BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13683

Length=888
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009588897.1|  PREDICTED: cysteine protease ATG4-like isofo...    299   2e-94   Nicotiana tomentosiformis
ref|XP_009761430.1|  PREDICTED: cysteine protease ATG4-like isofo...    300   2e-94   Nicotiana sylvestris
ref|XP_009588896.1|  PREDICTED: cysteine protease ATG4-like isofo...    300   3e-94   Nicotiana tomentosiformis
ref|XP_009761431.1|  PREDICTED: cysteine protease ATG4-like isofo...    299   3e-94   Nicotiana sylvestris
gb|EYU31238.1|  hypothetical protein MIMGU_mgv1a004965mg                295   2e-92   Erythranthe guttata [common monkey flower]
ref|XP_006354185.1|  PREDICTED: cysteine protease ATG4-like isofo...    293   1e-91   Solanum tuberosum [potatoes]
ref|XP_004228630.1|  PREDICTED: cysteine protease ATG4 isoform X2       292   1e-91   Solanum lycopersicum
ref|XP_006354186.1|  PREDICTED: cysteine protease ATG4-like isofo...    293   1e-91   Solanum tuberosum [potatoes]
ref|XP_010316044.1|  PREDICTED: cysteine protease ATG4 isoform X1       293   1e-91   Solanum lycopersicum
ref|XP_008375115.1|  PREDICTED: cysteine protease ATG4                  281   4e-87   
ref|XP_008346919.1|  PREDICTED: cysteine protease ATG4-like isofo...    279   2e-86   
ref|XP_009354662.1|  PREDICTED: cysteine protease ATG4-like             278   3e-86   Pyrus x bretschneideri [bai li]
ref|XP_010093156.1|  hypothetical protein L484_005165                   276   9e-86   Morus notabilis
ref|XP_010037858.1|  PREDICTED: cysteine protease ATG4 isoform X2       269   1e-83   
ref|XP_010037856.1|  PREDICTED: cysteine protease ATG4 isoform X1       270   4e-83   Eucalyptus grandis [rose gum]
ref|XP_003635099.1|  PREDICTED: cysteine protease ATG4 isoform X2       268   2e-82   Vitis vinifera
ref|XP_010277861.1|  PREDICTED: cysteine protease ATG4-like             266   1e-81   Nelumbo nucifera [Indian lotus]
ref|XP_006441972.1|  hypothetical protein CICLE_v10019906mg             259   5e-81   
ref|XP_010646416.1|  PREDICTED: cysteine protease ATG4 isoform X3       261   8e-81   Vitis vinifera
emb|CAN81102.1|  hypothetical protein VITISV_021940                     263   2e-80   Vitis vinifera
ref|XP_010646415.1|  PREDICTED: cysteine protease ATG4 isoform X1       263   2e-80   Vitis vinifera
dbj|BAM93578.1|  autophagy related protein 4                            254   3e-80   Vigna unguiculata
ref|XP_006478509.1|  PREDICTED: cysteine protease ATG4-like isofo...    260   8e-80   Citrus sinensis [apfelsine]
ref|XP_006478508.1|  PREDICTED: cysteine protease ATG4-like isofo...    260   9e-80   Citrus sinensis [apfelsine]
ref|XP_006441971.1|  hypothetical protein CICLE_v10019906mg             260   1e-79   
gb|KDO40316.1|  hypothetical protein CISIN_1g011418mg                   261   1e-79   Citrus sinensis [apfelsine]
ref|XP_006478507.1|  PREDICTED: cysteine protease ATG4-like isofo...    261   2e-79   Citrus sinensis [apfelsine]
ref|XP_006441973.1|  hypothetical protein CICLE_v10019906mg             261   2e-79   Citrus clementina [clementine]
gb|KHG08139.1|  Cysteine protease ATG4                                  261   4e-79   Gossypium arboreum [tree cotton]
ref|XP_008441686.1|  PREDICTED: cysteine protease ATG4-like isofo...    258   9e-79   Cucumis melo [Oriental melon]
ref|XP_006372315.1|  autophagy 4b family protein                        258   1e-78   
ref|XP_008441684.1|  PREDICTED: cysteine protease ATG4-like isofo...    258   1e-78   Cucumis melo [Oriental melon]
gb|EPS69655.1|  hypothetical protein M569_05108                         256   1e-78   Genlisea aurea
gb|KHN11545.1|  Cysteine protease ATG4                                  258   3e-78   Glycine soja [wild soybean]
ref|XP_009354661.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    258   4e-78   
ref|XP_011649086.1|  PREDICTED: cysteine protease ATG4-like isofo...    257   4e-78   Cucumis sativus [cucumbers]
ref|XP_004138950.1|  PREDICTED: cysteine protease ATG4-like isofo...    257   4e-78   Cucumis sativus [cucumbers]
gb|KEH23421.1|  cysteine protease ATG4B                                 254   5e-78   Medicago truncatula
ref|XP_008346917.1|  PREDICTED: cysteine protease ATG4-like isofo...    258   5e-78   Malus domestica [apple tree]
ref|XP_002529225.1|  Cysteine protease ATG4B, putative                  257   6e-78   Ricinus communis
gb|KEH23420.1|  cysteine protease ATG4B                                 256   8e-78   Medicago truncatula
ref|XP_010934833.1|  PREDICTED: cysteine protease ATG4B-like isof...    256   2e-77   Elaeis guineensis
ref|XP_003624282.1|  Cysteine protease ATG4                             256   2e-77   Medicago truncatula
emb|CDX71858.1|  BnaC08g30160D                                          246   3e-77   
ref|XP_011004543.1|  PREDICTED: cysteine protease ATG4-like isofo...    254   4e-77   Populus euphratica
ref|XP_004290339.1|  PREDICTED: cysteine protease ATG4-like             251   9e-77   Fragaria vesca subsp. vesca
ref|XP_008810461.1|  PREDICTED: cysteine protease ATG4B-like isof...    251   9e-77   
ref|XP_008810459.1|  PREDICTED: cysteine protease ATG4B-like isof...    253   2e-76   Phoenix dactylifera
ref|XP_007049916.1|  Peptidase family C54 protein isoform 2             250   2e-76   
gb|AFK45336.1|  unknown                                                 252   4e-76   Lotus japonicus
ref|XP_007049917.1|  Peptidase family C54 protein isoform 3             251   9e-76   
ref|XP_007139667.1|  hypothetical protein PHAVU_008G048900g             251   1e-75   Phaseolus vulgaris [French bean]
ref|XP_010512287.1|  PREDICTED: cysteine protease ATG4b-like isof...    247   2e-75   
ref|XP_011004542.1|  PREDICTED: cysteine protease ATG4-like isofo...    250   2e-75   Populus euphratica
emb|CDY17881.1|  BnaC04g03380D                                          249   3e-75   Brassica napus [oilseed rape]
ref|XP_010508336.1|  PREDICTED: cysteine protease ATG4a isoform X3      247   3e-75   Camelina sativa [gold-of-pleasure]
ref|XP_002309707.1|  autophagy 4b family protein                        249   4e-75   Populus trichocarpa [western balsam poplar]
ref|XP_009385978.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    249   5e-75   
ref|XP_010512286.1|  PREDICTED: cysteine protease ATG4b-like isof...    249   6e-75   Camelina sativa [gold-of-pleasure]
ref|NP_973687.1|  cysteine protease ATG4a                               247   7e-75   
ref|XP_006653040.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    248   7e-75   
ref|XP_010508335.1|  PREDICTED: cysteine protease ATG4a isoform X2      247   7e-75   
ref|XP_004492912.1|  PREDICTED: cysteine protease ATG4-like isofo...    246   8e-75   
gb|KHN40529.1|  Cysteine protease ATG4                                  249   8e-75   Glycine soja [wild soybean]
ref|XP_010506322.1|  PREDICTED: cysteine protease ATG4a-like isof...    246   9e-75   Camelina sativa [gold-of-pleasure]
gb|AAC23418.1|  unknown protein                                         247   1e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006397589.1|  hypothetical protein EUTSA_v10001432mg             244   1e-74   
ref|XP_004492911.1|  PREDICTED: cysteine protease ATG4-like isofo...    247   1e-74   
ref|XP_006397591.1|  hypothetical protein EUTSA_v10001432mg             245   2e-74   Eutrema salsugineum [saltwater cress]
ref|XP_004492910.1|  PREDICTED: cysteine protease ATG4-like isofo...    248   2e-74   Cicer arietinum [garbanzo]
gb|EMT18890.1|  hypothetical protein F775_28054                         245   2e-74   
ref|NP_850412.1|  cysteine protease ATG4a                               247   2e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010508333.1|  PREDICTED: cysteine protease ATG4a isoform X1      247   2e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010518003.1|  PREDICTED: cysteine protease ATG4a-like isof...    244   3e-74   Camelina sativa [gold-of-pleasure]
ref|XP_006294154.1|  hypothetical protein CARUB_v10023148mg             244   4e-74   Capsella rubella
ref|XP_012081892.1|  PREDICTED: cysteine protease ATG4-like isofo...    244   6e-74   Jatropha curcas
ref|XP_006397592.1|  hypothetical protein EUTSA_v10001432mg             246   6e-74   Eutrema salsugineum [saltwater cress]
ref|XP_006855548.1|  PREDICTED: cysteine protease ATG4                  246   7e-74   Amborella trichopoda
ref|XP_010506319.1|  PREDICTED: cysteine protease ATG4a-like isof...    246   8e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010469254.1|  PREDICTED: cysteine protease ATG4b isoform X4      243   9e-74   Camelina sativa [gold-of-pleasure]
gb|ACN76570.1|  cysteine proteinase                                     246   9e-74   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002881949.1|  autophagy 4a                                       245   9e-74   Arabidopsis lyrata subsp. lyrata
ref|XP_008232834.1|  PREDICTED: cysteine protease ATG4                  246   1e-73   Prunus mume [ume]
ref|XP_010469252.1|  PREDICTED: cysteine protease ATG4b isoform X3      243   1e-73   
ref|XP_010934834.1|  PREDICTED: cysteine protease ATG4B-like isof...    245   1e-73   
ref|XP_011005240.1|  PREDICTED: cysteine protease ATG4-like             245   2e-73   Populus euphratica
gb|AGW81780.1|  autophagy-related protein 4b                            245   2e-73   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009138890.1|  PREDICTED: cysteine protease ATG4b isoform X2      242   2e-73   Brassica rapa
ref|XP_009138889.1|  PREDICTED: cysteine protease ATG4b isoform X1      243   3e-73   Brassica rapa
ref|XP_006294155.1|  hypothetical protein CARUB_v10023148mg             244   3e-73   Capsella rubella
ref|XP_010518001.1|  PREDICTED: cysteine protease ATG4a-like isof...    244   3e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010469251.1|  PREDICTED: cysteine protease ATG4b isoform X2      244   3e-73   Camelina sativa [gold-of-pleasure]
ref|XP_012081889.1|  PREDICTED: cysteine protease ATG4-like isofo...    244   4e-73   Jatropha curcas
ref|XP_009116672.1|  PREDICTED: cysteine protease ATG4b isoform X2      241   4e-73   Brassica rapa
ref|XP_010469250.1|  PREDICTED: cysteine protease ATG4b isoform X1      244   5e-73   Camelina sativa [gold-of-pleasure]
emb|CDY45773.1|  BnaC04g22590D                                          242   7e-73   Brassica napus [oilseed rape]
ref|XP_009142996.1|  PREDICTED: cysteine protease ATG4a isoform X2      240   1e-72   Brassica rapa
ref|XP_009116671.1|  PREDICTED: cysteine protease ATG4b isoform X1      242   1e-72   Brassica rapa
ref|XP_007217926.1|  hypothetical protein PRUPE_ppa004885mg             243   1e-72   Prunus persica
ref|XP_002878306.1|  autophagy 4b                                       243   1e-72   
ref|NP_001054293.1|  Os04g0682000                                       243   1e-72   
sp|Q2XPP4.2|ATG4B_ORYSI  RecName: Full=Cysteine protease ATG4B; A...    243   1e-72   Oryza sativa Indica Group [Indian rice]
gb|ACN76571.1|  cysteine proteinase                                     243   2e-72   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009142995.1|  PREDICTED: cysteine protease ATG4a isoform X1      241   2e-72   Brassica rapa
ref|XP_006402636.1|  hypothetical protein EUTSA_v10005940mg             239   3e-72   Eutrema salsugineum [saltwater cress]
sp|A2XHJ5.1|ATG4A_ORYSI  RecName: Full=Cysteine protease ATG4A; A...    241   3e-72   Oryza sativa Indica Group [Indian rice]
gb|AGW81779.1|  autophagy-related protein 4a                            241   4e-72   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010413619.1|  PREDICTED: cysteine protease ATG4b-like isof...    239   4e-72   Camelina sativa [gold-of-pleasure]
ref|XP_011100135.1|  PREDICTED: cysteine protease ATG4-like             242   6e-72   
ref|XP_006402637.1|  hypothetical protein EUTSA_v10005940mg             240   9e-72   Eutrema salsugineum [saltwater cress]
ref|XP_004960034.1|  PREDICTED: cysteine protease ATG4B-like            240   1e-71   Setaria italica
ref|XP_010413618.1|  PREDICTED: cysteine protease ATG4b-like isof...    240   1e-71   Camelina sativa [gold-of-pleasure]
sp|Q75KP8.1|ATG4A_ORYSJ  RecName: Full=Cysteine protease ATG4A; A...    239   2e-71   Oryza sativa Japonica Group [Japonica rice]
ref|NP_191554.1|  peptidase family C54 protein                          239   3e-71   Arabidopsis thaliana [mouse-ear cress]
emb|CDY41195.1|  BnaA09g38200D                                          238   5e-71   Brassica napus [oilseed rape]
emb|CDX79779.1|  BnaA05g03770D                                          238   5e-71   
emb|CDX89039.1|  BnaA04g01470D                                          236   1e-70   
ref|XP_008661519.1|  PREDICTED: autophagy-related 4b isoform X3         237   2e-70   
ref|XP_010672541.1|  PREDICTED: cysteine protease ATG4                  236   4e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008668674.1|  PREDICTED: cysteine protease ATG4B-like isof...    236   5e-70   
ref|NP_001137489.1|  autophagy-related 4b                               236   5e-70   
ref|NP_001137488.1|  autophagy-related 4                                236   8e-70   Zea mays [maize]
ref|XP_006292861.1|  hypothetical protein CARUB_v10019120mg             235   8e-70   Capsella rubella
ref|XP_009398483.1|  PREDICTED: cysteine protease ATG4B-like            235   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC78268.1|  hypothetical protein OsI_17962                          240   8e-69   Oryza sativa Indica Group [Indian rice]
ref|XP_009382776.1|  PREDICTED: cysteine protease ATG4B-like isof...    233   9e-69   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE61922.1|  hypothetical protein OsJ_16662                          240   9e-69   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009382778.1|  PREDICTED: cysteine protease ATG4B-like isof...    233   1e-68   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB46919.1|  hypothetical protein B456_008G001300                    228   2e-68   Gossypium raimondii
ref|XP_003580841.1|  PREDICTED: cysteine protease ATG4B-like            231   7e-68   Brachypodium distachyon [annual false brome]
ref|XP_001758116.1|  predicted protein                                  226   2e-67   
gb|KJB46915.1|  hypothetical protein B456_008G001300                    229   4e-67   Gossypium raimondii
gb|AAR87272.1|  putative autophagy protein (with alternative spli...    224   3e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001770869.1|  predicted protein                                  216   1e-63   
emb|CAJ86292.1|  H0124B04.9                                             226   8e-63   Oryza sativa [red rice]
ref|XP_007049915.1|  Peptidase family C54 protein isoform 1             216   4e-62   
ref|XP_002973701.1|  hypothetical protein SELMODRAFT_54035              202   2e-58   
gb|KJB46917.1|  hypothetical protein B456_008G001300                    202   8e-58   Gossypium raimondii
gb|KJB46920.1|  hypothetical protein B456_008G001300                    202   9e-58   Gossypium raimondii
ref|XP_002975752.1|  hypothetical protein SELMODRAFT_54753              200   2e-57   
gb|KDO40318.1|  hypothetical protein CISIN_1g011418mg                   199   7e-57   Citrus sinensis [apfelsine]
gb|ACJ73913.1|  autophagy-related 4a variant 2                          194   2e-54   Zea mays [maize]
gb|EMS55294.1|  hypothetical protein TRIUR3_04442                       195   4e-54   Triticum urartu
gb|ADT92194.1|  autophagy-related 4b                                    196   7e-54   Zea mays [maize]
ref|XP_008661518.1|  PREDICTED: autophagy-related 4b isoform X2         190   8e-53   
ref|XP_009382779.1|  PREDICTED: cysteine protease ATG4B-like isof...    188   2e-52   
gb|KJB46918.1|  hypothetical protein B456_008G001300                    164   1e-43   Gossypium raimondii
gb|KDO40319.1|  hypothetical protein CISIN_1g011418mg                   159   7e-42   Citrus sinensis [apfelsine]
ref|XP_010527566.1|  PREDICTED: cysteine protease ATG4a-like            141   6e-36   Tarenaya hassleriana [spider flower]
ref|XP_010934835.1|  PREDICTED: cysteine protease ATG4B-like isof...    138   7e-34   Elaeis guineensis
gb|KFH70732.1|  hypothetical protein MVEG_03580                         132   3e-31   Mortierella verticillata NRRL 6337
ref|XP_005651667.1|  peptidase C54                                      129   6e-31   Coccomyxa subellipsoidea C-169
gb|AFW57899.1|  hypothetical protein ZEAMMB73_419246                    125   4e-30   
gb|AFW74617.1|  hypothetical protein ZEAMMB73_836919                    125   2e-29   
ref|XP_011396113.1|  Cysteine protease ATG4a                            124   1e-28   Auxenochlorella protothecoides
ref|XP_004341221.1|  cysteine protease, putative                        124   1e-28   Acanthamoeba castellanii str. Neff
ref|XP_001691049.1|  autophagy protein                                  123   3e-28   Chlamydomonas reinhardtii
ref|XP_009293968.1|  PREDICTED: cysteine protease ATG4A isoform X1      112   8e-26   
gb|ESA02267.1|  hypothetical protein GLOINDRAFT_337503                  115   2e-25   
ref|XP_006679571.1|  hypothetical protein BATDEDRAFT_35298              114   2e-25   Batrachochytrium dendrobatidis JAM81
ref|XP_004333021.1|  cysteine protease atg4a, putative                  110   2e-25   Acanthamoeba castellanii str. Neff
gb|EXX76432.1|  Atg4p                                                   117   3e-25   Rhizophagus irregularis DAOM 197198w
ref|NP_001019605.1|  cysteine protease ATG4A                            112   7e-25   Danio rerio [leopard danio]
gb|ERZ94855.1|  hypothetical protein GLOINDRAFT_315488                  110   8e-25   
ref|XP_003292315.1|  hypothetical protein DICPUDRAFT_99299              112   1e-24   Dictyostelium purpureum
ref|XP_002168183.2|  PREDICTED: cysteine protease ATG4B-like            112   1e-24   
ref|XP_007247106.1|  PREDICTED: cysteine protease ATG4A-like            111   1e-24   
ref|XP_001637442.1|  predicted protein                                  111   1e-24   Nematostella vectensis
ref|XP_004334148.1|  autophagy protein 4, putative                      112   2e-24   Acanthamoeba castellanii str. Neff
ref|XP_002948308.1|  autophagy protein                                  110   3e-24   Volvox carteri f. nagariensis
gb|EST08519.1|  hypothetical protein PSEUBRA_SCAF16g05398               110   3e-24   Kalmanozyma brasiliensis GHG001
ref|XP_011407221.1|  PREDICTED: cysteine protease ATG4D-like            108   9e-24   
ref|XP_010738868.1|  PREDICTED: cysteine protease ATG4D-like            110   1e-23   
emb|CCA19140.1|  cysteine protease family C54 putative                  109   1e-23   Albugo laibachii Nc14
ref|XP_007878879.1|  hypothetical protein PFL1_03172                    112   1e-23   Anthracocystis flocculosa PF-1
gb|ELT88258.1|  hypothetical protein CAPTEDRAFT_225251                  108   2e-23   Capitella teleta
gb|EFA84441.1|  autophagy protein 4                                     110   3e-23   Heterostelium album PN500
ref|XP_010894735.1|  PREDICTED: cysteine protease ATG4B isoform X1      107   4e-23   
ref|XP_010894737.1|  PREDICTED: cysteine protease ATG4B isoform X3      107   4e-23   Esox lucius
gb|KDN48512.1|  hypothetical protein K437DRAFT_245502                   109   5e-23   Tilletiaria anomala UBC 951
gb|EMP35426.1|  Cysteine protease ATG4A                                 105   6e-23   Chelonia mydas [green seaturtle]
ref|XP_001947296.2|  PREDICTED: cysteine protease ATG4B-like            107   6e-23   
ref|XP_006822046.1|  PREDICTED: cysteine protease ATG4D-like            106   8e-23   Saccoglossus kowalevskii
ref|XP_004743856.1|  PREDICTED: cysteine protease ATG4B                 106   9e-23   
ref|XP_008168276.1|  PREDICTED: cysteine protease ATG4A                 106   9e-23   Chrysemys picta bellii
ref|NP_001020882.1|  cysteine protease ATG4B                            103   1e-22   Rattus norvegicus [brown rat]
ref|XP_005945804.1|  PREDICTED: cysteine protease ATG4D-like            107   1e-22   Haplochromis burtoni
gb|EJW87807.1|  hypothetical protein WUBG_01286                         103   1e-22   Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_004567932.1|  PREDICTED: cysteine protease ATG4D-like            107   1e-22   Maylandia zebra
ref|XP_005752278.1|  PREDICTED: cysteine protease ATG4D-like            107   1e-22   Pundamilia nyererei
ref|XP_007060204.1|  PREDICTED: cysteine protease ATG4A isoform X2      105   1e-22   
ref|XP_004809677.1|  PREDICTED: cysteine protease ATG4B isoform X1      106   1e-22   
ref|XP_006787443.1|  PREDICTED: cysteine protease ATG4D-like            107   1e-22   Neolamprologus brichardi [lyretail cichlid]
ref|XP_005998268.1|  PREDICTED: cysteine protease ATG4A                 105   1e-22   
ref|XP_007060203.1|  PREDICTED: cysteine protease ATG4A isoform X1      105   1e-22   Chelonia mydas [green seaturtle]
ref|XP_010871080.1|  PREDICTED: cysteine protease ATG4D isoform X2      107   1e-22   Esox lucius
dbj|GAM24913.1|  hypothetical protein SAMD00019534_080880               108   1e-22   Acytostelium subglobosum LB1
dbj|GAM28128.1|  hypothetical protein SAMD00019534_113040               105   1e-22   Acytostelium subglobosum LB1
ref|XP_003447971.1|  PREDICTED: cysteine protease ATG4D-like            106   2e-22   Oreochromis niloticus
emb|CDJ26740.1|  cysteine peptidase 2 family C54 protein                105   2e-22   Tityus serrulatus
gb|ENN76867.1|  hypothetical protein YQE_06708                          105   2e-22   Dendroctonus ponderosae
ref|XP_010791075.1|  PREDICTED: cysteine protease ATG4D                 106   2e-22   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_001637280.1|  predicted protein                                  105   2e-22   Nematostella vectensis
emb|CDQ73539.1|  unnamed protein product                                105   3e-22   Oncorhynchus mykiss
emb|CDJ26739.1|  cysteine peptidase 1 family C54 protein                104   3e-22   Tityus serrulatus
gb|EDL91905.1|  autophagy-related 4B (yeast), isoform CRA_b             104   3e-22   Rattus norvegicus [brown rat]
dbj|BAI82576.1|  autophagy-related 4                                    104   3e-22   Haemaphysalis longicornis
ref|XP_005802888.1|  PREDICTED: cysteine protease ATG4D-like            104   3e-22   
ref|XP_003972638.1|  PREDICTED: cysteine protease ATG4D                 105   4e-22   Takifugu rubripes [tiger puffer]
ref|XP_003744760.1|  PREDICTED: cysteine protease ATG4D-like            105   4e-22   Galendromus occidentalis
gb|KFP10088.1|  Cysteine protease ATG4A                                 104   4e-22   Egretta garzetta
ref|XP_008405954.1|  PREDICTED: cysteine protease ATG4B                 104   5e-22   Poecilia reticulata
ref|XP_007541517.1|  PREDICTED: cysteine protease ATG4B                 104   5e-22   Poecilia formosa
ref|XP_005811409.1|  PREDICTED: cysteine protease ATG4B-like            104   5e-22   Xiphophorus maculatus
gb|KFO08631.1|  Cysteine protease ATG4A                                 104   5e-22   Balearica regulorum gibbericeps
dbj|BAC98052.1|  mKIAA0943 protein                                      102   5e-22   Mus musculus [mouse]
dbj|GAM23514.1|  hypothetical protein SAMD00019534_066890               106   5e-22   Acytostelium subglobosum LB1
ref|XP_010296150.1|  PREDICTED: cysteine protease ATG4A                 104   5e-22   Balearica regulorum gibbericeps
ref|XP_006245595.1|  PREDICTED: cysteine protease ATG4B isoform X1      103   5e-22   Rattus norvegicus [brown rat]
ref|XP_006245596.1|  PREDICTED: cysteine protease ATG4B isoform X2      103   6e-22   Rattus norvegicus [brown rat]
gb|KFR04240.1|  Cysteine protease ATG4A                                 103   6e-22   Opisthocomus hoazin [hoatzin]
gb|EFB16574.1|  hypothetical protein PANDA_012287                       103   6e-22   Ailuropoda melanoleuca
ref|XP_007428173.1|  PREDICTED: cysteine protease ATG4A isoform X2      103   6e-22   Python bivittatus
ref|XP_009943544.1|  PREDICTED: cysteine protease ATG4A                 103   6e-22   Opisthocomus hoazin [hoatzin]
ref|XP_007428172.1|  PREDICTED: cysteine protease ATG4A isoform X1      103   6e-22   Python bivittatus
ref|XP_005045997.1|  PREDICTED: cysteine protease ATG4A isoform X1      103   6e-22   
gb|ETI44487.1|  hypothetical protein F443_10814                         103   6e-22   Phytophthora parasitica P1569
ref|XP_011228071.1|  PREDICTED: cysteine protease ATG4B isoform X1      103   6e-22   
ref|XP_008906761.1|  hypothetical protein PPTG_12477                    103   6e-22   Phytophthora parasitica INRA-310
ref|XP_006136305.1|  PREDICTED: cysteine protease ATG4A                 103   7e-22   
emb|CDQ77825.1|  unnamed protein product                                103   7e-22   Oncorhynchus mykiss
ref|XP_011414249.1|  PREDICTED: cysteine protease ATG4B-like            103   7e-22   Crassostrea gigas
dbj|GAC95763.1|  cysteine protease                                      107   7e-22   Pseudozyma hubeiensis SY62
ref|XP_011228072.1|  PREDICTED: cysteine protease ATG4B isoform X2      103   7e-22   
ref|XP_007670381.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    103   7e-22   
emb|CDS10461.1|  hypothetical protein LRAMOSA03137                      104   9e-22   Lichtheimia ramosa
ref|XP_009644817.1|  PREDICTED: cysteine protease ATG4A                 104   9e-22   Egretta garzetta
ref|XP_007654448.1|  PREDICTED: cysteine protease ATG4D                 102   9e-22   
gb|KFM59607.1|  Cysteine protease ATG4C                                 105   1e-21   Stegodyphus mimosarum
ref|XP_010894736.1|  PREDICTED: cysteine protease ATG4B isoform X2      103   1e-21   
ref|XP_002592932.1|  hypothetical protein BRAFLDRAFT_275700             103   1e-21   Branchiostoma floridae
gb|ERL94645.1|  hypothetical protein D910_11920                         103   1e-21   Dendroctonus ponderosae
ref|XP_008275327.1|  PREDICTED: cysteine protease ATG4D                 104   1e-21   Stegastes partitus
ref|XP_006529856.1|  PREDICTED: cysteine protease ATG4B isoform X1      102   1e-21   Mus musculus [mouse]
ref|XP_004620730.1|  PREDICTED: cysteine protease ATG4B                 102   1e-21   Sorex araneus [Eurasian shrew]
ref|XP_006750817.1|  PREDICTED: cysteine protease ATG4B                 103   1e-21   Leptonychotes weddellii
gb|EDL39932.1|  autophagy-related 4B (yeast), isoform CRA_a             103   1e-21   Mus musculus [mouse]
gb|AAH27184.1|  Autophagy-related 4B (yeast)                            103   1e-21   Mus musculus [mouse]
gb|KFV52897.1|  Cysteine protease ATG4A                                 103   1e-21   Tyto alba [Schleiereule]
gb|KFQ29247.1|  Cysteine protease ATG4A                                 103   1e-21   Mesitornis unicolor
gb|KFP00710.1|  Cysteine protease ATG4A                                 103   1e-21   Calypte anna
ref|XP_007893162.1|  PREDICTED: cysteine protease ATG4A-like            104   1e-21   Callorhinchus milii [Australian ghost shark]
ref|XP_005484528.1|  PREDICTED: cysteine protease ATG4A isoform X2      102   1e-21   Zonotrichia albicollis
sp|Q8BGE6.2|ATG4B_MOUSE  RecName: Full=Cysteine protease ATG4B; A...    102   1e-21   Mus musculus [mouse]
ref|XP_009966603.1|  PREDICTED: cysteine protease ATG4A                 103   1e-21   Tyto alba [Schleiereule]
dbj|GAK63201.1|  conserved hypothetical protein                         106   1e-21   Moesziomyces antarcticus
ref|XP_008491928.1|  PREDICTED: cysteine protease ATG4A                 102   1e-21   Calypte anna
ref|XP_010192752.1|  PREDICTED: cysteine protease ATG4A                 103   1e-21   Mesitornis unicolor
gb|ETL91044.1|  hypothetical protein L917_10368                         103   1e-21   Phytophthora parasitica
ref|XP_010080212.1|  PREDICTED: cysteine protease ATG4A                 102   1e-21   Pterocles gutturalis
ref|NP_777363.1|  cysteine protease ATG4B                               102   2e-21   Mus musculus [mouse]
ref|XP_010567317.1|  PREDICTED: cysteine protease ATG4A isoform X2      102   2e-21   Haliaeetus leucocephalus
ref|XP_002197397.2|  PREDICTED: cysteine protease ATG4A                 102   2e-21   
ref|XP_005419973.1|  PREDICTED: cysteine protease ATG4A                 102   2e-21   Geospiza fortis
gb|KFV13942.1|  Cysteine protease ATG4A                                 102   2e-21   Pterocles gutturalis
ref|XP_006632798.1|  PREDICTED: cysteine protease ATG4A-like isof...    102   2e-21   
ref|XP_009292711.1|  PREDICTED: cysteine protease ATG4D                 103   2e-21   Danio rerio [leopard danio]
gb|KFP75743.1|  Cysteine protease ATG4A                                 102   2e-21   Acanthisitta chloris
ref|NP_001258915.1|  cysteine protease ATG4A isoform 1                  102   2e-21   Gallus gallus [bantam]
gb|KFO93313.1|  Cysteine protease ATG4A                                 102   2e-21   Buceros rhinoceros silvestris
ref|XP_002504432.1|  predicted protein                                  100   2e-21   Micromonas commoda
ref|XP_010567315.1|  PREDICTED: cysteine protease ATG4A isoform X1      102   2e-21   Haliaeetus leucocephalus
ref|XP_010140190.1|  PREDICTED: cysteine protease ATG4A                 102   2e-21   Buceros rhinoceros silvestris
ref|NP_001258916.1|  cysteine protease ATG4A isoform 2                  102   2e-21   Gallus gallus [bantam]
ref|XP_010282521.1|  PREDICTED: cysteine protease ATG4A                 102   2e-21   Phaethon lepturus
gb|KFQ10755.1|  Cysteine protease ATG4A                                 102   2e-21   Haliaeetus albicilla
gb|KGL75939.1|  Cysteine protease ATG4A                                 102   2e-21   Tinamus guttatus
gb|KFZ60992.1|  Cysteine protease ATG4A                                 102   2e-21   Podiceps cristatus
gb|KFV86680.1|  Cysteine protease ATG4A                                 102   2e-21   Struthio camelus australis
gb|KFV14060.1|  Cysteine protease ATG4A                                 102   2e-21   
ref|XP_005045998.1|  PREDICTED: cysteine protease ATG4A isoform X2      102   2e-21   
ref|XP_009887652.1|  PREDICTED: cysteine protease ATG4A                 102   2e-21   
ref|XP_010171640.1|  PREDICTED: cysteine protease ATG4A                 102   2e-21   
gb|KFW74210.1|  Cysteine protease ATG4A                                 102   2e-21   
ref|XP_009925619.1|  PREDICTED: cysteine protease ATG4A                 102   2e-21   
gb|KFP54053.1|  Cysteine protease ATG4A                                 102   2e-21   
gb|KFO64299.1|  Cysteine protease ATG4A                                 102   2e-21   
ref|XP_009475751.1|  PREDICTED: cysteine protease ATG4A                 102   2e-21   
gb|KFP26562.1|  Cysteine protease ATG4A                                 102   2e-21   
gb|AAL39598.1|  LD17482p                                                104   2e-21   
gb|KFQ84227.1|  Cysteine protease ATG4A                                 102   2e-21   
ref|XP_010203955.1|  PREDICTED: cysteine protease ATG4A                 102   2e-21   
gb|KFQ72355.1|  Cysteine protease ATG4A                                 102   2e-21   
ref|XP_009706812.1|  PREDICTED: cysteine protease ATG4A                 102   2e-21   
ref|XP_009068419.1|  PREDICTED: cysteine protease ATG4A                 102   2e-21   
ref|XP_008947001.1|  PREDICTED: cysteine protease ATG4A                 102   2e-21   
ref|XP_011310577.1|  PREDICTED: cysteine protease ATG4D isoform X3      102   2e-21   
gb|KFQ23323.1|  Cysteine protease ATG4A                                 102   2e-21   
gb|KFQ90824.1|  Cysteine protease ATG4A                                 102   2e-21   
ref|XP_009050496.1|  hypothetical protein LOTGIDRAFT_187088             102   2e-21   
ref|XP_005484527.1|  PREDICTED: cysteine protease ATG4A isoform X1      102   2e-21   
ref|XP_009980639.1|  PREDICTED: cysteine protease ATG4A                 102   2e-21   
ref|XP_009683794.1|  PREDICTED: cysteine protease ATG4A                 102   2e-21   
ref|XP_009806030.1|  PREDICTED: cysteine protease ATG4A                 102   2e-21   
gb|KFM04835.1|  Cysteine protease ATG4A                                 102   2e-21   
gb|KFZ63517.1|  Cysteine protease ATG4A                                 102   2e-21   
gb|KFP69128.1|  Cysteine protease ATG4A                                 102   2e-21   
ref|XP_005636054.1|  PREDICTED: cysteine protease ATG4B                 103   2e-21   
gb|KFP91885.1|  Cysteine protease ATG4A                                 102   2e-21   
gb|EMC83168.1|  Cysteine protease ATG4A                                 102   2e-21   
ref|XP_009575610.1|  PREDICTED: cysteine protease ATG4A                 102   2e-21   
gb|KFV41137.1|  Cysteine protease ATG4A                                 102   2e-21   
ref|XP_010211014.1|  PREDICTED: cysteine protease ATG4A                 102   2e-21   
ref|XP_005530076.1|  PREDICTED: cysteine protease ATG4A                 102   2e-21   
ref|XP_004412764.1|  PREDICTED: cysteine protease ATG4B                 102   2e-21   
ref|XP_009873953.1|  PREDICTED: cysteine protease ATG4A                 102   2e-21   
ref|XP_008688734.1|  PREDICTED: cysteine protease ATG4B                 102   2e-21   
gb|KFW95179.1|  Cysteine protease ATG4A                                 102   2e-21   
gb|KFV66805.1|  Cysteine protease ATG4A                                 102   2e-21   
gb|KGL96740.1|  Cysteine protease ATG4A                                 102   2e-21   
ref|XP_010713743.1|  PREDICTED: cysteine protease ATG4A                 102   2e-21   
ref|XP_009273637.1|  PREDICTED: cysteine protease ATG4A                 102   2e-21   
ref|NP_650452.1|  Autophagy-specific gene 4b                            104   2e-21   
emb|CCI43467.1|  unnamed protein product                                105   2e-21   
ref|XP_004701758.1|  PREDICTED: cysteine protease ATG4B                 101   2e-21   
ref|XP_005509169.1|  PREDICTED: cysteine protease ATG4A                 102   2e-21   
ref|XP_009898054.1|  PREDICTED: cysteine protease ATG4A                 102   2e-21   
ref|XP_008638751.1|  PREDICTED: cysteine protease ATG4A                 102   2e-21   
ref|XP_005148340.1|  PREDICTED: cysteine protease ATG4A isoform X2      102   2e-21   
ref|XP_006935826.1|  PREDICTED: cysteine protease ATG4B isoform X2      102   2e-21   
ref|XP_002606893.1|  hypothetical protein BRAFLDRAFT_126356             102   2e-21   
ref|XP_009088765.1|  PREDICTED: cysteine protease ATG4A                 102   2e-21   
gb|KFQ54333.1|  Cysteine protease ATG4A                                 102   2e-21   
ref|XP_009326181.1|  PREDICTED: cysteine protease ATG4A                 102   3e-21   
ref|XP_005148339.1|  PREDICTED: cysteine protease ATG4A isoform X1      102   3e-21   
gb|KFU89276.1|  Cysteine protease ATG4A                                 102   3e-21   
ref|XP_008931998.1|  PREDICTED: cysteine protease ATG4A                 102   3e-21   
ref|XP_010018033.1|  PREDICTED: cysteine protease ATG4A                 102   3e-21   
emb|CDQ94911.1|  unnamed protein product                                103   3e-21   
ref|XP_005238314.1|  PREDICTED: cysteine protease ATG4A                 102   3e-21   
ref|XP_008315566.1|  PREDICTED: cysteine protease ATG4D-like            103   3e-21   
ref|XP_009995536.1|  PREDICTED: cysteine protease ATG4A                 102   3e-21   
ref|XP_011310573.1|  PREDICTED: cysteine protease ATG4D isoform X1      102   3e-21   
ref|XP_008112889.1|  PREDICTED: cysteine protease ATG4A                 102   3e-21   
ref|XP_006033632.1|  PREDICTED: cysteine protease ATG4A isoform X2      101   3e-21   
ref|XP_010406056.1|  PREDICTED: cysteine protease ATG4A                 102   3e-21   
ref|XP_004355745.1|  autophagy protein 4                                103   3e-21   
ref|XP_006033631.1|  PREDICTED: cysteine protease ATG4A isoform X1      101   3e-21   
ref|XP_010899314.1|  PREDICTED: cysteine protease ATG4D-like isof...    102   3e-21   
ref|XP_011310575.1|  PREDICTED: cysteine protease ATG4D isoform X2      102   3e-21   
ref|XP_005339684.1|  PREDICTED: cysteine protease ATG4B                 102   3e-21   
emb|CDW54767.1|  cysteine protease ATG4A                                101   3e-21   
gb|EHJ72670.1|  putative Autophagy-specific protein                     101   3e-21   
ref|XP_001417407.1|  predicted protein                                  101   4e-21   
ref|XP_005857739.1|  PREDICTED: cysteine protease ATG4B isoform X7      101   4e-21   
ref|XP_007939564.1|  PREDICTED: cysteine protease ATG4B                 101   4e-21   
ref|XP_006970364.1|  PREDICTED: cysteine protease ATG4A isoform X1      101   4e-21   
ref|XP_006970365.1|  PREDICTED: cysteine protease ATG4A isoform X2      101   4e-21   
ref|XP_002103326.1|  GD20357                                            103   4e-21   
ref|XP_009510790.1|  PREDICTED: cysteine protease ATG4A                 102   4e-21   
ref|XP_006989676.1|  PREDICTED: cysteine protease ATG4B                 101   4e-21   
gb|KFQ10112.1|  Cysteine protease ATG4A                                 101   4e-21   
ref|XP_002031074.1|  GM25780                                            103   4e-21   
ref|XP_004667863.1|  PREDICTED: cysteine protease ATG4B                 101   4e-21   
ref|XP_006875278.1|  PREDICTED: cysteine protease ATG4B                 101   5e-21   
ref|XP_006083076.1|  PREDICTED: cysteine protease ATG4B isoform X3      101   5e-21   
ref|XP_010599003.1|  PREDICTED: cysteine protease ATG4B                 100   5e-21   
ref|XP_009948244.1|  PREDICTED: cysteine protease ATG4A                 101   5e-21   
emb|CDP92609.1|  Protein BM-ATG-4.1, isoform b                          102   5e-21   
ref|XP_010893023.1|  PREDICTED: cysteine protease ATG4A                 101   5e-21   
ref|XP_010120189.1|  PREDICTED: cysteine protease ATG4A                 101   5e-21   
gb|KFP42673.1|  Cysteine protease ATG4A                                 101   5e-21   
ref|XP_005857737.1|  PREDICTED: cysteine protease ATG4B isoform X5      101   5e-21   
ref|XP_011182582.1|  PREDICTED: cysteine protease ATG4C isoform X1      103   5e-21   
ref|XP_005857738.1|  PREDICTED: cysteine protease ATG4B isoform X6      101   5e-21   
ref|XP_001892265.1|  Peptidase family C54 containing protein            101   5e-21   
ref|XP_011182583.1|  PREDICTED: cysteine protease ATG4C isoform X2      103   5e-21   
ref|XP_011182584.1|  PREDICTED: cysteine protease ATG4C isoform X3      103   6e-21   
ref|XP_005077246.1|  PREDICTED: cysteine protease ATG4B                 101   6e-21   
ref|XP_009538056.1|  hypothetical protein PHYSODRAFT_532364             101   6e-21   
ref|XP_002434192.1|  cystein protease, putative                         100   6e-21   
ref|XP_010899313.1|  PREDICTED: cysteine protease ATG4D-like isof...    101   6e-21   
ref|XP_004065858.1|  PREDICTED: cysteine protease ATG4D                 102   6e-21   
gb|KFQ59287.1|  Cysteine protease ATG4A                                 100   6e-21   
emb|CDJ26741.1|  cysteine peptidase 3 family C54 protein                103   7e-21   
ref|XP_011439401.1|  PREDICTED: cysteine protease ATG4C-like            102   7e-21   
ref|XP_006083075.1|  PREDICTED: cysteine protease ATG4B isoform X2      101   7e-21   
ref|XP_009477117.1|  PREDICTED: cysteine protease ATG4A                 100   7e-21   
ref|XP_010899312.1|  PREDICTED: cysteine protease ATG4D-like isof...    102   7e-21   
gb|KDR21791.1|  Cysteine protease ATG4D                                 101   7e-21   
ref|XP_006631671.1|  PREDICTED: cysteine protease ATG4D-like            102   7e-21   
ref|XP_004360814.1|  hypothetical protein DFA_05093                     101   7e-21   
ref|XP_008329020.1|  PREDICTED: cysteine protease ATG4D                 101   7e-21   
ref|XP_005857734.1|  PREDICTED: cysteine protease ATG4B isoform X2      101   7e-21   
ref|XP_006165246.1|  PREDICTED: cysteine protease ATG4B                 101   7e-21   
ref|XP_007551645.1|  PREDICTED: cysteine protease ATG4D                 102   7e-21   
gb|EGT59662.1|  CBN-ATG-4.1 protein                                     101   7e-21   
ref|XP_005857735.1|  PREDICTED: cysteine protease ATG4B isoform X3      101   8e-21   
ref|XP_005857736.1|  PREDICTED: cysteine protease ATG4B isoform X4      101   8e-21   
ref|XP_002901571.1|  cysteine protease family C54, putative             100   8e-21   
ref|XP_006760601.1|  PREDICTED: cysteine protease ATG4B isoform X2      100   8e-21   
ref|XP_005797627.1|  PREDICTED: cysteine protease ATG4D-like            101   8e-21   
gb|ETS61635.1|  hypothetical protein PaG_04127                          103   8e-21   
ref|XP_011550553.1|  PREDICTED: cysteine protease ATG4D                 101   8e-21   
dbj|GAC71266.1|  cysteine protease                                      103   8e-21   
ref|XP_001980048.1|  GG20629                                            102   8e-21   
ref|XP_005361424.1|  PREDICTED: cysteine protease ATG4B                 100   8e-21   
ref|XP_006083074.1|  PREDICTED: cysteine protease ATG4B isoform X1      101   9e-21   
gb|EGT41252.1|  hypothetical protein CAEBREN_15768                      101   9e-21   
ref|XP_005185864.1|  PREDICTED: cysteine protease ATG4D                 102   9e-21   
ref|XP_005857733.1|  PREDICTED: cysteine protease ATG4B isoform X1      101   9e-21   
ref|XP_006632797.1|  PREDICTED: cysteine protease ATG4A-like isof...    100   1e-20   
emb|CDH54939.1|  cysteine protease atg4a                                101   1e-20   
ref|NP_001085611.1|  cysteine protease ATG4A                            100   1e-20   
gb|ACO10349.1|  Cysteine protease ATG4B                                 100   1e-20   
ref|XP_008556293.1|  PREDICTED: cysteine protease ATG4D                 101   1e-20   
ref|XP_004427815.1|  PREDICTED: cysteine protease ATG4B                 100   1e-20   
ref|XP_006760600.1|  PREDICTED: cysteine protease ATG4B isoform X1      100   1e-20   
ref|XP_010784097.1|  PREDICTED: cysteine protease ATG4B                 100   1e-20   
ref|XP_003774724.1|  PREDICTED: cysteine protease ATG4A                 100   1e-20   
ref|XP_004386575.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    100   1e-20   
ref|XP_008136707.1|  PREDICTED: cysteine protease ATG4B isoform X1      100   1e-20   
gb|KFW09067.1|  Cysteine protease ATG4A                                 100   1e-20   
ref|XP_010154018.1|  PREDICTED: cysteine protease ATG4A                 100   1e-20   
gb|ELK32675.1|  Cysteine protease ATG4B                                 100   1e-20   
gb|AFS31124.1|  autophagy related protein Atg4-like protein           99.8    1e-20   
ref|XP_009067746.1|  PREDICTED: cysteine protease ATG4B                 100   1e-20   
ref|XP_638996.1|  hypothetical protein DDB_G0283753                     101   1e-20   
ref|XP_008136708.1|  PREDICTED: cysteine protease ATG4B isoform X2      100   1e-20   
ref|XP_004597486.1|  PREDICTED: cysteine protease ATG4B                 100   1e-20   
ref|XP_004534138.1|  PREDICTED: cysteine protease ATG4D-like            102   1e-20   
ref|XP_002097748.1|  GE26385                                            102   1e-20   
ref|XP_007560398.1|  PREDICTED: cysteine protease ATG4D-like            100   1e-20   
gb|ETN66442.1|  Autophagy-specific protein                            99.8    1e-20   
gb|KFP75007.1|  Cysteine protease ATG4B                               99.8    1e-20   
ref|XP_002069918.1|  GK11310                                            102   2e-20   
ref|XP_011476875.1|  PREDICTED: cysteine protease ATG4D-like isof...    100   2e-20   
ref|XP_004067831.1|  PREDICTED: cysteine protease ATG4B               99.8    2e-20   
gb|EKC21133.1|  Leucine-rich repeat-containing protein 6                102   2e-20   
ref|XP_006909978.1|  PREDICTED: cysteine protease ATG4B               99.0    2e-20   
ref|NP_001016619.1|  autophagy related 4A, cysteine peptidase         99.8    2e-20   
ref|XP_006637839.1|  PREDICTED: cysteine protease ATG4B-like          99.8    2e-20   
ref|XP_554420.4|  AGAP004023-PA                                         101   2e-20   
ref|XP_010345601.1|  PREDICTED: cysteine protease ATG4B isoform X3    98.2    2e-20   
ref|XP_005026006.1|  PREDICTED: cysteine protease ATG4A-like          99.0    2e-20   
gb|KFD72515.1|  hypothetical protein M514_15351                       99.8    2e-20   
ref|NP_001072464.1|  autophagy related 4B, cysteine peptidase         99.4    2e-20   
ref|XP_005614461.1|  PREDICTED: cysteine protease ATG4A isoform X3    99.4    2e-20   
ref|XP_011550614.1|  PREDICTED: cysteine protease ATG4B               99.4    2e-20   
emb|CEI85714.1|  hypothetical protein RMCBS344292_00171               97.8    2e-20   
ref|XP_001490718.3|  PREDICTED: cysteine protease ATG4A isoform X1    99.4    2e-20   
ref|XP_001357920.3|  GA19429                                            101   2e-20   
ref|XP_002020011.1|  GL13755                                            101   2e-20   
ref|XP_008250612.1|  PREDICTED: cysteine protease ATG4B isoform X4    99.0    2e-20   
gb|EHJ67950.1|  autophagy related protein Atg4-like protein           99.0    2e-20   
gb|KHJ48776.1|  hypothetical protein D918_01081                       99.8    2e-20   
ref|XP_003139474.1|  hypothetical protein LOAG_03889                    100   2e-20   
gb|ERE82022.1|  cysteine protease ATG4B-like protein                  99.0    2e-20   
ref|XP_008413411.1|  PREDICTED: cysteine protease ATG4D-like            100   2e-20   
ref|XP_005050922.1|  PREDICTED: cysteine protease ATG4B                 100   2e-20   
ref|XP_004071879.1|  PREDICTED: cysteine protease ATG4D-like isof...    100   2e-20   
ref|XP_003494013.1|  PREDICTED: cysteine protease ATG4B-like          99.4    2e-20   
ref|XP_005614460.1|  PREDICTED: cysteine protease ATG4A isoform X2    99.4    2e-20   
gb|ERE82023.1|  cysteine protease ATG4B-like protein                  99.4    2e-20   
ref|XP_008305564.1|  PREDICTED: cysteine protease ATG4B isoform X2    99.4    3e-20   
ref|XP_010738092.1|  PREDICTED: cysteine protease ATG4B               99.4    3e-20   
gb|EGV95335.1|  Cysteine protease ATG4B                               99.4    3e-20   
ref|XP_003393246.1|  PREDICTED: cysteine protease ATG4B-like isof...  99.0    3e-20   
ref|XP_008250610.1|  PREDICTED: cysteine protease ATG4B isoform X2    99.4    3e-20   
gb|KFB41311.1|  AGAP004023-PA-like protein                              101   3e-20   
gb|KGB33028.1|  Cysteine protease ATG4B                                 100   3e-20   
ref|XP_007438433.1|  PREDICTED: cysteine protease ATG4B-like          97.4    3e-20   
ref|XP_007638248.1|  PREDICTED: cysteine protease ATG4B               99.4    3e-20   
emb|CDQ85923.1|  unnamed protein product                                100   3e-20   
emb|CAF90552.1|  unnamed protein product                              99.0    3e-20   
ref|XP_005682419.1|  PREDICTED: cysteine protease ATG4D isoform X3    97.4    3e-20   
ref|XP_011509141.1|  PREDICTED: cysteine protease ATG4B isoform X5    97.4    3e-20   
ref|XP_003393247.1|  PREDICTED: cysteine protease ATG4B-like isof...  99.0    3e-20   
gb|ERE82024.1|  cysteine protease ATG4B-like protein                  98.6    3e-20   
ref|XP_008250609.1|  PREDICTED: cysteine protease ATG4B isoform X1    99.0    3e-20   
dbj|GAN07444.1|  cysteine protease ATG4A isoform X1                     100   3e-20   
ref|XP_008250611.1|  PREDICTED: cysteine protease ATG4B isoform X3    99.0    3e-20   
ref|XP_005610863.1|  PREDICTED: cysteine protease ATG4B               99.0    3e-20   
ref|XP_008305563.1|  PREDICTED: cysteine protease ATG4B isoform X1    99.0    3e-20   
ref|XP_001964535.1|  GF23235                                            100   3e-20   
ref|XP_008851187.1|  PREDICTED: cysteine protease ATG4A               99.0    3e-20   
ref|NP_001177212.1|  cysteine protease ATG4B                          99.0    3e-20   
gb|ERG79102.1|  cysteine protease atg4a                               98.6    4e-20   
ref|XP_007651132.1|  PREDICTED: cysteine protease ATG4A isoform X5    98.2    4e-20   
ref|XP_006902983.1|  PREDICTED: cysteine protease ATG4B               98.6    4e-20   
ref|XP_001366892.1|  PREDICTED: cysteine protease ATG4B isoform X1    98.6    4e-20   
gb|ETE63547.1|  Cysteine protease ATG4B                               98.6    4e-20   
ref|XP_008550177.1|  PREDICTED: cysteine protease ATG4B               98.6    4e-20   
ref|XP_004414469.1|  PREDICTED: cysteine protease ATG4A               98.6    4e-20   
ref|XP_007502499.1|  PREDICTED: cysteine protease ATG4B isoform X2    98.6    4e-20   
ref|XP_004861508.1|  PREDICTED: cysteine protease ATG4A isoform X2    98.6    4e-20   
ref|XP_011374576.1|  PREDICTED: cysteine protease ATG4B isoform X2    98.6    4e-20   
ref|XP_010345598.1|  PREDICTED: cysteine protease ATG4B isoform X1    97.8    4e-20   
ref|XP_004861507.1|  PREDICTED: cysteine protease ATG4A isoform X1    98.6    5e-20   
ref|NP_001088025.1|  cysteine protease ATG4B                          98.2    5e-20   



>ref|XP_009588897.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Nicotiana 
tomentosiformis]
Length=487

 Score =   299 bits (766),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 173/212 (82%), Gaps = 1/212 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP LC++DI R C +LS G+VDW P++ LVPLVLGLDK+N RY+PLL ATF
Sbjct  276  GDEDGERGGAPVLCVEDIVRHCSDLSNGEVDWIPVLFLVPLVLGLDKINSRYLPLLAATF  335

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            SFPQSLGILGGRPG STYIVGVQDDQAFYLDPHEVQ VVD+  D LDIDTSSYHC+ +R 
Sbjct  336  SFPQSLGILGGRPGASTYIVGVQDDQAFYLDPHEVQPVVDIKTDKLDIDTSSYHCNTLRH  395

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQD-M  350
             PLDSIDPSLAIGFYC+DKSDFDDFC RAS+LVDQS GAPLFTITETR+    V+Y D +
Sbjct  396  FPLDSIDPSLAIGFYCRDKSDFDDFCIRASKLVDQSNGAPLFTITETRSSPTAVEYNDRV  455

Query  349  QGEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
               +      SFDA   G+S+ G+ ED+WQLL
Sbjct  456  TSNSGVPELDSFDAVGPGESDGGRPEDEWQLL  487



>ref|XP_009761430.1| PREDICTED: cysteine protease ATG4-like isoform X1 [Nicotiana 
sylvestris]
Length=515

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 173/212 (82%), Gaps = 1/212 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP LC++DI R C +LSKG+ DW P++ LVPLVLGLDK+N RY+PLL ATF
Sbjct  304  GDEDGERGGAPVLCVEDIVRHCSDLSKGEADWIPVLFLVPLVLGLDKINSRYLPLLAATF  363

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            SFPQSLGILGGRPG STYIVGVQDDQAFYLDPHEVQ VVD+  D LDIDTSSYHC+ VR 
Sbjct  364  SFPQSLGILGGRPGASTYIVGVQDDQAFYLDPHEVQPVVDIKTDKLDIDTSSYHCNTVRH  423

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQD-M  350
             PLDSIDPSLAIGFYC+DKSDFDDFC RAS+LVDQS GAPLFTITETR+ +  V+Y D +
Sbjct  424  FPLDSIDPSLAIGFYCRDKSDFDDFCIRASKLVDQSNGAPLFTITETRSPATSVEYNDRV  483

Query  349  QGEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
               +      SFDA   G+S+  + ED+WQLL
Sbjct  484  TSNSGVPELDSFDAVGPGESDGSRPEDEWQLL  515



>ref|XP_009588896.1| PREDICTED: cysteine protease ATG4-like isoform X1 [Nicotiana 
tomentosiformis]
Length=515

 Score =   300 bits (767),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 173/212 (82%), Gaps = 1/212 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP LC++DI R C +LS G+VDW P++ LVPLVLGLDK+N RY+PLL ATF
Sbjct  304  GDEDGERGGAPVLCVEDIVRHCSDLSNGEVDWIPVLFLVPLVLGLDKINSRYLPLLAATF  363

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            SFPQSLGILGGRPG STYIVGVQDDQAFYLDPHEVQ VVD+  D LDIDTSSYHC+ +R 
Sbjct  364  SFPQSLGILGGRPGASTYIVGVQDDQAFYLDPHEVQPVVDIKTDKLDIDTSSYHCNTLRH  423

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQD-M  350
             PLDSIDPSLAIGFYC+DKSDFDDFC RAS+LVDQS GAPLFTITETR+    V+Y D +
Sbjct  424  FPLDSIDPSLAIGFYCRDKSDFDDFCIRASKLVDQSNGAPLFTITETRSSPTAVEYNDRV  483

Query  349  QGEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
               +      SFDA   G+S+ G+ ED+WQLL
Sbjct  484  TSNSGVPELDSFDAVGPGESDGGRPEDEWQLL  515



>ref|XP_009761431.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Nicotiana 
sylvestris]
Length=487

 Score =   299 bits (765),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 152/212 (72%), Positives = 173/212 (82%), Gaps = 1/212 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP LC++DI R C +LSKG+ DW P++ LVPLVLGLDK+N RY+PLL ATF
Sbjct  276  GDEDGERGGAPVLCVEDIVRHCSDLSKGEADWIPVLFLVPLVLGLDKINSRYLPLLAATF  335

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            SFPQSLGILGGRPG STYIVGVQDDQAFYLDPHEVQ VVD+  D LDIDTSSYHC+ VR 
Sbjct  336  SFPQSLGILGGRPGASTYIVGVQDDQAFYLDPHEVQPVVDIKTDKLDIDTSSYHCNTVRH  395

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQD-M  350
             PLDSIDPSLAIGFYC+DKSDFDDFC RAS+LVDQS GAPLFTITETR+ +  V+Y D +
Sbjct  396  FPLDSIDPSLAIGFYCRDKSDFDDFCIRASKLVDQSNGAPLFTITETRSPATSVEYNDRV  455

Query  349  QGEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
               +      SFDA   G+S+  + ED+WQLL
Sbjct  456  TSNSGVPELDSFDAVGPGESDGSRPEDEWQLL  487



>gb|EYU31238.1| hypothetical protein MIMGU_mgv1a004965mg [Erythranthe guttata]
Length=502

 Score =   295 bits (754),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 174/211 (82%), Gaps = 6/211 (3%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CI+D+ R C E   GQVDWAPI+L+VPLVLGL+KVNPRY+PLL ATF
Sbjct  298  GDEDGERGGAPVVCIEDVLRHCSEFGGGQVDWAPILLMVPLVLGLEKVNPRYLPLLSATF  357

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGGRPG STYIVGVQD++AFYLDPHEVQQV+D+ RDNLD+DTSSYHC+VVR 
Sbjct  358  TFPQSLGILGGRPGASTYIVGVQDEKAFYLDPHEVQQVIDIKRDNLDLDTSSYHCNVVRH  417

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PLDSID SLAIGFYC+DKSDFDDFCARASEL+DQS GAPLFTI ETR ++ P       
Sbjct  418  IPLDSIDSSLAIGFYCRDKSDFDDFCARASELIDQSNGAPLFTIAETRTLAKPA------  471

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
            G  + E     +A +   +EN  QEDDWQLL
Sbjct  472  GNNNTEIEDKNNADNDLATENCAQEDDWQLL  502



>ref|XP_006354185.1| PREDICTED: cysteine protease ATG4-like isoform X1 [Solanum tuberosum]
Length=524

 Score =   293 bits (751),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 174/213 (82%), Gaps = 2/213 (1%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP LCI+DI + C  LSKG+VDW P++ LVPLVLGLDK+N RY+PLL ATF
Sbjct  312  GDEDGERGGAPVLCIEDIVKHCSGLSKGEVDWTPVVFLVPLVLGLDKINSRYLPLLAATF  371

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            SFPQSLGILGGRPG STYI+GVQDD+AFYLDPHEVQ VVD+  D LD+DTSSYHC+ VR 
Sbjct  372  SFPQSLGILGGRPGASTYIIGVQDDKAFYLDPHEVQPVVDIKMDKLDVDTSSYHCNTVRH  431

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQD-M  350
             PLDSIDPSLAIGFYC+DKSDFDDFC RASELVDQS GAPLFTIT TR+ +  V+Y D +
Sbjct  432  FPLDSIDPSLAIGFYCRDKSDFDDFCIRASELVDQSNGAPLFTITATRSSATSVEYNDRL  491

Query  349  QGEASAEGFKSFDATSIGDSE-NGKQEDDWQLL  254
              +       SFDA + G+S+ + + ED+WQLL
Sbjct  492  TSDTGVPELDSFDAGAPGESDGSSRPEDEWQLL  524



>ref|XP_004228630.1| PREDICTED: cysteine protease ATG4 isoform X2 [Solanum lycopersicum]
Length=493

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 149/213 (70%), Positives = 174/213 (82%), Gaps = 2/213 (1%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP LC++DI + C  L+KG+VDW P++ LVPLVLGLDK+N RY+PLL ATF
Sbjct  281  GDEDGERGGAPVLCVEDIVKHCSGLAKGEVDWTPVLFLVPLVLGLDKINSRYLPLLAATF  340

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            SFPQSLGILGGRPG STYIVGVQDD+A YLDPHEVQ VVD+  D LD+DTSSYHC+ VR 
Sbjct  341  SFPQSLGILGGRPGASTYIVGVQDDKAVYLDPHEVQPVVDIKMDKLDVDTSSYHCNTVRH  400

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQD-M  350
             PLDSIDPSLAIGFYC+DKSDFDDFC RASELVDQS GAPLFTITETR+ +  V+Y D +
Sbjct  401  FPLDSIDPSLAIGFYCRDKSDFDDFCIRASELVDQSNGAPLFTITETRSSATSVEYNDRL  460

Query  349  QGEASAEGFKSFDATSIGDSE-NGKQEDDWQLL  254
              +       SFDA + G+S+ + + ED+WQLL
Sbjct  461  TSDTGVPELDSFDAVAPGESDGSSRPEDEWQLL  493



>ref|XP_006354186.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Solanum tuberosum]
Length=496

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 174/213 (82%), Gaps = 2/213 (1%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP LCI+DI + C  LSKG+VDW P++ LVPLVLGLDK+N RY+PLL ATF
Sbjct  284  GDEDGERGGAPVLCIEDIVKHCSGLSKGEVDWTPVVFLVPLVLGLDKINSRYLPLLAATF  343

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            SFPQSLGILGGRPG STYI+GVQDD+AFYLDPHEVQ VVD+  D LD+DTSSYHC+ VR 
Sbjct  344  SFPQSLGILGGRPGASTYIIGVQDDKAFYLDPHEVQPVVDIKMDKLDVDTSSYHCNTVRH  403

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQD-M  350
             PLDSIDPSLAIGFYC+DKSDFDDFC RASELVDQS GAPLFTIT TR+ +  V+Y D +
Sbjct  404  FPLDSIDPSLAIGFYCRDKSDFDDFCIRASELVDQSNGAPLFTITATRSSATSVEYNDRL  463

Query  349  QGEASAEGFKSFDATSIGDSE-NGKQEDDWQLL  254
              +       SFDA + G+S+ + + ED+WQLL
Sbjct  464  TSDTGVPELDSFDAGAPGESDGSSRPEDEWQLL  496



>ref|XP_010316044.1| PREDICTED: cysteine protease ATG4 isoform X1 [Solanum lycopersicum]
Length=521

 Score =   293 bits (750),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 149/213 (70%), Positives = 174/213 (82%), Gaps = 2/213 (1%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP LC++DI + C  L+KG+VDW P++ LVPLVLGLDK+N RY+PLL ATF
Sbjct  309  GDEDGERGGAPVLCVEDIVKHCSGLAKGEVDWTPVLFLVPLVLGLDKINSRYLPLLAATF  368

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            SFPQSLGILGGRPG STYIVGVQDD+A YLDPHEVQ VVD+  D LD+DTSSYHC+ VR 
Sbjct  369  SFPQSLGILGGRPGASTYIVGVQDDKAVYLDPHEVQPVVDIKMDKLDVDTSSYHCNTVRH  428

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQD-M  350
             PLDSIDPSLAIGFYC+DKSDFDDFC RASELVDQS GAPLFTITETR+ +  V+Y D +
Sbjct  429  FPLDSIDPSLAIGFYCRDKSDFDDFCIRASELVDQSNGAPLFTITETRSSATSVEYNDRL  488

Query  349  QGEASAEGFKSFDATSIGDSE-NGKQEDDWQLL  254
              +       SFDA + G+S+ + + ED+WQLL
Sbjct  489  TSDTGVPELDSFDAVAPGESDGSSRPEDEWQLL  521



>ref|XP_008375115.1| PREDICTED: cysteine protease ATG4 [Malus domestica]
Length=492

 Score =   281 bits (718),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 175/212 (83%), Gaps = 1/212 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CI+D SR CLE S+GQVDW PI+LLVPLVLGL+KVNPRYIP L+ATF
Sbjct  281  GDEDGERGGAPVVCIEDASRHCLEFSRGQVDWTPILLLVPLVLGLEKVNPRYIPSLRATF  340

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGI+GG+PGVSTYI+GVQD++A YLDPHEVQ V+++ RD+++ DT SYHC+V+R 
Sbjct  341  TFPQSLGIMGGKPGVSTYIIGVQDEKALYLDPHEVQPVINIRRDDMEADTLSYHCNVIRH  400

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PLD IDPSLAIGFYC+D+ DF+DFC RAS+L D+S GAPLFT+T+T +V  PV + D  
Sbjct  401  IPLDLIDPSLAIGFYCRDRDDFNDFCFRASKLADESNGAPLFTVTQTHSVPRPVNHSDAL  460

Query  346  GEASA-EGFKSFDATSIGDSENGKQEDDWQLL  254
            G++ A E   SF    + D++   QEDDWQLL
Sbjct  461  GDSGAVENDDSFSVLPMSDADGSAQEDDWQLL  492



>ref|XP_008346919.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Malus domestica]
Length=487

 Score =   279 bits (713),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 174/212 (82%), Gaps = 1/212 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CI+D SR CLE S+GQVDW PI+LLVPLVLGL+KVNPRYIP L+ATF
Sbjct  276  GDEDGERGGAPVVCIEDASRHCLEFSRGQVDWTPILLLVPLVLGLEKVNPRYIPSLRATF  335

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGI+GG+PG STYI+GVQD++A YLDPHEVQ V+++ RD+L+ DT SYHC+V+R 
Sbjct  336  TFPQSLGIMGGKPGASTYIIGVQDEKALYLDPHEVQPVINIRRDDLEADTLSYHCNVIRH  395

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PLD IDPSLAIGFYC+D+ DF+DFC RAS+L D+S GAPLFT+T+T +V  PV + D  
Sbjct  396  IPLDLIDPSLAIGFYCRDRDDFNDFCFRASKLADESNGAPLFTVTQTHSVPRPVNHSDAL  455

Query  346  GEASA-EGFKSFDATSIGDSENGKQEDDWQLL  254
            G++ A E   SF    + D++   QED+WQLL
Sbjct  456  GDSGAVENDDSFSVLPMSDADGSAQEDEWQLL  487



>ref|XP_009354662.1| PREDICTED: cysteine protease ATG4-like [Pyrus x bretschneideri]
 ref|XP_009354663.1| PREDICTED: cysteine protease ATG4-like [Pyrus x bretschneideri]
Length=487

 Score =   278 bits (711),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 173/212 (82%), Gaps = 1/212 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CI+D SR CLE S+GQVDW PI+LLVPLVLGL+KVNPRYIP L+ATF
Sbjct  276  GDEDGERGGAPVVCIEDASRHCLEFSRGQVDWTPILLLVPLVLGLEKVNPRYIPSLRATF  335

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGI+GG+PG STYI+GVQD++A YLDPHEVQ V+++ RD+L+ DT SYHC+V+R 
Sbjct  336  TFPQSLGIMGGKPGASTYIIGVQDEKALYLDPHEVQPVINIRRDDLEADTLSYHCNVIRH  395

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PLD IDPSLAIGFYC+D+ DF+DFC RAS+L D+S GAPLFT+T+T +   PV + D  
Sbjct  396  IPLDLIDPSLAIGFYCRDRDDFNDFCFRASKLADESNGAPLFTVTQTHSFPRPVNHSDAL  455

Query  346  GEASA-EGFKSFDATSIGDSENGKQEDDWQLL  254
            G++ A E   SF    + D++   QEDDWQLL
Sbjct  456  GDSGAVENDDSFSVLPMSDADGSAQEDDWQLL  487



>ref|XP_010093156.1| hypothetical protein L484_005165 [Morus notabilis]
 gb|EXB53615.1| hypothetical protein L484_005165 [Morus notabilis]
Length=444

 Score =   276 bits (705),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 138/211 (65%), Positives = 173/211 (82%), Gaps = 1/211 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +C++D  R CLE S+GQ +W P++LLVPLVLGLD VNPRYIP L+ TF
Sbjct  235  GDEDGERGGAPVVCVEDAFRHCLEFSRGQANWTPMLLLVPLVLGLDTVNPRYIPSLRETF  294

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGI+GGRPG STYIVGVQD++AFYLDPHEVQ V+D+ R++++ DTSSYH +V+R 
Sbjct  295  TFPQSLGIMGGRPGASTYIVGVQDEKAFYLDPHEVQPVIDISRNSVEADTSSYHSNVIRH  354

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            + LDSIDPSLAIGFYC+DK+DFDDFC RAS+L D+S GAPLFT+T T+N+  PV + D+ 
Sbjct  355  IGLDSIDPSLAIGFYCRDKNDFDDFCFRASKLADESNGAPLFTVTRTKNLPKPVGHADVL  414

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
            G++S     SFDA    ++E+   EDDWQLL
Sbjct  415  GDSSGIS-DSFDALPSNNTEDCSHEDDWQLL  444



>ref|XP_010037858.1| PREDICTED: cysteine protease ATG4 isoform X2 [Eucalyptus grandis]
 ref|XP_010037859.1| PREDICTED: cysteine protease ATG4 isoform X2 [Eucalyptus grandis]
Length=395

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 167/212 (79%), Gaps = 1/212 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP LCI+D  + CLE S+GQ +W PI+LLVPLVLGL+KVNPRYIPLL+ATF
Sbjct  184  GDEDGERGGAPVLCIEDARKCCLEFSRGQDEWTPILLLVPLVLGLEKVNPRYIPLLRATF  243

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            SFPQSLGILGG+PG STY++GVQDD+AFYLDPH+VQ V  +  DNLD DTSSYHC+V+R+
Sbjct  244  SFPQSLGILGGKPGASTYLIGVQDDEAFYLDPHDVQPVCSISTDNLDSDTSSYHCNVIRR  303

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PLDS+DPSLAIGFYC+DK DFDDFC+RAS+L D S GAPLFT+ +T +   PV +    
Sbjct  304  IPLDSLDPSLAIGFYCRDKDDFDDFCSRASKLADDSSGAPLFTVAQTHSTPKPVGHSGDS  363

Query  346  GEAS-AEGFKSFDATSIGDSENGKQEDDWQLL  254
             E    EG   F    +GD +    ED+WQLL
Sbjct  364  TEGGIVEGNNPFSVIPMGDGDGSAGEDEWQLL  395



>ref|XP_010037856.1| PREDICTED: cysteine protease ATG4 isoform X1 [Eucalyptus grandis]
 ref|XP_010037857.1| PREDICTED: cysteine protease ATG4 isoform X1 [Eucalyptus grandis]
 gb|KCW49636.1| hypothetical protein EUGRSUZ_K03157 [Eucalyptus grandis]
Length=485

 Score =   270 bits (690),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 167/212 (79%), Gaps = 1/212 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP LCI+D  + CLE S+GQ +W PI+LLVPLVLGL+KVNPRYIPLL+ATF
Sbjct  274  GDEDGERGGAPVLCIEDARKCCLEFSRGQDEWTPILLLVPLVLGLEKVNPRYIPLLRATF  333

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            SFPQSLGILGG+PG STY++GVQDD+AFYLDPH+VQ V  +  DNLD DTSSYHC+V+R+
Sbjct  334  SFPQSLGILGGKPGASTYLIGVQDDEAFYLDPHDVQPVCSISTDNLDSDTSSYHCNVIRR  393

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PLDS+DPSLAIGFYC+DK DFDDFC+RAS+L D S GAPLFT+ +T +   PV +    
Sbjct  394  IPLDSLDPSLAIGFYCRDKDDFDDFCSRASKLADDSSGAPLFTVAQTHSTPKPVGHSGDS  453

Query  346  GEAS-AEGFKSFDATSIGDSENGKQEDDWQLL  254
             E    EG   F    +GD +    ED+WQLL
Sbjct  454  TEGGIVEGNNPFSVIPMGDGDGSAGEDEWQLL  485



>ref|XP_003635099.1| PREDICTED: cysteine protease ATG4 isoform X2 [Vitis vinifera]
 emb|CBI33041.3| unnamed protein product [Vitis vinifera]
Length=486

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 169/216 (78%), Gaps = 7/216 (3%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP + I++ SR CLE SKGQVDW PI+LLVPLVLGL+KVNPRYIP L ATF
Sbjct  273  GDEDGERGGAPVVYIEEASRHCLEFSKGQVDWTPILLLVPLVLGLEKVNPRYIPSLAATF  332

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQD++AFYLDPHE Q VVD+ R+NL+ DTSSYHC+++R 
Sbjct  333  TFPQSLGILGGKPGASTYIVGVQDEKAFYLDPHEAQSVVDIRRENLEADTSSYHCNIIRH  392

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            + LDSIDPSLAIGFYC+DK DFDDFC RAS+L D+S GAPLFT+    ++  P+   D  
Sbjct  393  ICLDSIDPSLAIGFYCRDKDDFDDFCIRASKLADKSNGAPLFTVAHIHSLPKPISCSDGM  452

Query  346  GEASAEGFK---SFDATSIGDSE--NGKQEDDWQLL  254
             + S  GF+   SFD  S   +E    + EDDWQLL
Sbjct  453  DDCS--GFREDDSFDVVSNKGAEGYEHEHEDDWQLL  486



>ref|XP_010277861.1| PREDICTED: cysteine protease ATG4-like [Nelumbo nucifera]
 ref|XP_010277863.1| PREDICTED: cysteine protease ATG4-like [Nelumbo nucifera]
 ref|XP_010277864.1| PREDICTED: cysteine protease ATG4-like [Nelumbo nucifera]
 ref|XP_010277865.1| PREDICTED: cysteine protease ATG4-like [Nelumbo nucifera]
Length=490

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 175/218 (80%), Gaps = 12/218 (6%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +C++D++R C E SKGQVDWAPI+LLVPLVLGL+KVNPRYIPLL ATF
Sbjct  278  GDEDGERGGAPVVCVEDVARLCSEFSKGQVDWAPILLLVPLVLGLEKVNPRYIPLLWATF  337

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+ GVSTYIVG+QDD+AFYLDPH+VQ VVD+  ++L+ DTSSYHC V+R 
Sbjct  338  TFPQSLGILGGKSGVSTYIVGMQDDKAFYLDPHDVQAVVDIRGNDLEADTSSYHCSVIRH  397

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDM-  350
            LPLD IDPSLAIGF+C++K DF+DFC RAS+L D+S GAPLFT+ ++ + + P+ ++D+ 
Sbjct  398  LPLDMIDPSLAIGFFCQNKDDFNDFCVRASKLADESNGAPLFTVAQSHSPTKPINHEDVM  457

Query  349  --QGEASAEGFKSFDATSIG----DSENGKQEDDWQLL  254
              +GE   +     DA  +G    DSE    +DDWQLL
Sbjct  458  VNRGEIQGD-----DAIVLGNPPSDSEAQSHDDDWQLL  490



>ref|XP_006441972.1| hypothetical protein CICLE_v10019906mg [Citrus clementina]
 gb|ESR55212.1| hypothetical protein CICLE_v10019906mg [Citrus clementina]
Length=314

 Score =   259 bits (662),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 165/212 (78%), Gaps = 3/212 (1%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CIDD SR C   SKGQ DW PI+LLVPLVLGL+KVNPRYIP L+ TF
Sbjct  105  GDEDGERGGAPVVCIDDASRHCSVFSKGQADWTPILLLVPLVLGLEKVNPRYIPTLRLTF  164

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGI+GG+PG STYIVGVQ++ A YLDPH+VQ V+++G+D+L+ DTS+YH DV+R 
Sbjct  165  TFPQSLGIVGGKPGASTYIVGVQEESAIYLDPHDVQLVINIGKDDLEADTSTYHSDVIRH  224

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            + LDSIDPSLAIGFYC+DK DFDDFCARAS+L ++S GAPLFT+T+T     PV + D+ 
Sbjct  225  IHLDSIDPSLAIGFYCRDKDDFDDFCARASKLAEESNGAPLFTVTQTHK--KPVNHSDVL  282

Query  346  GEASAEGF-KSFDATSIGDSENGKQEDDWQLL  254
            GE        S    S+ D+     EDDWQLL
Sbjct  283  GETGGVPEDDSLGVMSMNDAVGNAHEDDWQLL  314



>ref|XP_010646416.1| PREDICTED: cysteine protease ATG4 isoform X3 [Vitis vinifera]
 ref|XP_010646417.1| PREDICTED: cysteine protease ATG4 isoform X3 [Vitis vinifera]
Length=403

 Score =   261 bits (668),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 142/219 (65%), Positives = 168/219 (77%), Gaps = 10/219 (5%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP + I++ SR CLE SKGQVDW PI+LLVPLVLGL+KVNPRYIP L ATF
Sbjct  187  GDEDGERGGAPVVYIEEASRHCLEFSKGQVDWTPILLLVPLVLGLEKVNPRYIPSLAATF  246

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCD---V  536
            +FPQSLGILGG+PG STYIVGVQD++AFYLDPHE Q VVD+ R+NL+ DTSSYHC+   +
Sbjct  247  TFPQSLGILGGKPGASTYIVGVQDEKAFYLDPHEAQSVVDIRRENLEADTSSYHCNCSSI  306

Query  535  VRQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQ  356
            +R + LDSIDPSLAIGFYC+DK DFDDFC RAS+L D+S GAPLFT+    ++  P+   
Sbjct  307  IRHICLDSIDPSLAIGFYCRDKDDFDDFCIRASKLADKSNGAPLFTVAHIHSLPKPISCS  366

Query  355  DMQGEASAEGFK---SFDATSIGDSE--NGKQEDDWQLL  254
            D  G     GF+   SFD  S   +E    + EDDWQLL
Sbjct  367  D--GMDDCSGFREDDSFDVVSNKGAEGYEHEHEDDWQLL  403



>emb|CAN81102.1| hypothetical protein VITISV_021940 [Vitis vinifera]
Length=489

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 142/219 (65%), Positives = 169/219 (77%), Gaps = 10/219 (5%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP + I++ SR CLE SKGQVDW PI+LLVPLVLGL+KVNPRYIP L ATF
Sbjct  273  GDEDGERGGAPVVYIEEASRHCLEFSKGQVDWTPILLLVPLVLGLEKVNPRYIPSLAATF  332

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCD---V  536
            +FPQSLGILGG+PG STYIVGVQD++AFYLDPHE Q VVD+ R+NL+ DTSSYHC+   +
Sbjct  333  TFPQSLGILGGKPGASTYIVGVQDEKAFYLDPHEAQSVVDIRRENLEADTSSYHCNCSSI  392

Query  535  VRQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQ  356
            +R + LDSIDPSLAIGFYC+DK DFDDFC RAS+L D+S GAPLFT+    ++  P+   
Sbjct  393  IRHICLDSIDPSLAIGFYCRDKDDFDDFCIRASKLADESNGAPLFTVAHIHSLPKPISCS  452

Query  355  DMQGEASAEGFK---SFDATSIGDSE--NGKQEDDWQLL  254
            D   + S  GF+   SFD  S   +E    + EDDWQLL
Sbjct  453  DGMDDCS--GFREDDSFDVVSNKGAEGYEHEHEDDWQLL  489



>ref|XP_010646415.1| PREDICTED: cysteine protease ATG4 isoform X1 [Vitis vinifera]
Length=489

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 142/219 (65%), Positives = 169/219 (77%), Gaps = 10/219 (5%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP + I++ SR CLE SKGQVDW PI+LLVPLVLGL+KVNPRYIP L ATF
Sbjct  273  GDEDGERGGAPVVYIEEASRHCLEFSKGQVDWTPILLLVPLVLGLEKVNPRYIPSLAATF  332

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCD---V  536
            +FPQSLGILGG+PG STYIVGVQD++AFYLDPHE Q VVD+ R+NL+ DTSSYHC+   +
Sbjct  333  TFPQSLGILGGKPGASTYIVGVQDEKAFYLDPHEAQSVVDIRRENLEADTSSYHCNCSSI  392

Query  535  VRQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQ  356
            +R + LDSIDPSLAIGFYC+DK DFDDFC RAS+L D+S GAPLFT+    ++  P+   
Sbjct  393  IRHICLDSIDPSLAIGFYCRDKDDFDDFCIRASKLADKSNGAPLFTVAHIHSLPKPISCS  452

Query  355  DMQGEASAEGFK---SFDATSIGDSE--NGKQEDDWQLL  254
            D   + S  GF+   SFD  S   +E    + EDDWQLL
Sbjct  453  DGMDDCS--GFREDDSFDVVSNKGAEGYEHEHEDDWQLL  489



>dbj|BAM93578.1| autophagy related protein 4 [Vigna unguiculata]
Length=219

 Score =   254 bits (648),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 166/212 (78%), Gaps = 1/212 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CI+D  + C E S+GQ  W P++LLVPLVLGLDKVNPRYIPLL +TF
Sbjct  8    GDEDGERGGAPVVCIEDAFKHCSEFSRGQAAWTPLLLLVPLVLGLDKVNPRYIPLLHSTF  67

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDID-TSSYHCDVVR  530
             FPQSLGI+GG+PG STYI+GVQ ++AFYLDPH+VQ VV++  D  + + TSSYHC+V+R
Sbjct  68   KFPQSLGIMGGKPGASTYIIGVQSEKAFYLDPHDVQTVVNISGDTQEPNSTSSYHCNVMR  127

Query  529  QLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDM  350
             +PLDSIDPSLAIGFYC+DK DFDDFC++AS+L ++S GAPLFT+ ++R+ S  V   D+
Sbjct  128  HIPLDSIDPSLAIGFYCRDKDDFDDFCSQASKLAEESNGAPLFTVAQSRSFSKQVSGNDV  187

Query  349  QGEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
             G+ +     +F  T   D++ G  EDDWQLL
Sbjct  188  SGDNTGFEEDAFLGTDHDDNDAGTNEDDWQLL  219



>ref|XP_006478509.1| PREDICTED: cysteine protease ATG4-like isoform X3 [Citrus sinensis]
 gb|KDO40313.1| hypothetical protein CISIN_1g011418mg [Citrus sinensis]
 gb|KDO40314.1| hypothetical protein CISIN_1g011418mg [Citrus sinensis]
 gb|KDO40315.1| hypothetical protein CISIN_1g011418mg [Citrus sinensis]
Length=443

 Score =   260 bits (665),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 165/212 (78%), Gaps = 3/212 (1%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CIDD SR C   SKGQ DW PI+LLVPLVLGL+KVNPRYIP L+ TF
Sbjct  234  GDEDGERGGAPVVCIDDASRHCSVFSKGQADWTPILLLVPLVLGLEKVNPRYIPTLRLTF  293

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGI+GG+PG STYIVGVQ++ A YLDPH+VQ V+++G+D+L+ DTS+YH DV+R 
Sbjct  294  TFPQSLGIVGGKPGASTYIVGVQEESAIYLDPHDVQPVINIGKDDLEADTSTYHSDVIRH  353

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            + LDSIDPSLAIGFYC+DK DFDDFCARAS+L ++S GAPLFT+T+T     PV + D+ 
Sbjct  354  IHLDSIDPSLAIGFYCRDKDDFDDFCARASKLAEESNGAPLFTVTQTHK--KPVNHSDVL  411

Query  346  GEASAEGF-KSFDATSIGDSENGKQEDDWQLL  254
            GE        S    S+ D+     EDDWQLL
Sbjct  412  GETGGVPEDDSLGVMSMNDAVGNAHEDDWQLL  443



>ref|XP_006478508.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Citrus sinensis]
Length=444

 Score =   260 bits (665),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 165/212 (78%), Gaps = 3/212 (1%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CIDD SR C   SKGQ DW PI+LLVPLVLGL+KVNPRYIP L+ TF
Sbjct  235  GDEDGERGGAPVVCIDDASRHCSVFSKGQADWTPILLLVPLVLGLEKVNPRYIPTLRLTF  294

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGI+GG+PG STYIVGVQ++ A YLDPH+VQ V+++G+D+L+ DTS+YH DV+R 
Sbjct  295  TFPQSLGIVGGKPGASTYIVGVQEESAIYLDPHDVQPVINIGKDDLEADTSTYHSDVIRH  354

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            + LDSIDPSLAIGFYC+DK DFDDFCARAS+L ++S GAPLFT+T+T     PV + D+ 
Sbjct  355  IHLDSIDPSLAIGFYCRDKDDFDDFCARASKLAEESNGAPLFTVTQTHK--KPVNHSDVL  412

Query  346  GEASAEGF-KSFDATSIGDSENGKQEDDWQLL  254
            GE        S    S+ D+     EDDWQLL
Sbjct  413  GETGGVPEDDSLGVMSMNDAVGNAHEDDWQLL  444



>ref|XP_006441971.1| hypothetical protein CICLE_v10019906mg [Citrus clementina]
 gb|ESR55211.1| hypothetical protein CICLE_v10019906mg [Citrus clementina]
Length=444

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 165/212 (78%), Gaps = 3/212 (1%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CIDD SR C   SKGQ DW PI+LLVPLVLGL+KVNPRYIP L+ TF
Sbjct  235  GDEDGERGGAPVVCIDDASRHCSVFSKGQADWTPILLLVPLVLGLEKVNPRYIPTLRLTF  294

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGI+GG+PG STYIVGVQ++ A YLDPH+VQ V+++G+D+L+ DTS+YH DV+R 
Sbjct  295  TFPQSLGIVGGKPGASTYIVGVQEESAIYLDPHDVQLVINIGKDDLEADTSTYHSDVIRH  354

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            + LDSIDPSLAIGFYC+DK DFDDFCARAS+L ++S GAPLFT+T+T     PV + D+ 
Sbjct  355  IHLDSIDPSLAIGFYCRDKDDFDDFCARASKLAEESNGAPLFTVTQTHK--KPVNHSDVL  412

Query  346  GEASAEGF-KSFDATSIGDSENGKQEDDWQLL  254
            GE        S    S+ D+     EDDWQLL
Sbjct  413  GETGGVPEDDSLGVMSMNDAVGNAHEDDWQLL  444



>gb|KDO40316.1| hypothetical protein CISIN_1g011418mg [Citrus sinensis]
 gb|KDO40317.1| hypothetical protein CISIN_1g011418mg [Citrus sinensis]
Length=486

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 165/212 (78%), Gaps = 3/212 (1%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CIDD SR C   SKGQ DW PI+LLVPLVLGL+KVNPRYIP L+ TF
Sbjct  277  GDEDGERGGAPVVCIDDASRHCSVFSKGQADWTPILLLVPLVLGLEKVNPRYIPTLRLTF  336

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGI+GG+PG STYIVGVQ++ A YLDPH+VQ V+++G+D+L+ DTS+YH DV+R 
Sbjct  337  TFPQSLGIVGGKPGASTYIVGVQEESAIYLDPHDVQPVINIGKDDLEADTSTYHSDVIRH  396

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            + LDSIDPSLAIGFYC+DK DFDDFCARAS+L ++S GAPLFT+T+T     PV + D+ 
Sbjct  397  IHLDSIDPSLAIGFYCRDKDDFDDFCARASKLAEESNGAPLFTVTQTHK--KPVNHSDVL  454

Query  346  GEASAEGF-KSFDATSIGDSENGKQEDDWQLL  254
            GE        S    S+ D+     EDDWQLL
Sbjct  455  GETGGVPEDDSLGVMSMNDAVGNAHEDDWQLL  486



>ref|XP_006478507.1| PREDICTED: cysteine protease ATG4-like isoform X1 [Citrus sinensis]
Length=486

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 165/212 (78%), Gaps = 3/212 (1%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CIDD SR C   SKGQ DW PI+LLVPLVLGL+KVNPRYIP L+ TF
Sbjct  277  GDEDGERGGAPVVCIDDASRHCSVFSKGQADWTPILLLVPLVLGLEKVNPRYIPTLRLTF  336

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGI+GG+PG STYIVGVQ++ A YLDPH+VQ V+++G+D+L+ DTS+YH DV+R 
Sbjct  337  TFPQSLGIVGGKPGASTYIVGVQEESAIYLDPHDVQPVINIGKDDLEADTSTYHSDVIRH  396

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            + LDSIDPSLAIGFYC+DK DFDDFCARAS+L ++S GAPLFT+T+T     PV + D+ 
Sbjct  397  IHLDSIDPSLAIGFYCRDKDDFDDFCARASKLAEESNGAPLFTVTQTHK--KPVNHSDVL  454

Query  346  GEASAEGF-KSFDATSIGDSENGKQEDDWQLL  254
            GE        S    S+ D+     EDDWQLL
Sbjct  455  GETGGVPEDDSLGVMSMNDAVGNAHEDDWQLL  486



>ref|XP_006441973.1| hypothetical protein CICLE_v10019906mg [Citrus clementina]
 gb|ESR55213.1| hypothetical protein CICLE_v10019906mg [Citrus clementina]
Length=486

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 165/212 (78%), Gaps = 3/212 (1%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CIDD SR C   SKGQ DW PI+LLVPLVLGL+KVNPRYIP L+ TF
Sbjct  277  GDEDGERGGAPVVCIDDASRHCSVFSKGQADWTPILLLVPLVLGLEKVNPRYIPTLRLTF  336

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGI+GG+PG STYIVGVQ++ A YLDPH+VQ V+++G+D+L+ DTS+YH DV+R 
Sbjct  337  TFPQSLGIVGGKPGASTYIVGVQEESAIYLDPHDVQLVINIGKDDLEADTSTYHSDVIRH  396

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            + LDSIDPSLAIGFYC+DK DFDDFCARAS+L ++S GAPLFT+T+T     PV + D+ 
Sbjct  397  IHLDSIDPSLAIGFYCRDKDDFDDFCARASKLAEESNGAPLFTVTQTHK--KPVNHSDVL  454

Query  346  GEASAEGF-KSFDATSIGDSENGKQEDDWQLL  254
            GE        S    S+ D+     EDDWQLL
Sbjct  455  GETGGVPEDDSLGVMSMNDAVGNAHEDDWQLL  486



>gb|KHG08139.1| Cysteine protease ATG4 [Gossypium arboreum]
Length=530

 Score =   261 bits (667),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 136/219 (62%), Positives = 164/219 (75%), Gaps = 8/219 (4%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CI+D SR C E S+ Q DW PI+LLVPLVLGLDKVNPRYIP L+ATF
Sbjct  312  GDEDGERGGAPVVCIEDASRHCFEFSRHQADWTPILLLVPLVLGLDKVNPRYIPSLQATF  371

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQ LGILGG+PG STYIVGVQ++  FYLDPH+VQ VV+L  DNL+ DTSSYHCD++R 
Sbjct  372  TFPQCLGILGGKPGASTYIVGVQEENVFYLDPHDVQPVVNLSSDNLEADTSSYHCDIIRY  431

Query  526  LPLDSIDPSLAIGFYCKDKS-------DFDDFCARASELVDQSGGAPLFTITETRNVSMP  368
            +PLDS+DPSLAIGF+C+DK        DFDDFC RAS+L D+S GAPLFT+ +T +V  P
Sbjct  432  IPLDSLDPSLAIGFFCRDKGFPVNLVDDFDDFCFRASKLADESNGAPLFTVAQTHSVFKP  491

Query  367  VQYQDMQGEASAEGF-KSFDATSIGDSENGKQEDDWQLL  254
            + + D   +A  +    S      GD +    EDDWQLL
Sbjct  492  INHGDTMADAGGDRMDDSIGVLPTGDVDGNSHEDDWQLL  530



>ref|XP_008441686.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Cucumis melo]
Length=455

 Score =   258 bits (659),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 164/211 (78%), Gaps = 1/211 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP L IDD SR C E SKGQ DW+PI+LLVPLVLGL+K+NPRYIP L+ TF
Sbjct  246  GDEDGERGGAPVLYIDDASRHCFEFSKGQHDWSPILLLVPLVLGLEKINPRYIPSLRTTF  305

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQD+ AFYLDPHEVQQVV++ +D+L+ DTSSYHC+V+R 
Sbjct  306  TFPQSLGILGGKPGASTYIVGVQDENAFYLDPHEVQQVVNIDKDDLEADTSSYHCNVIRH  365

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+SIDPSLAIGFYC+DK DFD+FC RAS+L ++S GAPLFT+ ET + +   Q   + 
Sbjct  366  IPLESIDPSLAIGFYCRDKDDFDNFCYRASKLAEESDGAPLFTVAETHSTNSGRQSSALN  425

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
              +      +  A  + + E    EDDWQ L
Sbjct  426  DHSRLVEDDADGAVHMPNEEEA-HEDDWQFL  455



>ref|XP_006372315.1| autophagy 4b family protein [Populus trichocarpa]
 gb|ERP50112.1| autophagy 4b family protein [Populus trichocarpa]
Length=482

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 163/211 (77%), Gaps = 7/211 (3%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI++ +R C E SKGQ DW PI+LLVPLVLGLDK+NPRYIP L+ATF
Sbjct  279  GSEDGERGGAPVLCIEEAARHCSEFSKGQEDWTPILLLVPLVLGLDKINPRYIPSLQATF  338

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQD+ AFYLDPHEVQ VV++ RD+++ +TSSYHC+VVR 
Sbjct  339  TFPQSLGILGGKPGASTYIVGVQDENAFYLDPHEVQPVVNVSRDDVEANTSSYHCNVVRH  398

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PLD IDPSLAIGFYC+DK DFDDFC  AS+L D+S GAPLFT+  +R +      +   
Sbjct  399  MPLDLIDPSLAIGFYCRDKDDFDDFCTLASKLTDESNGAPLFTVAHSRKL-----LKHDS  453

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
            GE  ++   S    ++ D E    EDDWQLL
Sbjct  454  GEVRSD--DSLGVMTMNDVEGCVHEDDWQLL  482



>ref|XP_008441684.1| PREDICTED: cysteine protease ATG4-like isoform X1 [Cucumis melo]
Length=483

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 164/211 (78%), Gaps = 1/211 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP L IDD SR C E SKGQ DW+PI+LLVPLVLGL+K+NPRYIP L+ TF
Sbjct  274  GDEDGERGGAPVLYIDDASRHCFEFSKGQHDWSPILLLVPLVLGLEKINPRYIPSLRTTF  333

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQD+ AFYLDPHEVQQVV++ +D+L+ DTSSYHC+V+R 
Sbjct  334  TFPQSLGILGGKPGASTYIVGVQDENAFYLDPHEVQQVVNIDKDDLEADTSSYHCNVIRH  393

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+SIDPSLAIGFYC+DK DFD+FC RAS+L ++S GAPLFT+ ET + +   Q   + 
Sbjct  394  IPLESIDPSLAIGFYCRDKDDFDNFCYRASKLAEESDGAPLFTVAETHSTNSGRQSSALN  453

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
              +      +  A  + + E    EDDWQ L
Sbjct  454  DHSRLVEDDADGAVHMPNEEEA-HEDDWQFL  483



>gb|EPS69655.1| hypothetical protein M569_05108, partial [Genlisea aurea]
Length=403

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/211 (63%), Positives = 167/211 (79%), Gaps = 12/211 (6%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GD DGERGGAP LC++D+SRRC E  +GQ +WAP++LLVPLVLGL+KVNPRY+PLL ATF
Sbjct  205  GDGDGERGGAPVLCVEDVSRRCSEFGRGQDNWAPVLLLVPLVLGLEKVNPRYLPLLSATF  264

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGGRPGVSTYI+G+QD++A+YLDPHEVQQVVD+ + ++DID SSYHC+VVR 
Sbjct  265  TFPQSLGILGGRPGVSTYIIGIQDEKAYYLDPHEVQQVVDMKKGDIDIDFSSYHCNVVRN  324

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PLDSID SLAIGFYC+ K +FDDFC RASEL++QS GAPLFT+++  +    ++   M 
Sbjct  325  MPLDSIDSSLAIGFYCRGKREFDDFCIRASELIEQSNGAPLFTVSKAGDEKRGIR---MD  381

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
             +   EG            EN + ED+WQLL
Sbjct  382  DDDDDEG---------ALPENCENEDEWQLL  403



>gb|KHN11545.1| Cysteine protease ATG4 [Glycine soja]
Length=486

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 167/212 (79%), Gaps = 2/212 (1%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CI+D S+RC E S G   W P++LLVPLVLGLDKVNPRYIPLL++TF
Sbjct  276  GDEDGERGGAPVVCIEDASKRCFEFSSGLAAWTPLLLLVPLVLGLDKVNPRYIPLLRSTF  335

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLD-IDTSSYHCDVVR  530
             FPQSLGI+GG+PG STYI+G Q+++AFYLDPH+VQQVV++  D  +   TSSYHC+++R
Sbjct  336  KFPQSLGIMGGKPGASTYIIGAQNEKAFYLDPHDVQQVVNISGDTQEPTSTSSYHCNIMR  395

Query  529  QLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDM  350
             +PLDSIDPSLAIGFYC+DK DFDDFC++AS+L ++S GAPLFT+T++R+ S  V   D+
Sbjct  396  HIPLDSIDPSLAIGFYCRDKDDFDDFCSQASKLAEESNGAPLFTVTQSRSFSKQVTSNDV  455

Query  349  QGEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
             G+ +    + F     G+ + G  EDDWQLL
Sbjct  456  SGDNTGFQEEDFPGMDRGN-DTGTNEDDWQLL  486



>ref|XP_009354661.1| PREDICTED: LOW QUALITY PROTEIN: cysteine protease ATG4-like [Pyrus 
x bretschneideri]
Length=528

 Score =   258 bits (660),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 137/253 (54%), Positives = 171/253 (68%), Gaps = 42/253 (17%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CI+D SR CLE S+GQVDW PI+LLVPLVLGL+KVNPRYIP L+ATF
Sbjct  276  GDEDGERGGAPVVCIEDASRHCLEFSRGQVDWTPILLLVPLVLGLEKVNPRYIPSLRATF  335

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQ------------------------  599
            +FPQSLGI+GG+PG STYI+GVQD++A YLDPHEVQ                        
Sbjct  336  TFPQSLGIMGGKPGASTYIIGVQDEKALYLDPHEVQPRRSLSSRCEXVWETVRFWATTGI  395

Query  598  ------------------QVVDLGRDNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKD  473
                               V+++ RD+L+ DT SYHC+V+R +PLD IDPSLAIGFYC+D
Sbjct  396  SNGCLHDVFFLGDFSDWKAVINIRRDDLEADTLSYHCNVIRHIPLDLIDPSLAIGFYCRD  455

Query  472  KSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQGEASAEGFKSFDATSIGD  293
            + D +DFC RAS+L D+S GAPLFT+T+T +   PV + D  G+ + E   SF    + D
Sbjct  456  RDDLNDFCFRASKLADESNGAPLFTVTQTHSFPRPVNHSDALGDGAVENDDSFSVLPMSD  515

Query  292  SENGKQEDDWQLL  254
            ++   QEDDWQLL
Sbjct  516  ADGSAQEDDWQLL  528



>ref|XP_011649086.1| PREDICTED: cysteine protease ATG4-like isoform X1 [Cucumis sativus]
Length=483

 Score =   257 bits (657),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 163/211 (77%), Gaps = 1/211 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP L IDD SR C E SKGQ DW+PI+LLVPLVLGL+K+NPRYIP L+ TF
Sbjct  274  GDEDGERGGAPVLYIDDASRHCFEFSKGQHDWSPILLLVPLVLGLEKINPRYIPSLRTTF  333

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQD+ AFYLDPHEVQQVV++ +D+L+ DTSSYHC+V+R 
Sbjct  334  TFPQSLGILGGKPGASTYIVGVQDENAFYLDPHEVQQVVNIDKDDLEADTSSYHCNVIRH  393

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+SIDPSLAIGFYC+DK DFD+FC RAS+L ++S GAPLFT+ ET + + P +     
Sbjct  394  IPLESIDPSLAIGFYCRDKDDFDNFCHRASKLAEESDGAPLFTVAETHSTN-PGRQSSAL  452

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
             + S       D      +E    EDDWQ L
Sbjct  453  NDHSRLVEDDGDGVVHMPNEEESHEDDWQFL  483



>ref|XP_004138950.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Cucumis sativus]
 gb|KGN61454.1| hypothetical protein Csa_2G128640 [Cucumis sativus]
Length=483

 Score =   257 bits (657),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 163/211 (77%), Gaps = 1/211 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP L IDD SR C E SKGQ DW+PI+LLVPLVLGL+K+NPRYIP L+ TF
Sbjct  274  GDEDGERGGAPVLYIDDASRHCFEFSKGQHDWSPILLLVPLVLGLEKINPRYIPSLRTTF  333

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQD+ AFYLDPHEVQQVV++ +D+L+ DTSSYHC+V+R 
Sbjct  334  TFPQSLGILGGKPGASTYIVGVQDENAFYLDPHEVQQVVNIDKDDLEADTSSYHCNVIRH  393

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+SIDPSLAIGFYC+DK DFD+FC RAS+L ++S GAPLFT+ ET + + P +     
Sbjct  394  IPLESIDPSLAIGFYCRDKDDFDNFCHRASKLAEESDGAPLFTVAETHSTN-PGRQSSAL  452

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
             + S       D      +E    EDDWQ L
Sbjct  453  NDHSRLVEDDGDGVVHMPNEEESHEDDWQFL  483



>gb|KEH23421.1| cysteine protease ATG4B [Medicago truncatula]
Length=395

 Score =   254 bits (649),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 167/211 (79%), Gaps = 2/211 (1%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CI+D  +RCLE S+G V W P++LLVPLVLGLDKVN RYIPLL++TF
Sbjct  187  GDEDGERGGAPVVCIEDACKRCLEFSRGLVPWTPLLLLVPLVLGLDKVNLRYIPLLQSTF  246

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
             FPQSLGILGG+PG STYI+GVQ+D+AFYLDPHEV+ VV++  D  + +TSSYHC++ R 
Sbjct  247  KFPQSLGILGGKPGASTYIIGVQNDKAFYLDPHEVKPVVNITGDTQEPNTSSYHCNISRH  306

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PLDSIDPSLAIGFYC+DK DFDDFC+RA++L ++S GAPLFT+ ++R++ M V    + 
Sbjct  307  MPLDSIDPSLAIGFYCRDKDDFDDFCSRATKLAEESNGAPLFTVAQSRSLPMQVTSNSVS  366

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
            G+ +   F+  D+ S+    +   EDDWQ L
Sbjct  367  GDDTR--FEEDDSLSMNLVNDAGNEDDWQFL  395



>ref|XP_008346917.1| PREDICTED: cysteine protease ATG4-like isoform X1 [Malus domestica]
 ref|XP_008346918.1| PREDICTED: cysteine protease ATG4-like isoform X1 [Malus domestica]
Length=529

 Score =   258 bits (659),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 139/254 (55%), Positives = 174/254 (69%), Gaps = 43/254 (17%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CI+D SR CLE S+GQVDW PI+LLVPLVLGL+KVNPRYIP L+ATF
Sbjct  276  GDEDGERGGAPVVCIEDASRHCLEFSRGQVDWTPILLLVPLVLGLEKVNPRYIPSLRATF  335

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQ------------------------  599
            +FPQSLGI+GG+PG STYI+GVQD++A YLDPHEVQ                        
Sbjct  336  TFPQSLGIMGGKPGASTYIIGVQDEKALYLDPHEVQPCRSLSSRCESFWETVRFWATTGI  395

Query  598  ------------------QVVDLGRDNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKD  473
                               V+++ RD+L+ DT SYHC+V+R +PLD IDPSLAIGFYC+D
Sbjct  396  SNGCLHDVFFLGDFSGWKAVINIRRDDLEADTLSYHCNVIRHIPLDLIDPSLAIGFYCRD  455

Query  472  KSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQGEASA-EGFKSFDATSIG  296
            + DF+DFC RAS+L D+S GAPLFT+T+T +V  PV + D  G++ A E   SF    + 
Sbjct  456  RDDFNDFCFRASKLADESNGAPLFTVTQTHSVPRPVNHSDALGDSGAVENDDSFSVLPMS  515

Query  295  DSENGKQEDDWQLL  254
            D++   QED+WQLL
Sbjct  516  DADGSAQEDEWQLL  529



>ref|XP_002529225.1| Cysteine protease ATG4B, putative [Ricinus communis]
 gb|EEF33181.1| Cysteine protease ATG4B, putative [Ricinus communis]
Length=489

 Score =   257 bits (656),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 164/217 (76%), Gaps = 7/217 (3%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP + I+D SR CLE S+GQ DW PI+LLVPLVLGLDKVNPRYIP L+ATF
Sbjct  274  GDEDGERGGAPVVYIEDASRHCLEFSRGQADWTPILLLVPLVLGLDKVNPRYIPSLQATF  333

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +F QSLGI+GG+PG STYIVGVQDD AFYLDPHEVQ VV++GRD+++ DTSSYH D+VR 
Sbjct  334  TFSQSLGIMGGKPGASTYIVGVQDDNAFYLDPHEVQSVVNIGRDDIEADTSSYHSDIVRH  393

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL SIDPSLAIGFYC+DK DFD+FC  AS+L D S GAPLFT+     +  PV + DM 
Sbjct  394  IPLHSIDPSLAIGFYCRDKDDFDEFCLLASKLADDSQGAPLFTVAHCHKLPKPVSHGDML  453

Query  346  GEASAEGFKSFDATSIGDSEN------GKQEDDWQLL  254
                 E  +  D+ ++    N      G QED+WQLL
Sbjct  454  NNEDDE-VQEDDSVNVMMPVNDDAEGGGAQEDEWQLL  489



>gb|KEH23420.1| cysteine protease ATG4B [Medicago truncatula]
Length=454

 Score =   256 bits (653),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 167/211 (79%), Gaps = 2/211 (1%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CI+D  +RCLE S+G V W P++LLVPLVLGLDKVN RYIPLL++TF
Sbjct  246  GDEDGERGGAPVVCIEDACKRCLEFSRGLVPWTPLLLLVPLVLGLDKVNLRYIPLLQSTF  305

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
             FPQSLGILGG+PG STYI+GVQ+D+AFYLDPHEV+ VV++  D  + +TSSYHC++ R 
Sbjct  306  KFPQSLGILGGKPGASTYIIGVQNDKAFYLDPHEVKPVVNITGDTQEPNTSSYHCNISRH  365

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PLDSIDPSLAIGFYC+DK DFDDFC+RA++L ++S GAPLFT+ ++R++ M V    + 
Sbjct  366  MPLDSIDPSLAIGFYCRDKDDFDDFCSRATKLAEESNGAPLFTVAQSRSLPMQVTSNSVS  425

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
            G+ +   F+  D+ S+    +   EDDWQ L
Sbjct  426  GDDTR--FEEDDSLSMNLVNDAGNEDDWQFL  454



>ref|XP_010934833.1| PREDICTED: cysteine protease ATG4B-like isoform X1 [Elaeis guineensis]
Length=488

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 132/211 (63%), Positives = 162/211 (77%), Gaps = 0/211 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CID  +R C + +KGQ+ WAP++LLVPLVLGL+KVNPRYIPLL  TF
Sbjct  278  GDEDGERGGAPVVCIDVAARLCSDFTKGQISWAPMLLLVPLVLGLEKVNPRYIPLLWETF  337

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQDD+A YLDPH+VQ  VD+ RDNLD DTSSYHC  VR 
Sbjct  338  TFPQSLGILGGKPGASTYIVGVQDDKALYLDPHDVQLAVDIKRDNLDADTSSYHCSTVRN  397

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            LPLD IDPSLAIGFYC+DK DF+DFC+RAS+L D+S GAPLFT+ +T   ++ +Q+QD  
Sbjct  398  LPLDLIDPSLAIGFYCRDKDDFEDFCSRASKLEDKSNGAPLFTVAQTTRSAISIQHQDAL  457

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
             +       S    +  D      +++WQ+L
Sbjct  458  VDGLGGAGNSGMDDTFSDCGAHSGDEEWQIL  488



>ref|XP_003624282.1| Cysteine protease ATG4 [Medicago truncatula]
 sp|A2Q1V6.1|ATG4_MEDTR RecName: Full=Cysteine protease ATG4; AltName: Full=Autophagy-related 
protein 4 [Medicago truncatula]
 gb|ABN05923.1| Peptidase C54 [Medicago truncatula]
 gb|AES80500.1| cysteine protease ATG4B [Medicago truncatula]
Length=487

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 167/211 (79%), Gaps = 2/211 (1%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CI+D  +RCLE S+G V W P++LLVPLVLGLDKVN RYIPLL++TF
Sbjct  279  GDEDGERGGAPVVCIEDACKRCLEFSRGLVPWTPLLLLVPLVLGLDKVNLRYIPLLQSTF  338

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
             FPQSLGILGG+PG STYI+GVQ+D+AFYLDPHEV+ VV++  D  + +TSSYHC++ R 
Sbjct  339  KFPQSLGILGGKPGASTYIIGVQNDKAFYLDPHEVKPVVNITGDTQEPNTSSYHCNISRH  398

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PLDSIDPSLAIGFYC+DK DFDDFC+RA++L ++S GAPLFT+ ++R++ M V    + 
Sbjct  399  MPLDSIDPSLAIGFYCRDKDDFDDFCSRATKLAEESNGAPLFTVAQSRSLPMQVTSNSVS  458

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
            G+ +   F+  D+ S+    +   EDDWQ L
Sbjct  459  GDDTR--FEEDDSLSMNLVNDAGNEDDWQFL  487



>emb|CDX71858.1| BnaC08g30160D [Brassica napus]
Length=202

 Score =   246 bits (627),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 154/211 (73%), Gaps = 16/211 (8%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D+++ CLE SKG+ +W  ++L VPLVLGLDKVNPRYIP L ATF
Sbjct  8    GSEDGERGGAPILCIEDVTKTCLEYSKGETEWTSVLLFVPLVLGLDKVNPRYIPSLLATF  67

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQ+D+ FYLDPH+V QVV + ++  D+DTSSYHC+ VR 
Sbjct  68   TFPQSLGILGGKPGASTYIVGVQEDKGFYLDPHDVLQVVTVNKETQDVDTSSYHCNTVRY  127

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC+DK DFDDFC RA++L   S GAPLFT+T++             
Sbjct  128  VPLESLDPSLALGFYCRDKDDFDDFCIRATKLAGDSNGAPLFTVTKSHRT----------  177

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
                  G +    TS       + ED+WQLL
Sbjct  178  ------GDRGIAETSTVTCTCEEHEDEWQLL  202



>ref|XP_011004543.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Populus euphratica]
Length=482

 Score =   254 bits (650),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 163/211 (77%), Gaps = 7/211 (3%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI++ +R C E SKGQ DW PI+LLVPLVLGLDK+NPRYIP L+ATF
Sbjct  279  GSEDGERGGAPVLCIEEAARHCSECSKGQEDWMPILLLVPLVLGLDKINPRYIPSLQATF  338

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQD  AFYLDPHEVQ VV++ RD+++ +TSSYHCDVVR 
Sbjct  339  TFPQSLGILGGKPGASTYIVGVQDKNAFYLDPHEVQPVVNVSRDDVEANTSSYHCDVVRH  398

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PLD ID SLAIGFYC+DK DFDDFC+ AS+L D+S GAPLFT+  +R +      +   
Sbjct  399  IPLDLIDLSLAIGFYCRDKDDFDDFCSLASKLTDESNGAPLFTVAHSRKL-----LKHDS  453

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
            GE  ++  +S    ++ D E    EDDWQLL
Sbjct  454  GEIWSD--ESLGVQTMNDVEGCVHEDDWQLL  482



>ref|XP_004290339.1| PREDICTED: cysteine protease ATG4-like [Fragaria vesca subsp. 
vesca]
Length=411

 Score =   251 bits (642),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 169/216 (78%), Gaps = 8/216 (4%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDE+GERGGAP +CI+D SR CLE S+G+VDW PI+LLVPLVLGL+++NPRYIP L+ATF
Sbjct  199  GDENGERGGAPVVCIEDASRHCLEFSRGRVDWTPILLLVPLVLGLEELNPRYIPSLRATF  258

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDI----DTSSYHCD  539
            +FPQS+GI+GG+PGVSTYI+GVQD+ A YLDPH+VQ V+DL R++ ++     T+SYHC+
Sbjct  259  TFPQSVGIMGGKPGVSTYIIGVQDENAIYLDPHQVQPVIDLSRNDSEVVDSDATASYHCN  318

Query  538  VVRQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTIT-ETRNVSMPVQ  362
            V+R +PLD+IDPSLAIGFYC+DK DFDDFC RAS+L D+S GAPLFT+T ET+NVS P  
Sbjct  319  VIRHIPLDTIDPSLAIGFYCRDKDDFDDFCLRASKLADESNGAPLFTVTAETQNVSRP--  376

Query  361  YQDMQGEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
                 GE   +     +   +    +  +EDDWQLL
Sbjct  377  -PSQSGEGLGDNAGDQNNEDVDADGSAHEEDDWQLL  411



>ref|XP_008810461.1| PREDICTED: cysteine protease ATG4B-like isoform X2 [Phoenix dactylifera]
Length=404

 Score =   251 bits (642),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 163/216 (75%), Gaps = 5/216 (2%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CID  +R C + SKGQ+ W PI+LLVPLVLGL+KVNPRYIPLL  TF
Sbjct  189  GDEDGERGGAPVVCIDVAARLCSDFSKGQISWVPILLLVPLVLGLEKVNPRYIPLLWETF  248

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQDD+A YLDPHEVQ  VD+  D+LD DTSSYHC  VR 
Sbjct  249  TFPQSLGILGGKPGTSTYIVGVQDDKALYLDPHEVQVAVDIKTDDLDADTSSYHCSTVRN  308

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQD--  353
            LPLD IDPSLAIGFYC+DK DF+DFC RAS+L D+S GAPLFT+ +T   +  VQ+QD  
Sbjct  309  LPLDLIDPSLAIGFYCRDKDDFEDFCTRASDLEDKSNGAPLFTVAQTIRSAKSVQHQDSL  368

Query  352  ---MQGEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
               + G  ++    +F   +  D +    +D+WQ+L
Sbjct  369  VDSLGGAGNSGMDDTFAGDNFRDCDAHSGDDEWQIL  404



>ref|XP_008810459.1| PREDICTED: cysteine protease ATG4B-like isoform X1 [Phoenix dactylifera]
Length=494

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 163/216 (75%), Gaps = 5/216 (2%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CID  +R C + SKGQ+ W PI+LLVPLVLGL+KVNPRYIPLL  TF
Sbjct  279  GDEDGERGGAPVVCIDVAARLCSDFSKGQISWVPILLLVPLVLGLEKVNPRYIPLLWETF  338

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQDD+A YLDPHEVQ  VD+  D+LD DTSSYHC  VR 
Sbjct  339  TFPQSLGILGGKPGTSTYIVGVQDDKALYLDPHEVQVAVDIKTDDLDADTSSYHCSTVRN  398

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQD--  353
            LPLD IDPSLAIGFYC+DK DF+DFC RAS+L D+S GAPLFT+ +T   +  VQ+QD  
Sbjct  399  LPLDLIDPSLAIGFYCRDKDDFEDFCTRASDLEDKSNGAPLFTVAQTIRSAKSVQHQDSL  458

Query  352  ---MQGEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
               + G  ++    +F   +  D +    +D+WQ+L
Sbjct  459  VDSLGGAGNSGMDDTFAGDNFRDCDAHSGDDEWQIL  494



>ref|XP_007049916.1| Peptidase family C54 protein isoform 2 [Theobroma cacao]
 gb|EOX94073.1| Peptidase family C54 protein isoform 2 [Theobroma cacao]
Length=396

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 164/214 (77%), Gaps = 7/214 (3%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +C++D SR C E S+ + DW PI+LLVPLVLGLDKVN RYIP L+ATF
Sbjct  187  GDEDGERGGAPVVCVEDASRHCFEFSRCRADWTPILLLVPLVLGLDKVNSRYIPSLQATF  246

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQ LGILGG+PG STYIVGVQ++  FYLDPH+VQ VV+L +DN + DTSSYHCD++R 
Sbjct  247  TFPQCLGILGGKPGASTYIVGVQEENVFYLDPHDVQLVVNLSQDNQEADTSSYHCDIIRH  306

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PLDSIDPSLAIGF+C+DK DFDDFC RAS+L D+S GAPLFT+ +T +   P+ +    
Sbjct  307  IPLDSIDPSLAIGFFCRDKDDFDDFCLRASKLADESNGAPLFTVAQTHSSFKPISH----  362

Query  346  GEASAEGFKSFDATSIG---DSENGKQEDDWQLL  254
            G A  +  +  +  S+G   D +    EDDWQLL
Sbjct  363  GNALDDTGEVREDDSLGVVPDMDGSIHEDDWQLL  396



>gb|AFK45336.1| unknown [Lotus japonicus]
Length=489

 Score =   252 bits (643),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 134/212 (63%), Positives = 164/212 (77%), Gaps = 3/212 (1%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CI+D SRRC E S+G   W P++LLVPLVLGLDKVN RYIPLL++TF
Sbjct  280  GDEDGERGGAPVVCIEDASRRCSEFSRGLAAWTPLLLLVPLVLGLDKVNLRYIPLLQSTF  339

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
             FPQSLGILGG+PG STYI+GVQ+++AFYLDPH+VQ VV +  D  D +TSSYHC++VRQ
Sbjct  340  KFPQSLGILGGKPGASTYIIGVQNEKAFYLDPHDVQPVVHINGDAQDPNTSSYHCNIVRQ  399

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PLDSIDPSLAIGFYC+DK DFDDFC+RAS+L ++S GAPLFT+ + R  S P Q     
Sbjct  400  MPLDSIDPSLAIGFYCRDKDDFDDFCSRASKLAEESNGAPLFTVAQFR--SFPFQDAGYD  457

Query  346  GEASAEGFKSFDATSIG-DSENGKQEDDWQLL  254
                  GF+  D+  +   ++ G  EDDWQLL
Sbjct  458  VSGDNTGFQEDDSHGVDLLNDAGTNEDDWQLL  489



>ref|XP_007049917.1| Peptidase family C54 protein isoform 3 [Theobroma cacao]
 gb|EOX94074.1| Peptidase family C54 protein isoform 3 [Theobroma cacao]
Length=486

 Score =   251 bits (641),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 164/214 (77%), Gaps = 7/214 (3%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +C++D SR C E S+ + DW PI+LLVPLVLGLDKVN RYIP L+ATF
Sbjct  277  GDEDGERGGAPVVCVEDASRHCFEFSRCRADWTPILLLVPLVLGLDKVNSRYIPSLQATF  336

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQ LGILGG+PG STYIVGVQ++  FYLDPH+VQ VV+L +DN + DTSSYHCD++R 
Sbjct  337  TFPQCLGILGGKPGASTYIVGVQEENVFYLDPHDVQLVVNLSQDNQEADTSSYHCDIIRH  396

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PLDSIDPSLAIGF+C+DK DFDDFC RAS+L D+S GAPLFT+ +T +   P+ +    
Sbjct  397  IPLDSIDPSLAIGFFCRDKDDFDDFCLRASKLADESNGAPLFTVAQTHSSFKPISH----  452

Query  346  GEASAEGFKSFDATSIG---DSENGKQEDDWQLL  254
            G A  +  +  +  S+G   D +    EDDWQLL
Sbjct  453  GNALDDTGEVREDDSLGVVPDMDGSIHEDDWQLL  486



>ref|XP_007139667.1| hypothetical protein PHAVU_008G048900g [Phaseolus vulgaris]
 ref|XP_007139668.1| hypothetical protein PHAVU_008G048900g [Phaseolus vulgaris]
 gb|ESW11661.1| hypothetical protein PHAVU_008G048900g [Phaseolus vulgaris]
 gb|ESW11662.1| hypothetical protein PHAVU_008G048900g [Phaseolus vulgaris]
Length=489

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 163/212 (77%), Gaps = 2/212 (1%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP  CI+D  + C E S+G   W P++LLVPLVLGLDKVNPRYIPLL +TF
Sbjct  279  GDEDGERGGAPVFCIEDAFKHCSEFSRGLAAWTPLLLLVPLVLGLDKVNPRYIPLLHSTF  338

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLD-IDTSSYHCDVVR  530
             FPQSLGI+GG+PG STYI+GVQ ++AFYLDPH+VQ VV++  D  + I TSSYHC+V+R
Sbjct  339  KFPQSLGIMGGKPGASTYIIGVQSEKAFYLDPHDVQSVVNISGDTQELISTSSYHCNVMR  398

Query  529  QLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDM  350
             +PLDSIDPSLAIGFYC+DK DFDDFC++AS+L ++S GAPLFT+ ++R+ S  V   D+
Sbjct  399  HIPLDSIDPSLAIGFYCRDKDDFDDFCSQASKLAEESNGAPLFTVAQSRSFSKQVSSNDV  458

Query  349  QGEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
             G+ +      F  T   D++ G  EDDWQLL
Sbjct  459  SGDNTGFEEDIFLGTD-HDNDTGANEDDWQLL  489



>ref|XP_010512287.1| PREDICTED: cysteine protease ATG4b-like isoform X2 [Camelina 
sativa]
Length=391

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 162/211 (77%), Gaps = 11/211 (5%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D+++ C+E S+G+ +W P++L+VPLVLGLDKVNPRY+P L ATF
Sbjct  192  GSEDGERGGAPILCIEDVTKTCVEFSEGETEWTPVLLVVPLVLGLDKVNPRYLPSLIATF  251

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQ+D+ FYLDPH+VQQVV + ++N D+DTSSYHC+  R 
Sbjct  252  TFPQSLGILGGKPGASTYIVGVQEDKGFYLDPHDVQQVVTVNKENRDVDTSSYHCNTPRY  311

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC DK+DFDDFC RA++L  +S GAPLFT+T++         ++  
Sbjct  312  VPLESLDPSLALGFYCPDKADFDDFCIRATKLAGESNGAPLFTVTQSHR-------RNDC  364

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
            G A +        TS   S   + EDDWQLL
Sbjct  365  GIADSSSI----VTSTEFSGEEEHEDDWQLL  391



>ref|XP_011004542.1| PREDICTED: cysteine protease ATG4-like isoform X1 [Populus euphratica]
Length=483

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 163/212 (77%), Gaps = 8/212 (4%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI++ +R C E SKGQ DW PI+LLVPLVLGLDK+NPRYIP L+ATF
Sbjct  279  GSEDGERGGAPVLCIEEAARHCSECSKGQEDWMPILLLVPLVLGLDKINPRYIPSLQATF  338

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCD-VVR  530
            +FPQSLGILGG+PG STYIVGVQD  AFYLDPHEVQ VV++ RD+++ +TSSYHCD VVR
Sbjct  339  TFPQSLGILGGKPGASTYIVGVQDKNAFYLDPHEVQPVVNVSRDDVEANTSSYHCDSVVR  398

Query  529  QLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDM  350
             +PLD ID SLAIGFYC+DK DFDDFC+ AS+L D+S GAPLFT+  +R +      +  
Sbjct  399  HIPLDLIDLSLAIGFYCRDKDDFDDFCSLASKLTDESNGAPLFTVAHSRKL-----LKHD  453

Query  349  QGEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
             GE  ++  +S    ++ D E    EDDWQLL
Sbjct  454  SGEIWSD--ESLGVQTMNDVEGCVHEDDWQLL  483



>emb|CDY17881.1| BnaC04g03380D [Brassica napus]
Length=454

 Score =   249 bits (636),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 163/211 (77%), Gaps = 16/211 (8%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D+ + C+E S+G+ +WAP++LLVPLVLGLD+VNPRYIP LKATF
Sbjct  260  GSEDGERGGAPVLCIEDVIKSCVEFSRGEDEWAPLLLLVPLVLGLDRVNPRYIPSLKATF  319

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLG+LGG+PG STYIVGVQDD  FYLDPH+VQQVV + ++ LD+DTSSYHC+V+R 
Sbjct  320  TFPQSLGVLGGKPGASTYIVGVQDDNGFYLDPHDVQQVVTVNKETLDVDTSSYHCNVLRY  379

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC DK+DFDD C RAS L ++S GAPLFT+T+T ++        + 
Sbjct  380  VPLESLDPSLALGFYCPDKADFDDLCLRASTLAEESKGAPLFTVTQTHSL--------IS  431

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
              +S E         + D+     EDDWQLL
Sbjct  432  HHSSCEF--------VEDTGEEHGEDDWQLL  454



>ref|XP_010508336.1| PREDICTED: cysteine protease ATG4a isoform X3 [Camelina sativa]
 ref|XP_010508337.1| PREDICTED: cysteine protease ATG4a isoform X3 [Camelina sativa]
 ref|XP_010508338.1| PREDICTED: cysteine protease ATG4a isoform X3 [Camelina sativa]
Length=386

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 161/211 (76%), Gaps = 15/211 (7%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D ++ C E SKGQ +W PI+LLVPLVLGLDKVNPRYIP L ATF
Sbjct  191  GSEDGERGGAPILCIEDATKSCREFSKGQSEWTPILLLVPLVLGLDKVNPRYIPSLIATF  250

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQS+GILGG+PG STYI+GVQ+D+ FYLDPHEVQQVV + +++ D+DTSSYHC V+R 
Sbjct  251  AFPQSVGILGGKPGASTYIIGVQEDKGFYLDPHEVQQVVTVSKESPDVDTSSYHCKVLRY  310

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC+DK DF+DFC RAS+L ++S GAPLFT+T+T +      Y    
Sbjct  311  VPLESLDPSLALGFYCRDKDDFNDFCLRASKLAEESKGAPLFTVTQTHSAINQNNY----  366

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
                  GF   D     + E   +EDDWQLL
Sbjct  367  ------GFSEED-----NIEEEGREDDWQLL  386



>ref|XP_002309707.1| autophagy 4b family protein [Populus trichocarpa]
 gb|EEE90157.1| autophagy 4b family protein [Populus trichocarpa]
Length=481

 Score =   249 bits (636),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 133/212 (63%), Positives = 161/212 (76%), Gaps = 9/212 (4%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP L I+D +R C E SKG+ DW PI+LLVPLVLGLDK+NPRYIP L+ATF
Sbjct  278  GCEDGERGGAPVLSIEDAARHCSEFSKGREDWTPILLLVPLVLGLDKINPRYIPSLQATF  337

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQD+ AFYLDPHEVQ VV+  RD+++ +TSSYHCDVVR 
Sbjct  338  TFPQSLGILGGKPGASTYIVGVQDENAFYLDPHEVQPVVNFSRDDVEANTSSYHCDVVRH  397

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PLD IDPSLAIGFYC+DK DFDDFC+ AS+L D+S GAPLFT+  +        Y+  +
Sbjct  398  IPLDLIDPSLAIGFYCRDKDDFDDFCSLASKLADESNGAPLFTVANS--------YKSSK  449

Query  346  GEAS-AEGFKSFDATSIGDSENGKQEDDWQLL  254
             ++S           ++ D+E    EDDWQLL
Sbjct  450  HDSSEVRDDDPLGVMTMNDAEGCLNEDDWQLL  481



>ref|XP_009385978.1| PREDICTED: LOW QUALITY PROTEIN: cysteine protease ATG4B-like 
[Musa acuminata subsp. malaccensis]
Length=473

 Score =   249 bits (635),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 126/211 (60%), Positives = 161/211 (76%), Gaps = 11/211 (5%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CI+  +R C +  KGQ++WAPI+LLVPLVLGL+K+NPRYIPLL  TF
Sbjct  274  GDEDGERGGAPVICIEIAARLCYDFKKGQLNWAPILLLVPLVLGLEKINPRYIPLLWETF  333

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGGRPG STYIVG+QD++A YLDPHEVQ  VD+ RD+L+ D+SSYHC  VR 
Sbjct  334  TFPQSLGILGGRPGASTYIVGIQDNKALYLDPHEVQPAVDIKRDDLEADSSSYHCSTVRH  393

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PLD IDP+LAIGFYC+DK DF+DFC+RAS+L D+S GAPLFT+ +    + PV Y D+ 
Sbjct  394  VPLDMIDPTLAIGFYCRDKDDFEDFCSRASKLADKSNGAPLFTVAQNLQPAKPVPYDDL-  452

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
                          +  D+++   +D+WQ+L
Sbjct  453  ----------LAVDTFTDTDDPVHDDEWQIL  473



>ref|XP_010512286.1| PREDICTED: cysteine protease ATG4b-like isoform X1 [Camelina 
sativa]
Length=477

 Score =   249 bits (635),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 162/211 (77%), Gaps = 11/211 (5%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D+++ C+E S+G+ +W P++L+VPLVLGLDKVNPRY+P L ATF
Sbjct  278  GSEDGERGGAPILCIEDVTKTCVEFSEGETEWTPVLLVVPLVLGLDKVNPRYLPSLIATF  337

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQ+D+ FYLDPH+VQQVV + ++N D+DTSSYHC+  R 
Sbjct  338  TFPQSLGILGGKPGASTYIVGVQEDKGFYLDPHDVQQVVTVNKENRDVDTSSYHCNTPRY  397

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC DK+DFDDFC RA++L  +S GAPLFT+T++         ++  
Sbjct  398  VPLESLDPSLALGFYCPDKADFDDFCIRATKLAGESNGAPLFTVTQSHR-------RNDC  450

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
            G A +        TS   S   + EDDWQLL
Sbjct  451  GIADSSSI----VTSTEFSGEEEHEDDWQLL  477



>ref|NP_973687.1| cysteine protease ATG4a [Arabidopsis thaliana]
 gb|AEC10381.1| cysteine protease ATG4a [Arabidopsis thaliana]
Length=422

 Score =   247 bits (630),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D ++ CLE SKGQ +W PIILLVPLVLGLD VNPRYIP L ATF
Sbjct  229  GSEDGERGGAPILCIEDATKSCLEFSKGQSEWTPIILLVPLVLGLDSVNPRYIPSLVATF  288

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQS+GILGG+PG STYIVGVQ+D+ FYLDPHEVQQVV + ++  D+DTSSYHC+V+R 
Sbjct  289  TFPQSVGILGGKPGASTYIVGVQEDKGFYLDPHEVQQVVTVNKETPDVDTSSYHCNVLRY  348

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRN  380
            +PL+S+DPSLA+GFYC+DK DFDDFC RA +L ++S GAPLFT+T+T  
Sbjct  349  VPLESLDPSLALGFYCRDKDDFDDFCLRALKLAEESNGAPLFTVTQTHT  397



>ref|XP_006653040.1| PREDICTED: LOW QUALITY PROTEIN: cysteine protease ATG4B-like 
[Oryza brachyantha]
Length=480

 Score =   248 bits (634),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 163/213 (77%), Gaps = 4/213 (2%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CID  ++ C + +KGQ  W+PI+LLVPLVLGLDK+NPRYIPLLK TF
Sbjct  270  GDEDGERGGAPVVCIDVAAQLCCDFNKGQSTWSPILLLVPLVLGLDKLNPRYIPLLKETF  329

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYI GVQDD+A YLDPHEVQ  VD+  DNL+ DTSSYHC  +R 
Sbjct  330  TFPQSLGILGGKPGTSTYIAGVQDDRALYLDPHEVQMAVDIAADNLEADTSSYHCSTMRD  389

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            L LD IDPSLAIGFYC+DK DFDDFC+RASELVD++ GAPLFT+ ++   S  +  QD  
Sbjct  390  LALDLIDPSLAIGFYCRDKDDFDDFCSRASELVDKANGAPLFTVVQSVQPSKQMYNQDDV  449

Query  346  GEASAEGFKSFDATSIG--DSENGKQEDDWQLL  254
              +S +G    D  ++G  D   G  E++WQ+L
Sbjct  450  LGSSGDGM--VDNINVGDLDGSGGTGEEEWQIL  480



>ref|XP_010508335.1| PREDICTED: cysteine protease ATG4a isoform X2 [Camelina sativa]
Length=427

 Score =   247 bits (630),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 161/211 (76%), Gaps = 15/211 (7%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D ++ C E SKGQ +W PI+LLVPLVLGLDKVNPRYIP L ATF
Sbjct  232  GSEDGERGGAPILCIEDATKSCREFSKGQSEWTPILLLVPLVLGLDKVNPRYIPSLIATF  291

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQS+GILGG+PG STYI+GVQ+D+ FYLDPHEVQQVV + +++ D+DTSSYHC V+R 
Sbjct  292  AFPQSVGILGGKPGASTYIIGVQEDKGFYLDPHEVQQVVTVSKESPDVDTSSYHCKVLRY  351

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC+DK DF+DFC RAS+L ++S GAPLFT+T+T +      Y    
Sbjct  352  VPLESLDPSLALGFYCRDKDDFNDFCLRASKLAEESKGAPLFTVTQTHSAINQNNY----  407

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
                  GF   D     + E   +EDDWQLL
Sbjct  408  ------GFSEED-----NIEEEGREDDWQLL  427



>ref|XP_004492912.1| PREDICTED: cysteine protease ATG4-like isoform X3 [Cicer arietinum]
Length=397

 Score =   246 bits (628),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 167/214 (78%), Gaps = 6/214 (3%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CI+D S+ C E S+G V W P++LLVPLVLGLDKVN RYIPLL++TF
Sbjct  187  GDEDGERGGAPVVCIEDASKCCSEFSRGLVPWTPLLLLVPLVLGLDKVNLRYIPLLQSTF  246

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
             FPQSLGILGG+PG STYI+GVQ+++A YLDPH+V+ VV++  D  + +TSSYHC+++R 
Sbjct  247  KFPQSLGILGGKPGASTYIIGVQNEKAIYLDPHDVKPVVNINVDTQEPNTSSYHCNIIRH  306

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PLDSIDPSLAIGFYC+DK DFDDFC+RAS+L ++S GAPLFT+ ++R++SM V    + 
Sbjct  307  MPLDSIDPSLAIGFYCRDKDDFDDFCSRASKLAEESNGAPLFTVAQSRSLSMQVTSSSVS  366

Query  346  GEASAEGFK---SFDATSIGDSENGKQEDDWQLL  254
            G+ +   F+   S     + D+  G  EDDWQ L
Sbjct  367  GDNNTR-FQEDGSLGMDLVNDA--GTNEDDWQFL  397



>gb|KHN40529.1| Cysteine protease ATG4 [Glycine soja]
Length=485

 Score =   249 bits (635),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 166/212 (78%), Gaps = 3/212 (1%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CI+D S+RC E S G   W P++LLVPLVLGLDKVNPRYIPLL++TF
Sbjct  276  GDEDGERGGAPVVCIEDASKRCSEFSSGLAAWTPLLLLVPLVLGLDKVNPRYIPLLRSTF  335

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLD-IDTSSYHCDVVR  530
             FPQSLGI+GG+PG STYI+GVQ+++AFYLDPH+VQQVV++  D  +   TSSYHC+V+R
Sbjct  336  KFPQSLGIMGGKPGASTYIIGVQNEKAFYLDPHDVQQVVNISGDTQEPTGTSSYHCNVMR  395

Query  529  QLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDM  350
             +PLDSIDPSLAIGFYC+DK DFDDFC++AS+L ++S GAPLFT+ ++R+ S  V   D+
Sbjct  396  HIPLDSIDPSLAIGFYCRDKDDFDDFCSQASKLAEESNGAPLFTVAKSRSFSKQVS-NDV  454

Query  349  QGEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
             G+ +    + F     G+ +    EDDWQLL
Sbjct  455  SGDNTGFQEEDFPGMDCGN-DTVTNEDDWQLL  485



>ref|XP_010506322.1| PREDICTED: cysteine protease ATG4a-like isoform X2 [Camelina 
sativa]
 ref|XP_010506323.1| PREDICTED: cysteine protease ATG4a-like isoform X2 [Camelina 
sativa]
 ref|XP_010506325.1| PREDICTED: cysteine protease ATG4a-like isoform X2 [Camelina 
sativa]
 ref|XP_010506326.1| PREDICTED: cysteine protease ATG4a-like isoform X2 [Camelina 
sativa]
Length=386

 Score =   246 bits (627),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 161/211 (76%), Gaps = 15/211 (7%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D ++ C E SKGQ++W PI+LLVPLVLGLDKVNPRYIP L ATF
Sbjct  191  GSEDGERGGAPILCIEDATKSCREFSKGQLEWTPILLLVPLVLGLDKVNPRYIPSLIATF  250

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQS+GILGG+PG STYI+GVQ+D+ FYLDPHEVQQVV + +++ D+DTSSYHC V+R 
Sbjct  251  AFPQSVGILGGKPGASTYIIGVQEDKGFYLDPHEVQQVVTVSKESPDVDTSSYHCKVLRY  310

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC+DK DF+D C RAS+L ++S GAPLFT+T+T ++     Y    
Sbjct  311  VPLESLDPSLALGFYCRDKDDFNDLCLRASKLAEESKGAPLFTVTQTHSLINQNNY----  366

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
                  GF   D     + E    EDDWQLL
Sbjct  367  ------GFSEED-----NIEEEGHEDDWQLL  386



>gb|AAC23418.1| unknown protein [Arabidopsis thaliana]
Length=451

 Score =   247 bits (631),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 145/169 (86%), Gaps = 0/169 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D ++ CLE SKGQ +W PIILLVPLVLGLD VNPRYIP L ATF
Sbjct  258  GSEDGERGGAPILCIEDATKSCLEFSKGQSEWTPIILLVPLVLGLDSVNPRYIPSLVATF  317

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQS+GILGG+PG STYIVGVQ+D+ FYLDPHEVQQVV + ++  D+DTSSYHC+V+R 
Sbjct  318  TFPQSVGILGGKPGASTYIVGVQEDKGFYLDPHEVQQVVTVNKETPDVDTSSYHCNVLRY  377

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRN  380
            +PL+S+DPSLA+GFYC+DK DFDDFC RA +L ++S GAPLFT+T+T  
Sbjct  378  VPLESLDPSLALGFYCRDKDDFDDFCLRALKLAEESNGAPLFTVTQTHT  426



>ref|XP_006397589.1| hypothetical protein EUTSA_v10001432mg [Eutrema salsugineum]
 ref|XP_006397590.1| hypothetical protein EUTSA_v10001432mg [Eutrema salsugineum]
 gb|ESQ39042.1| hypothetical protein EUTSA_v10001432mg [Eutrema salsugineum]
 gb|ESQ39043.1| hypothetical protein EUTSA_v10001432mg [Eutrema salsugineum]
Length=365

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D  + CLE S GQ +W PI+LLVPLVLGLD+VNPRYIP L ATF
Sbjct  171  GSEDGERGGAPILCIEDARKSCLEFSNGQAEWTPILLLVPLVLGLDRVNPRYIPSLIATF  230

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQ+D+ FYLDPHEVQQV+ + ++  D+DTSSYHC+V+R 
Sbjct  231  TFPQSLGILGGKPGASTYIVGVQEDKGFYLDPHEVQQVITVNKETTDVDTSSYHCNVLRY  290

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNV  377
            +PL+S+DPSLA+GFYC+DK DFDDFC RAS+L ++S GAPLFT+T+T + 
Sbjct  291  VPLESLDPSLALGFYCRDKGDFDDFCQRASKLAEESNGAPLFTVTQTHSA  340



>ref|XP_004492911.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Cicer arietinum]
Length=457

 Score =   247 bits (631),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 167/214 (78%), Gaps = 6/214 (3%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CI+D S+ C E S+G V W P++LLVPLVLGLDKVN RYIPLL++TF
Sbjct  247  GDEDGERGGAPVVCIEDASKCCSEFSRGLVPWTPLLLLVPLVLGLDKVNLRYIPLLQSTF  306

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
             FPQSLGILGG+PG STYI+GVQ+++A YLDPH+V+ VV++  D  + +TSSYHC+++R 
Sbjct  307  KFPQSLGILGGKPGASTYIIGVQNEKAIYLDPHDVKPVVNINVDTQEPNTSSYHCNIIRH  366

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PLDSIDPSLAIGFYC+DK DFDDFC+RAS+L ++S GAPLFT+ ++R++SM V    + 
Sbjct  367  MPLDSIDPSLAIGFYCRDKDDFDDFCSRASKLAEESNGAPLFTVAQSRSLSMQVTSSSVS  426

Query  346  GEASAEGFK---SFDATSIGDSENGKQEDDWQLL  254
            G+ +   F+   S     + D+  G  EDDWQ L
Sbjct  427  GDNNTR-FQEDGSLGMDLVNDA--GTNEDDWQFL  457



>ref|XP_006397591.1| hypothetical protein EUTSA_v10001432mg [Eutrema salsugineum]
 gb|ESQ39044.1| hypothetical protein EUTSA_v10001432mg [Eutrema salsugineum]
Length=386

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D  + CLE S GQ +W PI+LLVPLVLGLD+VNPRYIP L ATF
Sbjct  192  GSEDGERGGAPILCIEDARKSCLEFSNGQAEWTPILLLVPLVLGLDRVNPRYIPSLIATF  251

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQ+D+ FYLDPHEVQQV+ + ++  D+DTSSYHC+V+R 
Sbjct  252  TFPQSLGILGGKPGASTYIVGVQEDKGFYLDPHEVQQVITVNKETTDVDTSSYHCNVLRY  311

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNV  377
            +PL+S+DPSLA+GFYC+DK DFDDFC RAS+L ++S GAPLFT+T+T + 
Sbjct  312  VPLESLDPSLALGFYCRDKGDFDDFCQRASKLAEESNGAPLFTVTQTHSA  361



>ref|XP_004492910.1| PREDICTED: cysteine protease ATG4-like isoform X1 [Cicer arietinum]
Length=490

 Score =   248 bits (633),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 167/214 (78%), Gaps = 6/214 (3%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CI+D S+ C E S+G V W P++LLVPLVLGLDKVN RYIPLL++TF
Sbjct  280  GDEDGERGGAPVVCIEDASKCCSEFSRGLVPWTPLLLLVPLVLGLDKVNLRYIPLLQSTF  339

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
             FPQSLGILGG+PG STYI+GVQ+++A YLDPH+V+ VV++  D  + +TSSYHC+++R 
Sbjct  340  KFPQSLGILGGKPGASTYIIGVQNEKAIYLDPHDVKPVVNINVDTQEPNTSSYHCNIIRH  399

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PLDSIDPSLAIGFYC+DK DFDDFC+RAS+L ++S GAPLFT+ ++R++SM V    + 
Sbjct  400  MPLDSIDPSLAIGFYCRDKDDFDDFCSRASKLAEESNGAPLFTVAQSRSLSMQVTSSSVS  459

Query  346  GEASAEGFK---SFDATSIGDSENGKQEDDWQLL  254
            G+ +   F+   S     + D+  G  EDDWQ L
Sbjct  460  GDNNTR-FQEDGSLGMDLVNDA--GTNEDDWQFL  490



>gb|EMT18890.1| hypothetical protein F775_28054 [Aegilops tauschii]
Length=392

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 161/213 (76%), Gaps = 4/213 (2%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CID  ++ C + +K Q  W+PI+LLVPLVLGLDK+NPRYIPLLK TF
Sbjct  182  GDEDGERGGAPVVCIDVAAQLCYDFNKDQSAWSPILLLVPLVLGLDKINPRYIPLLKETF  241

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYI GVQDD+A YLDPHEVQ  V++  DNL+ DTSSYHC  VR 
Sbjct  242  TFPQSLGILGGKPGASTYIAGVQDDRALYLDPHEVQMAVNIASDNLEADTSSYHCSTVRD  301

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PLD IDPSLAIGFYC+DK DFDDFC+RASEL +Q+ GAPLFT+ ++   S  +  QD  
Sbjct  302  MPLDLIDPSLAIGFYCRDKDDFDDFCSRASELAEQANGAPLFTVVQSVQPSKQMYNQDDG  361

Query  346  GEASAEGFK-SFDATSI-GDSENGKQEDDWQLL  254
               S  G   + DA  + G  E G  ED+WQ+L
Sbjct  362  SGCSGYGVSDNIDAEDLDGSGETG--EDEWQIL  392



>ref|NP_850412.1| cysteine protease ATG4a [Arabidopsis thaliana]
 sp|Q8S929.1|ATG4A_ARATH RecName: Full=Cysteine protease ATG4a; AltName: Full=Autophagy-related 
protein 4 homolog a; Short=AtAPG4a; Short=Protein 
autophagy 4a [Arabidopsis thaliana]
 dbj|BAB88383.1| autophagy 4a [Arabidopsis thaliana]
 dbj|BAE99076.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC10380.1| cysteine protease ATG4a [Arabidopsis thaliana]
Length=467

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D ++ CLE SKGQ +W PIILLVPLVLGLD VNPRYIP L ATF
Sbjct  274  GSEDGERGGAPILCIEDATKSCLEFSKGQSEWTPIILLVPLVLGLDSVNPRYIPSLVATF  333

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQS+GILGG+PG STYIVGVQ+D+ FYLDPHEVQQVV + ++  D+DTSSYHC+V+R 
Sbjct  334  TFPQSVGILGGKPGASTYIVGVQEDKGFYLDPHEVQQVVTVNKETPDVDTSSYHCNVLRY  393

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNV  377
            +PL+S+DPSLA+GFYC+DK DFDDFC RA +L ++S GAPLFT+T+T   
Sbjct  394  VPLESLDPSLALGFYCRDKDDFDDFCLRALKLAEESNGAPLFTVTQTHTA  443



>ref|XP_010508333.1| PREDICTED: cysteine protease ATG4a isoform X1 [Camelina sativa]
Length=474

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 161/211 (76%), Gaps = 15/211 (7%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D ++ C E SKGQ +W PI+LLVPLVLGLDKVNPRYIP L ATF
Sbjct  279  GSEDGERGGAPILCIEDATKSCREFSKGQSEWTPILLLVPLVLGLDKVNPRYIPSLIATF  338

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQS+GILGG+PG STYI+GVQ+D+ FYLDPHEVQQVV + +++ D+DTSSYHC V+R 
Sbjct  339  AFPQSVGILGGKPGASTYIIGVQEDKGFYLDPHEVQQVVTVSKESPDVDTSSYHCKVLRY  398

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC+DK DF+DFC RAS+L ++S GAPLFT+T+T +      Y    
Sbjct  399  VPLESLDPSLALGFYCRDKDDFNDFCLRASKLAEESKGAPLFTVTQTHSAINQNNY----  454

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
                  GF   D     + E   +EDDWQLL
Sbjct  455  ------GFSEED-----NIEEEGREDDWQLL  474



>ref|XP_010518003.1| PREDICTED: cysteine protease ATG4a-like isoform X2 [Camelina 
sativa]
Length=386

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 161/211 (76%), Gaps = 15/211 (7%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D ++ C E SKGQ++W PI+LLVPLVLGLDKVNPRYIP L ATF
Sbjct  191  GSEDGERGGAPILCIEDATKSCREFSKGQLEWTPILLLVPLVLGLDKVNPRYIPSLIATF  250

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQS+GILGG+PG STYI+GVQ+D+ FYLDPHEVQQVV + +++ D+DTSSYH  V+R 
Sbjct  251  AFPQSVGILGGKPGASTYIIGVQEDKGFYLDPHEVQQVVTVNKESPDVDTSSYHSKVLRY  310

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC+DK DF+DFC RAS+L ++S GAPLFT+T+T +      Y    
Sbjct  311  VPLESLDPSLALGFYCRDKDDFNDFCLRASKLAEESKGAPLFTVTQTHSAINQNNY----  366

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
                  GF   D     + E   +EDDWQLL
Sbjct  367  ------GFSEED-----NIEEEGREDDWQLL  386



>ref|XP_006294154.1| hypothetical protein CARUB_v10023148mg [Capsella rubella]
 gb|EOA27052.1| hypothetical protein CARUB_v10023148mg [Capsella rubella]
Length=384

 Score =   244 bits (622),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 159/211 (75%), Gaps = 17/211 (8%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D  + C E SKGQ +W PI+LLVPLVLGLDKVNPRYIP L ATF
Sbjct  191  GSEDGERGGAPILCIEDAIKSCREFSKGQSEWTPILLLVPLVLGLDKVNPRYIPSLIATF  250

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQS+GILGG+PG STYI+GVQ+D+ FYLDPHEVQQVV + ++  D+DTSSYHC V+R 
Sbjct  251  TFPQSVGILGGKPGASTYIIGVQEDKGFYLDPHEVQQVVTVNKETPDVDTSSYHCKVLRY  310

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC+DK DFDDFC RA++L ++S GAPLFT+T+T +      Y    
Sbjct  311  VPLESLDPSLALGFYCRDKDDFDDFCLRAAKLAEESKGAPLFTLTQTHSAINQNSY----  366

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
                  GF         D+   ++EDDWQLL
Sbjct  367  ------GFSE-------DNIEEEREDDWQLL  384



>ref|XP_012081892.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Jatropha curcas]
 ref|XP_012081893.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Jatropha curcas]
 ref|XP_012081894.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Jatropha curcas]
 ref|XP_012081895.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Jatropha curcas]
 ref|XP_012081896.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Jatropha curcas]
 ref|XP_012081897.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Jatropha curcas]
 ref|XP_012081899.1| PREDICTED: cysteine protease ATG4-like isoform X2 [Jatropha curcas]
Length=399

 Score =   244 bits (622),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 157/212 (74%), Gaps = 1/212 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CI+D SR CL+ S+GQ +W PI+LLVPLVLGL+KVN RYIP L+AT 
Sbjct  188  GDEDGERGGAPVVCIEDASRHCLDFSRGQANWTPILLLVPLVLGLEKVNLRYIPSLQATL  247

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGI+GG+PG STYIVGVQDD AFYLDPH VQ VV++ RD +  DTSSYH D +R 
Sbjct  248  TFPQSLGIMGGKPGASTYIVGVQDDNAFYLDPHGVQPVVNISRDGIGADTSSYHSDFIRH  307

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+SIDPSLAIGFYC+DK DFD+FC  AS+L D S GAPLFT+  +  +   V   D  
Sbjct  308  IPLESIDPSLAIGFYCRDKDDFDEFCFLASKLADDSHGAPLFTVAHSHKLPKSVGRTDTS  367

Query  346  GEAS-AEGFKSFDATSIGDSENGKQEDDWQLL  254
             + S  +   S     + D+E    EDDWQLL
Sbjct  368  NDNSGVQEDDSLGVMPMNDAEAPVNEDDWQLL  399



>ref|XP_006397592.1| hypothetical protein EUTSA_v10001432mg [Eutrema salsugineum]
 gb|ESQ39045.1| hypothetical protein EUTSA_v10001432mg [Eutrema salsugineum]
Length=471

 Score =   246 bits (628),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D  + CLE S GQ +W PI+LLVPLVLGLD+VNPRYIP L ATF
Sbjct  277  GSEDGERGGAPILCIEDARKSCLEFSNGQAEWTPILLLVPLVLGLDRVNPRYIPSLIATF  336

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQ+D+ FYLDPHEVQQV+ + ++  D+DTSSYHC+V+R 
Sbjct  337  TFPQSLGILGGKPGASTYIVGVQEDKGFYLDPHEVQQVITVNKETTDVDTSSYHCNVLRY  396

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNV  377
            +PL+S+DPSLA+GFYC+DK DFDDFC RAS+L ++S GAPLFT+T+T + 
Sbjct  397  VPLESLDPSLALGFYCRDKGDFDDFCQRASKLAEESNGAPLFTVTQTHSA  446



>ref|XP_006855548.1| PREDICTED: cysteine protease ATG4 [Amborella trichopoda]
 gb|ERN17015.1| hypothetical protein AMTR_s00057p00218370 [Amborella trichopoda]
Length=494

 Score =   246 bits (629),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 158/214 (74%), Gaps = 3/214 (1%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP LCI+D  R C     GQ  WAP++LLVPLVLGLDKVNPRYIP L ATF
Sbjct  281  GDEDGERGGAPVLCIEDAERICASFCGGQESWAPLLLLVPLVLGLDKVNPRYIPSLWATF  340

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQS GILGG+PG STYIVGVQDDQA YLDPHEVQ VV++   NL+ +TSSYHC+VVRQ
Sbjct  341  TFPQSTGILGGKPGASTYIVGVQDDQALYLDPHEVQSVVNIDPGNLEAETSSYHCNVVRQ  400

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNV---SMPVQYQ  356
            +P D+IDPSLAIGFYC+DK DF+DFC RA+E+   S GAPLFT+T ++ V   ++     
Sbjct  401  MPFDTIDPSLAIGFYCRDKDDFEDFCTRAAEIASNSNGAPLFTVTNSKPVKKGALASGSS  460

Query  355  DMQGEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
              + E S +       +  G++ +   EDDWQLL
Sbjct  461  VCEDEVSNQKLVLEADSFEGEANSLSNEDDWQLL  494



>ref|XP_010506319.1| PREDICTED: cysteine protease ATG4a-like isoform X1 [Camelina 
sativa]
 ref|XP_010506320.1| PREDICTED: cysteine protease ATG4a-like isoform X1 [Camelina 
sativa]
 ref|XP_010506321.1| PREDICTED: cysteine protease ATG4a-like isoform X1 [Camelina 
sativa]
Length=474

 Score =   246 bits (627),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 161/211 (76%), Gaps = 15/211 (7%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D ++ C E SKGQ++W PI+LLVPLVLGLDKVNPRYIP L ATF
Sbjct  279  GSEDGERGGAPILCIEDATKSCREFSKGQLEWTPILLLVPLVLGLDKVNPRYIPSLIATF  338

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQS+GILGG+PG STYI+GVQ+D+ FYLDPHEVQQVV + +++ D+DTSSYHC V+R 
Sbjct  339  AFPQSVGILGGKPGASTYIIGVQEDKGFYLDPHEVQQVVTVSKESPDVDTSSYHCKVLRY  398

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC+DK DF+D C RAS+L ++S GAPLFT+T+T ++     Y    
Sbjct  399  VPLESLDPSLALGFYCRDKDDFNDLCLRASKLAEESKGAPLFTVTQTHSLINQNNY----  454

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
                  GF   D     + E    EDDWQLL
Sbjct  455  ------GFSEED-----NIEEEGHEDDWQLL  474



>ref|XP_010469254.1| PREDICTED: cysteine protease ATG4b isoform X4 [Camelina sativa]
 ref|XP_010469255.1| PREDICTED: cysteine protease ATG4b isoform X4 [Camelina sativa]
 ref|XP_010469256.1| PREDICTED: cysteine protease ATG4b isoform X4 [Camelina sativa]
Length=391

 Score =   243 bits (620),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 163/211 (77%), Gaps = 11/211 (5%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D+++ C+E S+G+ +W+PI+LLVPLVLGLDKVNPRY+P L ATF
Sbjct  192  GSEDGERGGAPILCIEDVTKTCVEFSEGETEWSPILLLVPLVLGLDKVNPRYLPSLIATF  251

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQ+D+ FYLDPH+VQQVV + ++N D+DTSSYHC+  R 
Sbjct  252  TFPQSLGILGGKPGASTYIVGVQEDKGFYLDPHDVQQVVTVNKENRDVDTSSYHCNTPRY  311

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC DK+DFDDFC RA++L  +S GAPLFT+T++         ++  
Sbjct  312  VPLESLDPSLALGFYCPDKADFDDFCIRATKLAGESNGAPLFTVTQSHR-------RNDC  364

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
            G A +        TS   S   + EDDWQLL
Sbjct  365  GIAESSSI----VTSTEFSGEEEHEDDWQLL  391



>gb|ACN76570.1| cysteine proteinase [Triticum aestivum]
Length=484

 Score =   246 bits (627),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 132/211 (63%), Positives = 157/211 (74%), Gaps = 0/211 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CID  ++ C + +KGQ  W+PI+LLVPLVLGLDK+NPRYIPLLK TF
Sbjct  274  GDEDGERGGAPVVCIDVAAQLCYDFNKGQSAWSPILLLVPLVLGLDKINPRYIPLLKETF  333

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYI GVQDD+A YLDPHEVQ  V++  DNL+ DTSSYHC  VR 
Sbjct  334  TFPQSLGILGGKPGASTYIAGVQDDRALYLDPHEVQLAVNIASDNLEADTSSYHCSTVRD  393

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PLD IDPSLAIGFYC+DK DFDDFC+RASEL +Q+ GAPLFT+ ++   S  +  QD  
Sbjct  394  MPLDLIDPSLAIGFYCRDKDDFDDFCSRASELAEQANGAPLFTVVQSVQPSKQMYNQDDG  453

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
               S  G      T   D      ED+WQ+L
Sbjct  454  SGCSGYGVSDNIDTEDLDGSGETGEDEWQIL  484



>ref|XP_002881949.1| autophagy 4a [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58208.1| autophagy 4a [Arabidopsis lyrata subsp. lyrata]
Length=467

 Score =   245 bits (626),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D ++ CLE SKGQ +W PI+LLVPLVLGLD VNPRYIP L ATF
Sbjct  274  GSEDGERGGAPILCIEDATKSCLEFSKGQSEWTPILLLVPLVLGLDSVNPRYIPSLIATF  333

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQS+GILGG+PG STYIVGVQ+D+ FYLDPHEVQQVV + ++  D+DTSSYHC+V+R 
Sbjct  334  TFPQSVGILGGKPGASTYIVGVQEDKGFYLDPHEVQQVVTVNKETPDVDTSSYHCNVIRY  393

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNV  377
            +PL+S+DPSLA+GFYC+DK DFDDFC RAS+L + S GAPLFTIT+T + 
Sbjct  394  VPLESLDPSLALGFYCRDKDDFDDFCLRASKLAEDSNGAPLFTITQTHSA  443



>ref|XP_008232834.1| PREDICTED: cysteine protease ATG4 [Prunus mume]
Length=487

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 139/212 (66%), Positives = 167/212 (79%), Gaps = 1/212 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CI D SR CLE S+G+VDW PI+LLVPLVLGL+KVNPRYIP L ATF
Sbjct  276  GDEDGERGGAPVVCIQDASRHCLEFSRGRVDWTPILLLVPLVLGLEKVNPRYIPSLWATF  335

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGI+GG+PG STYI+GVQD++A YLDPHEVQ  +++ RD+L+ DT SYHC+V+R 
Sbjct  336  TFPQSLGIMGGKPGASTYIIGVQDEKALYLDPHEVQPAINIRRDDLEADTLSYHCNVIRH  395

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQD-M  350
            +PLDSIDPSLAIGFYC+D+ DFDDFC RAS+L D S GAPLFT+TET N   PV + D +
Sbjct  396  IPLDSIDPSLAIGFYCRDRDDFDDFCFRASKLADGSNGAPLFTVTETHNFPKPVNHSDVL  455

Query  349  QGEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
                  +   SF A  I D++    EDDWQLL
Sbjct  456  DDSGGVQNDDSFVAPPISDADGSAHEDDWQLL  487



>ref|XP_010469252.1| PREDICTED: cysteine protease ATG4b isoform X3 [Camelina sativa]
 ref|XP_010469253.1| PREDICTED: cysteine protease ATG4b isoform X3 [Camelina sativa]
Length=391

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 162/211 (77%), Gaps = 11/211 (5%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D+++ C+E S+G+ +W PI+LLVPLVLGLDKVNPRY+P L ATF
Sbjct  192  GSEDGERGGAPILCIEDVTKSCVEFSEGETEWTPILLLVPLVLGLDKVNPRYLPSLIATF  251

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQ+D+ FYLDPH+VQQVV + ++N D+DTSSYHC+  R 
Sbjct  252  TFPQSLGILGGKPGASTYIVGVQEDKGFYLDPHDVQQVVTVNKENRDVDTSSYHCNTPRY  311

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC DK+DFDDFC RA++L  +S GAPLFT+T++         ++  
Sbjct  312  VPLESLDPSLALGFYCPDKADFDDFCIRATKLAGESNGAPLFTVTQSHR-------RNDC  364

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
            G A +        TS   S   + EDDWQLL
Sbjct  365  GIAESSSI----VTSTEFSGEEEHEDDWQLL  391



>ref|XP_010934834.1| PREDICTED: cysteine protease ATG4B-like isoform X2 [Elaeis guineensis]
Length=484

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 159/211 (75%), Gaps = 4/211 (2%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CID  +R C + +KGQ+ WAP++LLVPLVLGL+KVNPRYIPLL  TF
Sbjct  278  GDEDGERGGAPVVCIDVAARLCSDFTKGQISWAPMLLLVPLVLGLEKVNPRYIPLLWETF  337

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQDD+A YLDPH+VQ  VD+ RDNLD DTSSYHC  VR 
Sbjct  338  TFPQSLGILGGKPGASTYIVGVQDDKALYLDPHDVQLAVDIKRDNLDADTSSYHCSTVRN  397

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            LPLD IDPSLAIGFYC+DK    DFC+RAS+L D+S GAPLFT+ +T   ++ +Q+QD  
Sbjct  398  LPLDLIDPSLAIGFYCRDK----DFCSRASKLEDKSNGAPLFTVAQTTRSAISIQHQDAL  453

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
             +       S    +  D      +++WQ+L
Sbjct  454  VDGLGGAGNSGMDDTFSDCGAHSGDEEWQIL  484



>ref|XP_011005240.1| PREDICTED: cysteine protease ATG4-like [Populus euphratica]
Length=481

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 159/212 (75%), Gaps = 9/212 (4%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP L I+D +R C E SKG+ DW PI+LLVPLVLGLDK+NPRYIP L+ATF
Sbjct  278  GCEDGERGGAPVLSIEDAARHCSEFSKGREDWTPILLLVPLVLGLDKINPRYIPSLQATF  337

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQD  AFYLDPHEVQ VV+  RD+++ +TSSYHCDVVR 
Sbjct  338  TFPQSLGILGGKPGASTYIVGVQDKNAFYLDPHEVQPVVNFSRDDVEANTSSYHCDVVRH  397

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PLD IDPSLAIGFYC+DK DFDDFC+ AS+L D+S GAPLFT+  +        Y+  +
Sbjct  398  IPLDLIDPSLAIGFYCRDKDDFDDFCSLASKLADESNGAPLFTVANS--------YKSSK  449

Query  346  GEAS-AEGFKSFDATSIGDSENGKQEDDWQLL  254
             ++S           ++ D+E    ED WQLL
Sbjct  450  HDSSEVRDDDPLGVMTMNDAEGCLNEDGWQLL  481



>gb|AGW81780.1| autophagy-related protein 4b [Triticum aestivum]
Length=484

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 161/213 (76%), Gaps = 4/213 (2%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CID  ++ C + +K Q  W+PI+LLVPLVLGLDK+NPRYIPLLK TF
Sbjct  274  GDEDGERGGAPVVCIDVAAQLCYDFNKDQSAWSPILLLVPLVLGLDKINPRYIPLLKETF  333

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYI GVQDD+A YLDPHEVQ  V++  DNL+ DTSSYHC  VR 
Sbjct  334  TFPQSLGILGGKPGASTYIAGVQDDRALYLDPHEVQMAVNIASDNLEADTSSYHCSTVRD  393

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PLD IDPSLAIGFYC+DK DFDDFC+RASEL +Q+ GAPLFT+ ++   S  +  QD  
Sbjct  394  MPLDLIDPSLAIGFYCRDKDDFDDFCSRASELAEQANGAPLFTVVQSVQPSKQMYNQDDG  453

Query  346  GEASAEGFK-SFDATSI-GDSENGKQEDDWQLL  254
               S  G   + DA  + G  E G  ED+WQ+L
Sbjct  454  SGCSGYGVSDNIDAEDLDGSGETG--EDEWQIL  484



>ref|XP_009138890.1| PREDICTED: cysteine protease ATG4b isoform X2 [Brassica rapa]
Length=379

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 159/211 (75%), Gaps = 12/211 (6%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D+++ CLE S+G+ +W  ++LLVPLVLGLDKVNPRYIP L ATF
Sbjct  181  GSEDGERGGAPILCIEDVAKACLEYSEGETEWTSVLLLVPLVLGLDKVNPRYIPSLIATF  240

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            SFPQSLGILGG+PG STYIVGVQ+D+ FYLDPH+VQQVV + ++  D+DTSSYHC+ +R 
Sbjct  241  SFPQSLGILGGKPGASTYIVGVQEDKGFYLDPHDVQQVVTVNKETKDVDTSSYHCNTLRY  300

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC+DK DFDDFC RA++L   + GAPLFT+T++             
Sbjct  301  VPLESLDPSLALGFYCRDKDDFDDFCVRATKLAGDANGAPLFTVTQSHR----------G  350

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
            GE       S  +++    E+   EDDWQLL
Sbjct  351  GERGIAETSSVASSTEISGED--HEDDWQLL  379



>ref|XP_009138889.1| PREDICTED: cysteine protease ATG4b isoform X1 [Brassica rapa]
Length=419

 Score =   243 bits (619),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 159/211 (75%), Gaps = 12/211 (6%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D+++ CLE S+G+ +W  ++LLVPLVLGLDKVNPRYIP L ATF
Sbjct  221  GSEDGERGGAPILCIEDVAKACLEYSEGETEWTSVLLLVPLVLGLDKVNPRYIPSLIATF  280

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            SFPQSLGILGG+PG STYIVGVQ+D+ FYLDPH+VQQVV + ++  D+DTSSYHC+ +R 
Sbjct  281  SFPQSLGILGGKPGASTYIVGVQEDKGFYLDPHDVQQVVTVNKETKDVDTSSYHCNTLRY  340

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC+DK DFDDFC RA++L   + GAPLFT+T++             
Sbjct  341  VPLESLDPSLALGFYCRDKDDFDDFCVRATKLAGDANGAPLFTVTQSHR----------G  390

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
            GE       S  +++    E+   EDDWQLL
Sbjct  391  GERGIAETSSVASSTEISGED--HEDDWQLL  419



>ref|XP_006294155.1| hypothetical protein CARUB_v10023148mg [Capsella rubella]
 gb|EOA27053.1| hypothetical protein CARUB_v10023148mg [Capsella rubella]
Length=467

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 161/214 (75%), Gaps = 23/214 (11%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D  + C E SKGQ +W PI+LLVPLVLGLDKVNPRYIP L ATF
Sbjct  274  GSEDGERGGAPILCIEDAIKSCREFSKGQSEWTPILLLVPLVLGLDKVNPRYIPSLIATF  333

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQS+GILGG+PG STYI+GVQ+D+ FYLDPHEVQQVV + ++  D+DTSSYHC V+R 
Sbjct  334  TFPQSVGILGGKPGASTYIIGVQEDKGFYLDPHEVQQVVTVNKETPDVDTSSYHCKVLRY  393

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC+DK DFDDFC RA++L ++S GAPLFT+T+T +           
Sbjct  394  VPLESLDPSLALGFYCRDKDDFDDFCLRAAKLAEESKGAPLFTLTQTHS-----------  442

Query  346  GEASAEGFKSFDATSIGDSENG---KQEDDWQLL  254
                     + +  S G SE+    ++EDDWQLL
Sbjct  443  ---------AINQNSYGFSEDNIEEEREDDWQLL  467



>ref|XP_010518001.1| PREDICTED: cysteine protease ATG4a-like isoform X1 [Camelina 
sativa]
 ref|XP_010518002.1| PREDICTED: cysteine protease ATG4a-like isoform X1 [Camelina 
sativa]
Length=472

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 161/211 (76%), Gaps = 15/211 (7%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D ++ C E SKGQ++W PI+LLVPLVLGLDKVNPRYIP L ATF
Sbjct  277  GSEDGERGGAPILCIEDATKSCREFSKGQLEWTPILLLVPLVLGLDKVNPRYIPSLIATF  336

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQS+GILGG+PG STYI+GVQ+D+ FYLDPHEVQQVV + +++ D+DTSSYH  V+R 
Sbjct  337  AFPQSVGILGGKPGASTYIIGVQEDKGFYLDPHEVQQVVTVNKESPDVDTSSYHSKVLRY  396

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC+DK DF+DFC RAS+L ++S GAPLFT+T+T +      Y    
Sbjct  397  VPLESLDPSLALGFYCRDKDDFNDFCLRASKLAEESKGAPLFTVTQTHSAINQNNY----  452

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
                  GF   D     + E   +EDDWQLL
Sbjct  453  ------GFSEED-----NIEEEGREDDWQLL  472



>ref|XP_010469251.1| PREDICTED: cysteine protease ATG4b isoform X2 [Camelina sativa]
Length=476

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 163/211 (77%), Gaps = 11/211 (5%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D+++ C+E S+G+ +W+PI+LLVPLVLGLDKVNPRY+P L ATF
Sbjct  277  GSEDGERGGAPILCIEDVTKTCVEFSEGETEWSPILLLVPLVLGLDKVNPRYLPSLIATF  336

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQ+D+ FYLDPH+VQQVV + ++N D+DTSSYHC+  R 
Sbjct  337  TFPQSLGILGGKPGASTYIVGVQEDKGFYLDPHDVQQVVTVNKENRDVDTSSYHCNTPRY  396

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC DK+DFDDFC RA++L  +S GAPLFT+T++         ++  
Sbjct  397  VPLESLDPSLALGFYCPDKADFDDFCIRATKLAGESNGAPLFTVTQSHR-------RNDC  449

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
            G A +        TS   S   + EDDWQLL
Sbjct  450  GIAESSSI----VTSTEFSGEEEHEDDWQLL  476



>ref|XP_012081889.1| PREDICTED: cysteine protease ATG4-like isoform X1 [Jatropha curcas]
 ref|XP_012081890.1| PREDICTED: cysteine protease ATG4-like isoform X1 [Jatropha curcas]
 ref|XP_012081891.1| PREDICTED: cysteine protease ATG4-like isoform X1 [Jatropha curcas]
 gb|KDP29532.1| hypothetical protein JCGZ_19245 [Jatropha curcas]
Length=492

 Score =   244 bits (624),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 157/212 (74%), Gaps = 1/212 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CI+D SR CL+ S+GQ +W PI+LLVPLVLGL+KVN RYIP L+AT 
Sbjct  281  GDEDGERGGAPVVCIEDASRHCLDFSRGQANWTPILLLVPLVLGLEKVNLRYIPSLQATL  340

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGI+GG+PG STYIVGVQDD AFYLDPH VQ VV++ RD +  DTSSYH D +R 
Sbjct  341  TFPQSLGIMGGKPGASTYIVGVQDDNAFYLDPHGVQPVVNISRDGIGADTSSYHSDFIRH  400

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+SIDPSLAIGFYC+DK DFD+FC  AS+L D S GAPLFT+  +  +   V   D  
Sbjct  401  IPLESIDPSLAIGFYCRDKDDFDEFCFLASKLADDSHGAPLFTVAHSHKLPKSVGRTDTS  460

Query  346  GEAS-AEGFKSFDATSIGDSENGKQEDDWQLL  254
             + S  +   S     + D+E    EDDWQLL
Sbjct  461  NDNSGVQEDDSLGVMPMNDAEAPVNEDDWQLL  492



>ref|XP_009116672.1| PREDICTED: cysteine protease ATG4b isoform X2 [Brassica rapa]
Length=374

 Score =   241 bits (615),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 154/211 (73%), Gaps = 16/211 (8%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LC++D ++ CLE SKG+ +W  ++LLVPLVLGLDKVNPRYIP L ATF
Sbjct  180  GSEDGERGGAPILCLEDATKTCLEYSKGETEWTSVLLLVPLVLGLDKVNPRYIPSLIATF  239

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQ+D+ FYLDPH VQQVV + ++  D+DTSSYHC+ VR 
Sbjct  240  TFPQSLGILGGKPGASTYIVGVQEDKGFYLDPHGVQQVVTVNKETQDVDTSSYHCNTVRY  299

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC+DK DFDDFC RA++L   S GAPLFT+T++             
Sbjct  300  VPLESLDPSLALGFYCRDKDDFDDFCIRATKLAGDSNGAPLFTVTKSHRT----------  349

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
                  G +    TS       + ED+WQLL
Sbjct  350  ------GDRGIAETSTVTCTCEEHEDEWQLL  374



>ref|XP_010469250.1| PREDICTED: cysteine protease ATG4b isoform X1 [Camelina sativa]
Length=476

 Score =   244 bits (622),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 162/211 (77%), Gaps = 11/211 (5%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D+++ C+E S+G+ +W PI+LLVPLVLGLDKVNPRY+P L ATF
Sbjct  277  GSEDGERGGAPILCIEDVTKSCVEFSEGETEWTPILLLVPLVLGLDKVNPRYLPSLIATF  336

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQ+D+ FYLDPH+VQQVV + ++N D+DTSSYHC+  R 
Sbjct  337  TFPQSLGILGGKPGASTYIVGVQEDKGFYLDPHDVQQVVTVNKENRDVDTSSYHCNTPRY  396

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC DK+DFDDFC RA++L  +S GAPLFT+T++         ++  
Sbjct  397  VPLESLDPSLALGFYCPDKADFDDFCIRATKLAGESNGAPLFTVTQSHR-------RNDC  449

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
            G A +        TS   S   + EDDWQLL
Sbjct  450  GIAESSSI----VTSTEFSGEEEHEDDWQLL  476



>emb|CDY45773.1| BnaC04g22590D [Brassica napus]
Length=427

 Score =   242 bits (617),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 159/212 (75%), Gaps = 14/212 (7%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D+++ CLE S+G+ +WA ++LLVPLVLGLDKVNPRYIP L ATF
Sbjct  229  GSEDGERGGAPILCIEDVTKTCLEYSEGETEWASVLLLVPLVLGLDKVNPRYIPSLIATF  288

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQ+D+ FYLDPH+VQQVV + ++  D DTSSYHC+ +R 
Sbjct  289  TFPQSLGILGGKPGASTYIVGVQEDKGFYLDPHDVQQVVTVNKETKDADTSSYHCNTLRY  348

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC+DK DFDDFC RA +L   + GAPLFT+T++             
Sbjct  349  VPLESLDPSLALGFYCRDKDDFDDFCIRARKLAGDANGAPLFTVTQSHR----------G  398

Query  346  GEAS-AEGFKSFDATSIGDSENGKQEDDWQLL  254
            GE   AE      +T I   E+   EDDWQLL
Sbjct  399  GERGIAETSSVASSTEISGEEH---EDDWQLL  427



>ref|XP_009142996.1| PREDICTED: cysteine protease ATG4a isoform X2 [Brassica rapa]
Length=385

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 150/171 (88%), Gaps = 1/171 (1%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D+ + C+E S+G+ +WAP++LLVPLVLGLD+VNPRYIP LKATF
Sbjct  189  GSEDGERGGAPVLCIEDVIKSCVEFSRGEDEWAPLLLLVPLVLGLDRVNPRYIPSLKATF  248

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLD-IDTSSYHCDVVR  530
            +FPQSLG+LGG+PG STYIVGVQ+D  FYLDPH+VQQVV + ++ LD +DTSSYHC+V+R
Sbjct  249  TFPQSLGVLGGKPGASTYIVGVQEDNGFYLDPHDVQQVVTVNKETLDVVDTSSYHCNVLR  308

Query  529  QLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNV  377
             +PL+S+DPSLA+GFYC+DK+DFDD C RAS L ++S GAPLFT+T+T ++
Sbjct  309  YVPLESLDPSLALGFYCRDKADFDDLCHRASTLAEESKGAPLFTVTQTHSL  359



>ref|XP_009116671.1| PREDICTED: cysteine protease ATG4b isoform X1 [Brassica rapa]
Length=442

 Score =   242 bits (617),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 154/211 (73%), Gaps = 16/211 (8%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LC++D ++ CLE SKG+ +W  ++LLVPLVLGLDKVNPRYIP L ATF
Sbjct  248  GSEDGERGGAPILCLEDATKTCLEYSKGETEWTSVLLLVPLVLGLDKVNPRYIPSLIATF  307

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQ+D+ FYLDPH VQQVV + ++  D+DTSSYHC+ VR 
Sbjct  308  TFPQSLGILGGKPGASTYIVGVQEDKGFYLDPHGVQQVVTVNKETQDVDTSSYHCNTVRY  367

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC+DK DFDDFC RA++L   S GAPLFT+T++             
Sbjct  368  VPLESLDPSLALGFYCRDKDDFDDFCIRATKLAGDSNGAPLFTVTKSHRT----------  417

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
                  G +    TS       + ED+WQLL
Sbjct  418  ------GDRGIAETSTVTCTCEEHEDEWQLL  442



>ref|XP_007217926.1| hypothetical protein PRUPE_ppa004885mg [Prunus persica]
 gb|EMJ19125.1| hypothetical protein PRUPE_ppa004885mg [Prunus persica]
Length=487

 Score =   243 bits (620),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 167/212 (79%), Gaps = 1/212 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CI D SR CLE S+G+VDW PI+LLVPLVLGL+KVNPRYIP L ATF
Sbjct  276  GDEDGERGGAPVVCIQDASRHCLEFSRGRVDWTPILLLVPLVLGLEKVNPRYIPSLWATF  335

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGI+GG+PG STYI+GVQD++A YLDPHEVQ  +++ RD+L+ DT SYHC+V+R 
Sbjct  336  TFPQSLGIMGGKPGASTYIIGVQDEKALYLDPHEVQPAINIRRDDLEADTLSYHCNVIRH  395

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQD-M  350
            +PLDSIDPSLAIGFYC+D+ DFDDFC RAS+L D S GAPLFT+T++ N   PV + D +
Sbjct  396  IPLDSIDPSLAIGFYCRDRDDFDDFCFRASKLADGSNGAPLFTVTQSHNFPKPVNHSDVL  455

Query  349  QGEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
                  +   SF A  I D++    EDDWQLL
Sbjct  456  DDSGGVQNDDSFVAPPISDADGSAHEDDWQLL  487



>ref|XP_002878306.1| autophagy 4b [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54565.1| autophagy 4b [Arabidopsis lyrata subsp. lyrata]
Length=476

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 161/211 (76%), Gaps = 11/211 (5%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D+++ CLE S+G  +W PI+LLVPLVLGLDKVNPRYIP L ATF
Sbjct  277  GSEDGERGGAPILCIEDVTKTCLEFSEGDTEWPPILLLVPLVLGLDKVNPRYIPSLIATF  336

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQ+D+ FYLDPH+VQQVV + ++N D+DTSSYHC+ +R 
Sbjct  337  TFPQSLGILGGKPGASTYIVGVQEDKGFYLDPHDVQQVVTVKKENQDVDTSSYHCNTLRY  396

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC+DK DFDDFC RA++L   S GAPLFT+T++   +         
Sbjct  397  VPLESLDPSLALGFYCQDKDDFDDFCIRATKLAGDSNGAPLFTVTQSHRTN-----DCGI  451

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
             E S+    S   T I   E+   EDDWQLL
Sbjct  452  AETSSSTVIS---TEISGEEH---EDDWQLL  476



>ref|NP_001054293.1| Os04g0682000 [Oryza sativa Japonica Group]
 sp|Q7XPW8.1|ATG4B_ORYSJ RecName: Full=Cysteine protease ATG4B; AltName: Full=Autophagy-related 
protein 4 homolog B [Oryza sativa Japonica Group]
 emb|CAE03430.1| OSJNBa0032F06.13 [Oryza sativa Japonica Group]
 gb|ABB77259.1| autophagy 4 [Oryza sativa Indica Group]
 dbj|BAF16207.1| Os04g0682000 [Oryza sativa Japonica Group]
 dbj|BAG91210.1| unnamed protein product [Oryza sativa Japonica Group]
Length=478

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 160/211 (76%), Gaps = 3/211 (1%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CID  ++ C + +KGQ  W+PI+LLVPLVLGLDK+NPRYIPLLK TF
Sbjct  271  GDEDGERGGAPVVCIDVAAQLCCDFNKGQSTWSPILLLVPLVLGLDKINPRYIPLLKETF  330

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYI GVQDD+A YLDPHEVQ  VD+  DN++ DTSSYHC  VR 
Sbjct  331  TFPQSLGILGGKPGTSTYIAGVQDDRALYLDPHEVQMAVDIAADNIEADTSSYHCSTVRD  390

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            L LD IDPSLAIGFYC+DK DFDDFC+RA+ELVD++ GAPLFT+ ++   S  +  QD  
Sbjct  391  LALDLIDPSLAIGFYCRDKDDFDDFCSRATELVDKANGAPLFTVVQSVQPSKQMYNQDDV  450

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
               S +G  + +     D+     E++WQ+L
Sbjct  451  LGISGDGNINVEDL---DASGETGEEEWQIL  478



>sp|Q2XPP4.2|ATG4B_ORYSI RecName: Full=Cysteine protease ATG4B; AltName: Full=Autophagy-related 
protein 4 homolog B; Short=Protein autophagy 4; AltName: 
Full=OsAtg4 [Oryza sativa Indica Group]
Length=478

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 160/211 (76%), Gaps = 3/211 (1%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CID  ++ C + +KGQ  W+PI+LLVPLVLGLDK+NPRYIPLLK TF
Sbjct  271  GDEDGERGGAPVVCIDVAAQLCCDFNKGQSTWSPILLLVPLVLGLDKINPRYIPLLKETF  330

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYI GVQDD+A YLDPHEVQ  VD+  DN++ DTSSYHC  VR 
Sbjct  331  TFPQSLGILGGKPGTSTYIAGVQDDRALYLDPHEVQMAVDIAADNIEADTSSYHCSTVRD  390

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            L LD IDPSLAIGFYC+DK DFDDFC+RA+ELVD++ GAPLFT+ ++   S  +  QD  
Sbjct  391  LALDLIDPSLAIGFYCRDKDDFDDFCSRATELVDKANGAPLFTVVQSVQPSKQMYNQDDV  450

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
               S +G  + +     D+     E++WQ+L
Sbjct  451  LGISGDGNINVEDL---DASGETGEEEWQIL  478



>gb|ACN76571.1| cysteine proteinase [Triticum aestivum]
Length=486

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 161/213 (76%), Gaps = 4/213 (2%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CID  ++ C + +K Q  W+PI+LLVPLVLGLDK+NPRYIPLLK TF
Sbjct  276  GDEDGERGGAPVVCIDVAAQLCYDFNKDQSAWSPILLLVPLVLGLDKINPRYIPLLKETF  335

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYI GVQDD+A YLDPHEVQ  V++  DNL+ DTSSYHC  VR 
Sbjct  336  TFPQSLGILGGKPGASTYIAGVQDDRALYLDPHEVQLAVNIASDNLEADTSSYHCSTVRD  395

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PLD IDPSLAIGFYC+DK DFDDFC+RASEL +Q+ GAPLFT+ ++   S  +  +D  
Sbjct  396  MPLDLIDPSLAIGFYCRDKDDFDDFCSRASELAEQANGAPLFTVVQSVQPSKQMYNRDDG  455

Query  346  GEASAEGFK-SFDATSI-GDSENGKQEDDWQLL  254
               S  G   + DA  + G  E G  ED+WQ+L
Sbjct  456  SGCSGYGVSGNIDAEDLDGSGETG--EDEWQIL  486



>ref|XP_009142995.1| PREDICTED: cysteine protease ATG4a isoform X1 [Brassica rapa]
Length=466

 Score =   241 bits (616),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 150/171 (88%), Gaps = 1/171 (1%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D+ + C+E S+G+ +WAP++LLVPLVLGLD+VNPRYIP LKATF
Sbjct  270  GSEDGERGGAPVLCIEDVIKSCVEFSRGEDEWAPLLLLVPLVLGLDRVNPRYIPSLKATF  329

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLD-IDTSSYHCDVVR  530
            +FPQSLG+LGG+PG STYIVGVQ+D  FYLDPH+VQQVV + ++ LD +DTSSYHC+V+R
Sbjct  330  TFPQSLGVLGGKPGASTYIVGVQEDNGFYLDPHDVQQVVTVNKETLDVVDTSSYHCNVLR  389

Query  529  QLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNV  377
             +PL+S+DPSLA+GFYC+DK+DFDD C RAS L ++S GAPLFT+T+T ++
Sbjct  390  YVPLESLDPSLALGFYCRDKADFDDLCHRASTLAEESKGAPLFTVTQTHSL  440



>ref|XP_006402636.1| hypothetical protein EUTSA_v10005940mg [Eutrema salsugineum]
 gb|ESQ44089.1| hypothetical protein EUTSA_v10005940mg [Eutrema salsugineum]
Length=389

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 159/211 (75%), Gaps = 13/211 (6%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D+S+ CLE S+G+ +W PI+LLVPLVLGL+KVNPRYIP L ATF
Sbjct  192  GSEDGERGGAPILCIEDVSKSCLEYSEGKSEWTPILLLVPLVLGLEKVNPRYIPSLIATF  251

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQ+D+ FYLDPH+VQQVV + ++  D+DTSSYHC+ +R 
Sbjct  252  TFPQSLGILGGKPGASTYIVGVQEDKGFYLDPHDVQQVVTVNKETQDVDTSSYHCNTLRY  311

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC+DK DFDDFC RA++L   S GAPLFT+T++   S         
Sbjct  312  VPLESLDPSLALGFYCRDKDDFDDFCIRATKLAGDSKGAPLFTVTQSHRTS---------  362

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
             +       +  +T     E+   ED+WQLL
Sbjct  363  -DCGIAETSTMTSTEFSGEEH---EDEWQLL  389



>sp|A2XHJ5.1|ATG4A_ORYSI RecName: Full=Cysteine protease ATG4A; AltName: Full=Autophagy-related 
protein 4 homolog A [Oryza sativa Indica Group]
 gb|EAY90305.1| hypothetical protein OsI_11880 [Oryza sativa Indica Group]
Length=473

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 160/212 (75%), Gaps = 6/212 (3%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CID  ++ C + +KGQ  W+PI+LLVPLVLGLDK+NPRYIPLLK TF
Sbjct  267  GDEDGERGGAPVVCIDVAAQLCCDFNKGQSTWSPILLLVPLVLGLDKLNPRYIPLLKETF  326

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STY+ GVQDD+  YLDPHEVQ  VD+  DNL+ DTSSYHC  VR 
Sbjct  327  TFPQSLGILGGKPGTSTYVAGVQDDRVLYLDPHEVQLAVDIAADNLEADTSSYHCSTVRD  386

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            L LD IDPSLAIGFYC+DK DFDDFC+RASELVD++ GAPLFT+ ++     P +    +
Sbjct  387  LALDLIDPSLAIGFYCRDKDDFDDFCSRASELVDKANGAPLFTVMQSVQ---PSKQMYNE  443

Query  346  GEASAEGFKSFDATSI-GDSENGKQEDDWQLL  254
              +S +G    +   + G  E G  E++WQ+L
Sbjct  444  ESSSGDGMDIINVEGLDGSGETG--EEEWQIL  473



>gb|AGW81779.1| autophagy-related protein 4a [Triticum aestivum]
Length=483

 Score =   241 bits (616),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 156/211 (74%), Gaps = 0/211 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CID  ++ C + +K Q  W+PI+LLVPLVLGLDK+NPRYIPLLK TF
Sbjct  273  GDEDGERGGAPVVCIDVAAQLCYDFNKDQSTWSPILLLVPLVLGLDKINPRYIPLLKETF  332

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYI GVQDD+A YLDPHEVQ  V++  DNL+ +TSSYHC  VR 
Sbjct  333  TFPQSLGILGGKPGASTYIAGVQDDRALYLDPHEVQLAVNIASDNLEANTSSYHCSTVRD  392

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PLD IDPSLAIGFYC+DK DFDDFC+RASEL +Q+ GAPLFT+ ++   S  +  QD  
Sbjct  393  MPLDLIDPSLAIGFYCRDKDDFDDFCSRASELAEQANGAPLFTVVQSVQPSKQMYNQDDG  452

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
               S  G      T   D      ED+WQ+L
Sbjct  453  SGCSGYGASDNIDTEDLDGSGETGEDEWQIL  483



>ref|XP_010413619.1| PREDICTED: cysteine protease ATG4b-like isoform X2 [Camelina 
sativa]
Length=391

 Score =   239 bits (610),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 161/211 (76%), Gaps = 11/211 (5%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D+++ C+E S+G+ +W PI+LLVPLVLGLDKVNPRY+P L ATF
Sbjct  192  GSEDGERGGAPILCIEDVTKSCVEFSEGETEWTPILLLVPLVLGLDKVNPRYLPSLIATF  251

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQ+D+ FYLDPH+VQQVV + +++ D+DT SYHC+  R 
Sbjct  252  TFPQSLGILGGKPGASTYIVGVQEDKGFYLDPHDVQQVVTVNKEDRDVDTLSYHCNTPRY  311

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC DK+DFDDFC RA++L  +S GAPLFT+T++         ++  
Sbjct  312  VPLESLDPSLALGFYCPDKADFDDFCIRATKLAGESNGAPLFTVTQSHR-------RNDS  364

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
            G A +        TS   S   + EDDWQLL
Sbjct  365  GIAESSSI----VTSTEFSGEEEHEDDWQLL  391



>ref|XP_011100135.1| PREDICTED: cysteine protease ATG4-like [Sesamum indicum]
Length=528

 Score =   242 bits (618),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 133/232 (57%), Positives = 164/232 (71%), Gaps = 21/232 (9%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GD+DGERGGAP LCI+DI+R C + S GQ DWAPI+L+VPLVLGL+K+NPRY+PLL ATF
Sbjct  297  GDDDGERGGAPVLCIEDIARLCSKCSGGQCDWAPILLMVPLVLGLEKINPRYLPLLSATF  356

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAF------------------YLDPHEVQ-QVVDL  584
            +FPQSLG+LGG+PG STYIVGVQD++                    Y     VQ QV  +
Sbjct  357  TFPQSLGLLGGKPGASTYIVGVQDEKGTGNVTIASISVYSLVVKCQYAPSLFVQLQVAQV  416

Query  583  GRDNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPL  404
              D+LD DTSSYHC+VVR +PL+SID SLAIGFYC++KSDFDDFC+RASEL+DQS GAPL
Sbjct  417  KMDDLDADTSSYHCNVVRHMPLESIDSSLAIGFYCRNKSDFDDFCSRASELIDQSNGAPL  476

Query  403  FTITETRNVSMPVQYQDMQGE--ASAEGFKSFDATSIGDSENGKQEDDWQLL  254
            FTI E+R+   P  Y+    +     + F+  D      SEN  Q+D+WQLL
Sbjct  477  FTIAESRSNPNPASYRSTAKDDAICTQDFEPVDKLPTSGSENFTQDDEWQLL  528



>ref|XP_006402637.1| hypothetical protein EUTSA_v10005940mg [Eutrema salsugineum]
 gb|ESQ44090.1| hypothetical protein EUTSA_v10005940mg [Eutrema salsugineum]
Length=474

 Score =   240 bits (613),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 159/211 (75%), Gaps = 13/211 (6%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D+S+ CLE S+G+ +W PI+LLVPLVLGL+KVNPRYIP L ATF
Sbjct  277  GSEDGERGGAPILCIEDVSKSCLEYSEGKSEWTPILLLVPLVLGLEKVNPRYIPSLIATF  336

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQ+D+ FYLDPH+VQQVV + ++  D+DTSSYHC+ +R 
Sbjct  337  TFPQSLGILGGKPGASTYIVGVQEDKGFYLDPHDVQQVVTVNKETQDVDTSSYHCNTLRY  396

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC+DK DFDDFC RA++L   S GAPLFT+T++   S         
Sbjct  397  VPLESLDPSLALGFYCRDKDDFDDFCIRATKLAGDSKGAPLFTVTQSHRTS---------  447

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
             +       +  +T     E+   ED+WQLL
Sbjct  448  -DCGIAETSTMTSTEFSGEEH---EDEWQLL  474



>ref|XP_004960034.1| PREDICTED: cysteine protease ATG4B-like [Setaria italica]
Length=480

 Score =   240 bits (613),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 132/211 (63%), Positives = 159/211 (75%), Gaps = 3/211 (1%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CID  ++ C + +KGQ  W+PI+LLVPLVLGLDK+NPRYIPLLK TF
Sbjct  273  GDEDGERGGAPVVCIDVAAQLCSDFNKGQSTWSPILLLVPLVLGLDKINPRYIPLLKETF  332

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYI GVQDD+A YLDPHEVQ  V++  DNL+ DTSSYHC VVR 
Sbjct  333  TFPQSLGILGGKPGTSTYIAGVQDDRALYLDPHEVQMAVNIAPDNLEADTSSYHCSVVRD  392

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            L LD IDPSLAIGFYC+DK  FDDFC+RASELV+++ GAPLFT+ ++   S  +  QD  
Sbjct  393  LALDQIDPSLAIGFYCRDKDGFDDFCSRASELVEKANGAPLFTVVQSIVPSKQMYKQDDG  452

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
               S     + D    G  E G  E++WQ+L
Sbjct  453  LGCSGSSMANHDDLD-GSGEAG--EEEWQIL  480



>ref|XP_010413618.1| PREDICTED: cysteine protease ATG4b-like isoform X1 [Camelina 
sativa]
Length=476

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 161/211 (76%), Gaps = 11/211 (5%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D+++ C+E S+G+ +W PI+LLVPLVLGLDKVNPRY+P L ATF
Sbjct  277  GSEDGERGGAPILCIEDVTKSCVEFSEGETEWTPILLLVPLVLGLDKVNPRYLPSLIATF  336

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQ+D+ FYLDPH+VQQVV + +++ D+DT SYHC+  R 
Sbjct  337  TFPQSLGILGGKPGASTYIVGVQEDKGFYLDPHDVQQVVTVNKEDRDVDTLSYHCNTPRY  396

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC DK+DFDDFC RA++L  +S GAPLFT+T++         ++  
Sbjct  397  VPLESLDPSLALGFYCPDKADFDDFCIRATKLAGESNGAPLFTVTQSHR-------RNDS  449

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
            G A +        TS   S   + EDDWQLL
Sbjct  450  GIAESSSI----VTSTEFSGEEEHEDDWQLL  476



>sp|Q75KP8.1|ATG4A_ORYSJ RecName: Full=Cysteine protease ATG4A; AltName: Full=Autophagy-related 
protein 4 homolog A [Oryza sativa Japonica Group]
 gb|AAR87271.1| putative autophagy protein (with alternative splicing) [Oryza 
sativa Japonica Group]
 gb|ABF96366.1| Peptidase family C54 containing protein, expressed [Oryza sativa 
Japonica Group]
 gb|EAZ27183.1| hypothetical protein OsJ_11120 [Oryza sativa Japonica Group]
 dbj|BAH01357.1| unnamed protein product [Oryza sativa Japonica Group]
Length=474

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 159/212 (75%), Gaps = 6/212 (3%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CID  ++ C + +K Q  W+PI+LLVPLVLGLDK+NPRYIPLLK T 
Sbjct  268  GDEDGERGGAPVVCIDVAAQLCCDFNKNQSTWSPILLLVPLVLGLDKLNPRYIPLLKETL  327

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYI GVQDD+A YLDPHEVQ  VD+  DNL+  TSSYHC  VR 
Sbjct  328  TFPQSLGILGGKPGTSTYIAGVQDDRALYLDPHEVQLAVDIAADNLEAGTSSYHCSTVRD  387

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            L LD IDPSLAIGFYC+DK DFDDFC+RASELVD++ GAPLFT+ ++     P +    +
Sbjct  388  LALDLIDPSLAIGFYCRDKDDFDDFCSRASELVDKANGAPLFTVVQSVQ---PSKQMYNE  444

Query  346  GEASAEGFKSFDATSI-GDSENGKQEDDWQLL  254
              +S +G  S +   + G  E G  E++WQ+L
Sbjct  445  ESSSGDGMDSINVEGLDGSGETG--EEEWQIL  474



>ref|NP_191554.1| peptidase family C54 protein [Arabidopsis thaliana]
 sp|Q9M1Y0.1|ATG4B_ARATH RecName: Full=Cysteine protease ATG4b; AltName: Full=Autophagy-related 
protein 4 homolog b; Short=AtAPG4b; Short=Protein 
autophagy 4b [Arabidopsis thaliana]
 emb|CAB75814.1| putative protein [Arabidopsis thaliana]
 dbj|BAB88384.1| autophagy 4b [Arabidopsis thaliana]
 dbj|BAE99003.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE79989.1| peptidase family C54 protein [Arabidopsis thaliana]
Length=477

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 159/211 (75%), Gaps = 11/211 (5%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D+++ CLE S+G+ +W PI+LLVPLVLGLD+VNPRYIP L ATF
Sbjct  278  GSEDGERGGAPILCIEDVTKTCLEFSEGETEWPPILLLVPLVLGLDRVNPRYIPSLIATF  337

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQ+D+ FYLDPH+VQQVV + ++N D+DTSSYHC+ +R 
Sbjct  338  TFPQSLGILGGKPGASTYIVGVQEDKGFYLDPHDVQQVVTVKKENQDVDTSSYHCNTLRY  397

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC+ K DFDDFC RA++L   S GAPLFT+T++         ++  
Sbjct  398  VPLESLDPSLALGFYCQHKDDFDDFCIRATKLAGDSNGAPLFTVTQSHR-------RNDC  450

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
            G A             G+    + EDDWQLL
Sbjct  451  GIAETSSSTETSTEISGE----EHEDDWQLL  477



>emb|CDY41195.1| BnaA09g38200D [Brassica napus]
Length=447

 Score =   238 bits (606),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 153/211 (73%), Gaps = 16/211 (8%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D+++ CLE S+G+ +W  ++LLVPLVLGLDKVN RYIP L ATF
Sbjct  253  GSEDGERGGAPILCIEDVTKTCLEYSEGETEWTAVLLLVPLVLGLDKVNSRYIPSLIATF  312

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQ+D+ FYLDPH VQQVV + ++  D+DTSSYHC+ V  
Sbjct  313  TFPQSLGILGGKPGASTYIVGVQEDKGFYLDPHGVQQVVTVNKETQDVDTSSYHCNTVHY  372

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC+DK DFDDFC RA++L   S GAPLFT+T++             
Sbjct  373  VPLESLDPSLALGFYCRDKDDFDDFCIRATKLAGDSNGAPLFTVTKSHRT----------  422

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
                  G +    TS       + ED+WQLL
Sbjct  423  ------GDRGIAETSTVTCTCEEHEDEWQLL  447



>emb|CDX79779.1| BnaA05g03770D [Brassica napus]
Length=456

 Score =   238 bits (607),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 148/171 (87%), Gaps = 1/171 (1%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D+ + C+E S+G+ +WAP++LLVPLVLGLD+VNPRYIP LKATF
Sbjct  260  GSEDGERGGAPVLCIEDVIKSCVEFSRGEDEWAPLLLLVPLVLGLDRVNPRYIPSLKATF  319

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLD-IDTSSYHCDVVR  530
            +FPQSLG+LGG+PG STYIVGVQ+D  FYLDPH+VQQVV + ++ LD +DTSSYHC+V+R
Sbjct  320  TFPQSLGVLGGKPGASTYIVGVQEDNGFYLDPHDVQQVVTVNKETLDVVDTSSYHCNVLR  379

Query  529  QLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNV  377
             +PL+S+DPSLA+GFYC+DK  FDD C RAS L ++S GAPLFT+T+T ++
Sbjct  380  YVPLESLDPSLALGFYCRDKGAFDDLCLRASTLAEESKGAPLFTVTQTHSL  430



>emb|CDX89039.1| BnaA04g01470D [Brassica napus]
Length=425

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 159/213 (75%), Gaps = 15/213 (7%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D+++ CLE ++ + +W  ++LLVPLVLGLDKVNPRYIP L ATF
Sbjct  226  GSEDGERGGAPILCIEDVAKTCLEYTERETEWTSVLLLVPLVLGLDKVNPRYIPSLIATF  285

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLD-IDTSSYHCDVVR  530
            SFPQSLGILGG+PG STYIVGVQ+D+ FYLDPH+VQQVV + ++  D +DTSSYHC+ +R
Sbjct  286  SFPQSLGILGGKPGASTYIVGVQEDKGFYLDPHDVQQVVTVNKETKDVVDTSSYHCNTLR  345

Query  529  QLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDM  350
             +PL+S+DPSLA+GFYC+DK DFDDFC RA++L   + GAPLFT+T++            
Sbjct  346  YVPLESLDPSLALGFYCRDKDDFDDFCIRATKLAGDANGAPLFTVTQSHR----------  395

Query  349  QGEAS-AEGFKSFDATSIGDSENGKQEDDWQLL  254
             GE   AE      +T I   E+   EDDWQLL
Sbjct  396  GGERGIAETSSVASSTEISGEEH---EDDWQLL  425



>ref|XP_008661519.1| PREDICTED: autophagy-related 4b isoform X3 [Zea mays]
 gb|ACF82474.1| unknown [Zea mays]
 gb|AFW59940.1| autophagy 4b variant 3 [Zea mays]
Length=462

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 159/216 (74%), Gaps = 12/216 (6%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP  CID  ++ C   +KGQ  W+PI+LL+PLVLGLDK+NPRYIPLLK TF
Sbjct  254  GDEDGERGGAPVFCIDVAAQLCSNFNKGQCTWSPILLLIPLVLGLDKINPRYIPLLKETF  313

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
             FPQSLGILGG+PG STYI GVQ+D+A YLDPH+VQ  VD+  DNL+ DTSSYHC VVR 
Sbjct  314  KFPQSLGILGGKPGTSTYIAGVQEDRALYLDPHDVQMAVDIAPDNLEADTSSYHCSVVRD  373

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            L L+ IDPSLAIGFYC+DK DFDDFC+RASEL +++ GAPLFT+ ++   S  +  QD  
Sbjct  374  LALEQIDPSLAIGFYCRDKDDFDDFCSRASELAEKANGAPLFTVMQSVQPSKQMYKQD--  431

Query  346  GEASAEGFKSFDATSIGDSE-----NGKQEDDWQLL  254
                 +G      +S+ + +     +G+  ++WQ+L
Sbjct  432  -----DGLCCCSGSSMANEDYDLDASGEAGEEWQIL  462



>ref|XP_010672541.1| PREDICTED: cysteine protease ATG4 [Beta vulgaris subsp. vulgaris]
Length=502

 Score =   236 bits (603),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 164/213 (77%), Gaps = 4/213 (2%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +C+DD+S  C + S G+ DW  I+LLVPLVLGLDK+NPRY+PLL ATF
Sbjct  292  GDEDGERGGAPVVCVDDVSSCCRDHSGGEADWMAILLLVPLVLGLDKLNPRYVPLLGATF  351

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PGVSTYIVGVQDD AFYLDPHE QQV ++ + +L+ DTSS+H +VVR 
Sbjct  352  TFPQSLGILGGKPGVSTYIVGVQDDNAFYLDPHEAQQVANITKGDLEADTSSFHSNVVRH  411

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+SIDPSLAIGFYCKDK DFDDF +RAS+L D+S GAPLFT+T +RN        DM 
Sbjct  412  IPLESIDPSLAIGFYCKDKDDFDDFYSRASKLADESNGAPLFTVTHSRNSLKTSNQCDMT  471

Query  346  GEASAEGFKSFDATSIGDSEN--GKQEDDWQLL  254
               S    +  D+  I  S N  G QED+WQLL
Sbjct  472  TGVSET--REDDSYDILHSNNDGGMQEDEWQLL  502



>ref|XP_008668674.1| PREDICTED: cysteine protease ATG4B-like isoform X2 [Zea mays]
Length=486

 Score =   236 bits (602),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 156/211 (74%), Gaps = 5/211 (2%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CID  ++ C + +KG   W+PI+LLVPLVLGLDK+NPRYIPLLK TF
Sbjct  281  GDEDGERGGAPVVCIDVAAQLCSDFNKGPSTWSPILLLVPLVLGLDKINPRYIPLLKETF  340

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
             FPQSLGILGG+PG STYI GVQDD+A YLDPHEVQ  VD+  DNL+ DTSSYHC VVR 
Sbjct  341  MFPQSLGILGGKPGTSTYIAGVQDDRALYLDPHEVQMTVDIALDNLEADTSSYHCSVVRA  400

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            L L+ IDPSLAIGFYC+DK DFDDFC+RASEL +++ GAPLFT+ ++   S  +  QD  
Sbjct  401  LALEQIDPSLAIGFYCRDKDDFDDFCSRASELAEKANGAPLFTVVQSIEPSKQMYKQDDG  460

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
               S     + D     D +   + ++WQ+L
Sbjct  461  LGCSGSSMANDD-----DLDGSGEAEEWQIL  486



>ref|NP_001137489.1| autophagy-related 4b [Zea mays]
 ref|XP_008661516.1| PREDICTED: autophagy-related 4b isoform X1 [Zea mays]
 ref|XP_008661517.1| PREDICTED: autophagy-related 4b isoform X1 [Zea mays]
 gb|ACF84662.1| unknown [Zea mays]
 gb|ACG48147.1| cysteine protease ATG4B [Zea mays]
 gb|ACJ73914.1| autophagy-related 4b variant 1 [Zea mays]
 gb|AFW59939.1| autophagy 4b variant 1Cysteine protease ATG4B [Zea mays]
Length=492

 Score =   236 bits (603),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 159/216 (74%), Gaps = 12/216 (6%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP  CID  ++ C   +KGQ  W+PI+LL+PLVLGLDK+NPRYIPLLK TF
Sbjct  284  GDEDGERGGAPVFCIDVAAQLCSNFNKGQCTWSPILLLIPLVLGLDKINPRYIPLLKETF  343

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
             FPQSLGILGG+PG STYI GVQ+D+A YLDPH+VQ  VD+  DNL+ DTSSYHC VVR 
Sbjct  344  KFPQSLGILGGKPGTSTYIAGVQEDRALYLDPHDVQMAVDIAPDNLEADTSSYHCSVVRD  403

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            L L+ IDPSLAIGFYC+DK DFDDFC+RASEL +++ GAPLFT+ ++   S  +  QD  
Sbjct  404  LALEQIDPSLAIGFYCRDKDDFDDFCSRASELAEKANGAPLFTVMQSVQPSKQMYKQD--  461

Query  346  GEASAEGFKSFDATSIGDSE-----NGKQEDDWQLL  254
                 +G      +S+ + +     +G+  ++WQ+L
Sbjct  462  -----DGLCCCSGSSMANEDYDLDASGEAGEEWQIL  492



>ref|NP_001137488.1| autophagy-related 4 [Zea mays]
 ref|XP_008668672.1| PREDICTED: cysteine protease ATG4B-like isoform X1 [Zea mays]
 ref|XP_008668673.1| PREDICTED: cysteine protease ATG4B-like isoform X1 [Zea mays]
 gb|ACG32144.1| cysteine protease ATG4B [Zea mays]
 gb|ACJ73912.1| autophagy-related 4 variant 1 [Zea mays]
 gb|ACL53549.1| unknown [Zea mays]
 tpg|DAA35300.1| TPA: autophagy 4a variant 2 isoform 1 [Zea mays]
 tpg|DAA35301.1| TPA: autophagy 4a variant 2 isoform 2 [Zea mays]
Length=492

 Score =   236 bits (601),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 156/211 (74%), Gaps = 5/211 (2%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CID  ++ C + +KG   W+PI+LLVPLVLGLDK+NPRYIPLLK TF
Sbjct  287  GDEDGERGGAPVVCIDVAAQLCSDFNKGPSTWSPILLLVPLVLGLDKINPRYIPLLKETF  346

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
             FPQSLGILGG+PG STYI GVQDD+A YLDPHEVQ  VD+  DNL+ DTSSYHC VVR 
Sbjct  347  MFPQSLGILGGKPGTSTYIAGVQDDRALYLDPHEVQMTVDIALDNLEADTSSYHCSVVRA  406

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            L L+ IDPSLAIGFYC+DK DFDDFC+RASEL +++ GAPLFT+ ++   S  +  QD  
Sbjct  407  LALEQIDPSLAIGFYCRDKDDFDDFCSRASELAEKANGAPLFTVVQSIEPSKQMYKQDDG  466

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
               S     + D     D +   + ++WQ+L
Sbjct  467  LGCSGSSMANDD-----DLDGSGEAEEWQIL  492



>ref|XP_006292861.1| hypothetical protein CARUB_v10019120mg [Capsella rubella]
 gb|EOA25759.1| hypothetical protein CARUB_v10019120mg [Capsella rubella]
Length=474

 Score =   235 bits (600),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 157/211 (74%), Gaps = 13/211 (6%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G EDGERGGAP LCI+D+++ C+E S  + +W P++LLVPLVLGLDKVNPRY+P L ATF
Sbjct  277  GSEDGERGGAPILCIEDVTKTCVEFSDRETEWTPVLLLVPLVLGLDKVNPRYLPSLIATF  336

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYIVGVQ+D+ FYLDPH+VQQVV + ++  D+DTSSYHC+  R 
Sbjct  337  TFPQSLGILGGKPGASTYIVGVQEDKGFYLDPHDVQQVVTVNKETRDVDTSSYHCNTPRY  396

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLA+GFYC DK+DFDDFC RA++L   S GAPLFT+T++   +         
Sbjct  397  VPLESLDPSLALGFYCPDKADFDDFCIRATKLAADSNGAPLFTVTQSHRTN---------  447

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
             +       +  +T I   E+   ED+WQLL
Sbjct  448  -DCGIAESSTLTSTEICGEEH---EDEWQLL  474



>ref|XP_009398483.1| PREDICTED: cysteine protease ATG4B-like [Musa acuminata subsp. 
malaccensis]
Length=492

 Score =   235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 157/214 (73%), Gaps = 3/214 (1%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGE+GGAP +C D ++R C   +     WAPI+LLVPLVLGL+++NPRYIPLL+ TF
Sbjct  279  GDEDGEQGGAPVVCTDVVARLCSSFNMALHAWAPILLLVPLVLGLERINPRYIPLLQETF  338

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            SFPQSLGILGG+PG STYIVGVQ+D+A YLDPHEVQQ VDL  D+ ++D  SYHC  VR 
Sbjct  339  SFPQSLGILGGKPGASTYIVGVQEDKALYLDPHEVQQAVDLKSDSSEVDYISYHCRTVRH  398

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +P D IDPSLAIGF+C+DK DF+DFC+RAS+L D+S GAPLFT+T+    S  V Y D  
Sbjct  399  VPFDLIDPSLAIGFHCRDKDDFEDFCSRASQLGDKSNGAPLFTVTQFPQPSKTVPYCDGD  458

Query  346  GEASAEGF---KSFDATSIGDSENGKQEDDWQLL  254
               ++       +FD  + GD +    ED+WQ+L
Sbjct  459  NVGNSRNCMMDNTFDVENFGDDDAQPGEDEWQIL  492



>gb|EEC78268.1| hypothetical protein OsI_17962 [Oryza sativa Indica Group]
Length=912

 Score =   240 bits (613),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 146/178 (82%), Gaps = 0/178 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CID  ++ C + +KGQ  W+PI+LLVPLVLGLDK+NPRYIPLLK TF
Sbjct  271  GDEDGERGGAPVVCIDVAAQLCCDFNKGQSTWSPILLLVPLVLGLDKINPRYIPLLKETF  330

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYI GVQDD+A YLDPHEVQ  VD+  DN++ DTSSYHC  VR 
Sbjct  331  TFPQSLGILGGKPGTSTYIAGVQDDRALYLDPHEVQMAVDIAADNIEADTSSYHCSTVRD  390

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQD  353
            L LD IDPSLAIGFYC+DK DFDDFC+RA+ELVD++ GAPLFT+ ++   S  +  QD
Sbjct  391  LALDLIDPSLAIGFYCRDKDDFDDFCSRATELVDKANGAPLFTVVQSVQPSKQMYNQD  448



>ref|XP_009382776.1| PREDICTED: cysteine protease ATG4B-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009382777.1| PREDICTED: cysteine protease ATG4B-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=487

 Score =   233 bits (594),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 152/211 (72%), Gaps = 2/211 (1%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGE+GGAP +CI+  ++     SKGQ++WAPI+LLVPLVLGL+K+NPRYIPLL  TF
Sbjct  279  GDEDGEQGGAPVVCIEVAAKLGSHFSKGQLEWAPILLLVPLVLGLEKINPRYIPLLWETF  338

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQS+GILGG+PG STYIVGVQDD+A YLDPHEVQ  VD+ RD+ + D +SYHC  VR 
Sbjct  339  TFPQSVGILGGKPGASTYIVGVQDDKALYLDPHEVQPAVDIRRDDSEADCTSYHCSTVRH  398

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            LP D IDPSLAIGFYC+DK DF+DFC+RAS+L D S GAPLFT+ +    + P+      
Sbjct  399  LPFDMIDPSLAIGFYCRDKGDFEDFCSRASQLADSSNGAPLFTVVQNLQPAKPIPCH--V  456

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
            G     G       +  D      ED+WQ+L
Sbjct  457  GTDHNRGIDDSSVENFSDIGGQVHEDEWQIL  487



>gb|EEE61922.1| hypothetical protein OsJ_16662 [Oryza sativa Japonica Group]
Length=892

 Score =   240 bits (612),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 146/178 (82%), Gaps = 0/178 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CID  ++ C + +KGQ  W+PI+LLVPLVLGLDK+NPRYIPLLK TF
Sbjct  271  GDEDGERGGAPVVCIDVAAQLCCDFNKGQSTWSPILLLVPLVLGLDKINPRYIPLLKETF  330

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYI GVQDD+A YLDPHEVQ  VD+  DN++ DTSSYHC  VR 
Sbjct  331  TFPQSLGILGGKPGTSTYIAGVQDDRALYLDPHEVQMAVDIAADNIEADTSSYHCSTVRD  390

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQD  353
            L LD IDPSLAIGFYC+DK DFDDFC+RA+ELVD++ GAPLFT+ ++   S  +  QD
Sbjct  391  LALDLIDPSLAIGFYCRDKDDFDDFCSRATELVDKANGAPLFTVVQSVQPSKQMYNQD  448



>ref|XP_009382778.1| PREDICTED: cysteine protease ATG4B-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=487

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 152/211 (72%), Gaps = 2/211 (1%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGE+GGAP +CI+  ++     SKGQ++WAPI+LLVPLVLGL+K+NPRYIPLL  TF
Sbjct  279  GDEDGEQGGAPVVCIEVAAKLGSHFSKGQLEWAPILLLVPLVLGLEKINPRYIPLLWETF  338

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQS+GILGG+PG STYIVGVQDD+A YLDPHEVQ  VD+ RD+ + D +SYHC  VR 
Sbjct  339  TFPQSVGILGGKPGASTYIVGVQDDKALYLDPHEVQPAVDIRRDDSEADCTSYHCSTVRH  398

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            LP D IDPSLAIGFYC+DK DF+DFC+RAS+L D S GAPLFT+ +    + P+      
Sbjct  399  LPFDMIDPSLAIGFYCRDKGDFEDFCSRASQLADSSNGAPLFTVVQNLQPAKPIPCH--V  456

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
            G     G       +  D      ED+WQ+L
Sbjct  457  GTDHNRGIDDSSVENFSDIGGQVHEDEWQIL  487



>gb|KJB46919.1| hypothetical protein B456_008G001300 [Gossypium raimondii]
Length=345

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 162/212 (76%), Gaps = 1/212 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CI+D SR C E S+ Q DW PI+LLVPLVLGLDKVNPRYIP L+ATF
Sbjct  134  GDEDGERGGAPVVCIEDASRHCFEFSRHQADWTPILLLVPLVLGLDKVNPRYIPSLQATF  193

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQ LGILGG+PG STYIVG+Q++  FYLDPH+VQ VV+L  +NL+ DTSSYHC+++R 
Sbjct  194  TFPQCLGILGGKPGASTYIVGIQEENVFYLDPHDVQPVVNLSTENLEADTSSYHCNIIRY  253

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLAIGF+C+DK DFDDFC RAS+L D+S GAPLFT+ +T +V  P+ + D  
Sbjct  254  IPLESLDPSLAIGFFCRDKDDFDDFCFRASKLADESNGAPLFTVAQTHSVFKPINHGDTM  313

Query  346  GEASAEGF-KSFDATSIGDSENGKQEDDWQLL  254
              A  +    S      GD +    EDDWQ L
Sbjct  314  ANAGGDRMDDSVRVLPTGDVDGNSHEDDWQFL  345



>ref|XP_003580841.1| PREDICTED: cysteine protease ATG4B-like [Brachypodium distachyon]
Length=493

 Score =   231 bits (588),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 126/211 (60%), Positives = 156/211 (74%), Gaps = 0/211 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CID  ++ C + +K Q  W+PI+LLVPLVLGLDK+NPRYIPLLK TF
Sbjct  283  GDEDGERGGAPVVCIDVAAQLCYDFNKDQSTWSPILLLVPLVLGLDKINPRYIPLLKETF  342

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYI G+QDD+A YLDPH+VQ  V++  DNLD DTSSYHC  VR 
Sbjct  343  TFPQSLGILGGKPGTSTYIAGIQDDRALYLDPHDVQMAVNIASDNLDADTSSYHCSTVRD  402

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            + LD +DPSLAIGFYC+DK DFDDFC+RASELV ++ GAPLFT+ ++   S  +  QD  
Sbjct  403  MALDLLDPSLAIGFYCRDKDDFDDFCSRASELVVKANGAPLFTVVQSIQPSKQMYNQDDG  462

Query  346  GEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
              +S +G          D      E++WQ+L
Sbjct  463  SGSSGDGMADNINMEDLDGSGEAGEEEWQIL  493



>ref|XP_001758116.1| predicted protein [Physcomitrella patens]
 gb|EDQ76938.1| predicted protein, partial [Physcomitrella patens]
Length=356

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 140/166 (84%), Gaps = 0/166 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G+ +GERGGAP LC++D++  C +  +   +W P+++LVPLVLGLDKVNPRY+P L+ATF
Sbjct  191  GEAEGERGGAPVLCVEDVATLCSKWREPTEEWTPLLVLVPLVLGLDKVNPRYLPSLRATF  250

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGI GG+PG STY++GVQD+QA YLDPHE QQVV +  +NL++DTSSYHC  VR+
Sbjct  251  TFPQSLGIAGGKPGASTYLIGVQDEQAMYLDPHENQQVVPVTPENLELDTSSYHCSTVRR  310

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITE  389
            LPLD+IDPSLAIGFYC+D+++FDD CAR+SEL  QS GAP+FT+ E
Sbjct  311  LPLDTIDPSLAIGFYCRDRAEFDDLCARSSELAKQSNGAPMFTVAE  356



>gb|KJB46915.1| hypothetical protein B456_008G001300 [Gossypium raimondii]
 gb|KJB46916.1| hypothetical protein B456_008G001300 [Gossypium raimondii]
 gb|KJB46921.1| hypothetical protein B456_008G001300 [Gossypium raimondii]
Length=488

 Score =   229 bits (583),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 162/212 (76%), Gaps = 1/212 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CI+D SR C E S+ Q DW PI+LLVPLVLGLDKVNPRYIP L+ATF
Sbjct  277  GDEDGERGGAPVVCIEDASRHCFEFSRHQADWTPILLLVPLVLGLDKVNPRYIPSLQATF  336

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQ LGILGG+PG STYIVG+Q++  FYLDPH+VQ VV+L  +NL+ DTSSYHC+++R 
Sbjct  337  TFPQCLGILGGKPGASTYIVGIQEENVFYLDPHDVQPVVNLSTENLEADTSSYHCNIIRY  396

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQ  347
            +PL+S+DPSLAIGF+C+DK DFDDFC RAS+L D+S GAPLFT+ +T +V  P+ + D  
Sbjct  397  IPLESLDPSLAIGFFCRDKDDFDDFCFRASKLADESNGAPLFTVAQTHSVFKPINHGDTM  456

Query  346  GEASAEGF-KSFDATSIGDSENGKQEDDWQLL  254
              A  +    S      GD +    EDDWQ L
Sbjct  457  ANAGGDRMDDSVRVLPTGDVDGNSHEDDWQFL  488



>gb|AAR87272.1| putative autophagy protein (with alternative splicing) [Oryza 
sativa Japonica Group]
 gb|ABF96367.1| Peptidase family C54 containing protein, expressed [Oryza sativa 
Japonica Group]
Length=505

 Score =   224 bits (571),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 159/243 (65%), Gaps = 37/243 (15%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CID  ++ C + +K Q  W+PI+LLVPLVLGLDK+NPRYIPLLK T 
Sbjct  268  GDEDGERGGAPVVCIDVAAQLCCDFNKNQSTWSPILLLVPLVLGLDKLNPRYIPLLKETL  327

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYI GVQDD+A YLDPHEVQ  VD+  DNL+  TSSYHC  VR 
Sbjct  328  TFPQSLGILGGKPGTSTYIAGVQDDRALYLDPHEVQLAVDIAADNLEAGTSSYHCSTVRD  387

Query  526  LPLDSIDPSLAIGFYCKDKS-------------------------------DFDDFCARA  440
            L LD IDPSLAIGFYC+DK                                DFDDFC+RA
Sbjct  388  LALDLIDPSLAIGFYCRDKGELLLPDKMLGHHLSSLQSWFSYLLCLSAYVDDFDDFCSRA  447

Query  439  SELVDQSGGAPLFTITETRNVSMPVQYQDMQGEASAEGFKSFDATSI-GDSENGKQEDDW  263
            SELVD++ GAPLFT+ ++     P +    +  +S +G  S +   + G  E G  E++W
Sbjct  448  SELVDKANGAPLFTVVQSVQ---PSKQMYNEESSSGDGMDSINVEGLDGSGETG--EEEW  502

Query  262  QLL  254
            Q+L
Sbjct  503  QIL  505



>ref|XP_001770869.1| predicted protein [Physcomitrella patens]
 gb|EDQ64393.1| predicted protein, partial [Physcomitrella patens]
Length=346

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 136/166 (82%), Gaps = 0/166 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            G+ +G+RGGAP  C++D +  C +  +   +W+P+++LVPLVLGLDK+NPRY+P L+ATF
Sbjct  175  GETEGDRGGAPVRCVEDAAVLCSKWGEATEEWSPLVVLVPLVLGLDKLNPRYLPSLRATF  234

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            + PQSLG+ GG+PG ST+++GVQ DQA YLDPHE QQV  +  +NL++DTS YHC VVR+
Sbjct  235  TLPQSLGVAGGKPGASTHLIGVQGDQAMYLDPHENQQVFAVTPENLELDTSFYHCSVVRR  294

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITE  389
            LPLDSIDPSLAIGFYC+D+++FDD CAR+SELV Q  GAP+FT+ E
Sbjct  295  LPLDSIDPSLAIGFYCRDRAEFDDLCARSSELVKQYNGAPIFTVAE  340



>emb|CAJ86292.1| H0124B04.9 [Oryza sativa Indica Group]
Length=1216

 Score =   226 bits (575),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 147/211 (70%), Gaps = 33/211 (16%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CID  ++ C + +KGQ  W+PI+LLVPLVLGLDK+NPRYIPLLK TF
Sbjct  542  GDEDGERGGAPVVCIDVAAQLCCDFNKGQSTWSPILLLVPLVLGLDKINPRYIPLLKETF  601

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQ------------------------  599
            +FPQSLGILGG+PG STYI GVQDD+A YLDPHEVQ                        
Sbjct  602  TFPQSLGILGGKPGTSTYIAGVQDDRALYLDPHEVQMSATVIIWLFLQYPFYAWNPFCYG  661

Query  598  ---------QVVDLGRDNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCA  446
                     Q VD+  DN++ DTSSYHC  VR L LD IDPSLAIGFYC+DK DFDDFC+
Sbjct  662  SYSGVFSTSQAVDIAADNIEADTSSYHCSTVRDLALDLIDPSLAIGFYCRDKDDFDDFCS  721

Query  445  RASELVDQSGGAPLFTITETRNVSMPVQYQD  353
            RA+ELVD++ GAPLFT+ ++   S  +  QD
Sbjct  722  RATELVDKANGAPLFTVVQSVQPSKQMYNQD  752



>ref|XP_007049915.1| Peptidase family C54 protein isoform 1 [Theobroma cacao]
 gb|EOX94072.1| Peptidase family C54 protein isoform 1 [Theobroma cacao]
Length=514

 Score =   216 bits (550),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 131/243 (54%), Positives = 163/243 (67%), Gaps = 36/243 (15%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNP----------  737
            GDEDGERGGAP +C++D SR C E S+ + DW PI+LLVPLVLGLDKVN           
Sbjct  276  GDEDGERGGAPVVCVEDASRHCFEFSRCRADWTPILLLVPLVLGLDKVNSSFCKEDSTFE  335

Query  736  ------------RYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQV  593
                         YIP L+ATF+FPQ LGILGG+PG STYIVGVQ++  FYLDPH+VQ V
Sbjct  336  TEGELHLDFAYLEYIPSLQATFTFPQCLGILGGKPGASTYIVGVQEENVFYLDPHDVQLV  395

Query  592  VDLGRDNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDK-------SDFDDFCARASE  434
            V+L +DN + DTSSYHCD++R +PLDSIDPSLAIGF+C+DK        DFDDFC RAS+
Sbjct  396  VNLSQDNQEADTSSYHCDIIRHIPLDSIDPSLAIGFFCRDKGLPVDLVDDFDDFCLRASK  455

Query  433  LVDQSGGAPLFTITETRNVSMPVQYQDMQGEASAEGFKSFDATSIG---DSENGKQEDDW  263
            L D+S GAPLFT+ +T +   P+ +    G A  +  +  +  S+G   D +    EDDW
Sbjct  456  LADESNGAPLFTVAQTHSSFKPISH----GNALDDTGEVREDDSLGVVPDMDGSIHEDDW  511

Query  262  QLL  254
            QLL
Sbjct  512  QLL  514



>ref|XP_002973701.1| hypothetical protein SELMODRAFT_54035, partial [Selaginella moellendorffii]
 gb|EFJ25361.1| hypothetical protein SELMODRAFT_54035, partial [Selaginella moellendorffii]
Length=358

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 127/166 (77%), Gaps = 11/166 (7%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GD  GERGGAP L   D++ +C  L           +LVPLVLGLDK+NPRY+P L+ATF
Sbjct  204  GDAHGERGGAPVLYNVDVAGKCPVL-----------ILVPLVLGLDKINPRYLPSLRATF  252

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQS+GI GG+P  S Y VGVQDDQA YLDPHEVQ+VV +  ++L+ D++SYHC VVR+
Sbjct  253  AFPQSVGIAGGKPAASVYFVGVQDDQALYLDPHEVQKVVSVSGESLEFDSASYHCSVVRK  312

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITE  389
            +PLD+IDPSLA+GFYC+++ + DD CARASEL  QS GAP+FT+ E
Sbjct  313  MPLDAIDPSLALGFYCRNREELDDLCARASELASQSNGAPMFTVAE  358



>gb|KJB46917.1| hypothetical protein B456_008G001300 [Gossypium raimondii]
Length=433

 Score =   202 bits (515),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CI+D SR C E S+ Q DW PI+LLVPLVLGLDKVNPRYIP L+ATF
Sbjct  277  GDEDGERGGAPVVCIEDASRHCFEFSRHQADWTPILLLVPLVLGLDKVNPRYIPSLQATF  336

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQ LGILGG+PG STYIVG+Q++  FYLDPH+VQ VV+L  +NL+ DTSSYHC+++R 
Sbjct  337  TFPQCLGILGGKPGASTYIVGIQEENVFYLDPHDVQPVVNLSTENLEADTSSYHCNIIRY  396

Query  526  LPLDSIDPSLAIGFYCKDK  470
            +PL+S+DPSLAIGF+C+DK
Sbjct  397  IPLESLDPSLAIGFFCRDK  415



>gb|KJB46920.1| hypothetical protein B456_008G001300 [Gossypium raimondii]
Length=429

 Score =   202 bits (515),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CI+D SR C E S+ Q DW PI+LLVPLVLGLDKVNPRYIP L+ATF
Sbjct  277  GDEDGERGGAPVVCIEDASRHCFEFSRHQADWTPILLLVPLVLGLDKVNPRYIPSLQATF  336

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQ LGILGG+PG STYIVG+Q++  FYLDPH+VQ VV+L  +NL+ DTSSYHC+++R 
Sbjct  337  TFPQCLGILGGKPGASTYIVGIQEENVFYLDPHDVQPVVNLSTENLEADTSSYHCNIIRY  396

Query  526  LPLDSIDPSLAIGFYCKDK  470
            +PL+S+DPSLAIGF+C+DK
Sbjct  397  IPLESLDPSLAIGFFCRDK  415



>ref|XP_002975752.1| hypothetical protein SELMODRAFT_54753, partial [Selaginella moellendorffii]
 gb|EFJ23381.1| hypothetical protein SELMODRAFT_54753, partial [Selaginella moellendorffii]
Length=358

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 126/166 (76%), Gaps = 11/166 (7%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GD  GERGGAP L   D++ +C  L           +LVPLVLGLDK+NPRY+P L+ATF
Sbjct  204  GDAHGERGGAPVLYNVDVAGKCPVL-----------ILVPLVLGLDKINPRYLPSLRATF  252

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQS+GI GG+P  S Y VGVQDDQA YLDPHEVQ+VV +  ++L+ D++SYHC VVR+
Sbjct  253  AFPQSVGIAGGKPAASVYFVGVQDDQALYLDPHEVQKVVSVSGESLEFDSASYHCSVVRK  312

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITE  389
            + LD+IDPSLA+GFYC+++ D DD CARASEL  QS GAP+FT+ E
Sbjct  313  MLLDAIDPSLALGFYCRNREDLDDLCARASELASQSNGAPMFTVAE  358



>gb|KDO40318.1| hypothetical protein CISIN_1g011418mg [Citrus sinensis]
Length=379

 Score =   199 bits (505),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CIDD SR C   SKGQ DW PI+LLVPLVLGL+KVNPRYIP L+ TF
Sbjct  234  GDEDGERGGAPVVCIDDASRHCSVFSKGQADWTPILLLVPLVLGLEKVNPRYIPTLRLTF  293

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGI+GG+PG STYIVGVQ++ A YLDPH+VQ V+++G+D+L+ DTS+YH DV+R 
Sbjct  294  TFPQSLGIVGGKPGASTYIVGVQEESAIYLDPHDVQPVINIGKDDLEADTSTYHSDVIRH  353

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDF  452
            + LDSIDPSLAIGFYC+DK     F
Sbjct  354  IHLDSIDPSLAIGFYCRDKGLLVTF  378



>gb|ACJ73913.1| autophagy-related 4a variant 2 [Zea mays]
Length=429

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CID  ++ C + +KG   W+PI+LLVPLVLGLDK+NPRYIPLLK TF
Sbjct  287  GDEDGERGGAPVVCIDVAAQLCSDFNKGPSTWSPILLLVPLVLGLDKINPRYIPLLKETF  346

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
             FPQSLGILGG+PG STYI GVQDD+A YLDPHEVQ  VD+  DNL+ DTSSYHC VVR 
Sbjct  347  MFPQSLGILGGKPGTSTYIAGVQDDRALYLDPHEVQMTVDIALDNLEADTSSYHCSVVRA  406

Query  526  LPLDSIDPSLAIGFYCKDKSD  464
            L L+ IDPSLAIGFYC+DK +
Sbjct  407  LALEQIDPSLAIGFYCRDKGE  427



>gb|EMS55294.1| hypothetical protein TRIUR3_04442 [Triticum urartu]
Length=511

 Score =   195 bits (495),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CID  ++ C + +K Q  W+PI+LLVPLVLGLDK+NPRYIPLLK TF
Sbjct  276  GDEDGERGGAPVVCIDVAAQLCYDFNKDQSAWSPILLLVPLVLGLDKINPRYIPLLKETF  335

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQSLGILGG+PG STYI GVQDD+A YLDPHEVQ  V++  DNL+ DTSSYHC  VR 
Sbjct  336  TFPQSLGILGGKPGASTYIAGVQDDRALYLDPHEVQLAVNIASDNLEADTSSYHCSTVRD  395

Query  526  LPLDSIDPSLAIGFYCKDK  470
            +PLD IDPSLAIGFYC+DK
Sbjct  396  MPLDLIDPSLAIGFYCRDK  414



>gb|ADT92194.1| autophagy-related 4b [Zea mays]
Length=595

 Score =   196 bits (497),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 116/141 (82%), Gaps = 0/141 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP  CID  ++ C   +KGQ  W+PI+LL+PLVLGLDK+NPRYIPLLK TF
Sbjct  284  GDEDGERGGAPVFCIDVAAQLCSNFNKGQCTWSPILLLIPLVLGLDKINPRYIPLLKETF  343

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
             FPQSLGILGG+PG STYI GVQ+D+A YLDPH+VQ  VD+  DNL+ DTSSYHC VVR 
Sbjct  344  KFPQSLGILGGKPGTSTYIAGVQEDRALYLDPHDVQMAVDIAPDNLEADTSSYHCSVVRD  403

Query  526  LPLDSIDPSLAIGFYCKDKSD  464
            L L+ IDPSLAIGFYC+DK D
Sbjct  404  LALEQIDPSLAIGFYCRDKGD  424



>ref|XP_008661518.1| PREDICTED: autophagy-related 4b isoform X2 [Zea mays]
Length=466

 Score =   190 bits (483),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 121/170 (71%), Gaps = 12/170 (7%)
 Frame = -3

Query  748  KVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNL  569
            +V  RYIPLLK TF FPQSLGILGG+PG STYI GVQ+D+A YLDPH+VQ  VD+  DNL
Sbjct  304  RVILRYIPLLKETFKFPQSLGILGGKPGTSTYIAGVQEDRALYLDPHDVQMAVDIAPDNL  363

Query  568  DIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITE  389
            + DTSSYHC VVR L L+ IDPSLAIGFYC+DK DFDDFC+RASEL +++ GAPLFT+ +
Sbjct  364  EADTSSYHCSVVRDLALEQIDPSLAIGFYCRDKDDFDDFCSRASELAEKANGAPLFTVMQ  423

Query  388  TRNVSMPVQYQDMQGEASAEGFKSFDATSIGDSE-----NGKQEDDWQLL  254
            +   S  +  QD       +G      +S+ + +     +G+  ++WQ+L
Sbjct  424  SVQPSKQMYKQD-------DGLCCCSGSSMANEDYDLDASGEAGEEWQIL  466



>ref|XP_009382779.1| PREDICTED: cysteine protease ATG4B-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=418

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGE+GGAP +CI+  ++     SKGQ++WAPI+LLVPLVLGL+K+NPRYIPLL  TF
Sbjct  279  GDEDGEQGGAPVVCIEVAAKLGSHFSKGQLEWAPILLLVPLVLGLEKINPRYIPLLWETF  338

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            +FPQS+GILGG+PG STYIVGVQDD+A YLDPHEVQ  VD+ RD+ + D +SYHC  VR 
Sbjct  339  TFPQSVGILGGKPGASTYIVGVQDDKALYLDPHEVQPAVDIRRDDSEADCTSYHCSTVRH  398

Query  526  LPLDSIDPSLAIGFYCKDK  470
            LP D IDPSLAIGFYC+DK
Sbjct  399  LPFDMIDPSLAIGFYCRDK  417



>gb|KJB46918.1| hypothetical protein B456_008G001300 [Gossypium raimondii]
Length=392

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 98/115 (85%), Gaps = 0/115 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CI+D SR C E S+ Q DW PI+LLVPLVLGLDKVNPRYIP L+ATF
Sbjct  277  GDEDGERGGAPVVCIEDASRHCFEFSRHQADWTPILLLVPLVLGLDKVNPRYIPSLQATF  336

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHC  542
            +FPQ LGILGG+PG STYIVG+Q++  FYLDPH+VQ VV+L  +NL+ DTSSYHC
Sbjct  337  TFPQCLGILGGKPGASTYIVGIQEENVFYLDPHDVQPVVNLSTENLEADTSSYHC  391



>gb|KDO40319.1| hypothetical protein CISIN_1g011418mg [Citrus sinensis]
Length=392

 Score =   159 bits (403),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CIDD SR C   SKGQ DW PI+LLVPLVLGL+KVNPRYIP L+ TF
Sbjct  277  GDEDGERGGAPVVCIDDASRHCSVFSKGQADWTPILLLVPLVLGLEKVNPRYIPTLRLTF  336

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCD  539
            +FPQSLGI+GG+PG STYIVGVQ++ A YLDPH+VQ V+++G+D+L+ DTS+YH +
Sbjct  337  TFPQSLGIVGGKPGASTYIVGVQEESAIYLDPHDVQPVINIGKDDLEADTSTYHSE  392



>ref|XP_010527566.1| PREDICTED: cysteine protease ATG4a-like [Tarenaya hassleriana]
Length=284

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 92/142 (65%), Gaps = 25/142 (18%)
 Frame = -3

Query  730  IPLLKATFSF-----PQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLD  566
            + LLK T  +     PQSLGILGG+PG STYIVGVQD + FYLDPHE  QVV + ++  D
Sbjct  50   VALLKFTSQYAQAQIPQSLGILGGKPGASTYIVGVQDGKGFYLDPHEDHQVVLVSKETPD  109

Query  565  IDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKS--------------------DFDDFCA  446
            +DTSSYHC+++R LPL+S+DPSLA+GFYC+DK                     D D+ C 
Sbjct  110  VDTSSYHCNLLRYLPLESLDPSLALGFYCQDKGSILLKQCRFLVLSSNLPSTDDLDNLCL  169

Query  445  RASELVDQSGGAPLFTITETRN  380
             ASEL   S GAPL T+ +TR+
Sbjct  170  GASELAMGSNGAPLLTVIQTRD  191



>ref|XP_010934835.1| PREDICTED: cysteine protease ATG4B-like isoform X3 [Elaeis guineensis]
 ref|XP_010934836.1| PREDICTED: cysteine protease ATG4B-like isoform X3 [Elaeis guineensis]
Length=396

 Score =   138 bits (347),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 85/96 (89%), Gaps = 0/96 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP +CID  +R C + +KGQ+ WAP++LLVPLVLGL+KVNPRYIPLL  TF
Sbjct  278  GDEDGERGGAPVVCIDVAARLCSDFTKGQISWAPMLLLVPLVLGLEKVNPRYIPLLWETF  337

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQ  599
            +FPQSLGILGG+PG STYIVGVQDD+A YLDPH+VQ
Sbjct  338  TFPQSLGILGGKPGASTYIVGVQDDKALYLDPHDVQ  373



>gb|KFH70732.1| hypothetical protein MVEG_03580 [Mortierella verticillata NRRL 
6337]
Length=650

 Score =   132 bits (333),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 86/126 (68%), Gaps = 3/126 (2%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            G+DK+NP Y   +K TF FPQSLGI GGRP  S Y VG Q D  FYLDPH  + VV+   
Sbjct  498  GIDKLNPIYNDAIKTTFEFPQSLGIAGGRPSSSYYFVGYQGDDLFYLDPHHSRCVVETKE  557

Query  577  --DNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSG-GAP  407
              + +  D ++YHC+VVR++ ++SIDPS+ + FYC+D+SDFD FC R  E+  + G G+ 
Sbjct  558  LSEYVAEDFATYHCEVVRKIDINSIDPSMLLAFYCRDRSDFDSFCERVKEMNTRPGMGSS  617

Query  406  LFTITE  389
            +FTI E
Sbjct  618  IFTIGE  623



>ref|XP_005651667.1| peptidase C54 [Coccomyxa subellipsoidea C-169]
 gb|EIE27123.1| peptidase C54 [Coccomyxa subellipsoidea C-169]
Length=362

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 95/167 (57%), Gaps = 13/167 (8%)
 Frame = -3

Query  748  KVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNL  569
            K+NPRY   L+   ++PQS+GI+GGRP  S Y +G+QD    YLDPHEVQ+V     +  
Sbjct  207  KINPRYCAQLQQLLTWPQSVGIVGGRPSSSLYFIGLQDQHVLYLDPHEVQEVAS---EAA  263

Query  568  DIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTIT-  392
            D+DT  Y C  +R +PL +IDPSLAIGFYC   SDF+D C R   L  ++G APL  +  
Sbjct  264  DLDT--YFCSSLRLMPLANIDPSLAIGFYCSSLSDFEDLCGRLRTLEAEAGCAPLVCMVD  321

Query  391  -ETRNVSMPVQYQDMQGEASAEGFKSFDATSIGDSENGKQEDDWQLL  254
             +    S P +        S EG  S DA S      G   D+W++L
Sbjct  322  EDAGEPSWPAEE-----VLSDEGIPS-DADSPAPPAGGANRDNWEML  362



>gb|AFW57899.1| hypothetical protein ZEAMMB73_419246 [Zea mays]
Length=290

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP + ID  ++ C + +KG   W+PI+LLVPLVLGLDK+NPRYIPLLK TF
Sbjct  127  GDEDGERGGAPVVYIDVAAQLCSDFNKGPSTWSPILLLVPLVLGLDKINPRYIPLLKETF  186

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQ  596
             FPQSLGILGG+PG STYI GVQDD+A YLDPHEVQ 
Sbjct  187  MFPQSLGILGGKPGTSTYIAGVQDDRALYLDPHEVQM  223



>gb|AFW74617.1| hypothetical protein ZEAMMB73_836919 [Zea mays]
Length=416

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 82/99 (83%), Gaps = 0/99 (0%)
 Frame = -3

Query  886  GDEDGERGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            GDEDGERGGAP + ID  ++ C + +KG   W+PI+LLVPLVLGLDK+NPRYIPLLK TF
Sbjct  120  GDEDGERGGAPVVYIDVAAQLCSDFNKGPSTWSPILLLVPLVLGLDKINPRYIPLLKETF  179

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVV  590
             FPQSLGILG +PG STYI GVQDD+A YLDPHEVQ V+
Sbjct  180  MFPQSLGILGVKPGTSTYIAGVQDDRALYLDPHEVQMVL  218



>ref|XP_011396113.1| Cysteine protease ATG4a [Auxenochlorella protothecoides]
 gb|KFM23243.1| Cysteine protease ATG4a [Auxenochlorella protothecoides]
Length=491

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 76/125 (61%), Gaps = 5/125 (4%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            GL K+NPRYIP L+A  + PQS+GI+GGRPG S Y VG Q D   YLDPHEVQ+      
Sbjct  266  GLGKLNPRYIPQLQAVLTMPQSIGIVGGRPGSSLYFVGTQQDLLLYLDPHEVQEAA----  321

Query  577  DNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFT  398
               D    SY    +R LP  ++DPSLA+GFY   K ++   C+   +L  +SGGAPL  
Sbjct  322  -TGDEHWRSYCGTTLRTLPFTAMDPSLALGFYVGSKEEYLGLCSALEQLESRSGGAPLVC  380

Query  397  ITETR  383
            +T  R
Sbjct  381  VTRAR  385



>ref|XP_004341221.1| cysteine protease, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR19150.1| cysteine protease, putative [Acanthamoeba castellanii str. Neff]
Length=434

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 93/141 (66%), Gaps = 10/141 (7%)
 Frame = -3

Query  793  WApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLD  614
            WAP+++++PL LGLD++N  Y P+LK TF  PQS+GI GG+P  S Y VG QDD  FYLD
Sbjct  269  WAPMLIMLPLRLGLDQLNEDYAPVLKETFRIPQSVGISGGKPRASLYFVGNQDDYVFYLD  328

Query  613  PHEVQ------QVVDLGRDNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDF  452
            PH VQ      +V D+       DT  +HC    +LP+  IDPSL + FYC+++ DFDDF
Sbjct  329  PHTVQPAPRFPEVGDVPASEDVYDT--FHCSAPLRLPIRDIDPSLCLAFYCRNREDFDDF  386

Query  451  CARASELVDQSGGAPLFTITE  389
            CARA +L +  G  P+FT+ E
Sbjct  387  CARAIQLSE--GPMPIFTVAE  405



>ref|XP_001691049.1| autophagy protein [Chlamydomonas reinhardtii]
 gb|EDP05495.1| autophagy protein [Chlamydomonas reinhardtii]
Length=484

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 73/122 (60%), Gaps = 11/122 (9%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            G+DK+NP YIP L+   S+PQS+GI+GGRP  S Y+ GVQD    YLDPHE Q       
Sbjct  339  GMDKINPVYIPQLQQVLSWPQSVGIVGGRPSASLYVCGVQDASFIYLDPHEAQ-------  391

Query  577  DNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFT  398
                +   +Y CDVVR LP   +DPSLAIGF C   ++ +D  AR   L  Q   APL T
Sbjct  392  ----LALGTYFCDVVRVLPSAQLDPSLAIGFVCTSSAELEDLFARLQALATQHSSAPLMT  447

Query  397  IT  392
            +T
Sbjct  448  LT  449



>ref|XP_009293968.1| PREDICTED: cysteine protease ATG4A isoform X1 [Danio rerio]
Length=206

 Score =   112 bits (279),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 101/182 (55%), Gaps = 7/182 (4%)
 Frame = -3

Query  853  ALCIDDISRRC----LELSKGQ-VDWApiillvplvLGLDKVNPRYIPLLKATFSFPQSL  689
             + I+DI + C    L+L   Q +DW P++L++PL +G++ +NP YI  LK  F  PQS 
Sbjct  4    TVVIEDIKKLCVRADLQLQSQQPLDWRPLLLVIPLRMGINSINPVYIQALKECFKMPQSC  63

Query  688  GILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCD-VVRQLPLDS  512
            G+LGG+P ++ Y +G  DD+  YLDPH  QQ VD    +  +D  S+HC     ++ + S
Sbjct  64   GVLGGKPNLAYYFIGFIDDELIYLDPHTTQQAVDTESGSA-VDDQSFHCQRTPHRMKITS  122

Query  511  IDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQGEASA  332
            +DPS+A+GF+CK + DFD +C    + + +     +F + E      P      + E   
Sbjct  123  LDPSVALGFFCKSEEDFDSWCDLVQQELLKKRNLRMFELVEKHPSHWPPFVPPTKPEVQT  182

Query  331  EG  326
             G
Sbjct  183  TG  184



>gb|ESA02267.1| hypothetical protein GLOINDRAFT_337503 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX64545.1| Atg4p [Rhizophagus irregularis DAOM 197198w]
Length=526

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 80/129 (62%), Gaps = 4/129 (3%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLG-  581
            G D +NP+Y   LKA F FP S+GI GG+P  S Y +G Q D  FYLDPH  +  ++L  
Sbjct  366  GTDNLNPKYYDALKAYFRFPHSVGIAGGKPSSSYYFIGTQGDDLFYLDPHHSRPALELKA  425

Query  580  -RDNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPL  404
             ++  + + +++HCD +R++P+  +DPS+ +GFYC++  +F++FC    E+       P+
Sbjct  426  IQEFTEEEMATFHCDTLRKIPISQLDPSMLLGFYCQNSEEFENFCNLVEEI--SKDHMPV  483

Query  403  FTITETRNV  377
            FTI +   V
Sbjct  484  FTIEQEEPV  492



>ref|XP_006679571.1| hypothetical protein BATDEDRAFT_35298 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF79772.1| hypothetical protein BATDEDRAFT_35298 [Batrachochytrium dendrobatidis 
JAM81]
Length=441

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 76/126 (60%), Gaps = 6/126 (5%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            G++ +NP Y P +K  F+    +GI GGRP  S + +GV  D   YLDPH ++  VD  R
Sbjct  302  GVETMNPVYYPGVKHCFAMSHCVGIAGGRPNSSLFFLGVDGDHLIYLDPHHLRPSVD-SR  360

Query  577  DNLDI---DTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAP  407
            D       D  SYHC+ VR LP+ S+DPSL IGFYC    DFD  CA+ +EL   +G AP
Sbjct  361  DITSYKMEDLLSYHCEKVRLLPIASMDPSLVIGFYCHSLKDFDVLCAKMTELA--TGSAP  418

Query  406  LFTITE  389
            LF+I E
Sbjct  419  LFSIEE  424



>ref|XP_004333021.1| cysteine protease atg4a, putative, partial [Acanthamoeba castellanii 
str. Neff]
 gb|ELR11008.1| cysteine protease atg4a, putative, partial [Acanthamoeba castellanii 
str. Neff]
Length=180

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 81/121 (67%), Gaps = 1/121 (1%)
 Frame = -3

Query  802  QVDWApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAF  623
            ++ W P+I+LVP+ LG+  +NP YIP LKA FSFPQ LG++GG+P  S Y VG QD++  
Sbjct  8    ELTWHPVIILVPVRLGIQCLNPIYIPTLKAFFSFPQCLGVIGGKPHSSFYFVGYQDNKVL  67

Query  622  YLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCAR  443
            Y+DPH VQ  V +  D L     SY  ++ + +  D IDPSLA+GF C  +++FDDFC  
Sbjct  68   YMDPHFVQPTVKMDDDPL-FPIESYRMEIPQAMSFDDIDPSLALGFLCSSQAEFDDFCLN  126

Query  442  A  440
            A
Sbjct  127  A  127



>gb|EXX76432.1| Atg4p [Rhizophagus irregularis DAOM 197198w]
Length=920

 Score =   117 bits (292),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 84/136 (62%), Gaps = 4/136 (3%)
 Frame = -3

Query  802  QVDWApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAF  623
            Q  W P+++L+ + LG DK+NP Y   LKA F+FPQ LGI GGRPG S Y V VQDD   
Sbjct  685  QKPWKPVLILLSVRLGTDKLNPSYSDNLKALFTFPQFLGIAGGRPGRSLYFVAVQDDDLL  744

Query  622  YLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCAR  443
            YLDPH V+  ++L +   +     YH  +VR + +  +DPS+ +GF C+   DFD+FC R
Sbjct  745  YLDPHFVRPAINLSK-TPEFPIEDYHSTIVRMMDISEMDPSMLLGFLCQSSQDFDNFCIR  803

Query  442  ASELVDQSGGAPLFTI  395
              +L  Q    PLFTI
Sbjct  804  IEKLNSQ---FPLFTI  816



>ref|NP_001019605.1| cysteine protease ATG4A [Danio rerio]
 gb|AAH95617.1| Zgc:111958 [Danio rerio]
Length=375

 Score =   112 bits (280),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 62/168 (37%), Positives = 98/168 (58%), Gaps = 7/168 (4%)
 Frame = -3

Query  853  ALCIDDISRRC----LELSKGQ-VDWApiillvplvLGLDKVNPRYIPLLKATFSFPQSL  689
             + I+DI + C    L+L   Q +DW P++L++PL +G++ +NP YI  LK  F  PQS 
Sbjct  173  TVVIEDIKKLCVRADLQLQSQQPLDWRPLLLVIPLRMGINSINPVYIQALKECFKMPQSC  232

Query  688  GILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVV-RQLPLDS  512
            G+LGG+P ++ Y +G  DD+  YLDPH  QQ VD    +  +D  S+HC     ++ + S
Sbjct  233  GVLGGKPNLAYYFIGFIDDELIYLDPHTTQQAVDTESGSA-VDDQSFHCQRTPHRMKITS  291

Query  511  IDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMP  368
            +DPS+A+GF+CK + DFD +C    + + +     +F + E      P
Sbjct  292  LDPSVALGFFCKSEEDFDSWCDLVQQELLKKRNLRMFELVEKHPSHWP  339



>gb|ERZ94855.1| hypothetical protein GLOINDRAFT_315488 [Rhizophagus irregularis 
DAOM 181602]
Length=249

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 78/124 (63%), Gaps = 1/124 (1%)
 Frame = -3

Query  802  QVDWApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAF  623
            Q  W P+++L+ + LG DK+NP Y   LKA F+FPQ LGI GGRPG S Y V VQDD   
Sbjct  79   QKPWKPVLILLSVRLGTDKLNPSYSDNLKALFTFPQFLGIAGGRPGRSLYFVAVQDDDLL  138

Query  622  YLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCAR  443
            YLDPH V+  ++L +   +     YH  +VR + +  +DPS+ +GF C+   DFD+FC R
Sbjct  139  YLDPHFVRPAINLSKTP-EFPIEDYHSTIVRMMDISEMDPSMLLGFLCQSSQDFDNFCIR  197

Query  442  ASEL  431
              ++
Sbjct  198  IEKV  201



>ref|XP_003292315.1| hypothetical protein DICPUDRAFT_99299 [Dictyostelium purpureum]
 gb|EGC31168.1| hypothetical protein DICPUDRAFT_99299 [Dictyostelium purpureum]
Length=465

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 86/135 (64%), Gaps = 7/135 (5%)
 Frame = -3

Query  793  WApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLD  614
            W  +I+++PL LG+D++N  YI  LK+  S PQSLG +GG+P  S Y +G QDDQ  YLD
Sbjct  217  WKSLIIMIPLKLGVDRINTSYIRKLKSILSIPQSLGFIGGKPKQSFYFIGFQDDQVIYLD  276

Query  613  PHEVQQVVDLGRDNLDIDTSSYHCDVVRQ-LPLDSIDPSLAIGFYCKDKSDFDDFCARAS  437
            PH VQ  VD   +N     S   C  + Q +   +IDPSL++GFYCKDKS FDD C R S
Sbjct  277  PHFVQDTVDPSSNNY----SETFCGCIPQKMSFSNIDPSLSVGFYCKDKSSFDDLCDRLS  332

Query  436  ELVDQSGGAPLFTIT  392
            +L  ++   P+ +I+
Sbjct  333  KL--ENDEFPIISIS  345



>ref|XP_002168183.2| PREDICTED: cysteine protease ATG4B-like [Hydra vulgaris]
Length=436

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 76/130 (58%), Gaps = 1/130 (1%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            GL ++N  Y   LK  F+  QSLG++GG+P  + Y +G   D+  YLDPH  QQ ++  R
Sbjct  259  GLSEINSDYYNSLKIMFTLRQSLGVIGGKPNHAHYFIGFNGDRLLYLDPHTTQQTIEPER  318

Query  577  DNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFT  398
             N+ I   S+HC     +   S+DPS+A+GFYC  + DFDD+C   +ELV Q    P+F 
Sbjct  319  FNV-IPDESFHCVYPCFMSFQSLDPSVALGFYCHTEDDFDDWCQAVNELVVQREKRPMFE  377

Query  397  ITETRNVSMP  368
            I +TR    P
Sbjct  378  INQTRPRHWP  387



>ref|XP_007247106.1| PREDICTED: cysteine protease ATG4A-like [Astyanax mexicanus]
Length=402

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/170 (36%), Positives = 95/170 (56%), Gaps = 2/170 (1%)
 Frame = -3

Query  811  SKGQVDWApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDD  632
            S+  +DW P++LL+PL +G++ +NP YI  LK  F  PQS G+LGG+P ++ Y +G  DD
Sbjct  219  SQQPLDWRPLLLLIPLRMGINNINPIYIQALKECFKMPQSCGVLGGKPNLAYYFIGFIDD  278

Query  631  QAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDV-VRQLPLDSIDPSLAIGFYCKDKSDFDD  455
            +  YLDPH  Q  VD       +D  SYHC    R++ + S+DPS+A+GF+CK + DFD 
Sbjct  279  ELIYLDPHTTQSAVD-SEMGTAVDDQSYHCQRNPRRMKITSLDPSVALGFFCKSEEDFDS  337

Query  454  FCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQGEASAEGFKSFDAT  305
            +C    + + +     +F + E      P      + E    G +  ++T
Sbjct  338  WCNLVQQEILKKRNLRMFELVEKHPSHWPPFVPPTKPEVQTTGAEFIEST  387



>ref|XP_001637442.1| predicted protein [Nematostella vectensis]
 gb|EDO45379.1| predicted protein [Nematostella vectensis]
Length=342

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 85/144 (59%), Gaps = 7/144 (5%)
 Frame = -3

Query  844  IDDISRRCLELSKGQVD-----WApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGIL  680
            ID++ R C      Q D     W P+I+LVP+ LG + +NP YIP +K+ F+  Q +GI+
Sbjct  197  IDEVKRVCTHCRTHQRDCSSGKWRPVIILVPMRLGGEALNPIYIPCVKSLFTLDQCIGII  256

Query  679  GGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQLPLDSIDPS  500
            GGRP  S Y VG QD++  +LDPH  Q VVD  ++     T S+HC   R+     +DPS
Sbjct  257  GGRPKHSLYFVGFQDEKMIHLDPHYCQPVVDTTQEKF--PTESFHCPNPRKTSFKKMDPS  314

Query  499  LAIGFYCKDKSDFDDFCARASELV  428
              IGFYC    DF+ FC  ASE++
Sbjct  315  CTIGFYCSSHEDFESFCQHASEVL  338



>ref|XP_004334148.1| autophagy protein 4, putative [Acanthamoeba castellanii str. 
Neff]
 gb|ELR12135.1| autophagy protein 4, putative [Acanthamoeba castellanii str. 
Neff]
Length=510

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 90/149 (60%), Gaps = 3/149 (2%)
 Frame = -3

Query  880  EDGERGGAPALCIDDISRRCLEL--SKGQVDWApiillvplvLGLDKVNPRYIPLLKATF  707
            E G+   + A  +      C  L  +  ++ W P+I+LVP+ LG+  +NP YIP LKA F
Sbjct  311  EAGDYSSSHAELMSSAESECESLDDNFTELTWHPVIILVPVRLGIQCLNPIYIPTLKAFF  370

Query  706  SFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQ  527
            SFPQ LG++GG+P  S Y VG QD++  Y+DPH VQ  V +  D L     SY  ++ + 
Sbjct  371  SFPQCLGVIGGKPHSSFYFVGYQDNKVLYMDPHFVQPTVKMDDDPL-FPIESYRMEIPQA  429

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARA  440
            +  D IDPSLA+GF C  +++FDDFC  A
Sbjct  430  MSFDDIDPSLALGFLCSSQAEFDDFCLNA  458



>ref|XP_002948308.1| autophagy protein [Volvox carteri f. nagariensis]
 gb|EFJ50715.1| autophagy protein [Volvox carteri f. nagariensis]
Length=391

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 75/139 (54%), Gaps = 17/139 (12%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            G+DK+NP Y+P L+   ++PQS+GI+GGRP  S Y+ GVQD    +LDPHE Q  V  G 
Sbjct  216  GMDKINPVYLPQLQRILTWPQSVGIVGGRPSASLYLCGVQDSSFLFLDPHEAQPTVRWGI  275

Query  577  DNLDIDT-----------------SSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFC  449
                  T                 ++Y CD VR +P  ++DPS+AIGF C   +D +D  
Sbjct  276  AGDAGHTKEAGNGGSAVVLPASSLATYFCDTVRLMPATALDPSMAIGFLCMGAADLEDLF  335

Query  448  ARASELVDQSGGAPLFTIT  392
             R   L  +   APL T+T
Sbjct  336  TRLDALAKEHSLAPLMTLT  354



>gb|EST08519.1| hypothetical protein PSEUBRA_SCAF16g05398 [Pseudozyma brasiliensis 
GHG001]
Length=417

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 67/109 (61%), Gaps = 15/109 (14%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            GLD VNP Y   +KATFSFP S+GI GGRP  S Y  G Q +  FYLDPH          
Sbjct  241  GLDSVNPIYYESVKATFSFPHSVGIAGGRPSSSYYFTGHQGNSLFYLDPH----------  290

Query  577  DNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCARASEL  431
                 +TS++HC+ VR++P+ S+DPS+ +GF  KD++D  D CAR   L
Sbjct  291  -----NTSTFHCEKVRRMPIKSLDPSMLLGFLVKDEADLADLCARIKAL  334



>ref|XP_011407221.1| PREDICTED: cysteine protease ATG4D-like [Amphimedon queenslandica]
Length=354

 Score =   108 bits (271),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 75/128 (59%), Gaps = 5/128 (4%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            G + +NP YIP +KA  +   ++GI+GGRP  S + +G QD+   +LDPH  Q  V++ R
Sbjct  178  GSESLNPIYIPCVKALLALDHTVGIIGGRPKHSVFFIGFQDENLIHLDPHYSQTAVNMTR  237

Query  577  DNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVD---QSGGAP  407
               D D SSYHC   +++P+  +DPS  +GFYC    DF+ F   A +++    Q G  P
Sbjct  238  T--DFDVSSYHCRSPKKIPVTKMDPSCTLGFYCHTLEDFNHFRIEAEKVLAPPMQKGQYP  295

Query  406  LFTITETR  383
             FT + TR
Sbjct  296  FFTFSNTR  303



>ref|XP_010738868.1| PREDICTED: cysteine protease ATG4D-like [Larimichthys crocea]
Length=502

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 104/203 (51%), Gaps = 11/203 (5%)
 Frame = -3

Query  841  DDISRRC-LELSKGQVD-----WApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGIL  680
            +D+ R C L LS+   D     W  +I+LVP+ LG + +NP YI  +K         GI+
Sbjct  304  EDVVRLCDLSLSQNPPDPSSQAWKSVIILVPVRLGGEALNPSYIECVKNILKLDCCTGII  363

Query  679  GGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQLPLDSIDPS  500
            GG+P  S Y +G QD+Q  YLDPH  Q VVD+ + N  ++  S+HC   +++P + +DPS
Sbjct  364  GGKPKHSLYFIGFQDEQLLYLDPHYCQPVVDVSQVNFSLE--SFHCSSPKKMPFNRMDPS  421

Query  499  LAIGFYCKDKSDFDDFCARASELVDQSGGA-PLFTITETRNVSMPVQYQDMQGEASAEGF  323
              IGFY K+K DF+  C+  SE +  S    P+FT  E R     ++         A   
Sbjct  422  CTIGFYAKNKKDFESLCSAVSEALSSSKEKYPIFTFVEGRGQDYGLEGHSSNNTGPAAHI  481

Query  322  KSFDATSIGDSENGKQEDDWQLL  254
                   +G S N +  D++  L
Sbjct  482  --LPPGRLGRSNNRRNSDEFVFL  502



>emb|CCA19140.1| cysteine protease family C54 putative [Albugo laibachii Nc14]
Length=459

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 79/129 (61%), Gaps = 7/129 (5%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            GLD +NPRY+P ++  F FPQ++GI+GG+ G S Y VG  D +   LDPH++    DL  
Sbjct  300  GLDSINPRYLPAIQRVFEFPQNVGIIGGKKGHSVYFVGTFDSKLQLLDPHDIHPTADL--  357

Query  577  DNLDIDTSSYHCDVVRQLPLD----SIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGA  410
             N    T+++   V  +LPL+    SIDPSLA+GFYC D+ D+ DF  R   +  + GGA
Sbjct  358  -NTAFPTATHLRTVHSRLPLEMSLGSIDPSLALGFYCSDRKDYLDFVDRVDRVQSELGGA  416

Query  409  PLFTITETR  383
              F+I + R
Sbjct  417  LPFSIAKAR  425



>ref|XP_007878879.1| hypothetical protein PFL1_03172 [Pseudozyma flocculosa PF-1]
 gb|EPQ29417.1| hypothetical protein PFL1_03172 [Pseudozyma flocculosa PF-1]
Length=1521

 Score =   112 bits (280),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 76/136 (56%), Gaps = 27/136 (20%)
 Frame = -3

Query  757   GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDL--  584
             GL+ VNP Y   +KATFSFPQS+GI GGRP  S Y +G Q +  FYLDPH V+  V L  
Sbjct  1015  GLEGVNPMYYDAVKATFSFPQSVGIAGGRPSSSYYFMGHQGNSLFYLDPHHVRPAVPLRY  1074

Query  583   --------------GRDNLDIDT-----------SSYHCDVVRQLPLDSIDPSLAIGFYC  479
                           G  + D D            +++H D VR++P+ S+DPS+ +GF C
Sbjct  1075  PPSRFPSAASSADEGSPDDDADEWWAHAYSEQQLATFHSDKVRRMPIKSLDPSMLLGFLC  1134

Query  478   KDKSDFDDFCARASEL  431
             KD++D  DFCAR   +
Sbjct  1135  KDEADLQDFCARVKAM  1150



>gb|ELT88258.1| hypothetical protein CAPTEDRAFT_225251 [Capitella teleta]
Length=410

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 77/130 (59%), Gaps = 2/130 (2%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            GL ++NP YIP LK   +F QS+GI+GG+P  + + +G  +D+  Y+DPH  Q  VD+ +
Sbjct  245  GLSEINPVYIPFLKTCLTFKQSVGIIGGKPNHAHWFIGFLEDELVYMDPHTTQPFVDVTQ  304

Query  577  DNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFT  398
                   +SYHC    ++P+  +DPS+A+GF+C+ ++DF+D C    + +      P+F 
Sbjct  305  PGE--SDASYHCSYSCRMPVSYLDPSVAVGFFCQTEADFEDLCQCIRKYILHGQKTPMFE  362

Query  397  ITETRNVSMP  368
            + + R    P
Sbjct  363  LHQRRPRHWP  372



>gb|EFA84441.1| autophagy protein 4 [Polysphondylium pallidum PN500]
Length=734

 Score =   110 bits (275),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 96/165 (58%), Gaps = 13/165 (8%)
 Frame = -3

Query  874  GERGGA---PALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATFS  704
            GE  G+   P  C D  S  C+        W  II+LVP+ LGLDK+N  Y   +K+   
Sbjct  515  GENSGSFKDPLTCSDFFSSSCIPQR-----WKSIIILVPIKLGLDKLNEVYFREIKSMLE  569

Query  703  FPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQL  524
             PQS+G++GG+P  S Y VG QD+   YLDPH V   V    ++++   S +HC V +++
Sbjct  570  LPQSIGLIGGKPKQSFYFVGYQDEHIIYLDPHFVHDTV--SPNDINFSDSYHHC-VPQKM  626

Query  523  PLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITE  389
             +  +DPS+AIGFYC  +SDF+DFC R  E+  +  G P+ ++ E
Sbjct  627  LISQLDPSMAIGFYCHTQSDFEDFCVRIKEI--EKRGFPVVSVGE  669



>ref|XP_010894735.1| PREDICTED: cysteine protease ATG4B isoform X1 [Esox lucius]
Length=404

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 75/126 (60%), Gaps = 2/126 (2%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            GL  +N  YI  LK  F  PQSLG++GG+P  + Y +G   ++  YLDPH  Q  V+ G 
Sbjct  241  GLSDINEAYIETLKQCFQLPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPGE  300

Query  577  DNLDIDTSSYHCDVVR-QLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLF  401
            D   +   +YHC     ++ +  IDPS+A+GF+C+ + DFDD+CAR  +L    GG P+F
Sbjct  301  DG-QVPDDTYHCQHPPCRMHICQIDPSIAVGFFCRTEDDFDDWCARVRKLSHSRGGLPMF  359

Query  400  TITETR  383
             + + +
Sbjct  360  ELADRQ  365



>ref|XP_010894737.1| PREDICTED: cysteine protease ATG4B isoform X3 [Esox lucius]
Length=397

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 75/126 (60%), Gaps = 2/126 (2%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            GL  +N  YI  LK  F  PQSLG++GG+P  + Y +G   ++  YLDPH  Q  V+ G 
Sbjct  234  GLSDINEAYIETLKQCFQLPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPGE  293

Query  577  DNLDIDTSSYHCDVVR-QLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLF  401
            D   +   +YHC     ++ +  IDPS+A+GF+C+ + DFDD+CAR  +L    GG P+F
Sbjct  294  DG-QVPDDTYHCQHPPCRMHICQIDPSIAVGFFCRTEDDFDDWCARVRKLSHSRGGLPMF  352

Query  400  TITETR  383
             + + +
Sbjct  353  ELADRQ  358



>gb|KDN48512.1| hypothetical protein K437DRAFT_245502 [Tilletiaria anomala UBC 
951]
Length=770

 Score =   109 bits (273),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 73/139 (53%), Gaps = 21/139 (15%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVD---  587
            GL  VNP Y   +K TF+FP + GI GGRP  S Y VGVQD    YLDPH V+  V    
Sbjct  306  GLSGVNPTYYESIKTTFAFPHTAGIAGGRPSSSYYFVGVQDSSLLYLDPHHVRPSVPFRF  365

Query  586  -------------LGRDNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCA  446
                         L R   +    ++HCD VR++PL S+DPS+ +GF C D+   +DFC+
Sbjct  366  PPPSLSGAELDKWLCRAYSEAQIGTFHCDRVRRMPLRSLDPSMLLGFICTDEQSLEDFCS  425

Query  445  RASELVDQSGGAPLFTITE  389
            R   L        LF+I E
Sbjct  426  RVKALPKT-----LFSIAE  439



>gb|EMP35426.1| Cysteine protease ATG4A [Chelonia mydas]
Length=265

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 56/164 (34%), Positives = 94/164 (57%), Gaps = 2/164 (1%)
 Frame = -3

Query  793  WApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLD  614
            W P++L++PL LG++ +NP YI   K  F  PQSLG LGG+P  + Y VG   +Q  YLD
Sbjct  88   WKPLLLIIPLRLGINHINPIYIDAFKECFKMPQSLGALGGKPNNAYYFVGFLGNQLIYLD  147

Query  613  PHEVQQVVDLGRDNLDIDTSSYHCDVV-RQLPLDSIDPSLAIGFYCKDKSDFDDFCARAS  437
            PH  Q  VDL  + + +D  S+HC     ++ + ++DPS+A+GF+CK++ DFD++C+   
Sbjct  148  PHTTQIFVDLEENGM-VDDQSFHCQQAPHRMKIMNLDPSVALGFFCKEEKDFDNWCSLVQ  206

Query  436  ELVDQSGGAPLFTITETRNVSMPVQYQDMQGEASAEGFKSFDAT  305
            + + +     +F + +      P      + E +  G +  ++T
Sbjct  207  KEILKQQSLRMFELVQNHPAHWPPFIPPAKPEVTTSGAELIEST  250



>ref|XP_001947296.2| PREDICTED: cysteine protease ATG4B-like [Acyrthosiphon pisum]
 ref|XP_003243448.1| PREDICTED: cysteine protease ATG4B-like [Acyrthosiphon pisum]
 ref|XP_003243449.1| PREDICTED: cysteine protease ATG4B-like [Acyrthosiphon pisum]
 ref|XP_003243450.1| PREDICTED: cysteine protease ATG4B-like [Acyrthosiphon pisum]
 ref|XP_008181456.1| PREDICTED: cysteine protease ATG4B-like [Acyrthosiphon pisum]
Length=402

 Score =   107 bits (266),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 99/169 (59%), Gaps = 15/169 (9%)
 Frame = -3

Query  853  ALCIDDISRRCLEL----SKGQVDWApiillvplvLGLDKVNPRYIPLLKATFSFPQSLG  686
             L I+++ + C  +    S  Q+ W P++L++PL LG+  +NP Y+  +K  F+FPQSLG
Sbjct  193  TLVINEVKKLCTVMEQTNSSKQI-WKPLVLVIPLRLGISAINPAYVQGVKMCFTFPQSLG  251

Query  685  ILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDT-----SSYHCDVVRQLP  521
            ++GGRP  + Y +G   +   +LDPH  QQ+  L   N DI+T      SYHC  + +LP
Sbjct  252  VIGGRPNHALYFIGFVGNDVIFLDPHTTQQIGMLP--NKDIETEHKIDHSYHCQQINRLP  309

Query  520  LDSIDPSLAIGFYCKDKSDFDDFCARAS-ELV--DQSGGAPLFTITETR  383
            + ++DPSLA  F C+ ++DF+  C      LV  DQS   PL TI + R
Sbjct  310  ILNMDPSLAACFMCQTENDFNALCHELKVHLVQSDQSPSQPLITICDER  358



>ref|XP_006822046.1| PREDICTED: cysteine protease ATG4D-like [Saccoglossus kowalevskii]
Length=426

 Score =   106 bits (265),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 87/138 (63%), Gaps = 5/138 (4%)
 Frame = -3

Query  793  WApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLD  614
            W  +I+L+P+ LG +++NP YI  +K+ F+    +GI+GG+P  S Y +G Q+D+  +LD
Sbjct  250  WCSVIILIPVRLGGEELNPVYISCIKSLFTLKHCIGIIGGKPKHSLYFIGFQEDKLIHLD  309

Query  613  PHEVQQVVDLGRDNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCARASE  434
            PH  Q VVD+   + D    S+HC   R++ L  +DPS  IGFYCK + DF +FC+ A E
Sbjct  310  PHLCQDVVDM--RSRDFPLQSFHCMSPRKMSLMKMDPSCTIGFYCKTQDDFKEFCSYAQE  367

Query  433  LVDQS---GGAPLFTITE  389
            ++D +   G  P+F  ++
Sbjct  368  VLDSTKHVGDYPMFIFSD  385



>ref|XP_004743856.1| PREDICTED: cysteine protease ATG4B [Mustela putorius furo]
 ref|XP_004809678.1| PREDICTED: cysteine protease ATG4B isoform X2 [Mustela putorius 
furo]
Length=393

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 94/166 (57%), Gaps = 9/166 (5%)
 Frame = -3

Query  865  GGAPALCIDDISRRC------LELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATFS  704
             GA AL  D  SR C       E++     W P++LL+PL LGL  +N  Y+  LK  F 
Sbjct  190  AGATALPTDS-SRHCNGFPAGAEVTNRPAPWRPLVLLIPLRLGLTDINEAYVETLKRCFM  248

Query  703  FPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHC-DVVRQ  527
             PQSLG++GG+P  + Y +G   ++  YLDPH  Q  V+L  D+  I   S+HC     +
Sbjct  249  MPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEL-TDSCFIPDESFHCRHPPSR  307

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITE  389
            + +  +DPS+A+GF+CK + DFDD+C R  +L    G  P+F + E
Sbjct  308  MGISELDPSIAVGFFCKTEDDFDDWCQRVRQLSLLGGALPMFELVE  353



>ref|XP_008168276.1| PREDICTED: cysteine protease ATG4A [Chrysemys picta bellii]
Length=397

 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 85/152 (56%), Gaps = 2/152 (1%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            G++ +NP YI   K  F  PQSLG LGG+P  + Y +G   ++  YLDPH  Q  VDL  
Sbjct  232  GINHINPIYIDAFKECFKMPQSLGALGGKPNNAYYFIGFLGNELIYLDPHTTQIFVDLEE  291

Query  577  DNLDIDTSSYHCDVV-RQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLF  401
            + + +D  S+HC     ++ + ++DPS+A+GF+CK++ DFD++C+   + + +  G  +F
Sbjct  292  NGM-VDDQSFHCQQAPHRMKIMNLDPSVALGFFCKEEKDFDNWCSLVQKEILKQQGLRMF  350

Query  400  TITETRNVSMPVQYQDMQGEASAEGFKSFDAT  305
             + +      P      + E +  G +  ++T
Sbjct  351  ELVQNHPAHWPPFIPPAKPEVTTSGAELIEST  382



>ref|NP_001020882.1| cysteine protease ATG4B [Rattus norvegicus]
 gb|AAH98833.1| ATG4 autophagy related 4 homolog B (S. cerevisiae) [Rattus norvegicus]
Length=224

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 98/175 (56%), Gaps = 9/175 (5%)
 Frame = -3

Query  865  GGAPALCIDDISRRC------LELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATFS  704
             GA AL ++   R C       E++   + W P++LL+PL LGL  +N  Y+  LK  F 
Sbjct  21   AGAAALSMES-ERHCNGLPAGAEVTNRPLAWRPLVLLIPLRLGLTDINEAYVETLKHCFM  79

Query  703  FPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVR-Q  527
             PQSLG++GG+P  + Y +G   ++  YLDPH  Q  V+L  D+  I   S+HC     +
Sbjct  80   MPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEL-TDSCFIPDESFHCQHPPCR  138

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQ  362
            + +  +DPS+A+GF+CK + DF+D+C +  +L    G  P+F + E +   +  Q
Sbjct  139  MGIGELDPSIAVGFFCKTEEDFNDWCQQVKKLSQLGGALPMFELVEQQPSHLACQ  193



>ref|XP_005945804.1| PREDICTED: cysteine protease ATG4D-like [Haplochromis burtoni]
Length=500

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 83/137 (61%), Gaps = 3/137 (2%)
 Frame = -3

Query  796  DWApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYL  617
            DW  +I+LVP+ LG + +NP YI  +K        +GI+GG+P  S Y +G QD+Q  YL
Sbjct  323  DWKSVIILVPVRLGGEALNPSYIDCVKNFLKLECCIGIIGGKPKHSLYFIGFQDEQLLYL  382

Query  616  DPHEVQQVVDLGRDNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCARAS  437
            DPH  Q VVD+ + N  ++  S+HC   +++P + +DPS  IGFY K+K DF+  C+  S
Sbjct  383  DPHYCQPVVDVSQVNFSLE--SFHCSSPKKMPFNRMDPSCTIGFYAKNKKDFESLCSAVS  440

Query  436  ELVDQSGGA-PLFTITE  389
            E +  S    P+FT  E
Sbjct  441  EALSSSKEKYPVFTFVE  457



>gb|EJW87807.1| hypothetical protein WUBG_01286, partial [Wuchereria bancrofti]
Length=216

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 87/157 (55%), Gaps = 14/157 (9%)
 Frame = -3

Query  796  DWApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYL  617
            +W P+++++PL LGL+ +N  Y P ++A F  PQ +GI+GGRP  + Y  G+ D+   YL
Sbjct  28   EWRPLLIIIPLRLGLNTINRCYFPAIQAFFELPQCVGIIGGRPNHALYFCGIVDNNLLYL  87

Query  616  DPHEVQQVVDL-----GRD---------NLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYC  479
            DPH  Q  VDL      RD         N +   S+YHC  +    +D +DPSLA+GF+C
Sbjct  88   DPHFCQNFVDLDETTTTRDERDDYVEIKNDEFKDSTYHCPFILSTKIDKVDPSLALGFFC  147

Query  478  KDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMP  368
              + D+++   R    +  +   PLF + ETR  + P
Sbjct  148  HTEDDYNELAKRLRTHLLPASTPPLFEMLETRPKNFP  184



>ref|XP_004567932.1| PREDICTED: cysteine protease ATG4D-like [Maylandia zebra]
Length=500

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 83/137 (61%), Gaps = 3/137 (2%)
 Frame = -3

Query  796  DWApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYL  617
            DW  +I+LVP+ LG + +NP YI  +K        +GI+GG+P  S Y +G QD+Q  YL
Sbjct  323  DWKSVIILVPVRLGGEALNPSYIDCVKNFLKLECCIGIIGGKPKHSLYFIGFQDEQLLYL  382

Query  616  DPHEVQQVVDLGRDNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCARAS  437
            DPH  Q VVD+ + N  ++  S+HC   +++P + +DPS  IGFY K+K DF+  C+  S
Sbjct  383  DPHYCQPVVDVSQVNFSLE--SFHCSSPKKMPFNRMDPSCTIGFYAKNKKDFESLCSAVS  440

Query  436  ELVDQSGGA-PLFTITE  389
            E +  S    P+FT  E
Sbjct  441  EALSSSKEKYPVFTFVE  457



>ref|XP_005752278.1| PREDICTED: cysteine protease ATG4D-like [Pundamilia nyererei]
Length=500

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 83/137 (61%), Gaps = 3/137 (2%)
 Frame = -3

Query  796  DWApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYL  617
            DW  +I+LVP+ LG + +NP YI  +K        +GI+GG+P  S Y +G QD+Q  YL
Sbjct  323  DWKSVIILVPVRLGGEALNPSYIDCVKNFLKLECCIGIIGGKPKHSLYFIGFQDEQLLYL  382

Query  616  DPHEVQQVVDLGRDNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCARAS  437
            DPH  Q VVD+ + N  ++  S+HC   +++P + +DPS  IGFY K+K DF+  C+  S
Sbjct  383  DPHYCQPVVDVSQVNFSLE--SFHCSSPKKMPFNRMDPSCTIGFYAKNKKDFESLCSAVS  440

Query  436  ELVDQSGGA-PLFTITE  389
            E +  S    P+FT  E
Sbjct  441  EALSSSKEKYPVFTFVE  457



>ref|XP_007060204.1| PREDICTED: cysteine protease ATG4A isoform X2 [Chelonia mydas]
Length=380

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 84/152 (55%), Gaps = 2/152 (1%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            G++ +NP YI   K  F  PQSLG LGG+P  + Y VG   +Q  YLDPH  Q  VDL  
Sbjct  215  GINHINPIYIDAFKECFKMPQSLGALGGKPNNAYYFVGFLGNQLIYLDPHTTQIFVDLEE  274

Query  577  DNLDIDTSSYHCDVV-RQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLF  401
            + + +D  S+HC     ++ + ++DPS+A+GF+CK++ DFD++C+   + + +     +F
Sbjct  275  NGM-VDDQSFHCQQAPHRMKIMNLDPSVALGFFCKEEKDFDNWCSLVQKEILKQQSLRMF  333

Query  400  TITETRNVSMPVQYQDMQGEASAEGFKSFDAT  305
             + +      P      + E +  G +  ++T
Sbjct  334  ELVQNHPAHWPPFIPPAKPEVTTSGAELIEST  365



>ref|XP_004809677.1| PREDICTED: cysteine protease ATG4B isoform X1 [Mustela putorius 
furo]
Length=415

 Score =   106 bits (264),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 94/166 (57%), Gaps = 9/166 (5%)
 Frame = -3

Query  865  GGAPALCIDDISRRC------LELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATFS  704
             GA AL  D  SR C       E++     W P++LL+PL LGL  +N  Y+  LK  F 
Sbjct  190  AGATALPTDS-SRHCNGFPAGAEVTNRPAPWRPLVLLIPLRLGLTDINEAYVETLKRCFM  248

Query  703  FPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHC-DVVRQ  527
             PQSLG++GG+P  + Y +G   ++  YLDPH  Q  V+L  D+  I   S+HC     +
Sbjct  249  MPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEL-TDSCFIPDESFHCRHPPSR  307

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITE  389
            + +  +DPS+A+GF+CK + DFDD+C R  +L    G  P+F + E
Sbjct  308  MGISELDPSIAVGFFCKTEDDFDDWCQRVRQLSLLGGALPMFELVE  353



>ref|XP_006787443.1| PREDICTED: cysteine protease ATG4D-like [Neolamprologus brichardi]
Length=500

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 83/137 (61%), Gaps = 3/137 (2%)
 Frame = -3

Query  796  DWApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYL  617
            DW  +I+LVP+ LG + +NP YI  +K        +GI+GG+P  S Y +G QD+Q  YL
Sbjct  323  DWKSVIILVPVRLGGEALNPSYIDCVKNFLKLECCIGIIGGKPKHSLYFIGFQDEQLLYL  382

Query  616  DPHEVQQVVDLGRDNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCARAS  437
            DPH  Q VVD+ + N  ++  S+HC   +++P + +DPS  IGFY K+K DF+  C+  S
Sbjct  383  DPHYCQPVVDVSQVNFSLE--SFHCSSPKKMPFNRMDPSCTIGFYAKNKKDFESLCSAVS  440

Query  436  ELVDQSGGA-PLFTITE  389
            E +  S    P+FT  E
Sbjct  441  EALSSSKEKYPVFTFVE  457



>ref|XP_005998268.1| PREDICTED: cysteine protease ATG4A [Latimeria chalumnae]
Length=382

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 91/159 (57%), Gaps = 2/159 (1%)
 Frame = -3

Query  799  VDWApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFY  620
            + W P++L++PL +G++ +NP Y    K  F  PQSLG+LGG+P  + Y +G   D+  Y
Sbjct  202  IAWKPLLLIIPLRMGINYINPVYTDAFKECFKMPQSLGVLGGKPNSAYYFIGFVGDELVY  261

Query  619  LDPHEVQQVVDLGRDNLDIDTSSYHCDVV-RQLPLDSIDPSLAIGFYCKDKSDFDDFCAR  443
            LDPH  Q VVDL  +  ++D  SYHC    R++ + ++DPS+A+GF+CKD+ DFD +C  
Sbjct  262  LDPHTTQTVVDL-EEGGNVDDQSYHCQRAPRRMKILNLDPSVALGFFCKDEHDFDSWCNL  320

Query  442  ASELVDQSGGAPLFTITETRNVSMPVQYQDMQGEASAEG  326
              + + +     +F + +      P      + E S  G
Sbjct  321  VQKEILKKQSLRMFELVQKHPPHWPPFVPPTKPEVSTIG  359



>ref|XP_007060203.1| PREDICTED: cysteine protease ATG4A isoform X1 [Chelonia mydas]
Length=397

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 84/152 (55%), Gaps = 2/152 (1%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            G++ +NP YI   K  F  PQSLG LGG+P  + Y VG   +Q  YLDPH  Q  VDL  
Sbjct  232  GINHINPIYIDAFKECFKMPQSLGALGGKPNNAYYFVGFLGNQLIYLDPHTTQIFVDLEE  291

Query  577  DNLDIDTSSYHCDVV-RQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLF  401
            + + +D  S+HC     ++ + ++DPS+A+GF+CK++ DFD++C+   + + +     +F
Sbjct  292  NGM-VDDQSFHCQQAPHRMKIMNLDPSVALGFFCKEEKDFDNWCSLVQKEILKQQSLRMF  350

Query  400  TITETRNVSMPVQYQDMQGEASAEGFKSFDAT  305
             + +      P      + E +  G +  ++T
Sbjct  351  ELVQNHPAHWPPFIPPAKPEVTTSGAELIEST  382



>ref|XP_010871080.1| PREDICTED: cysteine protease ATG4D isoform X2 [Esox lucius]
Length=527

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 87/161 (54%), Gaps = 3/161 (2%)
 Frame = -3

Query  868  RGGAPALCIDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATFSFPQSL  689
            +G    LC   ++R          DW  +I+LVP+ LG + +NP YI  +K        +
Sbjct  321  KGDVVCLCDQSLTRGMSVPEPSGSDWTSVIILVPVRLGGESLNPSYIQCVKNILRLKCCI  380

Query  688  GILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQLPLDSI  509
            GI+GG+P  S + +G QDDQ  YLDPH  Q VVD+ + N  ++  S+HC   R++P   +
Sbjct  381  GIIGGKPKHSLFFIGCQDDQLLYLDPHYCQAVVDVTQGNFPLE--SFHCSSPRKMPFSRM  438

Query  508  DPSLAIGFYCKDKSDFDDFCARASELVDQSGGA-PLFTITE  389
            DPS  IGFY + K DF+  C   SE +  S    P+FT  E
Sbjct  439  DPSCTIGFYARTKKDFETLCGDVSEALSSSKEKYPIFTFVE  479



>dbj|GAM24913.1| hypothetical protein SAMD00019534_080880 [Acytostelium subglobosum 
LB1]
Length=738

 Score =   108 bits (270),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 88/135 (65%), Gaps = 5/135 (4%)
 Frame = -3

Query  793  WApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLD  614
            W  II++VP+ LG+D++N  Y   +KA    PQSLGI+GG+P  S Y VG QDD   YLD
Sbjct  533  WKSIIIMVPIKLGVDRLNDIYFGQIKAMLQMPQSLGIIGGKPKQSFYFVGHQDDNLIYLD  592

Query  613  PHEVQQVVDLGRDNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCARASE  434
            PH V +     + N  ID  SYH  + +++ L  +DPS+AIGFYC+ +SDF+D C+R S 
Sbjct  593  PHFVHEHSTPDQQNF-ID--SYHNCIPQKMSLSQLDPSMAIGFYCRTQSDFEDLCSRISA  649

Query  433  LVDQSGGAPLFTITE  389
            +  +S G+P+ +I E
Sbjct  650  V--ESHGSPMISIGE  662



>dbj|GAM28128.1| hypothetical protein SAMD00019534_113040, partial [Acytostelium 
subglobosum LB1]
Length=409

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 85/146 (58%), Gaps = 4/146 (3%)
 Frame = -3

Query  826  RCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIV  647
            + +EL+     W P+++L+P  LG+D +N  Y   L   + FPQSLGI+GG+P  S Y +
Sbjct  233  KMMELALHNETWTPLLILIPTKLGVDTLNQLYYRPLLEIYRFPQSLGIVGGKPRASLYFI  292

Query  646  GVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKS  467
              QDD  FYLDPH VQQ ++   ++      S+ C++ ++  +  +DPSL + F C+ K 
Sbjct  293  AAQDDNLFYLDPHTVQQSIE---NDQQFSPHSFFCNIPKKANISEVDPSLVLAFICRTKE  349

Query  466  DFDDFCARASELVDQSGGAPLFTITE  389
            DF DF  R+  LV  S   PLF I E
Sbjct  350  DFLDFLERSKNLVSLS-EFPLFNIAE  374



>ref|XP_003447971.1| PREDICTED: cysteine protease ATG4D-like [Oreochromis niloticus]
Length=500

 Score =   106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 83/137 (61%), Gaps = 3/137 (2%)
 Frame = -3

Query  796  DWApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYL  617
            DW  +I+LVP+ LG + +NP YI  +K        +GI+GG+P  S Y +G QD+Q  YL
Sbjct  323  DWKSVIILVPVRLGGEALNPSYIDCVKNFLKLDCCIGIIGGKPKHSLYFIGFQDEQLLYL  382

Query  616  DPHEVQQVVDLGRDNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCARAS  437
            DPH  Q VVD+ + N  ++  S+HC   +++P + +DPS  IGFY K+K DF+  C+  S
Sbjct  383  DPHYCQPVVDVSQINFSLE--SFHCSSPKKMPFNRMDPSCTIGFYAKNKKDFESLCSAVS  440

Query  436  ELVDQSGGA-PLFTITE  389
            E +  S    P+FT  E
Sbjct  441  EALSSSKEKYPVFTFVE  457



>emb|CDJ26740.1| cysteine peptidase 2 family C54 protein [Tityus serrulatus]
Length=402

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 92/146 (63%), Gaps = 6/146 (4%)
 Frame = -3

Query  796  DWApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYL  617
            +W P++L +PL LGL ++NP Y+  LK TF   QSLGI+GG+P  + Y +GV  ++  YL
Sbjct  226  NWKPLLLFIPLRLGLSEINPVYLKALKITFCLKQSLGIIGGKPNHALYFIGVVGNEVVYL  285

Query  616  DPHEVQQVVDLGRDNLDI-DTSSYHCDV--VRQLPLDSIDPSLAIGFYCKDKSDFDDFCA  446
            DPH  QQ  D+   +L+I + SSYHC     R++ L+ +DPS+A+ FY + + +FD +C 
Sbjct  286  DPHTTQQATDI---SLEIPNDSSYHCPYGNSRRMNLNQMDPSVALCFYFQTEEEFDSWCI  342

Query  445  RASELVDQSGGAPLFTITETRNVSMP  368
            +  + +  +   PLF +++ R +  P
Sbjct  343  QVHKFLIAAETQPLFELSKERPLHWP  368



>gb|ENN76867.1| hypothetical protein YQE_06708, partial [Dendroctonus ponderosae]
Length=447

 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 86/153 (56%), Gaps = 7/153 (5%)
 Frame = -3

Query  844  IDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPG  665
            I DI   C++ +  +  W  ++LL+P+ LG +K N  Y P L   FS  + +GI+GGRP 
Sbjct  259  IRDIFAECIDQATNK--WKSLVLLIPVRLGAEKFNSIYSPCLTTLFSIKECIGIIGGRPK  316

Query  664  VSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQLPLDSIDPSLAIGF  485
             S Y VG QDD+  +LDPH  Q+VVD+     D   +++HC   R+LP+  IDPS  IGF
Sbjct  317  HSLYFVGYQDDRLIHLDPHYCQEVVDVWAS--DFPLTTFHCRSPRKLPISKIDPSCCIGF  374

Query  484  YCKDKSDFDDFCARASELVDQSGGA---PLFTI  395
            YC+ K DF         +V    GA   P+FT 
Sbjct  375  YCRTKEDFLTLVETVQPIVVPPHGAGDYPMFTF  407



>ref|XP_010791075.1| PREDICTED: cysteine protease ATG4D [Notothenia coriiceps]
Length=499

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 93/161 (58%), Gaps = 9/161 (6%)
 Frame = -3

Query  841  DDISRRC-LELSKGQVD-----WApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGIL  680
            +D+   C L LS+   D     W  +++LVP+ LG + +NP YI  +K        +GI+
Sbjct  301  EDVVHLCDLSLSQTPPDPSSQAWKSVLILVPVRLGGEVLNPSYIECVKNILKLECCIGII  360

Query  679  GGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQLPLDSIDPS  500
            GG+P  S Y VG QD+Q  YLDPH  Q +VD+ + N  ++  S+HC   +++P + +DPS
Sbjct  361  GGKPKHSLYFVGFQDEQLLYLDPHYSQPLVDVSQVNFSLE--SFHCSSPKKMPFNRMDPS  418

Query  499  LAIGFYCKDKSDFDDFCARASELVDQSGGA-PLFTITETRN  380
              IGFY +DK DF+  C+  SE +  S    P+FT  E ++
Sbjct  419  CTIGFYARDKKDFESLCSAVSEALSSSKEKYPIFTFVEGKS  459



>ref|XP_001637280.1| predicted protein [Nematostella vectensis]
 gb|EDO45217.1| predicted protein [Nematostella vectensis]
Length=368

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/168 (39%), Positives = 93/168 (55%), Gaps = 10/168 (6%)
 Frame = -3

Query  844  IDDISRRCLELSKGQV-------DWApiillvplvLGLDKVNPRYIPLLKATFSFPQSLG  686
             DD S  CL ++           +W P++L +PL LGL ++N  Y   LKA F+F QSLG
Sbjct  163  FDDWSSLCLHVAMDNTVIIEDISNWRPLVLFIPLRLGLTEMNVVYNEPLKACFTFKQSLG  222

Query  685  ILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLD-IDTSSYHCDVVRQLPLDSI  509
            I+GGRP  +TY +G   +   YLDPH  QQ V+   D L  I   S+HC    ++ +  +
Sbjct  223  IIGGRPNHATYFIGYFGNNLVYLDPHTTQQTVN--PDELSRIPDGSFHCVYPCRMNIADV  280

Query  508  DPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPV  365
            DPS+A+GF+CK + DFDD C +  + +      P+F I + R    PV
Sbjct  281  DPSVALGFFCKSEEDFDDLCQQIQKKIIDGKSRPMFEIAKDRPQHWPV  328



>emb|CDQ73539.1| unnamed protein product [Oncorhynchus mykiss]
Length=441

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 92/170 (54%), Gaps = 2/170 (1%)
 Frame = -3

Query  811  SKGQVDWApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDD  632
            S+   DW P++L++PL +G++ +NP YI  LK  F  PQS G+LGG+P ++ Y +G   +
Sbjct  258  SQSHSDWRPLLLVIPLRMGINHINPVYIQALKECFKMPQSCGVLGGKPNLAYYFIGFVGE  317

Query  631  QAFYLDPHEVQQVVDLGRDNLDIDTSSYHC-DVVRQLPLDSIDPSLAIGFYCKDKSDFDD  455
            +  YLDPH  Q  V+       +D  SYHC    R++ + ++DPS+A+GF+CK + DFD 
Sbjct  318  ELIYLDPHTTQSAVE-AEAGSGVDDQSYHCLRSPRRMKITNLDPSVALGFFCKSEDDFDS  376

Query  454  FCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQGEASAEGFKSFDAT  305
            +C    + +       +F + E      P      + E    G +  ++T
Sbjct  377  WCNLVQQEIQMKRNLRMFELVENHPPHWPPFVPPTKPEVQTTGAEFIEST  426



>emb|CDJ26739.1| cysteine peptidase 1 family C54 protein [Tityus serrulatus]
Length=408

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 90/156 (58%), Gaps = 4/156 (3%)
 Frame = -3

Query  808  KGQVDWApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQ  629
               ++W P+++ +PL LGL ++NP Y   LKA FS   SLGI+GGRP  + Y +G   ++
Sbjct  237  NSNLEWYPLLIFIPLRLGLFEINPIYFSALKAAFSMNNSLGIIGGRPNHALYFIGTVGEE  296

Query  628  AFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFC  449
              +LDPH  Q +VD       I+  SYHC+   ++ L+ +DPS+++ FYC  + +FD +C
Sbjct  297  LVFLDPHTTQPIVDFDE---GINDESYHCNYSGRMNLNQLDPSISLCFYCNTEIEFDRWC  353

Query  448  ARASELVDQSGGAPLFTITETRNVSMPVQYQDMQGE  341
             ++ + +      PLF I E R + +   Y D + E
Sbjct  354  VQSKQFLVTDQAQPLFEIFEDRPLHI-FSYSDNECE  388



>gb|EDL91905.1| autophagy-related 4B (yeast), isoform CRA_b [Rattus norvegicus]
Length=319

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 98/175 (56%), Gaps = 9/175 (5%)
 Frame = -3

Query  865  GGAPALCIDDISRRC------LELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATFS  704
             GA AL ++   R C       E++   + W P++LL+PL LGL  +N  Y+  LK  F 
Sbjct  116  AGAAALSMES-ERHCNGLPAGAEVTNRPLAWRPLVLLIPLRLGLTDINEAYVETLKHCFM  174

Query  703  FPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVR-Q  527
             PQSLG++GG+P  + Y +G   ++  YLDPH  Q  V+L  D+  I   S+HC     +
Sbjct  175  MPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEL-TDSCFIPDESFHCQHPPCR  233

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQ  362
            + +  +DPS+A+GF+CK + DF+D+C +  +L    G  P+F + E +   +  Q
Sbjct  234  MGIGELDPSIAVGFFCKTEEDFNDWCQQVKKLSQLGGALPMFELVEQQPSHLACQ  288



>dbj|BAI82576.1| autophagy-related 4 [Haemaphysalis longicornis]
Length=387

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 75/130 (58%), Gaps = 2/130 (2%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            GL ++NP Y   LK TF+  QSLGI+GG+P  + YI+GV  D   +LDPH  Q  VDL  
Sbjct  223  GLSEINPIYYCGLKRTFALKQSLGIIGGKPNHALYIIGVVGDDLVFLDPHTTQLAVDL--  280

Query  577  DNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFT  398
            D    D  SYHC    ++ +  +DPS+A+ FY   +++FD +C  A + +      PLF 
Sbjct  281  DTEFPDDESYHCAHASRMDIGQLDPSIALCFYLPTEAEFDSWCNLAHKHLISEMSQPLFE  340

Query  397  ITETRNVSMP  368
            ITE R +  P
Sbjct  341  ITEHRPLGWP  350



>ref|XP_005802888.1| PREDICTED: cysteine protease ATG4D-like [Xiphophorus maculatus]
Length=419

 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 82/139 (59%), Gaps = 3/139 (2%)
 Frame = -3

Query  793  WApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLD  614
            W  +++LVP+ LG  ++NP YIP +K        +GI+GG+P  S + VG QD+   YLD
Sbjct  247  WKSVLVLVPVRLGGQELNPSYIPCVKKLLMLQCCIGIIGGKPKHSLFFVGFQDNHLLYLD  306

Query  613  PHEVQQVVDLGRDNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCARASE  434
            PH  Q  V++ +DN  ++  S+HC   R++    +DPS  IGFY KD+S+F+  CA  +E
Sbjct  307  PHYCQPAVNIKKDNFPLE--SFHCKQPRKMAFSRMDPSCTIGFYAKDQSEFELMCAAVNE  364

Query  433  LVDQSGGA-PLFTITETRN  380
             V  S    P+F  +E + 
Sbjct  365  AVSTSAETYPMFIFSEEKR  383



>ref|XP_003972638.1| PREDICTED: cysteine protease ATG4D [Takifugu rubripes]
Length=499

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 65/183 (36%), Positives = 100/183 (55%), Gaps = 10/183 (5%)
 Frame = -3

Query  793  WApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLD  614
            W  +I+LVP+ LG + +NP YI  +K        +GI+GG+P  S Y VG QD+Q  YLD
Sbjct  324  WKSVIILVPVRLGGECLNPSYIECVKNILKLDCCIGIIGGKPKHSLYFVGFQDEQLLYLD  383

Query  613  PHEVQQVVDLGRDNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFC-ARAS  437
            PH  Q VVD+ + N  ++  S+HC+  +++P + +DPS  IGFY K K DF+  C A  +
Sbjct  384  PHYCQPVVDVSQVNSSLE--SFHCNAPKKMPFNRMDPSCTIGFYAKSKKDFESLCSAVGT  441

Query  436  ELVDQSGGAPLFTITETRNVSMPVQYQDMQGEASAEGFKS--FDATSIGDSENGKQEDDW  263
             L       PLFT  E R+     Q   ++G+++  G  +       +G S + +  D++
Sbjct  442  ALSSSKERYPLFTFIEGRS-----QDYGLEGQSTNTGPAAHILPPGKLGRSNHRRNSDEF  496

Query  262  QLL  254
              L
Sbjct  497  VFL  499



>ref|XP_003744760.1| PREDICTED: cysteine protease ATG4D-like [Metaseiulus occidentalis]
Length=488

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/140 (39%), Positives = 82/140 (59%), Gaps = 5/140 (4%)
 Frame = -3

Query  799  VDWApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFY  620
            ++W  ++LL+P+ LG ++VN  YI  +K   ++   LGI+GG+P  S Y VG Q  +  Y
Sbjct  308  IEWKSVVLLIPVRLGGERVNVNYIHCIKEILAYQNCLGIIGGKPRHSLYFVGFQGKKLVY  367

Query  619  LDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDF---C  449
            LDPH +Q+  D  R N  ++  S+HC   R++    +DPS  IGFYCK + DF+ F    
Sbjct  368  LDPHYLQKTTDTSRLNFSVN--SFHCTTARKVSFSKLDPSATIGFYCKTRRDFESFQSIM  425

Query  448  ARASELVDQSGGAPLFTITE  389
               +E   Q+ G P+F I+E
Sbjct  426  QSVTESCPQNQGYPVFIISE  445



>gb|KFP10088.1| Cysteine protease ATG4A, partial [Egretta garzetta]
Length=395

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 84/152 (55%), Gaps = 2/152 (1%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            G++ +NP YI   K  F  PQSLG LGG+P  + Y +G   ++  YLDPH  Q  VDL  
Sbjct  230  GINHINPVYIDAFKECFKMPQSLGALGGKPNNAYYFIGFLGNELIYLDPHTTQSFVDL-E  288

Query  577  DNLDIDTSSYHCDVV-RQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLF  401
            +N  +D  S+HC     ++ + ++DPS+A+GF+CK++ DFD++C+   + + +     +F
Sbjct  289  ENGTVDDESFHCQQAPHRMKIMNLDPSVALGFFCKEECDFDNWCSLVQKEILKQQSLRMF  348

Query  400  TITETRNVSMPVQYQDMQGEASAEGFKSFDAT  305
             + +      P      + E +  G +  ++T
Sbjct  349  ELVQKHPPHWPPFIPPTKPEVTTTGAELIEST  380



>ref|XP_008405954.1| PREDICTED: cysteine protease ATG4B [Poecilia reticulata]
Length=391

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 75/130 (58%), Gaps = 2/130 (2%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            GL  +N  YI  LK  F  PQSLG++GG+P  + Y +G   ++  YLDPH  Q  V+   
Sbjct  229  GLSDINEAYIETLKQCFMLPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPCE  288

Query  577  DNLDIDTSSYHCDVVR-QLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLF  401
            D   +   +YHC     ++ +  +DPS+A GF+CK + DFDD+C R   L  + GG P+F
Sbjct  289  DG-QVPDDTYHCQHPPCRMHICELDPSIAAGFFCKTEDDFDDWCMRIRRLSCKKGGLPMF  347

Query  400  TITETRNVSM  371
             + +++ V M
Sbjct  348  ELVDSQPVHM  357



>ref|XP_007541517.1| PREDICTED: cysteine protease ATG4B [Poecilia formosa]
Length=391

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 75/130 (58%), Gaps = 2/130 (2%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            GL  +N  YI  LK  F  PQSLG++GG+P  + Y +G   ++  YLDPH  Q  V+   
Sbjct  229  GLSDINEAYIETLKQCFMLPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPCE  288

Query  577  DNLDIDTSSYHCDVVR-QLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLF  401
            D   +   +YHC     ++ +  +DPS+A GF+CK + DFDD+C R   L  + GG P+F
Sbjct  289  DG-QVPDDTYHCQHPPCRMHICELDPSIAAGFFCKTEDDFDDWCMRIRRLSCKKGGLPMF  347

Query  400  TITETRNVSM  371
             + +++ V M
Sbjct  348  ELVDSQPVHM  357



>ref|XP_005811409.1| PREDICTED: cysteine protease ATG4B-like [Xiphophorus maculatus]
Length=391

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 75/130 (58%), Gaps = 2/130 (2%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            GL  +N  YI  LK  F  PQSLG++GG+P  + Y +G   ++  YLDPH  Q  V+   
Sbjct  229  GLSDINEAYIETLKQCFMLPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPCE  288

Query  577  DNLDIDTSSYHCDVVR-QLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLF  401
            D   +   +YHC     ++ +  +DPS+A GF+CK + DFDD+C R   L  + GG P+F
Sbjct  289  DG-QVPDDTYHCQHPPCRMHICELDPSIAAGFFCKTEDDFDDWCMRIRRLSCKKGGLPMF  347

Query  400  TITETRNVSM  371
             + +++ V M
Sbjct  348  ELVDSQPVHM  357



>gb|KFO08631.1| Cysteine protease ATG4A, partial [Balearica regulorum gibbericeps]
Length=395

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 84/152 (55%), Gaps = 2/152 (1%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            G++ +NP YI   K  F  PQSLG LGG+P  + Y +G   ++  YLDPH  Q  VDL  
Sbjct  230  GINHINPVYIDAFKECFKMPQSLGALGGKPNNAYYFIGFLGNELIYLDPHTTQSFVDL-E  288

Query  577  DNLDIDTSSYHCDVV-RQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLF  401
            +N  +D  S+HC     ++ + ++DPS+A+GF+CK++ DFD++C+   + + +     +F
Sbjct  289  ENGTVDDESFHCQQAPHRMKIMNLDPSVALGFFCKEECDFDNWCSLVQKEILKQQSLRMF  348

Query  400  TITETRNVSMPVQYQDMQGEASAEGFKSFDAT  305
             + +      P      + E +  G +  ++T
Sbjct  349  ELVQKHPPHWPPFIPPTKPEVTTTGAELIEST  380



>dbj|BAC98052.1| mKIAA0943 protein [Mus musculus]
 gb|EDL39936.1| autophagy-related 4B (yeast), isoform CRA_d, partial [Mus musculus]
Length=266

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 96/175 (55%), Gaps = 9/175 (5%)
 Frame = -3

Query  865  GGAPALCIDDISRRC------LELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATFS  704
             GA AL  D   R C       E++     W P++LL+PL LGL  +N  Y+  LK  F 
Sbjct  63   AGAAALPTDS-ERHCNGFPAGAEVTNRPSAWRPLVLLIPLRLGLTDINEAYVETLKHCFM  121

Query  703  FPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHC-DVVRQ  527
             PQSLG++GG+P  + Y +G   ++  YLDPH  Q  V+L  D+  I   S+HC     +
Sbjct  122  MPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEL-TDSCFIPDESFHCQHPPSR  180

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQ  362
            + +  +DPS+A+GF+CK + DF+D+C +  +L    G  P+F + E +   +  Q
Sbjct  181  MGIGELDPSIAVGFFCKKEEDFNDWCQQVKKLSQLGGALPMFELVEQQPSHLACQ  235



>dbj|GAM23514.1| hypothetical protein SAMD00019534_066890 [Acytostelium subglobosum 
LB1]
Length=710

 Score =   106 bits (265),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 88/136 (65%), Gaps = 5/136 (4%)
 Frame = -3

Query  793  WApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLD  614
            W  II+L+P+ LG++K+N  Y   +KA    PQS+GI+GG+P  S Y VG QDD  FYLD
Sbjct  505  WKSIIILIPIKLGVEKLNEVYFQEIKAMLEIPQSIGIIGGKPKQSFYFVGHQDDSLFYLD  564

Query  613  PHEVQQVVDLGRDNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCARASE  434
            PH V   V+   D    DT  YHC + +++ +  +DPS+AIGF+C+ ++DF+DFC R  +
Sbjct  565  PHFVHDTVN-PNDITFADT--YHCCIPQKMSISQLDPSMAIGFFCRTEADFEDFCKRIRD  621

Query  433  LVDQSGGAPLFTITET  386
            +  +  G P+ +I +T
Sbjct  622  V--EKSGFPIVSIGDT  635



>ref|XP_010296150.1| PREDICTED: cysteine protease ATG4A, partial [Balearica regulorum 
gibbericeps]
Length=409

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 84/152 (55%), Gaps = 2/152 (1%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            G++ +NP YI   K  F  PQSLG LGG+P  + Y +G   ++  YLDPH  Q  VDL  
Sbjct  244  GINHINPVYIDAFKECFKMPQSLGALGGKPNNAYYFIGFLGNELIYLDPHTTQSFVDL-E  302

Query  577  DNLDIDTSSYHCDVV-RQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLF  401
            +N  +D  S+HC     ++ + ++DPS+A+GF+CK++ DFD++C+   + + +     +F
Sbjct  303  ENGTVDDESFHCQQAPHRMKIMNLDPSVALGFFCKEECDFDNWCSLVQKEILKQQSLRMF  362

Query  400  TITETRNVSMPVQYQDMQGEASAEGFKSFDAT  305
             + +      P      + E +  G +  ++T
Sbjct  363  ELVQKHPPHWPPFIPPTKPEVTTTGAELIEST  394



>ref|XP_006245595.1| PREDICTED: cysteine protease ATG4B isoform X1 [Rattus norvegicus]
Length=393

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 98/175 (56%), Gaps = 9/175 (5%)
 Frame = -3

Query  865  GGAPALCIDDISRRC------LELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATFS  704
             GA AL ++   R C       E++   + W P++LL+PL LGL  +N  Y+  LK  F 
Sbjct  190  AGAAALSMES-ERHCNGLPAGAEVTNRPLAWRPLVLLIPLRLGLTDINEAYVETLKHCFM  248

Query  703  FPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVR-Q  527
             PQSLG++GG+P  + Y +G   ++  YLDPH  Q  V+L  D+  I   S+HC     +
Sbjct  249  MPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEL-TDSCFIPDESFHCQHPPCR  307

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQ  362
            + +  +DPS+A+GF+CK + DF+D+C +  +L    G  P+F + E +   +  Q
Sbjct  308  MGIGELDPSIAVGFFCKTEEDFNDWCQQVKKLSQLGGALPMFELVEQQPSHLACQ  362



>ref|XP_006245596.1| PREDICTED: cysteine protease ATG4B isoform X2 [Rattus norvegicus]
Length=360

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 98/175 (56%), Gaps = 9/175 (5%)
 Frame = -3

Query  865  GGAPALCIDDISRRC------LELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATFS  704
             GA AL ++   R C       E++   + W P++LL+PL LGL  +N  Y+  LK  F 
Sbjct  157  AGAAALSMES-ERHCNGLPAGAEVTNRPLAWRPLVLLIPLRLGLTDINEAYVETLKHCFM  215

Query  703  FPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVR-Q  527
             PQSLG++GG+P  + Y +G   ++  YLDPH  Q  V+L  D+  I   S+HC     +
Sbjct  216  MPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVELT-DSCFIPDESFHCQHPPCR  274

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQ  362
            + +  +DPS+A+GF+CK + DF+D+C +  +L    G  P+F + E +   +  Q
Sbjct  275  MGIGELDPSIAVGFFCKTEEDFNDWCQQVKKLSQLGGALPMFELVEQQPSHLACQ  329



>gb|KFR04240.1| Cysteine protease ATG4A, partial [Opisthocomus hoazin]
Length=395

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 84/152 (55%), Gaps = 2/152 (1%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            G++ +NP YI   K  F  PQSLG LGG+P  + Y +G   ++  YLDPH  Q  VDL  
Sbjct  230  GINHINPVYIDAFKECFKMPQSLGALGGKPNNAYYFIGFLGNELIYLDPHTTQSFVDL-E  288

Query  577  DNLDIDTSSYHCDVV-RQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLF  401
            +N  +D  S+HC     ++ + ++DPS+A+GF+CK++ DFD++C+   + + +     +F
Sbjct  289  ENGTVDDESFHCQQAPHRMKIMNLDPSVALGFFCKEECDFDNWCSLVQKEILKQQSLRMF  348

Query  400  TITETRNVSMPVQYQDMQGEASAEGFKSFDAT  305
             + +      P      + E +  G +  ++T
Sbjct  349  ELVQKHPPHWPPFVPPAKPEVTTTGAELIEST  380



>gb|EFB16574.1| hypothetical protein PANDA_012287, partial [Ailuropoda melanoleuca]
Length=369

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 94/166 (57%), Gaps = 9/166 (5%)
 Frame = -3

Query  865  GGAPALCIDDISRRC------LELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATFS  704
             GA +L  D  SR C       E++     W P++LL+PL LGL  +N  Y+  LK  F 
Sbjct  187  AGAASLSADS-SRHCNGFPAGAEVTDRPAPWRPLVLLIPLRLGLTDINEAYVETLKRCFM  245

Query  703  FPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHC-DVVRQ  527
             PQSLG++GG+P  + Y +G   ++  YLDPH  Q  V+L  D+  I   S+HC     +
Sbjct  246  MPQSLGVIGGKPNSAHYFIGYAGEELIYLDPHTTQPAVEL-TDSCFIADESFHCRHPPSR  304

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITE  389
            + +  +DPS+A+GF+CK + DFDD+C +  +L    G  P+F + E
Sbjct  305  MSIGELDPSIAVGFFCKTEDDFDDWCQQVRQLSLLGGALPMFELVE  350



>ref|XP_007428173.1| PREDICTED: cysteine protease ATG4A isoform X2 [Python bivittatus]
Length=384

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 83/152 (55%), Gaps = 2/152 (1%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            G++ +NP Y+   K  F  PQSLG LGG+P  + Y +G   ++  YLDPH  Q  VD   
Sbjct  219  GINHINPVYVDAFKECFKMPQSLGALGGKPNNAYYFIGFLGNELIYLDPHTTQVFVD-SD  277

Query  577  DNLDIDTSSYHCDVV-RQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLF  401
            +N  +D  S+HC     ++ + ++DPS+A+GF+CK++ DFD++C+   + + +     +F
Sbjct  278  ENGTVDDHSFHCQQAPHRMKIMNLDPSVALGFFCKEEKDFDNWCSLVQKEIHKKQSLRMF  337

Query  400  TITETRNVSMPVQYQDMQGEASAEGFKSFDAT  305
             + +      P      + E +  G +  D+T
Sbjct  338  ELVQKHPAHWPPFIPPTKPEVTTTGAELIDST  369



>ref|XP_009943544.1| PREDICTED: cysteine protease ATG4A [Opisthocomus hoazin]
Length=403

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 84/152 (55%), Gaps = 2/152 (1%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            G++ +NP YI   K  F  PQSLG LGG+P  + Y +G   ++  YLDPH  Q  VDL  
Sbjct  238  GINHINPVYIDAFKECFKMPQSLGALGGKPNNAYYFIGFLGNELIYLDPHTTQSFVDL-E  296

Query  577  DNLDIDTSSYHCDVV-RQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLF  401
            +N  +D  S+HC     ++ + ++DPS+A+GF+CK++ DFD++C+   + + +     +F
Sbjct  297  ENGTVDDESFHCQQAPHRMKIMNLDPSVALGFFCKEECDFDNWCSLVQKEILKQQSLRMF  356

Query  400  TITETRNVSMPVQYQDMQGEASAEGFKSFDAT  305
             + +      P      + E +  G +  ++T
Sbjct  357  ELVQKHPPHWPPFVPPAKPEVTTTGAELIEST  388



>ref|XP_007428172.1| PREDICTED: cysteine protease ATG4A isoform X1 [Python bivittatus]
Length=385

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 83/152 (55%), Gaps = 2/152 (1%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            G++ +NP Y+   K  F  PQSLG LGG+P  + Y +G   ++  YLDPH  Q  VD   
Sbjct  220  GINHINPVYVDAFKECFKMPQSLGALGGKPNNAYYFIGFLGNELIYLDPHTTQVFVD-SD  278

Query  577  DNLDIDTSSYHCDVV-RQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLF  401
            +N  +D  S+HC     ++ + ++DPS+A+GF+CK++ DFD++C+   + + +     +F
Sbjct  279  ENGTVDDHSFHCQQAPHRMKIMNLDPSVALGFFCKEEKDFDNWCSLVQKEIHKKQSLRMF  338

Query  400  TITETRNVSMPVQYQDMQGEASAEGFKSFDAT  305
             + +      P      + E +  G +  D+T
Sbjct  339  ELVQKHPAHWPPFIPPTKPEVTTTGAELIDST  370



>ref|XP_005045997.1| PREDICTED: cysteine protease ATG4A isoform X1 [Ficedula albicollis]
Length=413

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 90/177 (51%), Gaps = 10/177 (6%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            G++ +NP YI   K  F  PQSLG LGG+P  + Y +G   ++  YLDPH  Q  VD   
Sbjct  230  GINHINPVYIDAFKECFKMPQSLGALGGKPNNAYYFIGFLGNELIYLDPHTTQSFVD-SE  288

Query  577  DNLDIDTSSYHCDVV-RQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLF  401
            +N  +D  S+HC     ++ + ++DPS+A+GF+CK++ DFD++C+   + + +     +F
Sbjct  289  ENGTVDDQSFHCQQAPHRMKIMNLDPSVALGFFCKEECDFDNWCSLVQKEILKQQSLRMF  348

Query  400  TITETRNVSMPVQYQDMQGEASAEG-----FKSFDATSIG---DSENGKQEDDWQLL  254
             + +      P      + E +  G      K    + +G     EN  + ++W  L
Sbjct  349  ELVQKHPPHWPPFIPPTKPEVTTTGAGVVPLKVLLGSRVGLLSQQENHHRWNNWAFL  405



>gb|ETI44487.1| hypothetical protein F443_10814 [Phytophthora parasitica P1569]
 gb|ETM44342.1| hypothetical protein L914_10407 [Phytophthora parasitica]
Length=412

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 80/132 (61%), Gaps = 10/132 (8%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            GLD+VN RY+P ++ TF+FPQS+GI+GG+ G S Y VG Q DQ   LDPH+V    +L  
Sbjct  243  GLDQVNERYVPAIQKTFAFPQSVGIIGGKKGHSVYFVGTQQDQLHLLDPHDVHPAPEL--  300

Query  577  DNLDIDTSSYHCDVVRQLPL----DSIDPSLAIGFYCKDKSDFDDFCARASEL---VDQS  419
             N    T+++   V    PL     +IDPSLA+GF C++++D++DF  R   L   V + 
Sbjct  301  -NAAFPTATHLRTVHSSRPLVMNVTTIDPSLALGFLCENRADYEDFERRVRILHDEVKEE  359

Query  418  GGAPLFTITETR  383
            GG   F++   R
Sbjct  360  GGMCPFSVAARR  371



>ref|XP_011228071.1| PREDICTED: cysteine protease ATG4B isoform X1 [Ailuropoda melanoleuca]
Length=399

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 94/166 (57%), Gaps = 9/166 (5%)
 Frame = -3

Query  865  GGAPALCIDDISRRC------LELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATFS  704
             GA +L  D  SR C       E++     W P++LL+PL LGL  +N  Y+  LK  F 
Sbjct  211  AGAASLSADS-SRHCNGFPAGAEVTDRPAPWRPLVLLIPLRLGLTDINEAYVETLKRCFM  269

Query  703  FPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHC-DVVRQ  527
             PQSLG++GG+P  + Y +G   ++  YLDPH  Q  V+L  D+  I   S+HC     +
Sbjct  270  MPQSLGVIGGKPNSAHYFIGYAGEELIYLDPHTTQPAVEL-TDSCFIADESFHCRHPPSR  328

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITE  389
            + +  +DPS+A+GF+CK + DFDD+C +  +L    G  P+F + E
Sbjct  329  MSIGELDPSIAVGFFCKTEDDFDDWCQQVRQLSLLGGALPMFELVE  374



>ref|XP_008906761.1| hypothetical protein PPTG_12477 [Phytophthora parasitica INRA-310]
 gb|ETK84486.1| hypothetical protein L915_10556 [Phytophthora parasitica]
 gb|ETL37926.1| hypothetical protein L916_10445 [Phytophthora parasitica]
 gb|ETN07957.1| hypothetical protein PPTG_12477 [Phytophthora parasitica INRA-310]
 gb|ETO73143.1| hypothetical protein F444_10890 [Phytophthora parasitica P1976]
 gb|ETP14327.1| hypothetical protein F441_10739 [Phytophthora parasitica CJ01A1]
 gb|ETP42374.1| hypothetical protein F442_10711 [Phytophthora parasitica P10297]
Length=412

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 80/132 (61%), Gaps = 10/132 (8%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            GLD+VN RY+P ++ TF+FPQS+GI+GG+ G S Y VG Q DQ   LDPH+V    +L  
Sbjct  243  GLDQVNERYVPAIQKTFAFPQSVGIIGGKKGHSVYFVGTQQDQLHLLDPHDVHPAPEL--  300

Query  577  DNLDIDTSSYHCDVVRQLPL----DSIDPSLAIGFYCKDKSDFDDFCARASEL---VDQS  419
             N    T+++   V    PL     +IDPSLA+GF C++++D++DF  R   L   V + 
Sbjct  301  -NAAFPTATHLRTVHSSRPLVMNVTTIDPSLALGFLCENRADYEDFERRVRILHDEVKEE  359

Query  418  GGAPLFTITETR  383
            GG   F++   R
Sbjct  360  GGMCPFSVAARR  371



>ref|XP_006136305.1| PREDICTED: cysteine protease ATG4A [Pelodiscus sinensis]
Length=411

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/152 (32%), Positives = 84/152 (55%), Gaps = 2/152 (1%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            G++ +NP YI   K  F  PQSLG LGG+P  + Y +G   ++  YLDPH  Q  VDL  
Sbjct  246  GINHINPIYIDAFKECFKMPQSLGALGGKPNNAYYFIGFLGNELIYLDPHTTQVFVDLEE  305

Query  577  DNLDIDTSSYHCDVV-RQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLF  401
            + + +D  S+HC     ++ + ++DPS+A+GF+CK++ DFD++C+   + + +     +F
Sbjct  306  NGM-VDDKSFHCQQAPHRMEIMNLDPSVALGFFCKEEKDFDNWCSLVQKEILKQQSLRMF  364

Query  400  TITETRNVSMPVQYQDMQGEASAEGFKSFDAT  305
             + +      P      + E +  G +  ++T
Sbjct  365  ELVKNHPAHWPPFKPPAKPEVTTTGAELIEST  396



>emb|CDQ77825.1| unnamed protein product [Oncorhynchus mykiss]
Length=422

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 85/144 (59%), Gaps = 2/144 (1%)
 Frame = -3

Query  811  SKGQVDWApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDD  632
            S+ + DW P++L++PL LG++ +NP YI  LK  F  PQS G+LGG+P ++ Y +G   +
Sbjct  239  SQSRSDWRPLLLVIPLRLGINHINPVYIQALKECFKIPQSCGVLGGKPNLAYYFIGFVGE  298

Query  631  QAFYLDPHEVQQVVDLGRDNLDIDTSSYHC-DVVRQLPLDSIDPSLAIGFYCKDKSDFDD  455
            +  YLDPH  Q  V+       +D  SYHC    R++ + ++DPS+A+GF+CK + DFD 
Sbjct  299  ELIYLDPHTTQSAVE-SEAGSGVDDQSYHCLRSPRRMKITNLDPSVALGFFCKSEGDFDS  357

Query  454  FCARASELVDQSGGAPLFTITETR  383
            +C    + +       +F + E  
Sbjct  358  WCNLVQQEIQMKRNLRMFELVENH  381



>ref|XP_011414249.1| PREDICTED: cysteine protease ATG4B-like [Crassostrea gigas]
 gb|EKC37327.1| Cysteine protease ATG4B [Crassostrea gigas]
Length=405

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 78/142 (55%), Gaps = 3/142 (2%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            GL ++N  Y+  LKA  SFPQS+GI+GG+P  + + VG   D+  YLDPH  Q   DL  
Sbjct  248  GLTEINSVYVQSLKACLSFPQSVGIIGGKPNHAHWFVGYMSDKLIYLDPHTTQLCEDL--  305

Query  577  DNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFT  398
            D+ +    SYHC     + +  +DPS+A+GFYC  + +FDD      + V  S   P+F 
Sbjct  306  DSPNFSDESYHCPYPSTMNVMELDPSIALGFYCGTEKEFDDLTQSVQKFVVGSSKTPMFE  365

Query  397  ITETRNVSMPVQYQDMQGEASA  332
            + + R    P  Y+   G+ ++
Sbjct  366  LYKDRPPHWP-PYESYTGQTTS  386



>dbj|GAC95763.1| cysteine protease [Pseudozyma hubeiensis SY62]
Length=1371

 Score =   107 bits (266),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 95/198 (48%), Gaps = 46/198 (23%)
 Frame = -3

Query  757   GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDL--  584
             GL+ VNP Y   +KATFSFP S+GI GGRP  S Y +G Q +  FYLDPH V+  V L  
Sbjct  832   GLESVNPIYYESVKATFSFPHSVGIAGGRPSSSYYFMGHQGNSLFYLDPHNVRPAVPLRY  891

Query  583   -------------------------------GRDNLDIDTSSYHCDVVRQLPLDSIDPSL  497
                                             +   +  TS++HC+ VR++P+ S+DPS+
Sbjct  892   PPSSFPSAVPCHHDIARRFAQEDSDDEQEWWAQAYTEAQTSTFHCEKVRRMPIKSLDPSM  951

Query  496   AIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQYQDMQGEASAEGFKS  317
              +GF  KD+ D  D CAR   L        +F+  E    S P    D   + S E   S
Sbjct  952   LLGFLVKDEEDLIDLCARIKALPKT-----IFSFAE----SAPKWVDDDDFDPSME---S  999

Query  316   FDATSIGD-SENGKQEDD  266
             F   SIGD +E+G  E++
Sbjct  1000  FSEPSIGDGTEDGGDENN  1017



>ref|XP_011228072.1| PREDICTED: cysteine protease ATG4B isoform X2 [Ailuropoda melanoleuca]
Length=414

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 94/166 (57%), Gaps = 9/166 (5%)
 Frame = -3

Query  865  GGAPALCIDDISRRC------LELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATFS  704
             GA +L  D  SR C       E++     W P++LL+PL LGL  +N  Y+  LK  F 
Sbjct  211  AGAASLSADS-SRHCNGFPAGAEVTDRPAPWRPLVLLIPLRLGLTDINEAYVETLKRCFM  269

Query  703  FPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHC-DVVRQ  527
             PQSLG++GG+P  + Y +G   ++  YLDPH  Q  V+L  D+  I   S+HC     +
Sbjct  270  MPQSLGVIGGKPNSAHYFIGYAGEELIYLDPHTTQPAVEL-TDSCFIADESFHCRHPPSR  328

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITE  389
            + +  +DPS+A+GF+CK + DFDD+C +  +L    G  P+F + E
Sbjct  329  MSIGELDPSIAVGFFCKTEDDFDDWCQQVRQLSLLGGALPMFELVE  374



>ref|XP_007670381.1| PREDICTED: LOW QUALITY PROTEIN: cysteine protease ATG4A [Ornithorhynchus 
anatinus]
Length=406

 Score =   103 bits (258),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 84/152 (55%), Gaps = 2/152 (1%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            G++ +NP YI   K  F  PQSLG LGG+P  + Y +G   ++  YLDPH  Q  VD   
Sbjct  241  GINHINPIYIDAFKECFKTPQSLGALGGKPNNAYYFIGFLGNELIYLDPHTTQTFVD-TE  299

Query  577  DNLDIDTSSYHCDVVRQ-LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLF  401
            +N  +D  S+HC    Q + + ++DPS+A+GF+CK++ DFD++C+   + + +     +F
Sbjct  300  ENGQVDDHSFHCQQAPQRMKIMNLDPSVALGFFCKEEKDFDNWCSLVQKEILRQQSLRMF  359

Query  400  TITETRNVSMPVQYQDMQGEASAEGFKSFDAT  305
             + + R    P      + E +  G +  ++T
Sbjct  360  ELVQKRPSHWPPFIPPAKPEVTMTGAELIEST  391



>emb|CDS10461.1| hypothetical protein LRAMOSA03137 [Absidia idahoensis var. thermophila]
Length=481

 Score =   104 bits (259),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 75/129 (58%), Gaps = 12/129 (9%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPH------EVQQ  596
            G+D+++P Y P LK     P  +GI GGRP  S Y VG+Q D  FYLDPH      E   
Sbjct  322  GIDQLHPTYYPALKECMRLPWFVGIAGGRPNSSLYFVGLQGDDLFYLDPHFSRPALETLP  381

Query  595  VVDLGRDNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSG  416
            + D  + +LD    +YHC + R++ +  +DPS+ +GFYC+ +S+ D FC R +++     
Sbjct  382  MHDYTKQDLD----TYHCPIPRKIHISQLDPSMMLGFYCRTRSELDAFCDRITQMSKMY-  436

Query  415  GAPLFTITE  389
              P+FTI +
Sbjct  437  -TPIFTIAK  444



>ref|XP_009644817.1| PREDICTED: cysteine protease ATG4A [Egretta garzetta]
Length=473

 Score =   104 bits (259),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 84/152 (55%), Gaps = 2/152 (1%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            G++ +NP YI   K  F  PQSLG LGG+P  + Y +G   ++  YLDPH  Q  VDL  
Sbjct  308  GINHINPVYIDAFKECFKMPQSLGALGGKPNNAYYFIGFLGNELIYLDPHTTQSFVDL-E  366

Query  577  DNLDIDTSSYHCDVV-RQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLF  401
            +N  +D  S+HC     ++ + ++DPS+A+GF+CK++ DFD++C+   + + +     +F
Sbjct  367  ENGTVDDESFHCQQAPHRMKIMNLDPSVALGFFCKEECDFDNWCSLVQKEILKQQSLRMF  426

Query  400  TITETRNVSMPVQYQDMQGEASAEGFKSFDAT  305
             + +      P      + E +  G +  ++T
Sbjct  427  ELVQKHPPHWPPFIPPTKPEVTTTGAELIEST  458



>ref|XP_007654448.1| PREDICTED: cysteine protease ATG4D [Ornithorhynchus anatinus]
Length=297

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 87/151 (58%), Gaps = 3/151 (2%)
 Frame = -3

Query  838  DISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPGVS  659
            D++R   +    + +W  II+LVP+ LG + +NP Y+P +K        LGI+GG+P  S
Sbjct  108  DMARLAGQPGDPEAEWKSIIILVPVRLGGETLNPAYMPCIKELLRMEPCLGIIGGKPKHS  167

Query  658  TYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYC  479
             Y +G QDD   YLDPH  Q  VD  +D+  ++  S+HC   R+LP   +DPS  +GFY 
Sbjct  168  LYFIGYQDDFLLYLDPHYCQPCVDTMKDSFPLE--SFHCTAPRKLPFAKMDPSCTVGFYA  225

Query  478  KDKSDFDDFCARASELVDQSGGA-PLFTITE  389
              + DF+  C++  + ++ +    P+FT+ E
Sbjct  226  GTRKDFEALCSQLLQALNSTATRYPMFTVAE  256



>gb|KFM59607.1| Cysteine protease ATG4C, partial [Stegodyphus mimosarum]
Length=704

 Score =   105 bits (263),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 76/131 (58%), Gaps = 12/131 (9%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            G DK+NP YIP LK+  ++   +GI+GGRP  + Y +G QDD+  ++DPH  Q  VD+ +
Sbjct  543  GNDKINPFYIPCLKSLLAYEHCIGIIGGRPKHALYFIGWQDDKLIHMDPHSCQPAVDVEK  602

Query  577  DNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFT  398
            +  D +  S+H   +R +    +DPS AIGFY + K DFD F  + SE+      AP+  
Sbjct  603  E--DFNEKSFHSSSIRTMSFTEMDPSCAIGFYFRKKEDFDHFVTKFSEIT-----APM--  653

Query  397  ITETRNVSMPV  365
                +N+  PV
Sbjct  654  ---KKNLDYPV  661



>ref|XP_010894736.1| PREDICTED: cysteine protease ATG4B isoform X2 [Esox lucius]
Length=403

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 74/124 (60%), Gaps = 3/124 (2%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            GL  +N  YI  LK  F  PQSLG++GG+P  + Y +G   ++  YLDPH  Q  V+ G 
Sbjct  241  GLSDINEAYIETLKC-FQLPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPGE  299

Query  577  DNLDIDTSSYHCDVVR-QLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLF  401
            D   +   +YHC     ++ +  IDPS+A+GF+C+ + DFDD+CAR  +L    GG P+F
Sbjct  300  DG-QVPDDTYHCQHPPCRMHICQIDPSIAVGFFCRTEDDFDDWCARVRKLSHSRGGLPMF  358

Query  400  TITE  389
             + +
Sbjct  359  ELAD  362



>ref|XP_002592932.1| hypothetical protein BRAFLDRAFT_275700 [Branchiostoma floridae]
 gb|EEN48943.1| hypothetical protein BRAFLDRAFT_275700 [Branchiostoma floridae]
Length=380

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 76/131 (58%), Gaps = 2/131 (2%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            GL ++NP Y   LKA F+  QSLG++GG+P  + Y +G   +   YLDPH  Q  V+L  
Sbjct  235  GLSELNPVYTDCLKACFTLRQSLGMIGGKPNHAHYFIGYVGNSLVYLDPHTTQPAVEL-E  293

Query  577  DNLDIDTSSYHCDVVRQLPLDSIDPSLAIGFYCKDKSDFDDFCARASEL-VDQSGGAPLF  401
             N+ I  SS+HC    ++ +  +DPS+A+GF+C+D++DF D C     L + Q     +F
Sbjct  294  GNVPIPDSSFHCTHPSRMNIQDLDPSIALGFFCQDEADFADLCENMRRLIIGQKTQNAMF  353

Query  400  TITETRNVSMP  368
             + ++R    P
Sbjct  354  EVVQSRPAHWP  364



>gb|ERL94645.1| hypothetical protein D910_11920, partial [Dendroctonus ponderosae]
Length=399

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 82/145 (57%), Gaps = 4/145 (3%)
 Frame = -3

Query  844  IDDISRRCLELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPG  665
            I DI   C++ +  +  W  ++LL+P+ LG +K N  Y P L   FS  + +GI+GGRP 
Sbjct  259  IRDIFAECIDQATNK--WKSLVLLIPVRLGAEKFNSIYSPCLTTLFSIKECIGIIGGRPK  316

Query  664  VSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQLPLDSIDPSLAIGF  485
             S Y VG QDD+  +LDPH  Q+VVD+     D   +++HC   R+LP+  IDPS  IGF
Sbjct  317  HSLYFVGYQDDRLIHLDPHYCQEVVDVWAS--DFPLTTFHCRSPRKLPISKIDPSCCIGF  374

Query  484  YCKDKSDFDDFCARASELVDQSGGA  410
            YC+ K DF         +V    GA
Sbjct  375  YCRTKEDFLTLVETVQPIVVPPHGA  399



>ref|XP_008275327.1| PREDICTED: cysteine protease ATG4D [Stegastes partitus]
Length=499

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 91/158 (58%), Gaps = 9/158 (6%)
 Frame = -3

Query  841  DDISRRC-LELSKGQVD-----WApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGIL  680
            +D+ R C L LS+   D     W  +I+LVP+ LG + +NP YI  +K        +GI+
Sbjct  301  EDVVRLCDLSLSQTVPDPSSQAWKSVIILVPVRLGGEALNPSYIECVKNILKLDCCIGII  360

Query  679  GGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDVVRQLPLDSIDPS  500
            GG+P  S Y +G QD+Q  YLDPH  Q ++D+ + N  ++  S+HC   +++P + +DPS
Sbjct  361  GGKPKHSLYFIGFQDEQLLYLDPHYCQPMIDVTQVNFSLE--SFHCSSPKKMPFNRMDPS  418

Query  499  LAIGFYCKDKSDFDDFCARASELVDQSG-GAPLFTITE  389
              IGFY K+K DF+  C+  S  +  S    P+FT  E
Sbjct  419  CTIGFYAKNKKDFESLCSAVSMALSSSKEKYPVFTFVE  456



>ref|XP_006529856.1| PREDICTED: cysteine protease ATG4B isoform X1 [Mus musculus]
Length=319

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 96/174 (55%), Gaps = 9/174 (5%)
 Frame = -3

Query  862  GAPALCIDDISRRC------LELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATFSF  701
            GA AL  D   R C       E++     W P++LL+PL LGL  +N  Y+  LK  F  
Sbjct  117  GAAALPTDS-ERHCNGFPAGAEVTNRPSAWRPLVLLIPLRLGLTDINEAYVETLKHCFMM  175

Query  700  PQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDV-VRQL  524
            PQSLG++GG+P  + Y +G   ++  YLDPH  Q  V+L  D+  I   S+HC     ++
Sbjct  176  PQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEL-TDSCFIPDESFHCQHPPSRM  234

Query  523  PLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQ  362
             +  +DPS+A+GF+CK + DF+D+C +  +L    G  P+F + E +   +  Q
Sbjct  235  GIGELDPSIAVGFFCKTEEDFNDWCQQVKKLSQLGGALPMFELVEQQPSHLACQ  288



>ref|XP_004620730.1| PREDICTED: cysteine protease ATG4B [Sorex araneus]
Length=319

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 85/146 (58%), Gaps = 2/146 (1%)
 Frame = -3

Query  817  ELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQ  638
            EL+     W P++LL+PL LGL  +N  Y+  LK  F  PQSLG++GG+P  + Y +G  
Sbjct  137  ELANRPASWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYV  196

Query  637  DDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHC-DVVRQLPLDSIDPSLAIGFYCKDKSDF  461
             ++  YLDPH  Q  V+L      I   S+HC     ++ +  +DPS+A+GF+CK + DF
Sbjct  197  GEELIYLDPHTTQPAVELTGSCF-IPDESFHCQHPPSRMSIAELDPSIAVGFFCKTEGDF  255

Query  460  DDFCARASELVDQSGGAPLFTITETR  383
            DD+C +  +L    G  P+F + E +
Sbjct  256  DDWCQQVRKLSQLGGALPMFELVEQQ  281



>ref|XP_006750817.1| PREDICTED: cysteine protease ATG4B [Leptonychotes weddellii]
Length=383

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 93/166 (56%), Gaps = 9/166 (5%)
 Frame = -3

Query  865  GGAPALCIDDISRRC------LELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATFS  704
             GA AL  D  SR C       EL+     W P++LL+PL LGL  +N  Y+  LK  F 
Sbjct  195  AGAAALPADS-SRHCNGFPAGAELTNRPAPWRPLVLLIPLRLGLTDINEAYVETLKRCFM  253

Query  703  FPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHC-DVVRQ  527
             PQSLG++GG+P  + Y +G   ++  YLDPH  Q  V+   D+  I   S+HC     +
Sbjct  254  MPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEF-TDSCFIPDESFHCQHPPSR  312

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITE  389
            + +  +DPS+A+GF+CK + DFDD+C +  ++    G  P+F + E
Sbjct  313  MSIGELDPSIAVGFFCKTEDDFDDWCRQVRQVSLLGGALPMFELVE  358



>gb|EDL39932.1| autophagy-related 4B (yeast), isoform CRA_a, partial [Mus musculus]
Length=390

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 96/175 (55%), Gaps = 9/175 (5%)
 Frame = -3

Query  865  GGAPALCIDDISRRC------LELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATFS  704
             GA AL  D   R C       E++     W P++LL+PL LGL  +N  Y+  LK  F 
Sbjct  187  AGAAALPTDS-ERHCNGFPAGAEVTNRPSAWRPLVLLIPLRLGLTDINEAYVETLKHCFM  245

Query  703  FPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDV-VRQ  527
             PQSLG++GG+P  + Y +G   ++  YLDPH  Q  V+L  D+  I   S+HC     +
Sbjct  246  MPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEL-TDSCFIPDESFHCQHPPSR  304

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQ  362
            + +  +DPS+A+GF+CK + DF+D+C +  +L    G  P+F + E +   +  Q
Sbjct  305  MGIGELDPSIAVGFFCKKEEDFNDWCQQVKKLSQLGGALPMFELVEQQPSHLACQ  359



>gb|AAH27184.1| Autophagy-related 4B (yeast) [Mus musculus]
 dbj|BAC40587.1| unnamed protein product [Mus musculus]
 dbj|BAE25791.1| unnamed protein product [Mus musculus]
Length=393

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 96/175 (55%), Gaps = 9/175 (5%)
 Frame = -3

Query  865  GGAPALCIDDISRRC------LELSKGQVDWApiillvplvLGLDKVNPRYIPLLKATFS  704
             GA AL  D   R C       E++     W P++LL+PL LGL  +N  Y+  LK  F 
Sbjct  190  AGAAALPTDS-ERHCNGFPAGAEVTNRPSAWRPLVLLIPLRLGLTDINEAYVETLKHCFM  248

Query  703  FPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGRDNLDIDTSSYHCDV-VRQ  527
             PQSLG++GG+P  + Y +G   ++  YLDPH  Q  V+L  D+  I   S+HC     +
Sbjct  249  MPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEL-TDSCFIPDESFHCQHPPSR  307

Query  526  LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLFTITETRNVSMPVQ  362
            + +  +DPS+A+GF+CK + DF+D+C +  +L    G  P+F + E +   +  Q
Sbjct  308  MGIGELDPSIAVGFFCKKEEDFNDWCQQVKKLSQLGGALPMFELVEQQPSHLACQ  362



>gb|KFV52897.1| Cysteine protease ATG4A, partial [Tyto alba]
Length=395

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 83/152 (55%), Gaps = 2/152 (1%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            G++ +NP YI   K  F  PQSLG LGG+P  + Y +G   ++  YLDPH  Q  VD   
Sbjct  230  GINHINPVYIDAFKECFKMPQSLGALGGKPNNAYYFIGFLGNELIYLDPHTTQSFVD-SE  288

Query  577  DNLDIDTSSYHCDVVRQ-LPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLF  401
            +N  +D  S+HC    Q + + ++DPS+A+GF+CK++ DFD++C+   + + +     +F
Sbjct  289  ENGTVDDQSFHCQQAPQRMKIMNLDPSVALGFFCKEECDFDNWCSLVQKEILKQQSLRMF  348

Query  400  TITETRNVSMPVQYQDMQGEASAEGFKSFDAT  305
             + +      P      + E +  G +  ++T
Sbjct  349  ELVQKHPPHWPPFIPPTKPEVTTSGAELIEST  380



>gb|KFQ29247.1| Cysteine protease ATG4A, partial [Mesitornis unicolor]
Length=395

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 83/152 (55%), Gaps = 2/152 (1%)
 Frame = -3

Query  757  GLDKVNPRYIPLLKATFSFPQSLGILGGRPGVSTYIVGVQDDQAFYLDPHEVQQVVDLGR  578
            G++ +NP YI   K  F  PQSLG LGG+P  + Y +G   ++  YLDPH  Q  VDL  
Sbjct  230  GINHINPVYIDAFKECFKMPQSLGALGGKPNNAYYFIGFLGNELIYLDPHTTQSFVDL-E  288

Query  577  DNLDIDTSSYHCDVV-RQLPLDSIDPSLAIGFYCKDKSDFDDFCARASELVDQSGGAPLF  401
            +N  +D  S+HC     ++ + ++DPS+A+GF+CK++ DFD +C+   + + +     +F
Sbjct  289  ENGTVDDQSFHCQQAPHRMKIMNLDPSVALGFFCKEECDFDSWCSLVQKEILKQQSLRMF  348

Query  400  TITETRNVSMPVQYQDMQGEASAEGFKSFDAT  305
             + +      P      + E +  G +  ++T
Sbjct  349  ELVQKHPPHWPPFIPPSKPEVTTTGAELIEST  380



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2032267776884