypothetical protein ZEAMMB73_881856 [Zea mays]
Length=446

 Score =   293 bits (749),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 140/216 (65%), Positives = 168/216 (78%), Gaps = 2/216 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS++CIED YISTGDD +A+KSGWDEYGIAYGR S GIT+RR+
Sbjct  221  ILAPHDSPNTDGIDPDSSSNICIEDCYISTGDDSIAIKSGWDEYGIAYGRASSGITVRRI  280

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAG AVGSETSGGV +VLAEH+   N G GIH+KTN GRGG IRNIT S+V ++ 
Sbjct  281  TGSSPFAGFAVGSETSGGVENVLAEHLNFFNSGFGIHVKTNTGRGGFIRNITVSDVTLDN  340

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G+RI GDVG HPD+ +N +A+PIV  + +K+V G+ V + G I+GIP S F+ ICLS
Sbjct  341  VRYGLRIVGDVGNHPDDSYNRSALPIVDALTVKNVQGQNVREAGLIKGIPNSAFSRICLS  400

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            N+   G   +R  PWKC   SG A+ V PSPC+ELT
Sbjct  401  NVKFTGGAPVR--PWKCEAVSGGALDVQPSPCTELT  434



>ref|XP_009395761.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   293 bits (749),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 173/216 (80%), Gaps = 1/216 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDG+DPDSS +VCIED YISTGDDLVAVKSGWDEYGIAY RPS GI +RR+
Sbjct  223  ILAPYDSPNTDGVDPDSSLNVCIEDCYISTGDDLVAVKSGWDEYGIAYARPSSGIIVRRL  282

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAG AVGSETSGG+ ++LAE++ +   GVGIHIKTN GRGG I+NIT S+V +  
Sbjct  283  TGSSPFAGFAVGSETSGGIENILAENLNIFKTGVGIHIKTNSGRGGFIKNITISDVNLSN  342

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G+RIAG+VG HPD++++PNA+P+V  + IK+VWG ++ QPG I+GI  SPFT I LS
Sbjct  343  VRKGLRIAGNVGDHPDDRYDPNALPVVDGLTIKNVWGVRIQQPGSIQGIKNSPFTQIHLS  402

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            N+ L+ A S R   W C+D SG A+ V PSPC+ELT
Sbjct  403  NVKLDVA-SPRGVAWACADVSGGALDVQPSPCAELT  437



>gb|AIU50432.1| pectin lyase-like superfamily protein, partial [Panicum virgatum]
Length=406

 Score =   291 bits (744),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 144/215 (67%), Positives = 168/215 (78%), Gaps = 5/215 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDG+DPDSS++VCIEDSYISTGDDLVA+KSGWDEYGIAYGRPS GITIRRV
Sbjct  192  ILAPHDSPNTDGVDPDSSTNVCIEDSYISTGDDLVAIKSGWDEYGIAYGRPSSGITIRRV  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             GSSPF+GIA+GSE SGGV DVL E  ++ N G GIHIKTNVGRGG IRN+T  NV M  
Sbjct  252  RGSSPFSGIAIGSEASGGVRDVLVEDCSIFNSGYGIHIKTNVGRGGYIRNVTVDNVRMSG  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R+G+RIAGDVG HPD +F+  A+P V  ++I++VWG  V QPG + GI  SPFT ICLS
Sbjct  312  VRSGVRIAGDVGDHPDGRFSQLAVPTVDAVRIRNVWGVGVQQPGSLEGIRNSPFTRICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            N+ L G  +     W+C D  GAA+ V PSPC+EL
Sbjct  372  NVKLFGGAA-----WRCRDVRGAALGVHPSPCAEL  401



>gb|ACN36471.1| unknown [Zea mays]
Length=347

 Score =   288 bits (738),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 166/215 (77%), Gaps = 2/215 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDG+DPDSSS+VCIEDSYISTGDDLVA+KSGWDEYGIAYGRPS G+T+RRV
Sbjct  123  ILAPRDSPNTDGVDPDSSSNVCIEDSYISTGDDLVAIKSGWDEYGIAYGRPSAGVTVRRV  182

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             GSSPF+GIA+GSE SGGV DVL E   + + G GIHIKTNVGRGG IRN+T   V +  
Sbjct  183  RGSSPFSGIAIGSEASGGVRDVLVEDCAIFDSGYGIHIKTNVGRGGYIRNVTVDGVRLTG  242

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R+G+RIAGDVG HPD  F+  A+P V  ++I +VWG  V QPG + GI  SPFT ICLS
Sbjct  243  VRSGVRIAGDVGDHPDAHFSQLAVPTVDAVRISNVWGVNVQQPGSLEGIRASPFTRICLS  302

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            N+ L G +S  +  WKC D  GAA+ V PSPC+EL
Sbjct  303  NVKLFGWRS--DAAWKCRDVRGAALGVQPSPCAEL  335



>gb|AIU50440.1| pectin lyase-like superfamily protein, partial [Sorghum bicolor]
Length=406

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/215 (67%), Positives = 166/215 (77%), Gaps = 5/215 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVA+KSGWDEYGIAYGRPS GITIRRV
Sbjct  192  ILAPHDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAIKSGWDEYGIAYGRPSSGITIRRV  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             GSSPF+GIA+GSE SGGV DVL E  ++ + G GIHIKTNVGRGG IRN+T  NV M  
Sbjct  252  RGSSPFSGIAIGSEASGGVRDVLVEDCSIFDSGYGIHIKTNVGRGGYIRNVTVDNVRMSG  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R+G+RIAGDVG HPD  F+  A+P+V  ++I +VWG  V  PG + GI  SPFT ICLS
Sbjct  312  VRSGVRIAGDVGDHPDAHFSQLAVPLVDAVRISNVWGVNVQHPGSLEGIRSSPFTRICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            N+ L G     +  W+C D  GAA+ V PSPC+EL
Sbjct  372  NVKLFG-----DAAWRCRDVRGAALGVQPSPCAEL  401



>gb|AIU50436.1| pectin lyase-like superfamily protein, partial [Dioscorea oppositifolia]
Length=406

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 170/215 (79%), Gaps = 5/215 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVAVKSGWDEYGI +GRPS  ITIRR+
Sbjct  192  ILAPPDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAVKSGWDEYGITFGRPSSDITIRRL  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             GSSP+AGIA+GSE SGGV +VL +++ + N G GIHIKTN GRGG IRNIT SNV M K
Sbjct  252  RGSSPYAGIAIGSEASGGVQNVLVDNVNIFNSGFGIHIKTNTGRGGFIRNITISNVIMNK  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R GIRIAG+VG HPD++++ +A+P+V  + IK+V G  + QPG I+GI  SPFT ICLS
Sbjct  312  VRKGIRIAGNVGDHPDDKYDQSALPVVDGVTIKNVQGFNIEQPGTIQGIKDSPFTRICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            N+ L         PWKC D +GAA++V PSPC+EL
Sbjct  372  NVKL-----WSEVPWKCDDVTGAALEVQPSPCTEL  401



>ref|XP_009396562.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=449

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/216 (65%), Positives = 171/216 (79%), Gaps = 1/216 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDG+DPDSS +VCIED YISTGDDLVAVKSGWDEYGIAY RPS GIT+RRV
Sbjct  223  ILAPYDSPNTDGVDPDSSMNVCIEDCYISTGDDLVAVKSGWDEYGIAYARPSSGITVRRV  282

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGS+ FAGIA+GSETSGG+ +V AE++ + + G+GIHIKTN GRGG IRNIT S+V +  
Sbjct  283  TGSNQFAGIAIGSETSGGIENVFAENLDIFDSGIGIHIKTNSGRGGFIRNITISDVNLNN  342

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R  ++I+G  G HPD+ ++PNA+P+V  + IK+VWG  V QPG I+GI  SPFT+ICLS
Sbjct  343  VRKALKISGKAGDHPDDGYDPNALPVVDGLTIKNVWGVGVRQPGSIQGIKDSPFTHICLS  402

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            N+ L    S R  PW C+D SG A++V PSPC+ELT
Sbjct  403  NVTLK-VNSSREVPWTCADVSGGALEVQPSPCAELT  437



>ref|XP_002455965.1| hypothetical protein SORBIDRAFT_03g028140 [Sorghum bicolor]
 gb|EES01085.1| hypothetical protein SORBIDRAFT_03g028140 [Sorghum bicolor]
Length=447

 Score =   290 bits (741),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 169/216 (78%), Gaps = 2/216 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS++CIED YISTGDD +A+KSGWDEYGIAYGRPS  IT+RR+
Sbjct  222  ILAPHDSPNTDGIDPDSSSNICIEDCYISTGDDAIAIKSGWDEYGIAYGRPSSDITVRRI  281

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAG AVGSETSGGV +VLAEH+   + G GIHIKTN GRGG IRN+T S+V ++ 
Sbjct  282  TGSSPFAGFAVGSETSGGVENVLAEHLNFFSSGFGIHIKTNTGRGGFIRNVTVSDVTLDN  341

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G+RI GDVG HPDE++N +A+PIV  + IK+V G+ + + G I+GI  S F+ ICLS
Sbjct  342  VRYGLRIVGDVGNHPDERYNRSALPIVDALTIKNVQGQNIKEAGLIKGIANSAFSRICLS  401

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            N+ L G   ++  PWKC   SG A+ V PSPC+ELT
Sbjct  402  NVKLTGGAPVQ--PWKCEAVSGGALDVQPSPCTELT  435



>ref|NP_001170283.1| uncharacterized protein LOC100384246 precursor [Zea mays]
 gb|ACN33336.1| unknown [Zea mays]
 gb|AFW65883.1| hypothetical protein ZEAMMB73_311601 [Zea mays]
Length=451

 Score =   290 bits (741),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 166/215 (77%), Gaps = 2/215 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDG+DPDSSS+VCIEDSYISTGDDLVA+KSGWDEYGIAYGRPS G+T+RRV
Sbjct  227  ILAPRDSPNTDGVDPDSSSNVCIEDSYISTGDDLVAIKSGWDEYGIAYGRPSAGVTVRRV  286

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             GSSPF+GIA+GSE SGGV DVL E   + + G GIHIKTNVGRGG IRN+T   V +  
Sbjct  287  RGSSPFSGIAIGSEASGGVRDVLVEDCAIFDSGYGIHIKTNVGRGGYIRNVTVDGVRLTG  346

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R+G+RIAGDVG HPD  F+  A+P V  ++I +VWG  V QPG + GI  SPFT ICLS
Sbjct  347  VRSGVRIAGDVGDHPDAHFSQLAVPTVDAVRISNVWGVNVQQPGSLEGIRASPFTRICLS  406

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            N+ L G +S  +  WKC D  GAA+ V PSPC+EL
Sbjct  407  NVKLFGWRS--DAAWKCRDVRGAALGVQPSPCAEL  439



>ref|XP_004969187.1| PREDICTED: probable polygalacturonase-like [Setaria italica]
Length=444

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 169/216 (78%), Gaps = 2/216 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP DSPNTDGIDPDSSS+VCIED YISTGDD VA+KSGWDEYGIAYGRPS  IT+RR+
Sbjct  219  VLAPHDSPNTDGIDPDSSSNVCIEDCYISTGDDAVAIKSGWDEYGIAYGRPSSDITVRRI  278

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAG AVGSETSGGV +VLAEH+   + G GIHIKTN GRGG IRNIT S+V ++ 
Sbjct  279  TGSSPFAGFAVGSETSGGVQNVLAEHLNFFSSGFGIHIKTNTGRGGFIRNITVSDVTLDN  338

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G+RI GDVG HPD+ +N +A+P+V  + IK+V G+ + + G I+GI  S F+ ICLS
Sbjct  339  VRYGLRITGDVGDHPDDSYNRSALPVVDTLTIKNVQGQNIREAGLIKGITNSAFSRICLS  398

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT  231
            N+ L+G   +R  PWKC   +G A+ V PSPC+ELT
Sbjct  399  NVKLSGGTPVR--PWKCEAVTGGALDVQPSPCTELT  432



>ref|XP_004951285.1| PREDICTED: probable polygalacturonase-like [Setaria italica]
Length=447

 Score =   288 bits (736),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 168/215 (78%), Gaps = 2/215 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDG+DPDSSS+VCIEDSYISTGDDLVA+KSGWDEYGIAYGRPS GITIRRV
Sbjct  223  ILAPHDSPNTDGVDPDSSSNVCIEDSYISTGDDLVAIKSGWDEYGIAYGRPSSGITIRRV  282

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             GSSPF+GIA+GSE SGGV DVL E  ++ + G GIHIKT+VGRGG IRN+T  NV M +
Sbjct  283  RGSSPFSGIAIGSEASGGVRDVLVEDCSIFDSGYGIHIKTSVGRGGYIRNVTVDNVRMSR  342

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R+G+RIAGD G HPD +F+  A+P+V  ++I++VWG  + QPG + GI  SPFT ICL 
Sbjct  343  VRSGVRIAGDAGDHPDGRFSQRAVPMVDAVRIRNVWGVGIQQPGSLEGIRNSPFTRICLD  402

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            N+ L G ++     W+C D  GAA+ V P PC+EL
Sbjct  403  NVKLFGWRT--GAAWRCRDVRGAALGVQPWPCAEL  435



>ref|NP_001149385.1| LOC100283011 precursor [Zea mays]
 gb|ACG35253.1| polygalacturonase [Zea mays]
Length=446

 Score =   287 bits (735),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 168/215 (78%), Gaps = 0/215 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP DSPNTDGID DSSS+VC+ED YIS GDDL+++KSGWDEYG+A+GRPS GIT+RR+
Sbjct  222  VLAPHDSPNTDGIDLDSSSNVCVEDCYISAGDDLISIKSGWDEYGVAFGRPSSGITVRRI  281

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGS PFAG AVGSETSGGV DV+AEH++ S +GVG+H+KTN GRGG IRN+T S V ++ 
Sbjct  282  TGSGPFAGFAVGSETSGGVEDVVAEHLSFSGVGVGVHVKTNSGRGGFIRNVTVSQVTLDG  341

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G+RIAGDVGGHP   +N + +P+V  + +++VWG  V Q G IRGI  S F+NICLS
Sbjct  342  ARYGLRIAGDVGGHPGASYNASLLPVVDGVAVRNVWGRNVRQAGLIRGIRDSVFSNICLS  401

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            N+ L G  S    PW+C   SG+A+ V PSPC+EL
Sbjct  402  NVKLYGIGSDSIGPWRCRAVSGSALDVQPSPCAEL  436



>gb|AIU50438.1| pectin lyase-like superfamily protein, partial [Setaria italica]
Length=406

 Score =   286 bits (732),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 167/215 (78%), Gaps = 5/215 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDG+DPDSSS+VCIEDSYISTGDDLVA+KSGWDEYGIAYGRPS GITIRRV
Sbjct  192  ILAPHDSPNTDGVDPDSSSNVCIEDSYISTGDDLVAIKSGWDEYGIAYGRPSSGITIRRV  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             GSSPF+GIA+GSE SGGV DVL E  ++ + G GIHIKT+VGRGG IRN+T  NV M +
Sbjct  252  RGSSPFSGIAIGSEASGGVRDVLVEDCSIFDSGYGIHIKTSVGRGGYIRNVTVDNVRMSR  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R+G+RIAGD G HPD +F+  A+P+V  ++I++VWG  + QPG + GI  SPFT ICL 
Sbjct  312  VRSGVRIAGDAGDHPDGRFSQRAVPMVDAVRIRNVWGVGIQQPGSLEGIRNSPFTRICLD  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            N+ L G  +     W+C D  GAA+ V P PC+EL
Sbjct  372  NVKLFGGAA-----WRCRDVRGAALGVQPWPCAEL  401



>gb|AIU50449.1| pectin lyase-like superfamily protein, partial [Zea mays]
Length=406

 Score =   285 bits (730),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 141/215 (66%), Positives = 164/215 (76%), Gaps = 5/215 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDG+DPDSSS+VCIEDSYISTGDDLVA+KSGWDEYGIAYGRPS G+T+RRV
Sbjct  192  ILAPRDSPNTDGVDPDSSSNVCIEDSYISTGDDLVAIKSGWDEYGIAYGRPSAGVTVRRV  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             GSSPF+GIA+GSE SGGV DVL E   + + G GIHIKTNVGRGG IRN+T   V +  
Sbjct  252  RGSSPFSGIAIGSEASGGVRDVLVEDCAIFDSGYGIHIKTNVGRGGYIRNVTVDGVRLTG  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R+G+RIAGDVG HPD  F+  A+P V  ++I +VWG  V QPG + GI  SPFT ICLS
Sbjct  312  VRSGVRIAGDVGDHPDAHFSQLAVPTVDAVRISNVWGVNVQQPGSLEGIRASPFTRICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            N+ L G     +  WKC D  GAA+ V PSPC+EL
Sbjct  372  NVKLFG-----DAAWKCRDVRGAALGVQPSPCAEL  401



>ref|XP_002451891.1| hypothetical protein SORBIDRAFT_04g009310 [Sorghum bicolor]
 gb|EES04867.1| hypothetical protein SORBIDRAFT_04g009310 [Sorghum bicolor]
Length=448

 Score =   287 bits (734),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 167/216 (77%), Gaps = 2/216 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIEDSYISTGDDLVA+KSGWDEYGIAYGRPS GITIRRV
Sbjct  222  ILAPHDSPNTDGIDPDSSSNVCIEDSYISTGDDLVAIKSGWDEYGIAYGRPSSGITIRRV  281

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             GSSPF+GIA+GSE SGGV DVL E  ++ + G GIHIKTNVGRGG IRN+T  NV M  
Sbjct  282  RGSSPFSGIAIGSEASGGVRDVLVEDCSIFDSGYGIHIKTNVGRGGYIRNVTVDNVRMSG  341

Query  518  TR-TGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
             R +G+RIAGDVG HPD  F+  A+P+V  ++I +VWG  V  PG + GI  SPFT ICL
Sbjct  342  VRISGVRIAGDVGDHPDAHFSQLAVPLVDAVRISNVWGVNVQHPGSLEGIRSSPFTRICL  401

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            SN+ L G +   +  W+C D  GAA+ V PSPC+EL
Sbjct  402  SNVKLFGWRK-NDAAWRCRDVRGAALGVQPSPCAEL  436



>gb|AIU50444.1| pectin lyase-like superfamily protein, partial [Ceratophyllum 
platyacanthum subsp. oryzetorum]
Length=406

 Score =   285 bits (730),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 145/222 (65%), Positives = 172/222 (77%), Gaps = 5/222 (2%)
 Frame = -1

Query  899  LLFDMSPILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSH  720
            ++   + ILAP DSPNTDGIDPDSSS+VCIED YI+TGDDLVA+KSGWD+YGIAYGRPS 
Sbjct  185  VVIRYTTILAPHDSPNTDGIDPDSSSNVCIEDCYIATGDDLVAIKSGWDQYGIAYGRPSS  244

Query  719  GITIRRVTGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITF  540
            GITIRR+TGS+PFAGIA+GSE SGGV +VLAE +T+ N G GI++KT +GRGGII+NIT 
Sbjct  245  GITIRRLTGSTPFAGIAIGSEMSGGVENVLAEDVTIYNSGFGINLKTTIGRGGIIKNITV  304

Query  539  SNVYMEKTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSP  360
            S +Y+   R  IRIAG+VG HPD+ F+P+A+PIV  I IKDV G  VLQPG I GI  SP
Sbjct  305  SGLYVANVRKAIRIAGNVGDHPDDGFDPDAVPIVNGITIKDVRGVDVLQPGSIEGIKSSP  364

Query  359  FTNICLSNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            FT ICLSNI++    +     WKCSD SG A  V P PCS L
Sbjct  365  FTQICLSNINIPIGTA-----WKCSDISGVAQSVYPWPCSNL  401



>gb|AFW81284.1| hypothetical protein ZEAMMB73_960645 [Zea mays]
Length=458

 Score =   286 bits (733),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 168/215 (78%), Gaps = 0/215 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP DSPNTDGID DSSS+VC+ED YIS GDDL+++KSGWDEYG+A+GRPS GIT+RR+
Sbjct  234  VLAPHDSPNTDGIDLDSSSNVCVEDCYISAGDDLISIKSGWDEYGVAFGRPSSGITVRRI  293

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGS PFAG AVGSETSGGV DV+AEH++ S +GVG+H+KTN GRGG IRN+T S V ++ 
Sbjct  294  TGSGPFAGFAVGSETSGGVEDVVAEHLSFSGVGVGVHVKTNSGRGGFIRNVTVSQVTLDG  353

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R G+RIAGDVGGHP   +N + +P++  + +++VWG  V Q G IRGI  S F+NICLS
Sbjct  354  ARYGLRIAGDVGGHPGASYNASLLPVIDGVAVRNVWGRNVRQAGLIRGIRDSVFSNICLS  413

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            N+ L G  S    PW+C   SG+A+ V PSPC+EL
Sbjct  414  NVKLYGIGSDSIGPWRCRAVSGSALDVQPSPCAEL  448



>gb|AIU50451.1| pectin lyase-like superfamily protein, partial [Cabomba caroliniana]
Length=406

 Score =   278 bits (712),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 165/220 (75%), Gaps = 5/220 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS++VCIEDSYI+TGDDLVA+KSGWDEYGIA+GRPS  IT+RR+
Sbjct  192  ILAPFDSPNTDGIDPDSSNNVCIEDSYINTGDDLVAIKSGWDEYGIAFGRPSSNITVRRI  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TG+S FAGIA GSETSGG+ ++L E+I L N   GI +KTN GRGG+IRNIT  ++YME 
Sbjct  252  TGTSSFAGIAFGSETSGGIENILVENINLYNTATGIFLKTNAGRGGVIRNITVRDIYMEN  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             +  I+ AG+VG HPD  +NPNA+P+V  + I +VWG+ VL PG + G+  +PF  ICLS
Sbjct  312  VKNAIKFAGNVGDHPDNNYNPNALPVVDGVAIVNVWGDSVLHPGSLVGVQGAPFQRICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQS  219
            NI+L G+      PWKC    G A+ V P PC+ L   +S
Sbjct  372  NINLRGSL-----PWKCDGVEGFALGVHPGPCASLVSTRS  406



>gb|EMT32528.1| Putative polygalacturonase [Aegilops tauschii]
Length=443

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/233 (61%), Positives = 182/233 (78%), Gaps = 6/233 (3%)
 Frame = -1

Query  914  FIAAMLLFDMSPILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAY  735
            + + +L+ +++ ILAP DSPNTDGIDPDSSS+VCIED  ISTGDDL+A+KSGWDEYGIA 
Sbjct  199  YCSNVLIRNLT-ILAPHDSPNTDGIDPDSSSNVCIEDCNISTGDDLIAIKSGWDEYGIAC  257

Query  734  GRPSHGITIRRVTGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGII  555
            GRPS GITIRR+TGSSPFAG +VGSETSGGV +VLAEH+   + G G+HIKTN GRGG I
Sbjct  258  GRPSSGITIRRITGSSPFAGFSVGSETSGGVENVLAEHLNFYSSGFGVHIKTNSGRGGFI  317

Query  554  RNITFSNVYMEKTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRG  375
            RNIT S+V ++  R G+RIAGDVGGHPDE++N +A+PIV  + IK+V G+ + + G I+G
Sbjct  318  RNITVSDVVLDNVRYGLRIAGDVGGHPDERYNHSALPIVDSLTIKNVQGQNIKEAGLIKG  377

Query  374  IPKSPFTNICLSNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQSG  216
            IP S F+ ICLSNI L+G+  +R  PWKC  A+G A + S +  S+   D++G
Sbjct  378  IPNSAFSRICLSNIKLHGSAPVR--PWKC--AAGHAFE-SGTAGSQNRLDEAG  425



>ref|XP_006837459.1| PREDICTED: probable polygalacturonase [Amborella trichopoda]
 gb|ERN00313.1| hypothetical protein AMTR_s00107p00122980 [Amborella trichopoda]
Length=447

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 169/225 (75%), Gaps = 4/225 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP DSPNTDGIDPDSSS++CIEDSYISTGDDLVA+KSGWDEYGIAY RPS  ITIRR+
Sbjct  219  VLAPPDSPNTDGIDPDSSSNMCIEDSYISTGDDLVAIKSGWDEYGIAYARPSSFITIRRI  278

Query  698  TGSS-PFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            +GSS  F GIA GSETSGG++D++ E+ITL N    I +KTN GRGG IRNIT   V++E
Sbjct  279  SGSSLAFTGIAFGSETSGGISDIVVENITLVNTATAIFLKTNAGRGGYIRNITVRGVHLE  338

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
                 I+ AGDVG HPD++++P A+P+V+ + I DVWG  V+QPG ++GI  +PF  ICL
Sbjct  339  NVTKAIKFAGDVGDHPDDKYDPRALPVVEGVSISDVWGVGVMQPGSMKGINGAPFKGICL  398

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQ-SGAC  210
            SN++L G   +    WKC+D SG A+ V P PC+EL     +GAC
Sbjct  399  SNVNLYGW--VPGAQWKCTDISGVALGVRPWPCAELAATHGTGAC  441



>gb|AIU50447.1| pectin lyase-like superfamily protein, partial [Ginkgo biloba]
Length=401

 Score =   268 bits (685),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 162/215 (75%), Gaps = 5/215 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIED YI+ GDD++A+KSGWDEYGIAYGRPS  I IRRV
Sbjct  192  ILAPADSPNTDGIDPDSSSNVCIEDCYINNGDDMIAIKSGWDEYGIAYGRPSSNIIIRRV  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TG++ F+GIA GSETSGG+ D+L E++++ N G GI +KTN GRGGII+NIT S++Y+E 
Sbjct  252  TGTTGFSGIAFGSETSGGIRDILVENVSIFNSGTGIRLKTNAGRGGIIQNITISDIYLEN  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             R  I+  GD G HPD Q+NP A+PIV  I +K+V G+ +   G + G+ +SPF +ICL+
Sbjct  312  VRIAIKFTGDTGDHPDSQYNPQALPIVTKIAVKNVRGKNIHSVGSMDGLERSPFLDICLA  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            NI+L G  S     W+CS   GA+V V P PC +L
Sbjct  372  NINLQGTDS-----WQCSAVEGASVGVYPQPCPQL  401



>gb|EAZ12715.1| hypothetical protein OsJ_02632 [Oryza sativa Japonica Group]
Length=419

 Score =   268 bits (684),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 158/199 (79%), Gaps = 2/199 (1%)
 Frame = -1

Query  827  SSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRVTGSSPFAGIAVGSETSG  648
            SS+VCIED YISTGDDL+A+KSGWDEYG+AYGRPS  ITIRR+TGSSPFAG AVGSETSG
Sbjct  211  SSNVCIEDCYISTGDDLIAIKSGWDEYGMAYGRPSSHITIRRITGSSPFAGFAVGSETSG  270

Query  647  GVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEKTRTGIRIAGDVGGHPDE  468
            GV  VLAEH+   + G GIHIKTN GRGG IRN+T S+V ++  R G+RIAGDVGGHPD+
Sbjct  271  GVEHVLAEHLNFFSSGFGIHIKTNTGRGGFIRNVTVSDVTLDSVRYGLRIAGDVGGHPDD  330

Query  467  QFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLSNIHLNGAKSLRNPPWKC  288
            +++ NA+P+V  + IK+V G+ + + G I+GI  S F+ ICLSN+ LNG  ++R  PWKC
Sbjct  331  RYDRNALPVVDGLTIKNVQGQNIREAGSIKGIATSAFSRICLSNVKLNGGAAVR--PWKC  388

Query  287  SDASGAAVQVSPSPCSELT  231
               SGAA+ V PSPC+ELT
Sbjct  389  EAVSGAALDVQPSPCTELT  407



>gb|AIU50419.1| pectin lyase-like superfamily protein, partial [Ceratophyllum 
demersum]
Length=368

 Score =   264 bits (675),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 131/189 (69%), Positives = 155/189 (82%), Gaps = 0/189 (0%)
 Frame = -1

Query  899  LLFDMSPILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSH  720
            ++   + ILAP DSPNTDGIDPDSSS+VCIED YI+TGDDLVA+KSGWD+YGIAYGRPS 
Sbjct  180  VVIRYTTILAPHDSPNTDGIDPDSSSNVCIEDCYIATGDDLVAIKSGWDQYGIAYGRPSS  239

Query  719  GITIRRVTGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITF  540
            GITIRR+TGS+PFAGIA+GSE SGGV +VLAE +T+ N G GI++KT +GRGGII+NIT 
Sbjct  240  GITIRRLTGSTPFAGIAIGSEMSGGVENVLAEDVTIYNSGFGINLKTTIGRGGIIKNITV  299

Query  539  SNVYMEKTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSP  360
            S +Y+   R  IRIAG+VG HPD+ F+P+A+PIV  I IKDV G  VLQPG I GI  SP
Sbjct  300  SGLYVANVRKAIRIAGNVGDHPDDGFDPDAVPIVNGITIKDVRGVDVLQPGSIEGIKSSP  359

Query  359  FTNICLSNI  333
            FT ICLSNI
Sbjct  360  FTQICLSNI  368



>gb|AIU50428.1| pectin lyase-like superfamily protein, partial [Persea americana]
Length=190

 Score =   257 bits (657),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 151/174 (87%), Gaps = 1/174 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP DSPNTDGIDPDSS +VCIEDS+I+TGDDLVAVKSGWDEYGIAYGRPS+GITIRR+
Sbjct  18   VLAPHDSPNTDGIDPDSSLNVCIEDSFIATGDDLVAVKSGWDEYGIAYGRPSNGITIRRL  77

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPF+GIA+GSE SGGV +V AE+ITL NMGVGIH+KTN+GRGGII+NIT  +V+M  
Sbjct  78   TGSSPFSGIAIGSEASGGVLNVFAENITLFNMGVGIHVKTNIGRGGIIKNITVRDVHMHT  137

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPF  357
             R GI+IAGDVG HPD++F+P A+P+V  I +K+V G +VLQPG ++G+   PF
Sbjct  138  VRKGIKIAGDVGDHPDDKFDPKALPVVS-ITVKNVRGLKVLQPGLLQGLKDLPF  190



>gb|AIU50417.1| pectin lyase-like superfamily protein, partial [Iris japonica]
Length=406

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 159/215 (74%), Gaps = 5/215 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            +LAP DSPNTDGIDPDSSS+VCIEDS+ISTGDD +A+KSGWDEYGI+YGRPS  ITI+R+
Sbjct  192  VLAPHDSPNTDGIDPDSSSNVCIEDSFISTGDDAIAIKSGWDEYGISYGRPSTFITIQRI  251

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            T SSPF+ IA+GSE SGG+  +L  +I + +  + IHIKTN GRGG I N+T S+V+M +
Sbjct  252  TASSPFSAIAIGSEASGGIQHILIHNINIHSTAIAIHIKTNAGRGGFITNVTISDVHMSR  311

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
               G+RI GDVG HPD  FNP A+  V  + I+DVWG  V +PG I GI  SPFT ICLS
Sbjct  312  VTEGVRIVGDVGDHPDGNFNPGALTRVDGVTIRDVWGVGVREPGSIEGIKDSPFTRICLS  371

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            N+ L G +      W+C++ SG AV V P PC+EL
Sbjct  372  NVRLWGMEK-----WRCAEVSGVAVGVEPWPCAEL  401



>gb|KHN38363.1| Putative polygalacturonase [Glycine soja]
Length=327

 Score =   254 bits (648),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDP SSS+VCIEDSYISTGDDLVA KSGWDEYGI YGRPS  ITIRRV
Sbjct  119  ILAPRDSPNTDGIDPHSSSNVCIEDSYISTGDDLVAEKSGWDEYGIVYGRPSSDITIRRV  178

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAGIA+GSETSGGV +VL+EHI L NMG+GIHIKTN GR G I+NIT S+VYME+
Sbjct  179  TGSSPFAGIAIGSETSGGVENVLSEHINLYNMGIGIHIKTNTGRAGYIKNITMSHVYMEE  238

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQ  393
             R GIRI+GDVG HPD++++PNA+P+V+ + IK+VWG + L+
Sbjct  239  ARKGIRISGDVGDHPDDKYDPNALPLVKGVTIKNVWGVKDLE  280



>ref|XP_010527633.1| PREDICTED: probable polygalacturonase, partial [Tarenaya hassleriana]
Length=186

 Score =   238 bits (607),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 143/184 (78%), Gaps = 3/184 (2%)
 Frame = -1

Query  758  WDEYGIAYGRPSHGITIRRVTGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKT  579
            WDEYGIAY RPSH ITIRR+TGSSP+AGIA+GSE+SG + +V AE ITL N G G+HIKT
Sbjct  1    WDEYGIAYNRPSHDITIRRITGSSPYAGIAIGSESSGSIHNVTAEDITLYNSGFGVHIKT  60

Query  578  NVGRGGIIRNITFSNVYMEKTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQV  399
            N+GRGG ++NI  S +YME  RTGIRI+G  G HPD++FNP A+PIV+DI IK+V G +V
Sbjct  61   NIGRGGTVQNIRISGLYMENVRTGIRISGATGDHPDDKFNPKALPIVRDIMIKNVKGVKV  120

Query  398  LQPGWIRGIPKSPFTNICLSNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT-RDQ  222
               G ++G+  SPFTN+CLSN+ L   K+  +PPWKCSD +GAAV+VSP PC+EL    Q
Sbjct  121  QHAGLVQGLRDSPFTNVCLSNVTLTDPKA--SPPWKCSDVTGAAVKVSPLPCAELVATTQ  178

Query  221  SGAC  210
             G+C
Sbjct  179  GGSC  182



>ref|XP_011040145.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=469

 Score =   233 bits (594),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 146/215 (68%), Gaps = 3/215 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS  VCIED YISTGDD++A+KSGWDEYG++YGRPS  ITIRR+
Sbjct  220  ILAPLDSPNTDGIDPDSSDDVCIEDCYISTGDDIIAIKSGWDEYGMSYGRPSKNITIRRL  279

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             G +  AGIA+GSE SGGV++V AE++   N   GI IKT+ GRGG +RNI  SN+ +  
Sbjct  280  VGQTTSAGIAIGSEMSGGVSEVHAENLRFYNSTTGIRIKTSPGRGGYVRNIYISNMSLTD  339

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             +T IR  G  G HPDE ++P A+P+++ I I DV G+ V   G + G+    F +ICLS
Sbjct  340  VKTAIRFTGQYGEHPDESYDPKALPLIERITIDDVTGQNVKYAGLLEGLEGDTFLDICLS  399

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            NI+L+        PW CS   G +  VSP  C  L
Sbjct  400  NINLSVTS---KSPWNCSYIQGYSEAVSPEICEPL  431



>ref|XP_010909275.1| PREDICTED: probable polygalacturonase isoform X2 [Elaeis guineensis]
 ref|XP_010909282.1| PREDICTED: probable polygalacturonase isoform X2 [Elaeis guineensis]
Length=438

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 150/217 (69%), Gaps = 6/217 (3%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDS+++VCIED YISTGDDL+AVKSGWDEYGI++  PS  I+IRR+
Sbjct  190  ILAPLDSPNTDGIDPDSANNVCIEDCYISTGDDLIAVKSGWDEYGISFAHPSSNISIRRI  249

Query  698  TGSSPF-AGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            TG +   AGIA GSE SGGV++V AE I L N   GI IKT+ GRGG IRNI  S+V M+
Sbjct  250  TGETKLGAGIAFGSEMSGGVSEVWAEDIHLFNSKHGIRIKTSPGRGGYIRNIYISDVIMK  309

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
                 IRI G  G HPDE+++PNA+PI+  I IK+V G  +   G + GI    F+NICL
Sbjct  310  NVDIAIRIQGQYGEHPDEKYDPNALPIINRITIKNVAGANIRLAGLLEGIHGDNFSNICL  369

Query  341  SNIHLNGAKSLRNP-PWKCSDASGAAVQVSPSPCSEL  234
            SNI LN    + +P PW CS   G +  VSP  C  L
Sbjct  370  SNIILN----VTSPHPWNCSYVEGYSNMVSPESCEPL  402



>ref|XP_010909269.1| PREDICTED: probable polygalacturonase isoform X1 [Elaeis guineensis]
Length=467

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 150/217 (69%), Gaps = 6/217 (3%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDS+++VCIED YISTGDDL+AVKSGWDEYGI++  PS  I+IRR+
Sbjct  219  ILAPLDSPNTDGIDPDSANNVCIEDCYISTGDDLIAVKSGWDEYGISFAHPSSNISIRRI  278

Query  698  TGSSPF-AGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            TG +   AGIA GSE SGGV++V AE I L N   GI IKT+ GRGG IRNI  S+V M+
Sbjct  279  TGETKLGAGIAFGSEMSGGVSEVWAEDIHLFNSKHGIRIKTSPGRGGYIRNIYISDVIMK  338

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
                 IRI G  G HPDE+++PNA+PI+  I IK+V G  +   G + GI    F+NICL
Sbjct  339  NVDIAIRIQGQYGEHPDEKYDPNALPIINRITIKNVAGANIRLAGLLEGIHGDNFSNICL  398

Query  341  SNIHLNGAKSLRNP-PWKCSDASGAAVQVSPSPCSEL  234
            SNI LN    + +P PW CS   G +  VSP  C  L
Sbjct  399  SNIILN----VTSPHPWNCSYVEGYSNMVSPESCEPL  431



>ref|XP_006604763.1| PREDICTED: probable polygalacturonase-like isoform X2 [Glycine 
max]
Length=468

 Score =   230 bits (586),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 142/215 (66%), Gaps = 3/215 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS +VCIED YISTGDDL+A+KSGWDEYGIAYGRPS  I I R+
Sbjct  220  ILAPHDSPNTDGIDPDSSDNVCIEDCYISTGDDLIAIKSGWDEYGIAYGRPSTNIIIHRL  279

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             G +  +GIA+GSE SGGV++V AE I   +   GI IKT+ GRGG +RNI  SNV +  
Sbjct  280  VGKTQTSGIAIGSEMSGGVSEVHAEDIQFYDSYNGIRIKTSPGRGGYVRNIYVSNVSLAN  339

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
                I   G  G HPD+ ++PNA+P+++ + IKDV GE +   G I GI    F NICLS
Sbjct  340  VDIAIWFTGSYGEHPDDAYDPNALPVIEKVTIKDVVGENIKTAGLIEGIEGDNFVNICLS  399

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            NI LN      N PW CS   G +  V P  C  L
Sbjct  400  NIILNVTS---NYPWNCSYVKGYSDLVQPEACEPL  431



>ref|XP_003554577.1| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=467

 Score =   230 bits (586),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 142/215 (66%), Gaps = 3/215 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS +VCIED YISTGDDL+A+KSGWDEYGIAYGRPS  I I R+
Sbjct  220  ILAPHDSPNTDGIDPDSSDNVCIEDCYISTGDDLIAIKSGWDEYGIAYGRPSTNIIIHRL  279

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             G +  +GIA+GSE SGGV++V AE I   +   GI IKT+ GRGG +RNI  SNV +  
Sbjct  280  VGKTQTSGIAIGSEMSGGVSEVHAEDIQFYDSYNGIRIKTSPGRGGYVRNIYVSNVSLAN  339

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
                I   G  G HPD+ ++PNA+P+++ + IKDV GE +   G I GI    F NICLS
Sbjct  340  VDIAIWFTGSYGEHPDDAYDPNALPVIEKVTIKDVVGENIKTAGLIEGIEGDNFVNICLS  399

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            NI LN      N PW CS   G +  V P  C  L
Sbjct  400  NIILNVTS---NYPWNCSYVKGYSDLVQPEACEPL  431



>gb|ABG34278.1| polygalacturonase [Eucalyptus globulus subsp. globulus]
Length=307

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 141/215 (66%), Gaps = 3/215 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            I AP DSPNTDGIDPDSS  VCIED YISTGDD++A+KSGWDEYGI+YGRPS  I IRR+
Sbjct  59   IRAPLDSPNTDGIDPDSSDDVCIEDCYISTGDDVIAIKSGWDEYGISYGRPSKNIIIRRL  118

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             G +  +GIA+GSE SGGV+DV AE I   N   GI IKT+ GRGG +RNI  SNV +  
Sbjct  119  IGETHSSGIAIGSEMSGGVSDVHAEDIVFFNSTTGIRIKTSPGRGGYVRNIFISNVSLAN  178

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             +  IR  G  G HPDE ++P A+P ++ I  KD+ GE +   G + GI    F NICL 
Sbjct  179  VKVAIRFTGRYGEHPDESYDPKAMPKIERITFKDIHGENITVAGLMEGIEGDNFINICLY  238

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            NI L+   S+   PW CS+  G +  V P  C  L
Sbjct  239  NITLS-VNSI--SPWNCSNVQGFSSLVFPQTCELL  270



>ref|XP_003626072.1| Polygalacturonase [Medicago truncatula]
 gb|AES82290.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=466

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 144/216 (67%), Gaps = 4/216 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS  VCIED YISTGDDL+A+KSGWDEYGIA+GRPS  I I R+
Sbjct  220  ILAPLDSPNTDGIDPDSSDDVCIEDCYISTGDDLIAIKSGWDEYGIAFGRPSTNIVIHRL  279

Query  698  TGSS-PFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
             G +   AGIA+GSE SGGV+DV AE I   +    I IKT+ GRGG +RNI  +N+ + 
Sbjct  280  VGKTHTSAGIAIGSEMSGGVSDVRAEDIHFYDSYTAIRIKTSPGRGGYVRNIYVTNMTLA  339

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
                 IR  G  G HPD+ ++PNA+P+++ I I+DV GE + + G I GI    F NICL
Sbjct  340  NVDIAIRFTGSYGDHPDDAYDPNALPVIEKITIEDVIGENITKAGLIEGIEGDNFVNICL  399

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            SNI LN +    N PW CS+  G +  V P  C  L
Sbjct  400  SNITLNVSS---NYPWNCSNIRGYSDMVFPEACEPL  432



>ref|NP_001241086.1| uncharacterized protein LOC100817309 precursor [Glycine max]
 gb|ACU18828.1| unknown [Glycine max]
Length=467

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/215 (56%), Positives = 141/215 (66%), Gaps = 3/215 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS +VCIED YISTGDDL+A+KSGWDEYGIAYGRPS  I I R+
Sbjct  220  ILAPHDSPNTDGIDPDSSDNVCIEDCYISTGDDLIAIKSGWDEYGIAYGRPSTNIIIHRL  279

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             G +  +GIA+GSE SGGV++V AE I   +    I IKT+ GRGG +RNI  SNV +  
Sbjct  280  VGRTQTSGIAIGSEMSGGVSEVHAEDIQFYDSYNAIRIKTSPGRGGYVRNIYVSNVTLAN  339

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
                I   G  G HPD+ +NPNA+P+++ I IKDV GE +   G I GI    F NICLS
Sbjct  340  VDIAITFTGLYGEHPDDAYNPNALPVIEKITIKDVVGENIKTAGLIEGIEGDNFVNICLS  399

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            NI LN      N PW CS   G +  V P  C  L
Sbjct  400  NIILNVTS---NYPWNCSYVKGYSDLVQPEACEPL  431



>ref|XP_006576263.1| PREDICTED: uncharacterized protein LOC100817309 isoform X2 [Glycine 
max]
Length=463

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/215 (56%), Positives = 141/215 (66%), Gaps = 3/215 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS +VCIED YISTGDDL+A+KSGWDEYGIAYGRPS  I I R+
Sbjct  220  ILAPHDSPNTDGIDPDSSDNVCIEDCYISTGDDLIAIKSGWDEYGIAYGRPSTNIIIHRL  279

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             G +  +GIA+GSE SGGV++V AE I   +    I IKT+ GRGG +RNI  SNV +  
Sbjct  280  VGRTQTSGIAIGSEMSGGVSEVHAEDIQFYDSYNAIRIKTSPGRGGYVRNIYVSNVTLAN  339

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
                I   G  G HPD+ +NPNA+P+++ I IKDV GE +   G I GI    F NICLS
Sbjct  340  VDIAITFTGLYGEHPDDAYNPNALPVIEKITIKDVVGENIKTAGLIEGIEGDNFVNICLS  399

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            NI LN      N PW CS   G +  V P  C  L
Sbjct  400  NIILNVTS---NYPWNCSYVKGYSDLVQPEACEPL  431



>ref|XP_011005969.1| PREDICTED: probable polygalacturonase [Populus euphratica]
 ref|XP_011005971.1| PREDICTED: probable polygalacturonase [Populus euphratica]
Length=465

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 146/215 (68%), Gaps = 3/215 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS  VC+ED Y+STGDD++A+KSGWDEYG++YGRPS  ITIRR+
Sbjct  220  ILAPLDSPNTDGIDPDSSDDVCVEDCYVSTGDDIIAIKSGWDEYGMSYGRPSKNITIRRL  279

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             G +  AGIA+GSE SGGV++V AE++   N   GI IKT+ GRGG +RNI  SN+ +  
Sbjct  280  VGQTTSAGIAIGSEMSGGVSEVHAENLRFYNSTTGIRIKTSPGRGGYVRNIYISNMSLTD  339

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             +T I   G  G HPDE ++P A+P+++ I I+DV G+ V   G + GI    F +ICLS
Sbjct  340  VKTAISFTGRYGEHPDEYYDPTALPLIERITIEDVAGQNVKYAGLLEGIEGDTFLDICLS  399

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            NI+L+        PW CS   G +  VSP  C  L
Sbjct  400  NINLSVTS---KSPWNCSYIQGYSDTVSPEICEPL  431



>ref|XP_008788175.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
Length=468

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/226 (54%), Positives = 153/226 (68%), Gaps = 6/226 (3%)
 Frame = -1

Query  899  LLFDMSPILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSH  720
            +L +   ILAP DSPNTDGIDPDSS++VCIE+ YISTGDDL+AVKSGWDEYGIA+  PS 
Sbjct  213  VLVEKVTILAPPDSPNTDGIDPDSSNNVCIEECYISTGDDLIAVKSGWDEYGIAFAHPSS  272

Query  719  GITIRRVTGSSPF-AGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNIT  543
             I+IRR+TG +   AGIA GSE SGGV++V AE I L N   GI IKT+ GRGG I+NI 
Sbjct  273  NISIRRITGETKLGAGIAFGSEMSGGVSEVWAEDIHLFNSKHGIRIKTSPGRGGYIQNIY  332

Query  542  FSNVYMEKTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKS  363
             S+V M+     IRI G  G HPDE+++PNA+P++  I IK+V G  +   G + GI   
Sbjct  333  ISDVIMKNVDIAIRIQGQYGEHPDEKYDPNALPVINRITIKNVTGGNIRLAGLLEGIHGD  392

Query  362  PFTNICLSNIHLNGAKSLRNP-PWKCSDASGAAVQVSPSPCSELTR  228
             F+NICLSN+ LN    + +P PW CS   G +  VSP  C  L  
Sbjct  393  NFSNICLSNVILN----VTSPNPWNCSYVEGYSNMVSPESCEPLKE  434



>gb|KEH24447.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=466

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 144/216 (67%), Gaps = 4/216 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS  VCIED YISTGDDL+A+KSGWDEYGIA+GRPS  I I R+
Sbjct  220  ILAPLDSPNTDGIDPDSSDDVCIEDCYISTGDDLIAIKSGWDEYGIAFGRPSTNIVIHRL  279

Query  698  TGSS-PFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
             G +   AGIA+GSE SGGV+DV AE I   +    I IKT+ GRGG +RNI  +N+ + 
Sbjct  280  VGKTHTSAGIAIGSEMSGGVSDVRAEDIHFYDSYTAIRIKTSPGRGGYVRNIYVTNMTLA  339

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
                 IR  G  G HPD+ ++PNA+P+++ I I+DV GE + + G I GI    F NICL
Sbjct  340  NVDIAIRFTGSYGDHPDDAYDPNALPVIEKITIEDVIGENITKAGLIEGIEGDNFVNICL  399

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            SNI LN +    N PW CS+  G +  V P  C  L
Sbjct  400  SNITLNVSS---NYPWNCSNIRGYSDMVFPEACEPL  432



>ref|XP_006576262.1| PREDICTED: uncharacterized protein LOC100817309 isoform X1 [Glycine 
max]
Length=468

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/215 (56%), Positives = 141/215 (66%), Gaps = 3/215 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS +VCIED YISTGDDL+A+KSGWDEYGIAYGRPS  I I R+
Sbjct  220  ILAPHDSPNTDGIDPDSSDNVCIEDCYISTGDDLIAIKSGWDEYGIAYGRPSTNIIIHRL  279

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             G +  +GIA+GSE SGGV++V AE I   +    I IKT+ GRGG +RNI  SNV +  
Sbjct  280  VGRTQTSGIAIGSEMSGGVSEVHAEDIQFYDSYNAIRIKTSPGRGGYVRNIYVSNVTLAN  339

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
                I   G  G HPD+ +NPNA+P+++ I IKDV GE +   G I GI    F NICLS
Sbjct  340  VDIAITFTGLYGEHPDDAYNPNALPVIEKITIKDVVGENIKTAGLIEGIEGDNFVNICLS  399

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            NI LN      N PW CS   G +  V P  C  L
Sbjct  400  NIILNVTS---NYPWNCSYVKGYSDLVQPEACEPL  431



>ref|XP_002320934.2| hypothetical protein POPTR_0014s10770g [Populus trichocarpa]
 gb|EEE99249.2| hypothetical protein POPTR_0014s10770g [Populus trichocarpa]
Length=463

 Score =   228 bits (582),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 143/215 (67%), Gaps = 3/215 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS  VCIED YISTGDD++A+KSGWDEYG +Y RPS  ITIR +
Sbjct  220  ILAPLDSPNTDGIDPDSSDDVCIEDCYISTGDDIIAIKSGWDEYGTSYARPSKNITIRGL  279

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             G +  AGIA+GSE SGGV++V AE++T  N   GI IKT  GRGG +RNI  SN+ +  
Sbjct  280  VGQTTSAGIAIGSEMSGGVSEVHAENLTFYNSTTGIRIKTAPGRGGYVRNIYISNMSLTD  339

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             +T IR  G  G HPDE ++P A+P+++ I I DV G+ V   G + G+    F +ICLS
Sbjct  340  VKTAIRFTGQYGDHPDESYDPKALPLIERITIDDVTGQNVKYAGLLEGLEGDTFLDICLS  399

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            NI+L+        PW CS   G +  VSP  C  L
Sbjct  400  NINLSVTS---KSPWNCSYIQGYSEAVSPEICEPL  431



>gb|KHN14175.1| Putative polygalacturonase [Glycine soja]
Length=489

 Score =   229 bits (583),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 120/215 (56%), Positives = 141/215 (66%), Gaps = 3/215 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS +VCIED YISTGDDL+A+KSGWDEYGIAYGRPS  I I R+
Sbjct  242  ILAPHDSPNTDGIDPDSSDNVCIEDCYISTGDDLIAIKSGWDEYGIAYGRPSTNIIIHRL  301

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             G +  +GIA+GSE SGGV++V AE I   +    I IKT+ GRGG +RNI  SNV +  
Sbjct  302  VGRTQTSGIAIGSEMSGGVSEVHAEDIQFYDSYNAIRIKTSPGRGGYVRNIYVSNVTLAN  361

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
                I   G  G HPD+ +NPNA+P+++ I IKDV GE +   G I GI    F NICLS
Sbjct  362  VDIAITFTGLYGEHPDDAYNPNALPVIEKITIKDVVGENIKTAGLIEGIEGDNFVNICLS  421

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            NI LN      N PW CS   G +  V P  C  L
Sbjct  422  NIILNVTS---NYPWNCSYVKGYSDLVQPEACEPL  453



>gb|KHN43408.1| Putative polygalacturonase [Glycine soja]
Length=563

 Score =   230 bits (587),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 142/217 (65%), Gaps = 3/217 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS +VCIED YISTGDDL+A+KSGWDEYGIAYGRPS  I I R+
Sbjct  318  ILAPHDSPNTDGIDPDSSDNVCIEDCYISTGDDLIAIKSGWDEYGIAYGRPSTNIIIHRL  377

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             G +  +GIA+GSE SGGV++V AE I   +   GI IKT+ GRGG +RNI  SNV +  
Sbjct  378  VGKTQTSGIAIGSEMSGGVSEVHAEDIQFYDSYNGIRIKTSPGRGGYVRNIYVSNVSLAN  437

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
                I   G  G HPD+ ++PNA+P+++ + IKDV GE +   G I GI    F NICLS
Sbjct  438  VDIAIWFTGSYGEHPDDAYDPNALPVIEKVTIKDVVGENIKTAGLIEGIEGDNFVNICLS  497

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTR  228
            NI LN      N PW CS   G +  V P  C  L  
Sbjct  498  NIILNVTS---NYPWNCSYVKGYSDLVQPEACEPLKE  531



>ref|XP_002535132.1| Polygalacturonase precursor, putative [Ricinus communis]
 gb|EEF27252.1| Polygalacturonase precursor, putative [Ricinus communis]
Length=476

 Score =   228 bits (581),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 141/216 (65%), Gaps = 4/216 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            I AP DSPNTDGIDPDSS  VCIED +ISTGDDL+A+KSGWDEYGI YGRP   ITIRR+
Sbjct  230  IRAPLDSPNTDGIDPDSSDDVCIEDCFISTGDDLIAIKSGWDEYGILYGRPCRNITIRRL  289

Query  698  TGSS-PFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
             G +   AGIA+GSE SGGV++V AE+I   N   GI IKT+ GRGG +RNI  SNV + 
Sbjct  290  VGQTRSSAGIAIGSEMSGGVSEVHAENILFYNSNTGIRIKTSPGRGGYVRNIYVSNVTLN  349

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
                 IR  G+ G HPDE ++P A+PI++ I I+ V G+ +   G + GI    F NICL
Sbjct  350  DVNIAIRFTGNYGEHPDEHYDPKALPIIERITIEHVMGDNIKYAGILDGIEADSFVNICL  409

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            SNI LN        PW CS   G +  VSP  C  L
Sbjct  410  SNISLNVTSKF---PWNCSYIQGYSESVSPEICEPL  442



>ref|XP_009387922.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=456

 Score =   227 bits (579),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 120/234 (51%), Positives = 152/234 (65%), Gaps = 5/234 (2%)
 Frame = -1

Query  905  AMLLFDMSPILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRP  726
            + +L     ILAP DSPNTDGIDPDSSS+VCIED YISTGDDL+ +KSGWDEYGI+Y  P
Sbjct  211  SQVLIQNVTILAPPDSPNTDGIDPDSSSNVCIEDCYISTGDDLIVIKSGWDEYGISYAHP  270

Query  725  SHGITIRRVTGSSPF-AGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRN  549
            S  I+IRR+ G +   AGIA GSE SGG++DV AE I+L N   GI IKT+ GRGG ++ 
Sbjct  271  SSNISIRRIVGEAKSGAGIAFGSEMSGGISDVEAEDISLFNSLYGIRIKTSPGRGGYVQY  330

Query  548  ITFSNVYMEKTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIP  369
            I  SNV +      I I G  G HPDE F+PNA+PI++ I ++D+ G  +   G + GI 
Sbjct  331  IHISNVVLNNVNIAIGITGQYGEHPDENFDPNALPIIKMITLEDIKGTNIKHAGTLEGIQ  390

Query  368  KSPFTNICLSNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRD-QSGAC  210
               F++ICL N+HLN   S    PW+CS   G++  VSP  C  L    Q+  C
Sbjct  391  GDNFSSICLFNVHLNVTSS---SPWQCSYIQGSSNLVSPESCEPLRNPYQTSVC  441



>ref|XP_002273855.2| PREDICTED: probable polygalacturonase [Vitis vinifera]
 ref|XP_010652335.1| PREDICTED: probable polygalacturonase [Vitis vinifera]
 emb|CBI37055.3| unnamed protein product [Vitis vinifera]
Length=466

 Score =   227 bits (578),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 145/216 (67%), Gaps = 4/216 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS+ VCIED YISTGDDL+A+KSGWDEYGI+Y RPS  I IRR+
Sbjct  220  ILAPLDSPNTDGIDPDSSNDVCIEDCYISTGDDLIAIKSGWDEYGISYARPSTNIIIRRL  279

Query  698  TG-SSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
             G ++  AGIA+GSE SGGV++V AE +   N   GI IKT+ GRGG +RNI  S++ + 
Sbjct  280  VGKTNSSAGIAIGSEMSGGVSEVHAESLQFFNSKTGIRIKTSPGRGGYVRNIYISDMNLV  339

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
              +  IR  G  G HPDE ++P A+PI+++I +KDV GE +   G + GI    F NICL
Sbjct  340  DVKIAIRFTGQYGEHPDEFYDPTALPIIENITVKDVMGENIKFAGLLEGIEGDNFVNICL  399

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            SNI LN        PW CS   G +  VSP  C  L
Sbjct  400  SNITLNVTSE---SPWNCSYIHGYSDLVSPEACEPL  432



>ref|XP_010241442.1| PREDICTED: probable polygalacturonase isoform X2 [Nelumbo nucifera]
Length=391

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/238 (50%), Positives = 150/238 (63%), Gaps = 8/238 (3%)
 Frame = -1

Query  908  AAMLLFDMSPILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGR  729
             + +L   + ILAP  SPNTDGIDPDSSS VCIED YISTGDDL+++KSGWDEYGI+Y R
Sbjct  127  CSQVLVQKATILAPLHSPNTDGIDPDSSSDVCIEDCYISTGDDLISIKSGWDEYGISYAR  186

Query  728  PSHGITIRRVTGSS-PFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIR  552
            PS  I IRR+ G +   +GIA+GSE SGGV++V AE +   N   GI IKT  GRGG +R
Sbjct  187  PSTNIIIRRIVGQTLSSSGIAIGSEMSGGVSEVHAEGLQFFNSKTGIRIKTAPGRGGYVR  246

Query  551  NITFSNVYMEKTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGI  372
            NI  S+V +   +  IR  G  G HPDE ++PNA+PI+ ++  KD+ G+ +   G + G+
Sbjct  247  NIYVSDVKLTDVKMAIRFTGQYGEHPDEFYDPNALPIINNVTFKDIRGDNISIAGLLEGV  306

Query  371  PKSPFTNICLSNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTR----DQSGAC  210
                F NICLSNI LN   +    PWKCS   G +  V P  C  L      + S AC
Sbjct  307  EGESFQNICLSNITLNVTST---SPWKCSFIKGYSDLVYPETCEPLRERIFPEHSSAC  361



>ref|XP_004494475.1| PREDICTED: probable polygalacturonase-like isoform X2 [Cicer 
arietinum]
Length=466

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 143/216 (66%), Gaps = 3/216 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS  VCIED YISTGDDL+A+KSGWDEYGIA+GRPS  I I R+
Sbjct  220  ILAPLDSPNTDGIDPDSSDDVCIEDCYISTGDDLIAIKSGWDEYGIAFGRPSTNIIIHRL  279

Query  698  TGSS-PFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
             G +   AGIA+GSE SGGV++V AE I   +    I IKT  GRGG ++NI  SN+ + 
Sbjct  280  VGKTHTSAGIAIGSEMSGGVSNVRAEDIRFDDSYTAIRIKTTPGRGGYVKNIYVSNMTLV  339

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
                 IR  G  G HPD+ ++PNA+P+++ I IKDV GE + + G I GI    F +ICL
Sbjct  340  NVDIAIRFTGLYGDHPDDGYDPNALPVIEKITIKDVKGENIKKAGLIEGIEGDNFVDICL  399

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            SNI LN   S  N PW CS+  G +  V P  C  L
Sbjct  400  SNIILNNVSS--NYPWNCSNVRGYSDSVLPEACEPL  433



>ref|XP_009412155.1| PREDICTED: probable polygalacturonase [Musa acuminata subsp. 
malaccensis]
Length=459

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 121/235 (51%), Positives = 152/235 (65%), Gaps = 5/235 (2%)
 Frame = -1

Query  908  AAMLLFDMSPILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGR  729
             + +L     ILAP DSPNTDGIDPDSS +VCIED YISTGDDL+ +KSGWDEYGI++ R
Sbjct  213  CSQVLVQNVTILAPPDSPNTDGIDPDSSDNVCIEDCYISTGDDLIVIKSGWDEYGISFAR  272

Query  728  PSHGITIRRVTG-SSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIR  552
            PS  I+IR + G ++  AGIA+GSE SGG+++V AE I L N   GI IKT+ GRGG +R
Sbjct  273  PSSNISIRHIVGEANSGAGIALGSEMSGGISNVRAEDICLFNSLYGIRIKTSPGRGGYVR  332

Query  551  NITFSNVYMEKTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGI  372
            +I  SNV M   +T I I G  G HPDE ++PNA+P++  I I+DV G  +   G + GI
Sbjct  333  HIHISNVIMTNVKTAIGITGRYGEHPDENYDPNALPVIDMITIEDVSGTVIKHAGTLEGI  392

Query  371  PKSPFTNICLSNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTR-DQSGAC  210
                F +ICLSN+HLN        PWKCS   G +  V+P  C  L    QS  C
Sbjct  393  KGDNFNSICLSNVHLNVTS---KHPWKCSYIEGFSNLVTPELCESLRNPYQSSVC  444



>ref|XP_004494474.1| PREDICTED: probable polygalacturonase-like isoform X1 [Cicer 
arietinum]
Length=467

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 143/216 (66%), Gaps = 3/216 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS  VCIED YISTGDDL+A+KSGWDEYGIA+GRPS  I I R+
Sbjct  220  ILAPLDSPNTDGIDPDSSDDVCIEDCYISTGDDLIAIKSGWDEYGIAFGRPSTNIIIHRL  279

Query  698  TGSS-PFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
             G +   AGIA+GSE SGGV++V AE I   +    I IKT  GRGG ++NI  SN+ + 
Sbjct  280  VGKTHTSAGIAIGSEMSGGVSNVRAEDIRFDDSYTAIRIKTTPGRGGYVKNIYVSNMTLV  339

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
                 IR  G  G HPD+ ++PNA+P+++ I IKDV GE + + G I GI    F +ICL
Sbjct  340  NVDIAIRFTGLYGDHPDDGYDPNALPVIEKITIKDVKGENIKKAGLIEGIEGDNFVDICL  399

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            SNI LN   S  N PW CS+  G +  V P  C  L
Sbjct  400  SNIILNNVSS--NYPWNCSNVRGYSDSVLPEACEPL  433



>ref|XP_010241441.1| PREDICTED: probable polygalacturonase isoform X1 [Nelumbo nucifera]
Length=474

 Score =   226 bits (575),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 118/237 (50%), Positives = 150/237 (63%), Gaps = 8/237 (3%)
 Frame = -1

Query  905  AMLLFDMSPILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRP  726
            + +L   + ILAP  SPNTDGIDPDSSS VCIED YISTGDDL+++KSGWDEYGI+Y RP
Sbjct  211  SQVLVQKATILAPLHSPNTDGIDPDSSSDVCIEDCYISTGDDLISIKSGWDEYGISYARP  270

Query  725  SHGITIRRVTGSS-PFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRN  549
            S  I IRR+ G +   +GIA+GSE SGGV++V AE +   N   GI IKT  GRGG +RN
Sbjct  271  STNIIIRRIVGQTLSSSGIAIGSEMSGGVSEVHAEGLQFFNSKTGIRIKTAPGRGGYVRN  330

Query  548  ITFSNVYMEKTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIP  369
            I  S+V +   +  IR  G  G HPDE ++PNA+PI+ ++  KD+ G+ +   G + G+ 
Sbjct  331  IYVSDVKLTDVKMAIRFTGQYGEHPDEFYDPNALPIINNVTFKDIRGDNISIAGLLEGVE  390

Query  368  KSPFTNICLSNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTR----DQSGAC  210
               F NICLSNI LN   +    PWKCS   G +  V P  C  L      + S AC
Sbjct  391  GESFQNICLSNITLNVTST---SPWKCSFIKGYSDLVYPETCEPLRERIFPEHSSAC  444



>ref|XP_003535296.2| PREDICTED: probable polygalacturonase-like [Glycine max]
 gb|KHN14231.1| Putative polygalacturonase [Glycine soja]
Length=464

 Score =   225 bits (574),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 148/215 (69%), Gaps = 3/215 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            I+AP  SPNTDGI+PDSS +VCIED YISTGDDL+++KSGWD YGI++GRPS  I IRR+
Sbjct  220  IIAPLSSPNTDGINPDSSDNVCIEDCYISTGDDLISIKSGWDGYGISFGRPSTNINIRRL  279

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             G +  AGIA+GSE SGGV++V AE I + +    I IKT+ GRGG +RN+  SN+ +  
Sbjct  280  IGKTTSAGIAIGSEMSGGVSEVHAEDIYIFDSHSAIRIKTSPGRGGYVRNVYISNMILVN  339

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
                IR  G  G HPD+ ++P+A+P+++ I IKDV GE+V + G I+GI    F NICLS
Sbjct  340  VDIAIRFTGLYGEHPDDTYDPDALPVIERITIKDVIGEKVKRAGLIQGIKGDNFVNICLS  399

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            NI LN +K L   PW CS   G +  VSP  C  L
Sbjct  400  NITLNVSKKL---PWNCSYVKGYSDLVSPEACEPL  431



>ref|XP_006386685.1| hypothetical protein POPTR_0002s18800g [Populus trichocarpa]
 ref|XP_002301554.2| hypothetical protein POPTR_0002s18800g [Populus trichocarpa]
 gb|ERP64482.1| hypothetical protein POPTR_0002s18800g [Populus trichocarpa]
 gb|EEE80827.2| hypothetical protein POPTR_0002s18800g [Populus trichocarpa]
Length=449

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 145/215 (67%), Gaps = 3/215 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS  VC+ED Y+STGDD++A+KSGWDEYG++YGRPS  ITIRR+
Sbjct  220  ILAPLDSPNTDGIDPDSSDDVCVEDCYVSTGDDIIAIKSGWDEYGMSYGRPSKNITIRRL  279

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             G +  AGIA+GSE SGGV++V AE++   N   GI IKT+ GRGG +RNI  SN+ +  
Sbjct  280  VGQTTSAGIAIGSEMSGGVSEVHAENLRFYNSTTGIRIKTSPGRGGYVRNIYISNMSLTD  339

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             +T I   G  G HPDE ++P A+P+++ I ++DV G+ V   G + GI    F +ICL 
Sbjct  340  VKTAISFTGRYGEHPDEYYDPTALPLIERITVEDVAGQNVKYAGLLEGIEGDTFLDICLL  399

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            NI+L+        PW CS   G +  VSP    +L
Sbjct  400  NINLSVTS---KSPWNCSYIQGYSDTVSPEIFQDL  431



>gb|EMS62381.1| putative polygalacturonase [Triticum urartu]
Length=269

 Score =   219 bits (559),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCIED  ISTGDDL+A+KSGWDEYGIAYGRPS GITIRR+
Sbjct  123  ILAPHDSPNTDGIDPDSSSNVCIEDCNISTGDDLIAIKSGWDEYGIAYGRPSSGITIRRI  182

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TGSSPFAG +VGSETSGGV DVLAEH+   + G G+HIKTN GRGG IRNIT S+V ++ 
Sbjct  183  TGSSPFAGFSVGSETSGGVEDVLAEHLNFYSSGFGVHIKTNSGRGGFIRNITVSDVILDN  242

Query  518  TRTGIRIAGDVGGHPDEQ  465
             R G+RIAGDVGGHPDE+
Sbjct  243  VRYGLRIAGDVGGHPDER  260



>ref|XP_002989426.1| hypothetical protein SELMODRAFT_129742 [Selaginella moellendorffii]
 gb|EFJ09517.1| hypothetical protein SELMODRAFT_129742 [Selaginella moellendorffii]
Length=439

 Score =   224 bits (571),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 150/221 (68%), Gaps = 3/221 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCI+D YIS GDD++A+KSGWDEYGIAYG+PS  I IRRV
Sbjct  208  ILAPQDSPNTDGIDPDSSSNVCIQDCYISNGDDMIAIKSGWDEYGIAYGQPSSNIHIRRV  267

Query  698  TGSSPF-AGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            TG +   A IA+GSETSGG+ +VL E +   +   GI I+T VGRG  IRN+  S++ + 
Sbjct  268  TGQTKRGAAIAIGSETSGGIENVLVEDLVAVSTKSGISIRTGVGRGAYIRNVVLSSITLL  327

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
              +T I I+G    HPD  FN  A P+V+ + ++ V G  + +PG I GIP+ PF +ICL
Sbjct  328  DIQTAITISGFSSEHPDNGFNATAFPVVEKVTVRGVTGNTLDRPGRILGIPEVPFRDICL  387

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQS  219
             +I L+    L    WKC+D  G +  V+P  CS+L+ + +
Sbjct  388  EDIALDATTGLT--AWKCTDVEGYSSSVTPKICSQLSENNT  426



>gb|KEH43186.1| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=406

 Score =   223 bits (567),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/217 (51%), Positives = 148/217 (68%), Gaps = 3/217 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            I+ P  SPNTDGIDPDSS +VCIED YISTGDDL+++KSGWDEYGI++GRPS  I+I R+
Sbjct  155  IIVPFGSPNTDGIDPDSSDNVCIEDCYISTGDDLISIKSGWDEYGISFGRPSTNISIHRL  214

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TG +  AGIA+GSE SGGV++V AE I + +    I IKT+ GRGG +RN+  SN+ +  
Sbjct  215  TGRTTSAGIAIGSEMSGGVSEVYAEDIYIFDSKSAIRIKTSPGRGGYVRNVYISNMTLIN  274

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
                IR  G  G HPD+ ++ +A+P+++ I + +V GE + + G I+GI    F +ICLS
Sbjct  275  VDIAIRFTGLYGEHPDDSYDRDALPVIERITVVNVIGENIKRAGLIQGIKGDNFVDICLS  334

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTR  228
            NI LN +K   N PW CSD  G +  VSP  C +L  
Sbjct  335  NITLNVSK---NNPWNCSDVKGYSELVSPESCEQLNE  368



>ref|XP_010091430.1| putative polygalacturonase [Morus notabilis]
 gb|EXB44467.1| putative polygalacturonase [Morus notabilis]
Length=468

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 122/216 (56%), Positives = 147/216 (68%), Gaps = 2/216 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP +SPNTDGIDPDSS +VCIED YISTGDDLVA+KSGWDEYGI+ GRPS  I IRR+
Sbjct  219  ILAPPESPNTDGIDPDSSDNVCIEDCYISTGDDLVAIKSGWDEYGISSGRPSTNIIIRRL  278

Query  698  TGSS-PFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
             G S   AGIA+GSE SGGV++V  E+I + N   GI IKT+ GRGG +RNI  S++ M 
Sbjct  279  MGESGRAAGIAIGSEMSGGVSEVRVENIQIFNSRTGIRIKTSPGRGGYVRNIYVSDMKMV  338

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
               T IR     G HPDE ++P A+P+++ I IKDV GE +   G + GI    F NICL
Sbjct  339  NVGTAIRFTSLYGEHPDEFYDPTALPLIERITIKDVVGEDIKIAGVLEGIEGDTFLNICL  398

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            SNI LNG  S ++ PW CS   G +  VSP  C  L
Sbjct  399  SNITLNGITSNKS-PWNCSYIQGFSDLVSPEICEPL  433



>gb|KCW46748.1| hypothetical protein EUGRSUZ_K00562 [Eucalyptus grandis]
Length=444

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 140/215 (65%), Gaps = 3/215 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            I AP DSPNTDGIDPDSS  VCIED YISTGDD++A+KSGWDEYG +YGRPS  I IRR+
Sbjct  196  IRAPLDSPNTDGIDPDSSDDVCIEDCYISTGDDVIAIKSGWDEYGTSYGRPSKNIVIRRL  255

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             G +  +GIA+GSE SGGV+DV AE I   N   GI IKT+ GRGG +RNI  SNV +  
Sbjct  256  IGETHSSGIAIGSEMSGGVSDVHAEDIVFFNSTTGIRIKTSPGRGGYVRNIFISNVSLAN  315

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             +  IR  G  G HPDE ++P A+P ++ I  KD+ GE +   G + GI    F NICL 
Sbjct  316  VKVAIRFTGRYGEHPDESYDPKALPKIERITFKDIHGENITVAGLMEGIEGDNFINICLY  375

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            NI L+   S+   PW CS+  G +  V P  C  L
Sbjct  376  NITLS-VNSI--SPWNCSNVQGFSSLVFPQTCELL  407



>ref|XP_012083013.1| PREDICTED: probable polygalacturonase [Jatropha curcas]
 ref|XP_012083014.1| PREDICTED: probable polygalacturonase [Jatropha curcas]
 gb|KDP28345.1| hypothetical protein JCGZ_14116 [Jatropha curcas]
Length=466

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 143/216 (66%), Gaps = 4/216 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            I AP DSPNTDGIDPDSS  VCIED +ISTGDDL+A+KSGWDEYGI+YGRP   I IRR+
Sbjct  220  IRAPLDSPNTDGIDPDSSDDVCIEDCFISTGDDLIAIKSGWDEYGISYGRPCRNIIIRRL  279

Query  698  TGSS-PFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
             G +   AG+++GSE SGGV++V AE++   N   GI IKT+ GRGG +RNI  SN+ + 
Sbjct  280  IGQTRSSAGLSIGSEMSGGVSEVHAENLQFYNSSTGIRIKTSPGRGGYVRNIHVSNITLI  339

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
              +  IR  G  G HPDE ++P A+PIV+ I I+DV GE +   G + GI    F +ICL
Sbjct  340  DVKIAIRFTGLYGEHPDEHYDPAALPIVERITIEDVTGENIEYAGILDGIQADAFLDICL  399

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            SNI LN      N PW CS   G +  VSP  C  L
Sbjct  400  SNITLNVTS---NSPWNCSYVQGYSDSVSPETCEPL  432



>ref|XP_002962842.1| hypothetical protein SELMODRAFT_78556 [Selaginella moellendorffii]
 gb|EFJ36305.1| hypothetical protein SELMODRAFT_78556 [Selaginella moellendorffii]
Length=439

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 150/221 (68%), Gaps = 3/221 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSSS+VCI+D YIS GDD++A+KSGWDEYGIAYG+PS  I IRRV
Sbjct  208  ILAPQDSPNTDGIDPDSSSNVCIQDCYISNGDDMIAIKSGWDEYGIAYGQPSSNIHIRRV  267

Query  698  TGSSPF-AGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            TG +   A IA+GSETSGG+ +VL E +   +   G+ I+T VGRG  IRN+  S++ + 
Sbjct  268  TGQTKRGAAIAIGSETSGGIENVLVEDLVAVSTKSGVSIRTGVGRGAYIRNVVLSSITLL  327

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
              +T I I+G    HPD  +N  A P+V+ + ++ V G  + +PG I GIP+ PF +ICL
Sbjct  328  DIQTAITISGFSSEHPDNGYNATAFPVVEKVTVRGVTGNTLDRPGRILGIPEVPFRDICL  387

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQS  219
             +I L+ +  L    WKC+D  G +  V+P  C EL+ + S
Sbjct  388  EDIALDASTGLT--AWKCTDVEGYSSSVTPKICKELSENNS  426



>ref|XP_008227776.1| PREDICTED: probable polygalacturonase [Prunus mume]
 ref|XP_008227777.1| PREDICTED: probable polygalacturonase [Prunus mume]
Length=467

 Score =   224 bits (570),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 144/216 (67%), Gaps = 4/216 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            I+AP  SPNTDGIDPDSS +VCIED YISTGDDL+A+KSGWDEYGI+YGRPS  I IRR+
Sbjct  221  IIAPPKSPNTDGIDPDSSDNVCIEDCYISTGDDLIAIKSGWDEYGISYGRPSRNIIIRRI  280

Query  698  TGSSPF-AGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            TG +   AGIA+GSE SGGV++V AE++   N   GI IKT+ GRGG ++NI  SNV ++
Sbjct  281  TGKTETSAGIAIGSEMSGGVSEVHAENLHFFNSKTGIRIKTSPGRGGYVKNIYVSNVTLD  340

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
                 IR     G HPDE ++PNA+PI++ I  KDV G+ +   G + G+    F +ICL
Sbjct  341  GIDIAIRFTSHYGEHPDEFYDPNALPIIEQITFKDVVGKNIKTAGLLEGLEGDTFMDICL  400

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            SNI LN        PW CS   G +  VSP  C  L
Sbjct  401  SNITLNVTS---KSPWICSSIQGYSDLVSPETCEPL  433



>ref|XP_007221479.1| hypothetical protein PRUPE_ppa005310mg [Prunus persica]
 gb|EMJ22678.1| hypothetical protein PRUPE_ppa005310mg [Prunus persica]
Length=467

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/216 (53%), Positives = 143/216 (66%), Gaps = 4/216 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            I+AP  SPNTDGIDPDSS +VCIED YISTGDDL+A+KSGWDEYGI+YGRPS  I IRR+
Sbjct  221  IIAPPKSPNTDGIDPDSSDNVCIEDCYISTGDDLIAIKSGWDEYGISYGRPSRNIIIRRI  280

Query  698  TGSSPF-AGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
             G +   AGIA+GSE SGGV++V AE++   N   GI IKT+ GRGG ++NI  SNV ++
Sbjct  281  AGKTETSAGIAIGSEMSGGVSEVHAENLHFFNSKTGIRIKTSPGRGGYVKNIFVSNVTLD  340

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
                 IR     G HPDE ++PNA+PI++ I  KD  G+ +   G + G+    F +ICL
Sbjct  341  GIDIAIRFTSHYGEHPDEFYDPNALPIIEQITFKDFVGKNIKTAGLLEGLEGDTFLDICL  400

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            SNI LN        PWKCS   G +  VSP  C  L
Sbjct  401  SNITLNVTS---KSPWKCSSIQGYSDLVSPETCEPL  433



>ref|XP_010035373.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 ref|XP_010035375.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 ref|XP_010035376.1| PREDICTED: probable polygalacturonase [Eucalyptus grandis]
 gb|KCW46747.1| hypothetical protein EUGRSUZ_K00562 [Eucalyptus grandis]
Length=468

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 140/215 (65%), Gaps = 3/215 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            I AP DSPNTDGIDPDSS  VCIED YISTGDD++A+KSGWDEYG +YGRPS  I IRR+
Sbjct  220  IRAPLDSPNTDGIDPDSSDDVCIEDCYISTGDDVIAIKSGWDEYGTSYGRPSKNIVIRRL  279

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             G +  +GIA+GSE SGGV+DV AE I   N   GI IKT+ GRGG +RNI  SNV +  
Sbjct  280  IGETHSSGIAIGSEMSGGVSDVHAEDIVFFNSTTGIRIKTSPGRGGYVRNIFISNVSLAN  339

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
             +  IR  G  G HPDE ++P A+P ++ I  KD+ GE +   G + GI    F NICL 
Sbjct  340  VKVAIRFTGRYGEHPDESYDPKALPKIERITFKDIHGENITVAGLMEGIEGDNFINICLY  399

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            NI L+   S+   PW CS+  G +  V P  C  L
Sbjct  400  NITLS-VNSI--SPWNCSNVQGFSSLVFPQTCELL  431



>gb|AES61557.2| polygalacturonase/glycoside hydrolase family protein [Medicago 
truncatula]
Length=510

 Score =   223 bits (569),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 111/217 (51%), Positives = 148/217 (68%), Gaps = 3/217 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            I+ P  SPNTDGIDPDSS +VCIED YISTGDDL+++KSGWDEYGI++GRPS  I+I R+
Sbjct  259  IIVPFGSPNTDGIDPDSSDNVCIEDCYISTGDDLISIKSGWDEYGISFGRPSTNISIHRL  318

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TG +  AGIA+GSE SGGV++V AE I + +    I IKT+ GRGG +RN+  SN+ +  
Sbjct  319  TGRTTSAGIAIGSEMSGGVSEVYAEDIYIFDSKSAIRIKTSPGRGGYVRNVYISNMTLIN  378

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
                IR  G  G HPD+ ++ +A+P+++ I + +V GE + + G I+GI    F +ICLS
Sbjct  379  VDIAIRFTGLYGEHPDDSYDRDALPVIERITVVNVIGENIKRAGLIQGIKGDNFVDICLS  438

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTR  228
            NI LN +K   N PW CSD  G +  VSP  C +L  
Sbjct  439  NITLNVSK---NNPWNCSDVKGYSELVSPESCEQLNE  472



>emb|CDX67875.1| BnaA07g19150D [Brassica napus]
Length=458

 Score =   222 bits (565),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 112/222 (50%), Positives = 146/222 (66%), Gaps = 5/222 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDG+DPDSS++VCIED YI TGDDLV++KSGWDEYGI+Y RPS  I I R+
Sbjct  207  ILAPLDSPNTDGVDPDSSTNVCIEDCYIVTGDDLVSIKSGWDEYGISYARPSSKIKINRL  266

Query  698  TG-SSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            TG ++  +GIA+GSE SGGV+D+  + + L N   GI IKT+ GRGG +RN+  SNV   
Sbjct  267  TGQTTSSSGIAIGSEMSGGVSDIYIKDLHLFNSNTGIRIKTSPGRGGYVRNVHVSNVKFH  326

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
              +  IR  G  G HPDE F+P A+P+++ I  +++ GE +   G + GI    F NIC 
Sbjct  327  NVQKAIRFTGKYGEHPDENFDPKALPVIEKITFENINGEDIGVAGLLEGIEGDEFKNICF  386

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQSG  216
             N+ L   K+ +  PWKCS   G +  VSP    E+T D  G
Sbjct  387  LNVTLTVKKNSKKAPWKCSHVRGYSQWVSP----EITCDSFG  424



>ref|XP_009104364.1| PREDICTED: probable polygalacturonase [Brassica rapa]
 ref|XP_009104365.1| PREDICTED: probable polygalacturonase [Brassica rapa]
 ref|XP_009104366.1| PREDICTED: probable polygalacturonase [Brassica rapa]
 ref|XP_009104367.1| PREDICTED: probable polygalacturonase [Brassica rapa]
 ref|XP_009104368.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=472

 Score =   222 bits (566),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 112/222 (50%), Positives = 146/222 (66%), Gaps = 5/222 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDG+DPDSS++VCIED YI TGDDLV++KSGWDEYGI+Y RPS  I I R+
Sbjct  221  ILAPLDSPNTDGVDPDSSTNVCIEDCYIVTGDDLVSIKSGWDEYGISYARPSSKIKINRL  280

Query  698  TG-SSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            TG ++  +GIA+GSE SGGV+D+  + + L N   GI IKT+ GRGG +RN+  SNV   
Sbjct  281  TGQTTSSSGIAIGSEMSGGVSDIYIKDLHLFNSNTGIRIKTSPGRGGYVRNVHVSNVKFH  340

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
              +  IR  G  G HPDE F+P A+P+++ I  +++ GE +   G + GI    F NIC 
Sbjct  341  NVQKAIRFTGKYGEHPDENFDPKALPVIEKITFENINGEDIGVAGLLEGIEGDEFKNICF  400

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQSG  216
             N+ L   K+ +  PWKCS   G +  VSP    E+T D  G
Sbjct  401  LNVTLTVKKNSKKAPWKCSHVRGYSQWVSP----EITCDSFG  438



>emb|CDY25090.1| BnaC06g18320D [Brassica napus]
Length=458

 Score =   221 bits (564),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 146/222 (66%), Gaps = 5/222 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDG+DPDSS++VCIED YI TGDDLV++KSGWDEYGI+Y RPS  I I RV
Sbjct  207  ILAPLDSPNTDGVDPDSSTNVCIEDCYIVTGDDLVSIKSGWDEYGISYARPSSKIKINRV  266

Query  698  TG-SSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            TG ++  +GIA+GSE SGGV+D+  + + L N   GI IKT+ GRGG +RN+  SNV   
Sbjct  267  TGQTTSSSGIAIGSEMSGGVSDIYIKDLHLFNSNTGIRIKTSPGRGGYVRNVHVSNVKFH  326

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
              +  IR  G  G HPDE F+P A+P+++ I  ++V GE +   G + GI    F NIC 
Sbjct  327  NVQKAIRFTGKYGEHPDENFDPKALPVIEKITFENVNGEGIGVAGLLEGIEGDEFKNICF  386

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQSG  216
             N+ L   K+ +  PWKCS   G +  VSP    E+T D  G
Sbjct  387  LNVTLIVKKNSKKAPWKCSHVRGYSQWVSP----EITCDSFG  424



>ref|XP_004288344.1| PREDICTED: probable polygalacturonase isoform X1 [Fragaria vesca 
subsp. vesca]
Length=466

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 144/221 (65%), Gaps = 4/221 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP +SPNTDGIDPDSS +VCIED YISTGDDL+++KSGWDEYGI+YGRPS  I IR +
Sbjct  230  ILAPLNSPNTDGIDPDSSDNVCIEDCYISTGDDLISIKSGWDEYGISYGRPSRNILIRGI  289

Query  698  TGSSPF-AGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            TG S   AGI++GSE SGGV++V AE++       GI IKT+ GRGG +RNI  SN+ ++
Sbjct  290  TGKSQTSAGISIGSEMSGGVSEVHAENLQFFGSHTGIRIKTSPGRGGYVRNICVSNMTLD  349

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
                 IR     G HPDE ++P+A+PI++ I  KDV G+ +   G + G+    F NICL
Sbjct  350  GVYIAIRFTSQYGEHPDEFYDPSALPIIEHITFKDVLGDNIKIAGLLEGLEGGSFQNICL  409

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQS  219
            SNI LN        PW CS   G +  VSP  C  L    S
Sbjct  410  SNIFLNVTS---KSPWNCSSIHGYSYLVSPEICEPLKESIS  447



>ref|XP_011467185.1| PREDICTED: probable polygalacturonase isoform X2 [Fragaria vesca 
subsp. vesca]
Length=457

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 144/221 (65%), Gaps = 4/221 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP +SPNTDGIDPDSS +VCIED YISTGDDL+++KSGWDEYGI+YGRPS  I IR +
Sbjct  221  ILAPLNSPNTDGIDPDSSDNVCIEDCYISTGDDLISIKSGWDEYGISYGRPSRNILIRGI  280

Query  698  TGSSPF-AGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            TG S   AGI++GSE SGGV++V AE++       GI IKT+ GRGG +RNI  SN+ ++
Sbjct  281  TGKSQTSAGISIGSEMSGGVSEVHAENLQFFGSHTGIRIKTSPGRGGYVRNICVSNMTLD  340

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
                 IR     G HPDE ++P+A+PI++ I  KDV G+ +   G + G+    F NICL
Sbjct  341  GVYIAIRFTSQYGEHPDEFYDPSALPIIEHITFKDVLGDNIKIAGLLEGLEGGSFQNICL  400

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQS  219
            SNI LN        PW CS   G +  VSP  C  L    S
Sbjct  401  SNIFLNVTS---KSPWNCSSIHGYSYLVSPEICEPLKESIS  438



>ref|XP_009363066.1| PREDICTED: probable polygalacturonase isoform X2 [Pyrus x bretschneideri]
Length=467

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 143/221 (65%), Gaps = 4/221 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP  SPNTDGIDPDSS +VCIED YISTGDDL+++KSGWDEYGI+YGRPS  I I R+
Sbjct  220  ILAPLKSPNTDGIDPDSSDNVCIEDCYISTGDDLISIKSGWDEYGISYGRPSRNIIIHRI  279

Query  698  TGSSPF-AGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            TG +   AGIA+GSE SGGV++V  E +       GI IKT+ GRGG +RNI  SN+ ++
Sbjct  280  TGKTETSAGIAIGSEMSGGVSEVHVEDLHFFGSKTGIRIKTSPGRGGYVRNIYVSNMNLD  339

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
                 +R     G HPDE ++PNA+P V+ I  KD+ GE +   G + G+    F NICL
Sbjct  340  GVGIALRFTSQYGEHPDEFYDPNALPNVERITFKDIIGENIKTAGLLEGLEGENFLNICL  399

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQS  219
            SNI LN        PWKCS   G +  VSP  C+ L  + S
Sbjct  400  SNITLNVTS---KSPWKCSSVQGYSDLVSPETCAPLKENLS  437



>ref|XP_008381624.1| PREDICTED: probable polygalacturonase [Malus domestica]
Length=479

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/222 (53%), Positives = 146/222 (66%), Gaps = 6/222 (3%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP  SPNTDGIDPDSS +VCIED YISTGDDL+++KSGWDEYGI+YGRPS  I I R+
Sbjct  232  ILAPLKSPNTDGIDPDSSDNVCIEDCYISTGDDLISIKSGWDEYGISYGRPSRNIIIHRI  291

Query  698  TGSSPF-AGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            TG +   AGIA+GSE SGGV++V  E +       GI IKT+ GRGG +RNI  SN+ ++
Sbjct  292  TGKTETSAGIAIGSEMSGGVSEVHVEDLHFFGSKTGIRIKTSPGRGGYVRNIYVSNMNLD  351

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
                 +R     G HPDE +NPNA+P V+ I  K++ GE +   G + G+    F NICL
Sbjct  352  GVGIALRFTSQYGEHPDEFYNPNALPKVERITFKNIIGENIKTAGLLEGLEGEKFLNICL  411

Query  341  SNIHLN-GAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQS  219
            SNI LN  +KS    PWKCS   G +  VSP  C+ L  + S
Sbjct  412  SNITLNVRSKS----PWKCSSVQGYSDLVSPETCAPLKENIS  449



>ref|XP_009363065.1| PREDICTED: probable polygalacturonase isoform X1 [Pyrus x bretschneideri]
Length=482

 Score =   221 bits (564),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 143/221 (65%), Gaps = 4/221 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP  SPNTDGIDPDSS +VCIED YISTGDDL+++KSGWDEYGI+YGRPS  I I R+
Sbjct  235  ILAPLKSPNTDGIDPDSSDNVCIEDCYISTGDDLISIKSGWDEYGISYGRPSRNIIIHRI  294

Query  698  TGSSPF-AGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            TG +   AGIA+GSE SGGV++V  E +       GI IKT+ GRGG +RNI  SN+ ++
Sbjct  295  TGKTETSAGIAIGSEMSGGVSEVHVEDLHFFGSKTGIRIKTSPGRGGYVRNIYVSNMNLD  354

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
                 +R     G HPDE ++PNA+P V+ I  KD+ GE +   G + G+    F NICL
Sbjct  355  GVGIALRFTSQYGEHPDEFYDPNALPNVERITFKDIIGENIKTAGLLEGLEGENFLNICL  414

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQS  219
            SNI LN        PWKCS   G +  VSP  C+ L  + S
Sbjct  415  SNITLNVTS---KSPWKCSSVQGYSDLVSPETCAPLKENLS  452



>ref|XP_003591306.1| Polygalacturonase-like protein [Medicago truncatula]
Length=601

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 148/215 (69%), Gaps = 3/215 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            I+ P  SPNTDGIDPDSS +VCIED YISTGDDL+++KSGWDEYGI++GRPS  I+I R+
Sbjct  350  IIVPFGSPNTDGIDPDSSDNVCIEDCYISTGDDLISIKSGWDEYGISFGRPSTNISIHRL  409

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
            TG +  AGIA+GSE SGGV++V AE I + +    I IKT+ GRGG +RN+  SN+ +  
Sbjct  410  TGRTTSAGIAIGSEMSGGVSEVYAEDIYIFDSKSAIRIKTSPGRGGYVRNVYISNMTLIN  469

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
                IR  G  G HPD+ ++ +A+P+++ I + +V GE + + G I+GI    F +ICLS
Sbjct  470  VDIAIRFTGLYGEHPDDSYDRDALPVIERITVVNVIGENIKRAGLIQGIKGDNFVDICLS  529

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            NI LN +K   N PW CSD  G +  VSP  C +L
Sbjct  530  NITLNVSK---NNPWNCSDVKGYSELVSPESCEQL  561



>ref|XP_010544930.1| PREDICTED: probable polygalacturonase, partial [Tarenaya hassleriana]
Length=261

 Score =   214 bits (546),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 140/210 (67%), Gaps = 2/210 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP +SPNTDG+DPDSS+ VCIED YI TGDDLV++KSGWDEYGI+Y RPS  I I R+
Sbjct  12   ILAPLESPNTDGVDPDSSNDVCIEDCYIVTGDDLVSIKSGWDEYGISYARPSTRIKISRL  71

Query  698  TG-SSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            TG ++  +GIA+GSE SGGV+++  E + L N   GI IKT+ GRGG +RN+  SNV +E
Sbjct  72   TGQTTSSSGIAIGSEMSGGVSEIHVEDVHLYNSKTGIRIKTSPGRGGYVRNVYVSNVKLE  131

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
                 IR  G  G HPD +++P A P+++ I  ++  G+ +   G  +GI    F NICL
Sbjct  132  NVSIAIRFTGQYGEHPDGKYDPKAFPLIEKITFENFTGDSIGVAGLFQGIEGDEFKNICL  191

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSP  252
             N+ L   KS R  PWKCS   G +  VSP
Sbjct  192  VNVSLQ-VKSSRKSPWKCSYVRGYSQWVSP  220



>gb|KHN00242.1| Putative polygalacturonase [Glycine soja]
Length=472

 Score =   220 bits (561),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 145/215 (67%), Gaps = 3/215 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            I+AP  SPNTDGI+PDSS +VCIED YISTGDDL+++KSGWD YGI++GRPS  I IRR+
Sbjct  228  IIAPLSSPNTDGINPDSSDNVCIEDCYISTGDDLISIKSGWDGYGISFGRPSTNINIRRL  287

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             G +  AGIA+GSE SGGV++V AE I + +    I IKT+ GRGG +RN+  SN+ +  
Sbjct  288  IGKTTSAGIAIGSEMSGGVSEVHAEDIYIFDSHSAIRIKTSPGRGGYVRNVYISNMILAN  347

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
                IR  G  G HPD+ ++P+A+P+++ I IKDV G +V   G I+GI    F NICLS
Sbjct  348  VDIAIRFTGLYGEHPDDTYDPDALPVIERITIKDVIGVKVKHAGLIQGIKGDNFVNICLS  407

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            NI LN +  L   PW CS   G +  VSP  C  L
Sbjct  408  NITLNVSSKL---PWNCSYIKGFSDLVSPEACEPL  439



>ref|XP_003519731.2| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=464

 Score =   220 bits (560),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 145/215 (67%), Gaps = 3/215 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            I+AP  SPNTDGI+PDSS +VCIED YISTGDDL+++KSGWD YGI++GRPS  I IRR+
Sbjct  220  IIAPLSSPNTDGINPDSSDNVCIEDCYISTGDDLISIKSGWDGYGISFGRPSTNINIRRL  279

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             G +  AGIA+GSE SGGV++V AE I + +    I IKT+ GRGG +RN+  SN+ +  
Sbjct  280  IGKTTSAGIAIGSEMSGGVSEVHAEDIYIFDSHSAIRIKTSPGRGGYVRNVYISNMILAN  339

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
                IR  G  G HPD+ ++P+A+P+++ I IKDV G +V   G I+GI    F NICLS
Sbjct  340  VDIAIRFTGLYGEHPDDTYDPDALPVIERITIKDVIGVKVKHAGLIQGIKGDNFVNICLS  399

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            NI LN +  L   PW CS   G +  VSP  C  L
Sbjct  400  NITLNVSSKL---PWNCSYIKGFSDLVSPEACEPL  431



>ref|XP_010914786.1| PREDICTED: probable polygalacturonase [Elaeis guineensis]
Length=470

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/225 (50%), Positives = 149/225 (66%), Gaps = 4/225 (2%)
 Frame = -1

Query  905  AMLLFDMSPILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRP  726
            + +L     ILAP DSPNTDGIDPDSS++VCIED YISTGDDL+ +KSGWDEYGI++  P
Sbjct  212  SQVLVQNVTILAPLDSPNTDGIDPDSSTNVCIEDCYISTGDDLIVIKSGWDEYGISFAYP  271

Query  725  SHGITIRRVTGSSPF-AGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRN  549
            S  I+IRR+ G +   AGIA GSE SGG+++V AE I L N   GI +KT+ GRGG +RN
Sbjct  272  SSNISIRRIAGETKSGAGIAFGSEMSGGISEVEAEGIHLFNSLHGIRLKTSPGRGGYVRN  331

Query  548  ITFSNVYMEKTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIP  369
            I  S+V M   +  IRI G    HPD++++ NA+P++  I IKD+ G  +   G + GI 
Sbjct  332  IYISDVTMTDVKIAIRITGQYDEHPDDKYDENALPLINRITIKDIVGVNISIAGLLEGIR  391

Query  368  KSPFTNICLSNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
               F++ICLSN+ L+      +PPW+CS   G +  VSP  C  L
Sbjct  392  GDNFSSICLSNVFLDATA---DPPWRCSYIQGYSNLVSPESCEPL  433



>ref|XP_007051305.1| Pectin lyase-like superfamily protein isoform 4 [Theobroma cacao]
 gb|EOX95462.1| Pectin lyase-like superfamily protein isoform 4 [Theobroma cacao]
Length=360

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 141/216 (65%), Gaps = 4/216 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS  VCIED YISTGDDL+A+KSGWDEYGI++  PS  ITIR +
Sbjct  112  ILAPLDSPNTDGIDPDSSDDVCIEDCYISTGDDLIAIKSGWDEYGISFAHPSTNITIRGL  171

Query  698  TGSSPF-AGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            TG +   +GIA+GSE SGGV++V AE+I   N    I IKT  GRGG +RNI  SNV + 
Sbjct  172  TGHNRNGSGIAIGSEMSGGVSEVYAENIFFFNTSTAIIIKTARGRGGYVRNIYISNVTLA  231

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
               T ++   +   HPDE ++PNA+P+++ I IKDV G+ +   G ++GI    F N+CL
Sbjct  232  GVDTALKFNSNFSQHPDEFYDPNALPVIERITIKDVVGDNIKVAGLLKGIEGDSFRNVCL  291

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
             NI LN         W CS+  G +  VSP  C  L
Sbjct  292  LNITLNVTSE---SSWNCSNIRGYSALVSPETCEPL  324



>ref|XP_007145093.1| hypothetical protein PHAVU_007G209200g [Phaseolus vulgaris]
 gb|ESW17087.1| hypothetical protein PHAVU_007G209200g [Phaseolus vulgaris]
Length=464

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 111/217 (51%), Positives = 144/217 (66%), Gaps = 3/217 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ++AP  SPNTDGI+PDSS +VCIED YISTGDDL+++KSGWD YGI++GRPS  I IRR+
Sbjct  222  VIAPHGSPNTDGINPDSSDNVCIEDCYISTGDDLISIKSGWDGYGISFGRPSTNINIRRL  281

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             G +  AGIA+GSE SGGV++V AE I + N    + IKT+ GRGG +RN+  SN+ +  
Sbjct  282  IGKTTSAGIAIGSEMSGGVSEVHAEDIYIFNSRSAVRIKTSPGRGGYVRNVYISNMVLAN  341

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
                IR  G  G HPD+ ++  A+P+++ I IKDV GE+V + G I+GI    F NICLS
Sbjct  342  VDIAIRFTGLYGEHPDDNYDQEALPVIERITIKDVIGEKVKRAGLIQGIKGDNFVNICLS  401

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTR  228
            NI L+    L   PW CS   G +  VSP  C  L  
Sbjct  402  NITLHVTSKL---PWNCSYVKGYSDLVSPEACEPLNE  435



>ref|XP_007163248.1| hypothetical protein PHAVU_001G218400g [Phaseolus vulgaris]
 gb|ESW35242.1| hypothetical protein PHAVU_001G218400g [Phaseolus vulgaris]
Length=465

 Score =   218 bits (555),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/216 (53%), Positives = 138/216 (64%), Gaps = 4/216 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            I AP DSPNTDGIDPDSS +VCIED YISTGDDL+A+KSGWDEYGI YGRP   I I R+
Sbjct  219  IFAPLDSPNTDGIDPDSSDNVCIEDCYISTGDDLIAIKSGWDEYGIRYGRPCTNIIIHRL  278

Query  698  TGSSPF-AGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
             G +   AGIA+GSE SGGV++V  E I   +    I IKT+ GRGG +RNI  +NV + 
Sbjct  279  VGKTQTSAGIAIGSEMSGGVSEVHIEDIQFYDSHTAIRIKTSPGRGGYVRNIYVTNVTLA  338

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
                 IR  G  G HPD+ ++P A+P+++ I IKDV GE +   G I GI    F N+CL
Sbjct  339  NVDIAIRFTGLYGEHPDDAYDPKALPVIEKITIKDVVGENIKTAGLIEGIEGDNFVNVCL  398

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            SNI LN +    N PW CS   G +  V P  C  L
Sbjct  399  SNIVLNVSS---NYPWNCSYVKGYSDLVLPEACEPL  431



>ref|XP_006656549.1| PREDICTED: probable polygalacturonase-like [Oryza brachyantha]
Length=479

 Score =   218 bits (554),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 146/224 (65%), Gaps = 2/224 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAPT SPNTDGI+PDS SHV IED YI +GDD VA+KSGWDEYGIAYG PS  I +RR+
Sbjct  233  ILAPTHSPNTDGINPDSCSHVRIEDCYIVSGDDCVAIKSGWDEYGIAYGMPSQHIVVRRL  292

Query  698  TGSSPFAG-IAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            T  SP +  IA+GSE SGG+ DV AE IT  N   G+ IKT VGRG  +R++    + ++
Sbjct  293  TCVSPTSAVIALGSEMSGGINDVRAEDITAVNSESGVRIKTAVGRGAYVRDVFVRRMSLD  352

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
              +    + G+   HPD++++PNAIP+V++I  +DV    V     + GI  +PF +IC+
Sbjct  353  TMKWVFWMTGNYKSHPDDKYDPNAIPVVENISYQDVVATAVNTAARLEGIQGAPFRDICI  412

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQSGAC  210
            +N+    AKS R  PW C+D  G +  V+PSPC  L     GAC
Sbjct  413  ANVTATLAKS-RKYPWTCTDVEGVSAGVTPSPCQPLQGSHDGAC  455



>ref|XP_006444619.1| hypothetical protein CICLE_v10020035mg [Citrus clementina]
 ref|XP_006492425.1| PREDICTED: probable polygalacturonase-like [Citrus sinensis]
 gb|ESR57859.1| hypothetical protein CICLE_v10020035mg [Citrus clementina]
 gb|KDO86775.1| hypothetical protein CISIN_1g012308mg [Citrus sinensis]
Length=466

 Score =   217 bits (553),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 141/216 (65%), Gaps = 4/216 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            I AP DSPNTDGIDPDSS  VCI+D YISTGDDLV++KSGWDEYGI+YGRPS  ITI  +
Sbjct  220  IRAPLDSPNTDGIDPDSSDDVCIKDCYISTGDDLVSIKSGWDEYGISYGRPSTKITIHGL  279

Query  698  TGSSPF-AGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
             G +   AGIA+GSE SGGV++V AE++   N   GI IKT+ GRGG +RNI+ SNV + 
Sbjct  280  IGETKLGAGIAIGSEMSGGVSEVHAENLYFFNSVRGIRIKTSPGRGGYVRNISISNVTLN  339

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
                 I   G  G HPD+ ++P+A+PI++ I IK+V GE V   G + GI    F  ICL
Sbjct  340  HVDVAIIFTGHFGEHPDDSYDPSALPIIERITIKNVIGENVKMAGQLEGIEGDTFRYICL  399

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            SNI LNG       PW CS   G +  V P  C  L
Sbjct  400  SNIKLNGVSE---SPWNCSYIQGYSDLVFPETCDPL  432



>ref|XP_001781065.1| predicted protein [Physcomitrella patens]
 gb|EDQ54091.1| predicted protein [Physcomitrella patens]
Length=446

 Score =   216 bits (551),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 143/224 (64%), Gaps = 4/224 (2%)
 Frame = -1

Query  890  DMSPILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGIT  711
            DM+ +LAP +SPNTDGIDPDSS +VCIED YIS GDD +A+KSGWDEYG AYG PS  I 
Sbjct  223  DMT-LLAPLNSPNTDGIDPDSSQYVCIEDCYISVGDDAIAIKSGWDEYGTAYGMPSQHID  281

Query  710  IRR-VTGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSN  534
            IRR V  S   AGIA GSE SGG++DV  +H+ +     GI  KT  GRGG IRNIT  N
Sbjct  282  IRRIVVHSETSAGIAFGSEMSGGISDVKVDHMMIFGARWGIRFKTGPGRGGYIRNITVDN  341

Query  533  VYMEKTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFT  354
            V M    T I   G+ G HPDE +N    P+++++ I+++ GE +   G   G+P+SPF 
Sbjct  342  VNMRSVNTAIAFTGNYGEHPDENWNRTDYPVIENVLIENIVGEDITHAGLFLGLPESPFL  401

Query  353  NICLSNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQ  222
            NI L+NI L+      +  W CS  +G    V P PC + T+++
Sbjct  402  NIHLANIALDTKSESED--WNCSSVAGTYFFVWPQPCPDFTKEE  443



>emb|CDY11403.1| BnaA09g39690D [Brassica napus]
Length=460

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 141/210 (67%), Gaps = 1/210 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDG+DPDSS++VCIED YI TGDDLV++KSGWDEYGI+Y RPS  I I R+
Sbjct  209  ILAPLDSPNTDGVDPDSSTNVCIEDCYIVTGDDLVSIKSGWDEYGISYARPSSKIKINRL  268

Query  698  TG-SSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            TG ++  +GIA+GSE SGGV+D+  + + L N   GI IKT+ GRGG +RN+  SNV ++
Sbjct  269  TGQTTSSSGIAIGSEMSGGVSDIYIKDLHLFNSNTGIRIKTSPGRGGYVRNVHVSNVKLD  328

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
              +  IR  G  G HPD  F+  A+P ++ I  ++V GE +   G + GI    F NIC 
Sbjct  329  NVKKAIRFTGKYGEHPDGNFDTKALPAIEKITFENVSGEDIGVAGLLEGIEGDEFKNICF  388

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSP  252
             N+ L   K+ +  PW+CS+  G +  VSP
Sbjct  389  LNVTLTVKKNSKKAPWRCSNVRGYSQWVSP  418



>ref|XP_008810120.1| PREDICTED: probable polygalacturonase isoform X2 [Phoenix dactylifera]
Length=441

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 147/220 (67%), Gaps = 3/220 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGI+PDS S+V IED +I +GDD +A+KSGWDEYGIA+  P+  + IRR+
Sbjct  193  ILAPVDSPNTDGINPDSCSNVFIEDCFIVSGDDCIAIKSGWDEYGIAFNMPTQHVIIRRL  252

Query  698  TGSSPF-AGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            +  SP  A IA+GSE SGGV D+ AE IT  N   G+ IKT +GRGG I++I    + + 
Sbjct  253  SCISPSSATIALGSEMSGGVQDIRAEDITAINTESGVRIKTAIGRGGYIKDIFVRRMTLN  312

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
              +    + G+ G HPD+ ++PNAIP+VQ+I   DV  E V   G + GIPK+PFT ICL
Sbjct  313  AMKYVFWMTGNYGQHPDDNYDPNAIPLVQNINYSDVVAENVTIAGKLEGIPKAPFTGICL  372

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQ  222
            SN+ ++  KS +   W C+D  G +  V P+PC  L RDQ
Sbjct  373  SNVTVDVVKS-KKLKWNCTDVEGVSSAVVPTPCDSL-RDQ  410



>ref|XP_007160099.1| hypothetical protein PHAVU_002G292300g [Phaseolus vulgaris]
 gb|ESW32093.1| hypothetical protein PHAVU_002G292300g [Phaseolus vulgaris]
Length=469

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 147/227 (65%), Gaps = 4/227 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP  SPNTDGI+PDS ++  IED YI +GDD VAVKSGWDEYGIAYG P+  + IRR+
Sbjct  220  ILAPVTSPNTDGINPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIAYGMPTKQLVIRRL  279

Query  698  TGSSPFAG-IAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            T  SPF+  IA+GSE SGG+ DV AE I   N   G+ IKT VGRGG +++I    + M+
Sbjct  280  TCISPFSAVIALGSEMSGGIQDVRAEDIVAINTESGVRIKTAVGRGGYVKDIYVRRMTMK  339

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
              +    + G+ G H D++++PNA+P++Q+I  +D+  E V     + GI   PFT IC+
Sbjct  340  TMKWAFWMTGNYGSHADDKYDPNALPVIQNINYRDMVAENVTMAARLEGISGDPFTGICI  399

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCS---ELTRDQSGAC  210
            SN+ +  AK  +  PW C+D  G +  V+P+PC+   E   +  GAC
Sbjct  400  SNVTIQLAKKAKKVPWTCTDIDGISSDVTPAPCNLLPEQGEENIGAC  446



>gb|KHN16795.1| Putative polygalacturonase [Glycine soja]
Length=434

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 146/227 (64%), Gaps = 4/227 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP  SPNTDGI+PDS +   IED YI +GDD VAVKSGWDEYGIAYG P+  + IRR+
Sbjct  185  ILAPVTSPNTDGINPDSCTDTRIEDCYIVSGDDCVAVKSGWDEYGIAYGMPTKQLVIRRL  244

Query  698  TGSSPF-AGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            T  SPF A IA+GSE SGG+ D+ AE I   N   G+ IKT VGRGG +++I    + M+
Sbjct  245  TCISPFSAAIALGSEMSGGIQDMRAEDIVAINTESGVRIKTAVGRGGYVKDIFVRRMTMK  304

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
              +    + G+ G H D+ ++PNA+P++Q+I  +D+  E V     + GI   PFT IC+
Sbjct  305  TMKWAFWMTGNYGSHADDNYDPNALPVIQNINYRDMVAENVTMAARLEGISGDPFTGICI  364

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT---RDQSGAC  210
            SN+ +  AK  +  PW C+D +G +  V+P+PC  L     ++ GAC
Sbjct  365  SNVTIQLAKKAKKVPWTCTDIAGISSDVTPAPCDLLPDQGEEKIGAC  411



>ref|XP_009116889.1| PREDICTED: probable polygalacturonase [Brassica rapa]
 ref|XP_009116890.1| PREDICTED: probable polygalacturonase [Brassica rapa]
 ref|XP_009116891.1| PREDICTED: probable polygalacturonase [Brassica rapa]
Length=471

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 141/210 (67%), Gaps = 1/210 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDG+DPDSS++VCIED YI TGDDLV++KSGWDEYGI+Y RPS  I I R+
Sbjct  220  ILAPLDSPNTDGVDPDSSTNVCIEDCYIVTGDDLVSIKSGWDEYGISYARPSSKIKINRL  279

Query  698  TG-SSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            TG ++  +GIA+GSE SGGV+D+  + + L N   GI IKT+ GRGG +RN+  SNV ++
Sbjct  280  TGQTTSSSGIAIGSEMSGGVSDIYIKDLHLFNSNTGIRIKTSPGRGGYVRNVHVSNVKLD  339

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
              +  IR  G  G HPD  F+  A+P ++ I  ++V GE +   G + GI    F NIC 
Sbjct  340  NVKKAIRFTGKYGEHPDGNFDTKALPAIEKITFENVSGEDIGVAGLLEGIEGDEFKNICF  399

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSP  252
             N+ L   K+ +  PW+CS+  G +  VSP
Sbjct  400  LNVTLTVKKNSKKAPWRCSNVRGYSQWVSP  429



>gb|KHM99951.1| Putative polygalacturonase [Glycine soja]
Length=434

 Score =   215 bits (548),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 147/227 (65%), Gaps = 4/227 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP  SPNTDGI+PDS ++  IED YI +GDD VAVKSGWDEYGIAYG P+  + IRR+
Sbjct  185  ILAPVTSPNTDGINPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIAYGMPTKQLVIRRL  244

Query  698  TGSSPFAG-IAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            T  SPF+  IA+GSE SGG+ DV AE I   N   G+ IKT VGRGG +++I    + M+
Sbjct  245  TCISPFSAVIALGSEMSGGIQDVRAEDIVAINSESGVRIKTAVGRGGYVKDIFVRRMTMK  304

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
              +    + G+ G H D+ ++PNA+P++Q+I  +D+  E V     + GI   PFT IC+
Sbjct  305  TMKWAFWMTGNYGSHADDNYDPNALPVIQNINYRDMVAENVTMAARLEGISGDPFTGICI  364

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT---RDQSGAC  210
            SN+ +  AK  +  PW C+D +G +  V+P+PC  L     ++ GAC
Sbjct  365  SNVTIQLAKKAKKVPWTCTDIAGISSDVTPAPCGLLPDQGEEKIGAC  411



>ref|XP_007051302.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007051303.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX95459.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX95460.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
Length=468

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/216 (52%), Positives = 141/216 (65%), Gaps = 4/216 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS  VCIED YISTGDDL+A+KSGWDEYGI++  PS  ITIR +
Sbjct  220  ILAPLDSPNTDGIDPDSSDDVCIEDCYISTGDDLIAIKSGWDEYGISFAHPSTNITIRGL  279

Query  698  TGSSPF-AGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            TG +   +GIA+GSE SGGV++V AE+I   N    I IKT  GRGG +RNI  SNV + 
Sbjct  280  TGHNRNGSGIAIGSEMSGGVSEVYAENIFFFNTSTAIIIKTARGRGGYVRNIYISNVTLA  339

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
               T ++   +   HPDE ++PNA+P+++ I IKDV G+ +   G ++GI    F N+CL
Sbjct  340  GVDTALKFNSNFSQHPDEFYDPNALPVIERITIKDVVGDNIKVAGLLKGIEGDSFRNVCL  399

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
             NI LN         W CS+  G +  VSP  C  L
Sbjct  400  LNITLNVTSE---SSWNCSNIRGYSALVSPETCEPL  432



>ref|XP_008810119.1| PREDICTED: probable polygalacturonase isoform X1 [Phoenix dactylifera]
Length=493

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 147/220 (67%), Gaps = 3/220 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGI+PDS S+V IED +I +GDD +A+KSGWDEYGIA+  P+  + IRR+
Sbjct  245  ILAPVDSPNTDGINPDSCSNVFIEDCFIVSGDDCIAIKSGWDEYGIAFNMPTQHVIIRRL  304

Query  698  TGSSPF-AGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            +  SP  A IA+GSE SGGV D+ AE IT  N   G+ IKT +GRGG I++I    + + 
Sbjct  305  SCISPSSATIALGSEMSGGVQDIRAEDITAINTESGVRIKTAIGRGGYIKDIFVRRMTLN  364

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
              +    + G+ G HPD+ ++PNAIP+VQ+I   DV  E V   G + GIPK+PFT ICL
Sbjct  365  AMKYVFWMTGNYGQHPDDNYDPNAIPLVQNINYSDVVAENVTIAGKLEGIPKAPFTGICL  424

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELTRDQ  222
            SN+ ++  KS +   W C+D  G +  V P+PC  L RDQ
Sbjct  425  SNVTVDVVKS-KKLKWNCTDVEGVSSAVVPTPCDSL-RDQ  462



>gb|KJB49712.1| hypothetical protein B456_008G134500 [Gossypium raimondii]
Length=468

 Score =   215 bits (548),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 142/216 (66%), Gaps = 4/216 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS  VCIED YISTGDDL+++KSGWDEYGI++ RPS  I IRR+
Sbjct  220  ILAPLDSPNTDGIDPDSSDDVCIEDCYISTGDDLISIKSGWDEYGISFARPSRNIIIRRL  279

Query  698  TGSSPF-AGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            TG +   +GIA+GSE SGGV++V AE+I   N   GI +KT  GRGG +RNI  SNV + 
Sbjct  280  TGHNRNGSGIAIGSEMSGGVSEVYAENIYFFNSSTGIILKTARGRGGYVRNIYISNVTLV  339

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
               T I    +   HPDE ++PN++P+++ I  KDV G+ +   G ++GI    F +ICL
Sbjct  340  GVDTAIFFNSNFSQHPDEFYDPNSLPVIERITFKDVIGDNIKVAGLLKGIEGDSFRHICL  399

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
             NI L+        PW CS+  G +  VSP  C  L
Sbjct  400  LNITLDVTTK---SPWNCSNIQGYSSLVSPETCEPL  432



>ref|XP_006580552.1| PREDICTED: probable polygalacturonase-like isoform X2 [Glycine 
max]
Length=469

 Score =   215 bits (548),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 147/227 (65%), Gaps = 4/227 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP  SPNTDGI+PDS ++  IED YI +GDD VAVKSGWDEYGIAYG P+  + IRR+
Sbjct  220  ILAPVTSPNTDGINPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIAYGMPTKQLVIRRL  279

Query  698  TGSSPFAG-IAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            T  SPF+  IA+GSE SGG+ DV AE I   N   G+ IKT VGRGG +++I    + M+
Sbjct  280  TCISPFSAVIALGSEMSGGIQDVRAEDIVAINSESGVRIKTAVGRGGYVKDIFVRRMTMK  339

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
              +    + G+ G H D+ ++PNA+P++Q+I  +D+  E V     + GI   PFT IC+
Sbjct  340  TMKWAFWMTGNYGSHADDNYDPNALPVIQNINYRDMVAENVTMAARLEGISGDPFTGICI  399

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT---RDQSGAC  210
            SN+ +  AK  +  PW C+D +G +  V+P+PC  L     ++ GAC
Sbjct  400  SNVTIQLAKKAKKVPWTCTDIAGISSDVTPAPCGLLPDQGEEKIGAC  446



>gb|KJB49711.1| hypothetical protein B456_008G134500 [Gossypium raimondii]
Length=472

 Score =   215 bits (548),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 142/216 (66%), Gaps = 4/216 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP DSPNTDGIDPDSS  VCIED YISTGDDL+++KSGWDEYGI++ RPS  I IRR+
Sbjct  224  ILAPLDSPNTDGIDPDSSDDVCIEDCYISTGDDLISIKSGWDEYGISFARPSRNIIIRRL  283

Query  698  TGSSPF-AGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            TG +   +GIA+GSE SGGV++V AE+I   N   GI +KT  GRGG +RNI  SNV + 
Sbjct  284  TGHNRNGSGIAIGSEMSGGVSEVYAENIYFFNSSTGIILKTARGRGGYVRNIYISNVTLV  343

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
               T I    +   HPDE ++PN++P+++ I  KDV G+ +   G ++GI    F +ICL
Sbjct  344  GVDTAIFFNSNFSQHPDEFYDPNSLPVIERITFKDVIGDNIKVAGLLKGIEGDSFRHICL  403

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
             NI L+        PW CS+  G +  VSP  C  L
Sbjct  404  LNITLDVTTK---SPWNCSNIQGYSSLVSPETCEPL  436



>ref|XP_002876663.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52922.1| glycoside hydrolase family 28 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=471

 Score =   215 bits (547),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 143/210 (68%), Gaps = 1/210 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP +SPNTDG+DPDSS++VCIED YI TGDDLV++KSGWDEYGI+Y RPS  I I R+
Sbjct  220  ILAPLESPNTDGVDPDSSTNVCIEDCYIVTGDDLVSIKSGWDEYGISYARPSSKIKINRL  279

Query  698  TG-SSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            TG ++  +GIA+GSE SGGV+++  + + L N   GI IKT+ GRGG +RN+   NV ++
Sbjct  280  TGQTTSSSGIAIGSEMSGGVSEIYIKDLHLFNSNTGIRIKTSPGRGGYVRNVHILNVKLD  339

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
              +  IR  G  G HPDE+F+P A+P ++ I  ++V G+ +   G + GI    F NIC 
Sbjct  340  NVKKAIRFTGKYGEHPDEKFDPKALPAIEKITFENVNGDGIGVAGLLEGIAGDEFKNICF  399

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSP  252
             N+ L   K+ +  PW+CS+  G +  VSP
Sbjct  400  LNVTLRVKKNSKKSPWECSNVRGYSQWVSP  429



>ref|XP_003525377.2| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=492

 Score =   216 bits (549),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 147/227 (65%), Gaps = 4/227 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP  SPNTDGI+PDS ++  IED YI +GDD VAVKSGWDEYGIAYG P+  + IRR+
Sbjct  243  ILAPVTSPNTDGINPDSCTNTRIEDCYIVSGDDCVAVKSGWDEYGIAYGMPTKQLVIRRL  302

Query  698  TGSSPFAG-IAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            T  SPF+  IA+GSE SGG+ DV AE I   N   G+ IKT VGRGG +++I    + M+
Sbjct  303  TCISPFSAVIALGSEMSGGIQDVRAEDIVAINSESGVRIKTAVGRGGYVKDIFVRRMTMK  362

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
              +    + G+ G H D+ ++PNA+P++Q+I  +D+  E V     + GI   PFT IC+
Sbjct  363  TMKWAFWMTGNYGSHADDNYDPNALPVIQNINYRDMVAENVTMAARLEGISGDPFTGICI  422

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT---RDQSGAC  210
            SN+ +  AK  +  PW C+D +G +  V+P+PC  L     ++ GAC
Sbjct  423  SNVTIQLAKKAKKVPWTCTDIAGISSDVTPAPCGLLPDQGEEKIGAC  469



>ref|XP_003532926.1| PREDICTED: probable polygalacturonase-like isoform X1 [Glycine 
max]
Length=494

 Score =   216 bits (549),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 146/227 (64%), Gaps = 4/227 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP  SPNTDGI+PDS +   IED YI +GDD VAVKSGWDEYGIAYG P+  + IRR+
Sbjct  245  ILAPVTSPNTDGINPDSCTDTRIEDCYIVSGDDCVAVKSGWDEYGIAYGMPTKQLVIRRL  304

Query  698  TGSSPF-AGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            T  SPF A IA+GSE SGG+ D+ AE I   N   G+ IKT VGRGG +++I    + M+
Sbjct  305  TCISPFSAAIALGSEMSGGIQDMRAEDIVAINTESGVRIKTAVGRGGYVKDIFVRRMTMK  364

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
              +    + G+ G H D+ ++PNA+P++Q+I  +D+  E V     + GI   PFT IC+
Sbjct  365  TMKWAFWMTGNYGSHADDNYDPNALPVIQNINYRDMVAENVTMAARLEGISGDPFTGICI  424

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT---RDQSGAC  210
            SN+ +  AK  +  PW C+D +G +  V+P+PC  L     ++ GAC
Sbjct  425  SNVTIQLAKKAKKVPWTCTDIAGISSDVTPAPCDLLPDQGEEKIGAC  471



>ref|XP_010933983.1| PREDICTED: probable polygalacturonase isoform X2 [Elaeis guineensis]
Length=492

 Score =   215 bits (548),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 107/216 (50%), Positives = 145/216 (67%), Gaps = 2/216 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP  SPNTDGIDPDSSS+V IED +I +GDD +A+KSGWDEYGIA+  P+  + IRR+
Sbjct  244  ILAPVTSPNTDGIDPDSSSNVLIEDCFIVSGDDCIAIKSGWDEYGIAFNMPTRHVIIRRL  303

Query  698  TGSSPF-AGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            T  SP  A IA+GSE SGG+ DV AE I   N   G+ IKT +GRGG +++I    + + 
Sbjct  304  TCISPTSATIALGSEMSGGIEDVRAEDIMAINTESGVRIKTAIGRGGYVKDIFVRRMTLN  363

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
              +    +AG+ G HPD++++PNAIPI+ +I  +DV  E V   G + G+PK+PFT ICL
Sbjct  364  TMKYVFWMAGNYGQHPDDKYDPNAIPIIHNINYRDVVAEDVTIAGKLEGLPKAPFTGICL  423

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            SN+ ++  KS +   W C+D  G +  V P+PC  L
Sbjct  424  SNVTVDVVKS-KKLKWNCTDVEGVSSAVMPTPCDSL  458



>ref|XP_006584731.1| PREDICTED: probable polygalacturonase-like isoform X2 [Glycine 
max]
Length=506

 Score =   215 bits (548),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 107/227 (47%), Positives = 146/227 (64%), Gaps = 4/227 (2%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP  SPNTDGI+PDS +   IED YI +GDD VAVKSGWDEYGIAYG P+  + IRR+
Sbjct  257  ILAPVTSPNTDGINPDSCTDTRIEDCYIVSGDDCVAVKSGWDEYGIAYGMPTKQLVIRRL  316

Query  698  TGSSPF-AGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            T  SPF A IA+GSE SGG+ D+ AE I   N   G+ IKT VGRGG +++I    + M+
Sbjct  317  TCISPFSAAIALGSEMSGGIQDMRAEDIVAINTESGVRIKTAVGRGGYVKDIFVRRMTMK  376

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
              +    + G+ G H D+ ++PNA+P++Q+I  +D+  E V     + GI   PFT IC+
Sbjct  377  TMKWAFWMTGNYGSHADDNYDPNALPVIQNINYRDMVAENVTMAARLEGISGDPFTGICI  436

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSELT---RDQSGAC  210
            SN+ +  AK  +  PW C+D +G +  V+P+PC  L     ++ GAC
Sbjct  437  SNVTIQLAKKAKKVPWTCTDIAGISSDVTPAPCDLLPDQGEEKIGAC  483



>ref|XP_008807914.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
 ref|XP_008807915.1| PREDICTED: probable polygalacturonase [Phoenix dactylifera]
Length=469

 Score =   214 bits (546),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 112/225 (50%), Positives = 148/225 (66%), Gaps = 4/225 (2%)
 Frame = -1

Query  905  AMLLFDMSPILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRP  726
            + +L     ILAP DSPNTDGIDPDSS++VCIED YISTGDDL+ +KSGWDEYGI++  P
Sbjct  211  SQVLVQNVTILAPLDSPNTDGIDPDSSTNVCIEDCYISTGDDLIVIKSGWDEYGISFAHP  270

Query  725  SHGITIRRVTGSSPF-AGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRN  549
            S  I+IR + G +   AGIA GSE SGG+++V AE I + N   GI +KT+ GRGG +RN
Sbjct  271  SSNISIRGLAGETRSGAGIAFGSEMSGGISEVQAEGIHIFNSLHGIRLKTSPGRGGYVRN  330

Query  548  ITFSNVYMEKTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIP  369
            I  S+V +   +  IRI G  G HPD++++ NA+PI+  I IKD+ G  +   G + GI 
Sbjct  331  IYISDVTLTDVKIAIRITGQYGEHPDDKYDENALPIINRITIKDIVGVNISIAGLLEGIM  390

Query  368  KSPFTNICLSNIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
               F++ICL N+ LN      +PPW+CS   G +  VSP  C  L
Sbjct  391  GDNFSSICLYNVFLNVTT---DPPWQCSYIQGYSNLVSPESCEPL  432



>ref|XP_010679489.1| PREDICTED: probable polygalacturonase isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=459

 Score =   214 bits (545),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 140/215 (65%), Gaps = 3/215 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            I AP DSPNTDGIDPDSS+ VCIED YISTGDDLVAVKSGWDEYGI++ RPS  I+I R+
Sbjct  229  IRAPYDSPNTDGIDPDSSNDVCIEDCYISTGDDLVAVKSGWDEYGISFARPSTNISIYRL  288

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             G +  +GI +GSE SGGV+D+  E + + N    I I+T+ GRGG ++N+  SN+ +  
Sbjct  289  RGETQSSGITIGSEMSGGVSDIYVEDLFVFNTKTAITIRTSPGRGGYVKNVCISNMSIRN  348

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
              T I      G HPD Q+NP A+P+++ I IK+V G+ +   G + GI ++ F +ICL 
Sbjct  349  ITTAIWFNSQYGEHPDNQYNPKALPLIEKITIKNVVGDNIRVAGLLEGIQRADFLDICLY  408

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            N+ LN   +   PPW CS   G +  V P  C  L
Sbjct  409  NVTLNANSA---PPWHCSHVQGYSDLVFPPLCEPL  440



>ref|NP_567126.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
 gb|AAG40344.1|AF324992_1 AT3g62110 [Arabidopsis thaliana]
 gb|AAN31866.1| unknown protein [Arabidopsis thaliana]
 gb|AEE80311.1| pectin lyase-like superfamily protein [Arabidopsis thaliana]
Length=471

 Score =   214 bits (546),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 143/210 (68%), Gaps = 1/210 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP +SPNTDG+DPDSS++VCIED YI TGDDLV++KSGWDEYGI+Y RPS  I I R+
Sbjct  220  ILAPLESPNTDGVDPDSSTNVCIEDCYIVTGDDLVSIKSGWDEYGISYARPSSKIKINRL  279

Query  698  TG-SSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            TG ++  +GIA+GSE SGGV+++  + + L N   GI IKT+ GRGG +RN+   NV ++
Sbjct  280  TGQTTSSSGIAIGSEMSGGVSEIYIKDLHLFNSNTGIRIKTSAGRGGYVRNVHILNVKLD  339

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
              +  IR  G  G HPDE+++P A+P ++ I  ++V G+ +   G + GI    F NIC 
Sbjct  340  NVKKAIRFTGKYGEHPDEKYDPKALPAIEKITFENVNGDGIGVAGLLEGIEGDVFKNICF  399

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSP  252
             N+ L   K+ +  PW+CS+  G +  VSP
Sbjct  400  LNVTLRVKKNSKKSPWECSNVRGYSQWVSP  429



>emb|CAB71871.1| putative protein [Arabidopsis thaliana]
Length=470

 Score =   214 bits (546),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 143/210 (68%), Gaps = 1/210 (0%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            ILAP +SPNTDG+DPDSS++VCIED YI TGDDLV++KSGWDEYGI+Y RPS  I I R+
Sbjct  219  ILAPLESPNTDGVDPDSSTNVCIEDCYIVTGDDLVSIKSGWDEYGISYARPSSKIKINRL  278

Query  698  TG-SSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYME  522
            TG ++  +GIA+GSE SGGV+++  + + L N   GI IKT+ GRGG +RN+   NV ++
Sbjct  279  TGQTTSSSGIAIGSEMSGGVSEIYIKDLHLFNSNTGIRIKTSAGRGGYVRNVHILNVKLD  338

Query  521  KTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICL  342
              +  IR  G  G HPDE+++P A+P ++ I  ++V G+ +   G + GI    F NIC 
Sbjct  339  NVKKAIRFTGKYGEHPDEKYDPKALPAIEKITFENVNGDGIGVAGLLEGIEGDVFKNICF  398

Query  341  SNIHLNGAKSLRNPPWKCSDASGAAVQVSP  252
             N+ L   K+ +  PW+CS+  G +  VSP
Sbjct  399  LNVTLRVKKNSKKSPWECSNVRGYSQWVSP  428



>ref|XP_004955888.1| PREDICTED: probable polygalacturonase-like isoform X1 [Setaria 
italica]
 ref|XP_004955889.1| PREDICTED: probable polygalacturonase-like isoform X2 [Setaria 
italica]
Length=480

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 149/226 (66%), Gaps = 6/226 (3%)
 Frame = -1

Query  905  AMLLFDMSPILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRP  726
            + +L     ILAP  SPNTDGIDPDSS++VCIED YI  GDD+V +KSGWDEYGI++  P
Sbjct  212  SQVLVQHLTILAPISSPNTDGIDPDSSTNVCIEDCYIRNGDDIVVIKSGWDEYGISFAHP  271

Query  725  SHGITIRRVTGSSP-FAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRN  549
            S  I+IR +TG +   AGIA+GSE SGG++DV AE I + N   GI IKT  GRGG ++N
Sbjct  272  SSNISIRNITGQTRNSAGIALGSEMSGGISDVRAEGIRIVNSVHGIRIKTAPGRGGYVKN  331

Query  548  ITFSNVYMEKTRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIP  369
            +  ++V +E     IRI G+ G HPDE +N NA+P + +I IK++ G  +   G ++GI 
Sbjct  332  VYVADVSLENVSIAIRITGNYGEHPDENYNKNALPTISNITIKNIVGVNISVAGMLQGIQ  391

Query  368  KSPFTNICLSNIHLNGAKSLRNP-PWKCSDASGAAVQVSPSPCSEL  234
              PF+NICLSN+ L    S+R+  PW CS   G +  V P  C +L
Sbjct  392  GDPFSNICLSNVSL----SVRSTNPWNCSLVEGYSNSVLPEICEQL  433



>ref|XP_010679488.1| PREDICTED: probable polygalacturonase isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=460

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/215 (49%), Positives = 140/215 (65%), Gaps = 3/215 (1%)
 Frame = -1

Query  878  ILAPTDSPNTDGIDPDSSSHVCIEDSYISTGDDLVAVKSGWDEYGIAYGRPSHGITIRRV  699
            I AP DSPNTDGIDPDSS+ VCIED YISTGDDLVAVKSGWDEYGI++ RPS  I+I R+
Sbjct  230  IRAPYDSPNTDGIDPDSSNDVCIEDCYISTGDDLVAVKSGWDEYGISFARPSTNISIYRL  289

Query  698  TGSSPFAGIAVGSETSGGVTDVLAEHITLSNMGVGIHIKTNVGRGGIIRNITFSNVYMEK  519
             G +  +GI +GSE SGGV+D+  E + + N    I I+T+ GRGG ++N+  SN+ +  
Sbjct  290  RGETQSSGITIGSEMSGGVSDIYVEDLFVFNTKTAITIRTSPGRGGYVKNVCISNMSIRN  349

Query  518  TRTGIRIAGDVGGHPDEQFNPNAIPIVQDIKIKDVWGEQVLQPGWIRGIPKSPFTNICLS  339
              T I      G HPD Q+NP A+P+++ I IK+V G+ +   G + GI ++ F +ICL 
Sbjct  350  ITTAIWFNSQYGEHPDNQYNPKALPLIEKITIKNVVGDNIRVAGLLEGIQRADFLDICLY  409

Query  338  NIHLNGAKSLRNPPWKCSDASGAAVQVSPSPCSEL  234
            N+ LN   +   PPW CS   G +  V P  C  L
Sbjct  410  NVTLNANSA---PPWHCSHVQGYSDLVFPPLCEPL  441



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2118266961610