BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13678

Length=819
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EPS60527.1|  hypothetical protein M569_14276                         271   5e-87   Genlisea aurea
gb|KDO65284.1|  hypothetical protein CISIN_1g010649mg                   276   8e-86   Citrus sinensis [apfelsine]
ref|XP_006426523.1|  hypothetical protein CICLE_v10025421mg             276   8e-86   
ref|XP_010314157.1|  PREDICTED: ethylene-responsive RNA helicase ...    276   1e-85   
ref|XP_006645603.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    276   1e-85   Oryza brachyantha
gb|EEE54050.1|  hypothetical protein OsJ_00740                          275   1e-85   Oryza sativa Japonica Group [Japonica rice]
emb|CAA09209.1|  RNA helicase                                           266   1e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009625322.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    276   2e-85   Nicotiana tomentosiformis
gb|EEC70110.1|  hypothetical protein OsI_00766                          275   2e-85   Oryza sativa Indica Group [Indian rice]
sp|Q5QMN3.2|RH20_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA ...    275   2e-85   Oryza sativa Japonica Group [Japonica rice]
gb|KDO65286.1|  hypothetical protein CISIN_1g010649mg                   275   2e-85   Citrus sinensis [apfelsine]
gb|KDO65287.1|  hypothetical protein CISIN_1g010649mg                   275   3e-85   Citrus sinensis [apfelsine]
ref|XP_006426524.1|  hypothetical protein CICLE_v10025421mg             275   3e-85   Citrus clementina [clementine]
ref|XP_006426525.1|  hypothetical protein CICLE_v10025421mg             275   3e-85   Citrus clementina [clementine]
ref|XP_006466042.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    275   4e-85   Citrus sinensis [apfelsine]
ref|XP_006426526.1|  hypothetical protein CICLE_v10025421mg             275   4e-85   
ref|XP_006466041.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    275   4e-85   Citrus sinensis [apfelsine]
ref|XP_006366150.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    275   4e-85   Solanum tuberosum [potatoes]
ref|XP_011072507.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    275   5e-85   Sesamum indicum [beniseed]
gb|KHG24204.1|  DEAD-box ATP-dependent RNA helicase 20 -like protein    275   5e-85   Gossypium arboreum [tree cotton]
ref|XP_010106662.1|  DEAD-box ATP-dependent RNA helicase 20             274   7e-85   
gb|KJB70270.1|  hypothetical protein B456_011G066000                    274   7e-85   Gossypium raimondii
gb|KHF98903.1|  DEAD-box ATP-dependent RNA helicase 20 -like protein    275   9e-85   Gossypium arboreum [tree cotton]
emb|CDO97919.1|  unnamed protein product                                274   1e-84   Coffea canephora [robusta coffee]
gb|KJB56890.1|  hypothetical protein B456_009G140700                    273   2e-84   Gossypium raimondii
ref|XP_006858286.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    273   2e-84   Amborella trichopoda
ref|XP_010242202.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    273   2e-84   Nelumbo nucifera [Indian lotus]
ref|XP_009802114.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    273   2e-84   Nicotiana sylvestris
ref|XP_010262147.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    273   2e-84   Nelumbo nucifera [Indian lotus]
ref|XP_010262146.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    273   2e-84   Nelumbo nucifera [Indian lotus]
ref|XP_010262145.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    273   3e-84   Nelumbo nucifera [Indian lotus]
gb|KJB56888.1|  hypothetical protein B456_009G140700                    273   4e-84   Gossypium raimondii
ref|NP_001142117.1|  uncharacterized protein LOC100274281               272   4e-84   Zea mays [maize]
emb|CDM81540.1|  unnamed protein product                                271   6e-84   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007024450.1|  DEA(D/H)-box RNA helicase family protein           271   8e-84   
ref|XP_002527412.1|  dead box ATP-dependent RNA helicase, putative      271   8e-84   Ricinus communis
ref|XP_012068991.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    271   1e-83   Jatropha curcas
ref|XP_008447604.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    271   1e-83   Cucumis melo [Oriental melon]
ref|XP_004146825.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    271   1e-83   Cucumis sativus [cucumbers]
ref|XP_008805786.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    271   1e-83   Phoenix dactylifera
ref|XP_003564953.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    270   2e-83   Brachypodium distachyon [annual false brome]
ref|XP_004968530.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    270   2e-83   Setaria italica
ref|XP_008805785.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    271   3e-83   Phoenix dactylifera
ref|XP_006385358.1|  DEAD box RNA helicase family protein               270   4e-83   
ref|XP_004968529.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    270   4e-83   
gb|KHN39300.1|  DEAD-box ATP-dependent RNA helicase 20                  267   5e-83   Glycine soja [wild soybean]
ref|XP_009380443.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    269   8e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002279117.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    269   8e-83   Vitis vinifera
ref|XP_011000790.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    269   9e-83   Populus euphratica
ref|XP_010915213.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    269   9e-83   Elaeis guineensis
ref|XP_007135556.1|  hypothetical protein PHAVU_010G139400g             269   1e-82   Phaseolus vulgaris [French bean]
gb|EYU21378.1|  hypothetical protein MIMGU_mgv1a004869mg                268   1e-82   Erythranthe guttata [common monkey flower]
ref|XP_006392681.1|  hypothetical protein EUTSA_v10011413mg             266   2e-82   Eutrema salsugineum [saltwater cress]
ref|XP_006583016.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    268   2e-82   Glycine max [soybeans]
ref|XP_010480030.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    266   3e-82   Camelina sativa [gold-of-pleasure]
ref|XP_003529884.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    268   3e-82   Glycine max [soybeans]
ref|XP_010501121.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    267   5e-82   Camelina sativa [gold-of-pleasure]
ref|XP_003531619.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    267   5e-82   Glycine max [soybeans]
ref|XP_006392683.1|  hypothetical protein EUTSA_v10011413mg             266   7e-82   Eutrema salsugineum [saltwater cress]
ref|XP_004486821.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    266   8e-82   Cicer arietinum [garbanzo]
ref|XP_010480028.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    266   9e-82   Camelina sativa [gold-of-pleasure]
ref|XP_010542432.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    266   9e-82   Tarenaya hassleriana [spider flower]
ref|XP_010462359.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    265   1e-81   Camelina sativa [gold-of-pleasure]
ref|NP_175911.1|  DEAD-box ATP-dependent RNA helicase 20                266   1e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008228305.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    265   2e-81   Prunus mume [ume]
ref|XP_008228303.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    265   2e-81   Prunus mume [ume]
ref|XP_010462358.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    265   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_008391321.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    265   2e-81   Malus domestica [apple tree]
ref|XP_007215261.1|  hypothetical protein PRUPE_ppa004545mg             265   3e-81   Prunus persica
ref|XP_009367550.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    265   3e-81   Pyrus x bretschneideri [bai li]
ref|XP_010534903.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    262   4e-81   Tarenaya hassleriana [spider flower]
ref|XP_004486820.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    265   5e-81   
ref|XP_002891814.1|  hypothetical protein ARALYDRAFT_474570             264   6e-81   
ref|XP_010686087.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    264   6e-81   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004297601.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    264   7e-81   Fragaria vesca subsp. vesca
gb|KCW53605.1|  hypothetical protein EUGRSUZ_J028691                    263   9e-81   Eucalyptus grandis [rose gum]
emb|CDY10596.1|  BnaC03g70180D                                          263   1e-80   Brassica napus [oilseed rape]
ref|XP_003597619.1|  DEAD-box ATP-dependent RNA helicase                263   1e-80   Medicago truncatula
gb|AFK42127.1|  unknown                                                 263   1e-80   Medicago truncatula
gb|KFK38698.1|  hypothetical protein AALP_AA3G148400                    263   2e-80   Arabis alpina [alpine rockcress]
emb|CDY02459.1|  BnaA08g00660D                                          263   2e-80   
ref|XP_010033787.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    263   2e-80   Eucalyptus grandis [rose gum]
ref|XP_009106904.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    263   2e-80   Brassica rapa
ref|XP_010534902.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    263   3e-80   Tarenaya hassleriana [spider flower]
gb|EMT09661.1|  DEAD-box ATP-dependent RNA helicase 20                  260   3e-80   
gb|EMS55994.1|  DEAD-box ATP-dependent RNA helicase 20                  261   7e-80   Triticum urartu
dbj|BAD73320.1|  putative ethylene-responsive RNA helicase              261   1e-79   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006306418.1|  hypothetical protein CARUB_v10012355mg             260   2e-79   Capsella rubella
ref|XP_002455005.1|  hypothetical protein SORBIDRAFT_03g002860          256   5e-78   
gb|ACN39916.1|  unknown                                                 253   7e-76   Picea sitchensis
gb|ABR16327.1|  unknown                                                 251   9e-76   Picea sitchensis
ref|NP_001234650.1|  ethylene-responsive RNA helicase                   249   2e-75   
ref|XP_006845267.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    248   3e-73   Amborella trichopoda
ref|XP_001763089.1|  predicted protein                                  241   5e-72   
ref|XP_006439905.1|  hypothetical protein CICLE_v10019394mg             236   2e-71   
ref|XP_008807455.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    243   3e-71   Phoenix dactylifera
ref|XP_010932245.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    242   1e-70   Elaeis guineensis
ref|XP_002987999.1|  hypothetical protein SELMODRAFT_269342             237   2e-70   
gb|KDO69502.1|  hypothetical protein CISIN_1g013176mg                   235   2e-70   Citrus sinensis [apfelsine]
ref|XP_002972931.1|  hypothetical protein SELMODRAFT_98552              237   3e-70   
ref|XP_010663104.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    239   1e-69   Vitis vinifera
ref|XP_007036326.1|  P-loop containing nucleoside triphosphate hy...    237   2e-69   
gb|AAG51573.1|AC027034_19  RNA helicase, 5' partial; 101954-101280      223   3e-69   Arabidopsis thaliana [mouse-ear cress]
gb|KHN18420.1|  DEAD-box ATP-dependent RNA helicase 30                  234   4e-69   Glycine soja [wild soybean]
ref|XP_006476870.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    235   6e-69   Citrus sinensis [apfelsine]
ref|XP_006439909.1|  hypothetical protein CICLE_v10019394mg             235   6e-69   Citrus clementina [clementine]
gb|KHN34349.1|  DEAD-box ATP-dependent RNA helicase 30                  233   7e-69   Glycine soja [wild soybean]
gb|KDP31038.1|  hypothetical protein JCGZ_11414                         235   1e-68   Jatropha curcas
gb|KJB40103.1|  hypothetical protein B456_007G047000                    234   2e-68   Gossypium raimondii
ref|XP_007155472.1|  hypothetical protein PHAVU_003G204200g             234   2e-68   Phaseolus vulgaris [French bean]
gb|KEH31793.1|  DEAD-box ATP-dependent RNA helicase-like protein        234   2e-68   Medicago truncatula
ref|XP_012079989.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    234   2e-68   
ref|XP_003549600.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    233   3e-68   Glycine max [soybeans]
ref|XP_006579582.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    233   4e-68   
ref|XP_009412685.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    234   5e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004515873.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    231   2e-67   Cicer arietinum [garbanzo]
ref|XP_008239580.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    231   2e-67   Prunus mume [ume]
ref|XP_007210287.1|  hypothetical protein PRUPE_ppa002741mg             231   4e-67   Prunus persica
ref|XP_010251083.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    233   4e-67   Nelumbo nucifera [Indian lotus]
ref|XP_002322195.2|  hypothetical protein POPTR_0015s09460g             230   7e-67   Populus trichocarpa [western balsam poplar]
ref|XP_008365657.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    229   3e-66   
ref|XP_004299135.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    228   4e-66   Fragaria vesca subsp. vesca
ref|XP_002318665.2|  ethylene-responsive DEAD box RNA helicase fa...    226   8e-66   
ref|XP_011047813.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    227   9e-66   Populus euphratica
ref|XP_011071940.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    227   9e-66   Sesamum indicum [beniseed]
ref|XP_011046220.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    226   2e-65   Populus euphratica
ref|XP_011071939.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    226   2e-65   Sesamum indicum [beniseed]
ref|XP_009345779.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    226   2e-65   Pyrus x bretschneideri [bai li]
ref|XP_009363040.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    226   3e-65   Pyrus x bretschneideri [bai li]
emb|CDP12744.1|  unnamed protein product                                226   4e-65   Coffea canephora [robusta coffee]
gb|KDP40781.1|  hypothetical protein JCGZ_24780                         219   5e-65   Jatropha curcas
ref|XP_010102487.1|  DEAD-box ATP-dependent RNA helicase 20             225   7e-65   Morus notabilis
ref|XP_008464517.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    224   2e-64   Cucumis melo [Oriental melon]
ref|XP_004236255.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    223   4e-64   Solanum lycopersicum
ref|XP_006344459.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    223   5e-64   Solanum tuberosum [potatoes]
ref|XP_004138092.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    221   2e-63   Cucumis sativus [cucumbers]
ref|XP_010027294.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    221   3e-63   Eucalyptus grandis [rose gum]
ref|XP_002458964.1|  hypothetical protein SORBIDRAFT_03g043450          219   3e-63   Sorghum bicolor [broomcorn]
ref|XP_009594348.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    221   3e-63   Nicotiana tomentosiformis
gb|KHN25107.1|  DEAD-box ATP-dependent RNA helicase 20                  214   3e-63   Glycine soja [wild soybean]
tpg|DAA56213.1|  TPA: putative DEAD-box ATP-dependent RNA helicas...    219   4e-63   
ref|XP_006646592.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    218   5e-63   
ref|XP_009769444.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    220   6e-63   Nicotiana sylvestris
ref|XP_010550696.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    218   7e-63   Tarenaya hassleriana [spider flower]
dbj|BAD82427.1|  putative DEAD box RNA helicase                         218   1e-62   Oryza sativa Japonica Group [Japonica rice]
sp|Q5N7W4.2|RH30_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA ...    218   3e-62   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006394312.1|  hypothetical protein EUTSA_v10003871mg             217   3e-62   Eutrema salsugineum [saltwater cress]
emb|CDY48128.1|  BnaCnng15700D                                          217   4e-62   Brassica napus [oilseed rape]
ref|XP_004971011.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    216   8e-62   Setaria italica
gb|AFW97645.1|  cold responsive DEAD-box RNA helicase                   216   1e-61   Chorispora bungeana
ref|XP_009112063.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    216   1e-61   Brassica rapa
emb|CDY16735.1|  BnaA09g06470D                                          216   1e-61   Brassica napus [oilseed rape]
gb|EYU22173.1|  hypothetical protein MIMGU_mgv1a003417mg                215   2e-61   Erythranthe guttata [common monkey flower]
ref|XP_004971010.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    215   2e-61   
ref|XP_006280218.1|  hypothetical protein CARUB_v10026128mg             215   3e-61   Capsella rubella
ref|XP_010484038.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    214   3e-61   Camelina sativa [gold-of-pleasure]
gb|KFK25761.1|  hypothetical protein AALP_AA8G156100                    214   3e-61   Arabis alpina [alpine rockcress]
dbj|BAB10554.1|  ATP-dependent RNA helicase-like protein                214   3e-61   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974985.1|  DEAD-box ATP-dependent RNA helicase 30                214   4e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010444189.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    214   4e-61   Camelina sativa [gold-of-pleasure]
ref|XP_002866536.1|  hypothetical protein ARALYDRAFT_496494             214   4e-61   
ref|XP_010459851.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    214   5e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010678860.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    215   5e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001105241.1|  DEAD box RNA helicase1                             213   8e-61   
ref|XP_003564892.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    213   9e-61   Brachypodium distachyon [annual false brome]
gb|EMS66298.1|  DEAD-box ATP-dependent RNA helicase 30                  212   2e-60   Triticum urartu
emb|CDM85602.1|  unnamed protein product                                212   2e-60   Triticum aestivum [Canadian hard winter wheat]
ref|XP_005850349.1|  hypothetical protein CHLNCDRAFT_30080              211   3e-60   Chlorella variabilis
ref|XP_005650016.1|  DEAD-box RNA helicase                              200   8e-57   Coccomyxa subellipsoidea C-169
ref|XP_002771918.1|  RNA helicase, putative                             198   1e-55   Perkinsus marinus ATCC 50983
ref|XP_002774608.1|  RNA helicase, putative                             198   1e-55   Perkinsus marinus ATCC 50983
ref|XP_002777393.1|  RNA helicase, putative                             196   1e-54   Perkinsus marinus ATCC 50983
ref|XP_002777392.1|  RNA helicase, putative                             196   1e-54   Perkinsus marinus ATCC 50983
ref|XP_009336746.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    184   1e-54   Pyrus x bretschneideri [bai li]
ref|XP_002780686.1|  DEAD box ATP-dependent RNA helicase, putative      182   2e-53   Perkinsus marinus ATCC 50983
emb|CAA09215.1|  RNA helicase                                           185   4e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002955411.1|  DEAD-box RNA helicase, ATP-dependent               191   1e-52   Volvox carteri f. nagariensis
emb|CCF73942.1|  unnamed protein product                                190   1e-52   Babesia microti strain RI
emb|CDI80731.1|  hypothetical protein, conserved                        181   3e-52   Eimeria acervulina
ref|XP_002776976.1|  helicase, putative                                 180   3e-52   Perkinsus marinus ATCC 50983
ref|XP_004831007.1|  DEAD box ATP-dependent RNA helicase family m...    189   4e-52   Theileria equi strain WA
ref|XP_001690022.1|  DEAD-box RNA helicase                              188   5e-52   Chlamydomonas reinhardtii
ref|XP_004349647.1|  ATPdependent RNA helicase dbp2, putative           189   3e-51   Acanthamoeba castellanii str. Neff
gb|KIZ00407.1|  ATP-dependent RNA helicase DDX5/DBP2                    186   5e-51   Monoraphidium neglectum
emb|CCF44879.1|  ATP-dependent RNA helicase dbp2                        178   8e-51   Colletotrichum higginsianum
gb|EXX56938.1|  Dbp2p                                                   186   8e-51   Rhizophagus irregularis DAOM 197198w
gb|KFG62415.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 17               175   3e-50   Toxoplasma gondii RUB
dbj|BAN64363.1|  p68-like protein                                       178   3e-50   Babesia bovis
ref|XP_006521353.1|  PREDICTED: probable ATP-dependent RNA helica...    179   2e-49   Mus musculus [mouse]
gb|AAI54494.1|  LOC556764 protein                                       181   2e-49   Danio rerio [leopard danio]
gb|AAI17661.1|  LOC556764 protein                                       181   2e-49   Danio rerio [leopard danio]
gb|AAI34864.1|  LOC556764 protein                                       181   2e-49   Danio rerio [leopard danio]
ref|XP_004563118.1|  PREDICTED: probable ATP-dependent RNA helica...    181   3e-49   
ref|XP_011476846.1|  PREDICTED: probable ATP-dependent RNA helica...    181   3e-49   Oryzias latipes [Japanese rice fish]
emb|CDW55278.1|  ATP dependent RNA helicase DDX5                        181   4e-49   Trichuris trichiura
emb|CAF95263.1|  unnamed protein product                                181   4e-49   Tetraodon nigroviridis
ref|XP_006426527.1|  hypothetical protein CICLE_v10025421mg             179   4e-49   
gb|KFD69250.1|  hypothetical protein M514_04547                         182   4e-49   Trichuris suis
gb|KHJ49547.1|  hypothetical protein D918_00674                         182   4e-49   Trichuris suis
ref|XP_007370735.1|  DEAD-domain-containing protein                     180   5e-49   Dichomitus squalens LYAD-421 SS1
ref|XP_007231410.1|  PREDICTED: probable ATP-dependent RNA helica...    182   6e-49   
ref|XP_010746314.1|  PREDICTED: probable ATP-dependent RNA helica...    182   6e-49   
ref|XP_009160472.1|  ATP-dependent RNA helicase dbp2                    180   7e-49   Exophiala dermatitidis NIH/UT8656
gb|KFP69316.1|  putative ATP-dependent RNA helicase DDX17               178   7e-49   Acanthisitta chloris
emb|CDR95325.1|  p68-like protein, putative                             180   7e-49   Babesia bigemina
ref|XP_011476809.1|  PREDICTED: probable ATP-dependent RNA helica...    181   7e-49   Oryzias latipes [Japanese rice fish]
gb|KFH65694.1|  hypothetical protein MVEG_09167                         181   7e-49   Mortierella verticillata NRRL 6337
ref|XP_011476845.1|  PREDICTED: probable ATP-dependent RNA helica...    181   8e-49   Oryzias latipes [Japanese rice fish]
ref|XP_003655899.1|  hypothetical protein THITE_2120154                 181   9e-49   Thielavia terrestris NRRL 8126
ref|XP_004071866.1|  PREDICTED: probable ATP-dependent RNA helica...    181   9e-49   Oryzias latipes [Japanese rice fish]
ref|XP_001923830.1|  PREDICTED: probable ATP-dependent RNA helica...    181   9e-49   
ref|XP_003381848.1|  ATP-dependent RNA helicase Dbp2                    180   1e-48   Trichinella spiralis
gb|EQK99950.1|  ATP-dependent RNA helicase dbp-2                        178   1e-48   Ophiocordyceps sinensis CO18
ref|XP_006798015.1|  PREDICTED: probable ATP-dependent RNA helica...    181   1e-48   Neolamprologus brichardi [lyretail cichlid]
ref|XP_005737994.1|  PREDICTED: probable ATP-dependent RNA helica...    181   1e-48   Pundamilia nyererei
ref|XP_004563116.1|  PREDICTED: probable ATP-dependent RNA helica...    181   1e-48   
ref|XP_005737995.1|  PREDICTED: probable ATP-dependent RNA helica...    181   1e-48   
ref|XP_005940780.1|  PREDICTED: probable ATP-dependent RNA helica...    181   1e-48   Haplochromis burtoni
ref|XP_009073300.1|  PREDICTED: probable ATP-dependent RNA helica...    178   2e-48   Acanthisitta chloris
ref|XP_004563117.1|  PREDICTED: probable ATP-dependent RNA helica...    181   2e-48   
ref|XP_003453852.1|  PREDICTED: probable ATP-dependent RNA helica...    181   2e-48   
ref|XP_005797285.1|  PREDICTED: probable ATP-dependent RNA helica...    181   2e-48   Xiphophorus maculatus
ref|XP_002402985.1|  ATP-dependent RNA helicase, putative               177   2e-48   Ixodes scapularis [blacklegged tick]
ref|XP_008407161.1|  PREDICTED: probable ATP-dependent RNA helica...    181   2e-48   Poecilia reticulata
ref|XP_004198636.1|  Piso0_002019                                       179   2e-48   
ref|XP_006790684.1|  PREDICTED: probable ATP-dependent RNA helica...    179   2e-48   Neolamprologus brichardi [lyretail cichlid]
ref|XP_003712846.1|  ATP-dependent RNA helicase DBP2                    179   2e-48   Magnaporthe oryzae 70-15
ref|XP_007543657.1|  PREDICTED: probable ATP-dependent RNA helica...    181   2e-48   Poecilia formosa
ref|XP_008315636.1|  PREDICTED: probable ATP-dependent RNA helica...    180   2e-48   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008328999.1|  PREDICTED: probable ATP-dependent RNA helica...    178   2e-48   Cynoglossus semilaevis [half-smooth tongue sole]
gb|KFQ42674.1|  putative ATP-dependent RNA helicase DDX17               178   2e-48   Nestor notabilis
gb|KFO61287.1|  putative ATP-dependent RNA helicase DDX17               177   2e-48   Corvus brachyrhynchos
ref|XP_007914595.1|  putative atp-dependent rna helicase dbp-2 pr...    179   2e-48   Phaeoacremonium minimum UCRPA7
gb|KFO81715.1|  putative ATP-dependent RNA helicase DDX17               177   2e-48   Cuculus canorus
gb|KFO06156.1|  putative ATP-dependent RNA helicase DDX17               178   2e-48   Balearica regulorum gibbericeps
gb|EMC76814.1|  putative ATP-dependent RNA helicase DDX17               178   2e-48   
gb|KFZ49707.1|  putative ATP-dependent RNA helicase DDX17               178   2e-48   Podiceps cristatus
gb|EPR60274.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 17               179   2e-48   Toxoplasma gondii GT1
ref|XP_002369028.1|  DEAD/DEAH box helicase, putative                   179   2e-48   Toxoplasma gondii ME49
gb|KFZ60114.1|  putative ATP-dependent RNA helicase DDX17               178   2e-48   Antrostomus carolinensis
ref|XP_007560356.1|  PREDICTED: probable ATP-dependent RNA helica...    178   2e-48   Poecilia formosa
ref|XP_008294587.1|  PREDICTED: probable ATP-dependent RNA helica...    180   2e-48   Stegastes partitus
gb|KJB56889.1|  hypothetical protein B456_009G140700                    177   2e-48   Gossypium raimondii
dbj|BAB28651.1|  unnamed protein product                                174   2e-48   Mus musculus [mouse]
gb|KFV68880.1|  putative ATP-dependent RNA helicase DDX17               177   2e-48   Picoides pubescens
ref|XP_008885470.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 17          179   2e-48   
ref|XP_663535.1|  hypothetical protein AN5931.2                         179   2e-48   Aspergillus nidulans FGSC A4
gb|KFQ18808.1|  putative ATP-dependent RNA helicase DDX17               178   3e-48   Merops nubicus
gb|KFP10244.1|  putative ATP-dependent RNA helicase DDX17               177   3e-48   Egretta garzetta
gb|KFP74117.1|  putative ATP-dependent RNA helicase DDX17               177   3e-48   Apaloderma vittatum
dbj|BAE87553.1|  unnamed protein product                                176   3e-48   Macaca fascicularis [crab eating macaque]
emb|CAG10773.1|  unnamed protein product                                179   3e-48   Tetraodon nigroviridis
gb|KFW90864.1|  putative ATP-dependent RNA helicase DDX17               177   3e-48   Phalacrocorax carbo [common cormorant]
ref|XP_003443250.1|  PREDICTED: probable ATP-dependent RNA helica...    180   3e-48   Oreochromis niloticus
gb|KFO95968.1|  putative ATP-dependent RNA helicase DDX17               177   3e-48   Calypte anna
gb|KGL73587.1|  putative ATP-dependent RNA helicase DDX17               177   3e-48   Tinamus guttatus
ref|XP_005468481.1|  PREDICTED: probable ATP-dependent RNA helica...    180   3e-48   
gb|EDM15798.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 17, isofor...    178   3e-48   Rattus norvegicus [brown rat]
gb|KFQ23731.1|  putative ATP-dependent RNA helicase DDX17               177   3e-48   Mesitornis unicolor
gb|KJJ32198.1|  DEADDEAH box helicase                                   177   3e-48   
ref|XP_008278145.1|  PREDICTED: probable ATP-dependent RNA helica...    180   3e-48   Stegastes partitus
ref|XP_002130131.1|  PREDICTED: ATP-dependent RNA helicase dbp2         179   4e-48   Ciona intestinalis [sea vase]
gb|KFP53210.1|  putative ATP-dependent RNA helicase DDX17               177   4e-48   Cathartes aura
ref|XP_003385512.1|  PREDICTED: ATP-dependent RNA helicase dbp2-like    179   4e-48   Amphimedon queenslandica
gb|KFP37484.1|  putative ATP-dependent RNA helicase DDX17               177   4e-48   Chlamydotis macqueenii
gb|KFV00645.1|  putative ATP-dependent RNA helicase DDX17               177   4e-48   Tauraco erythrolophus
gb|KFQ80585.1|  putative ATP-dependent RNA helicase DDX17               177   4e-48   Phoenicopterus ruber ruber
gb|KGL90702.1|  putative ATP-dependent RNA helicase DDX17               177   4e-48   Charadrius vociferus
ref|XP_001609970.1|  p68-like protein                                   178   4e-48   Babesia bovis T2Bo
ref|XP_008413684.1|  PREDICTED: probable ATP-dependent RNA helica...    177   4e-48   Poecilia reticulata
gb|KFM02164.1|  putative ATP-dependent RNA helicase DDX17               177   4e-48   Aptenodytes forsteri
gb|KFR10998.1|  putative ATP-dependent RNA helicase DDX17               177   4e-48   Opisthocomus hoazin [hoatzin]
gb|KIW56054.1|  ATP-dependent RNA helicase dbp2                         178   4e-48   Exophiala xenobiotica
gb|KFP59950.1|  putative ATP-dependent RNA helicase DDX17               177   4e-48   Cariama cristata
gb|KFO88513.1|  putative ATP-dependent RNA helicase DDX17               177   4e-48   Buceros rhinoceros silvestris
ref|XP_005735867.1|  PREDICTED: probable ATP-dependent RNA helica...    179   4e-48   Pundamilia nyererei
ref|XP_005925008.1|  PREDICTED: probable ATP-dependent RNA helica...    179   4e-48   Haplochromis burtoni
ref|XP_010895018.1|  PREDICTED: probable ATP-dependent RNA helica...    178   4e-48   Esox lucius
ref|XP_010597633.1|  PREDICTED: probable ATP-dependent RNA helica...    177   4e-48   Loxodonta africana [African bush elephant]
gb|AAD38876.1|AF110008_1  p68 RNA helicase                              179   4e-48   
gb|KFV75709.1|  putative ATP-dependent RNA helicase DDX17               177   4e-48   
gb|KFQ57153.1|  putative ATP-dependent RNA helicase DDX17               177   4e-48   
ref|XP_004538967.1|  PREDICTED: probable ATP-dependent RNA helica...    179   4e-48   
gb|KFR08900.1|  putative ATP-dependent RNA helicase DDX17               177   4e-48   
gb|KFQ77919.1|  putative ATP-dependent RNA helicase DDX17               177   4e-48   
gb|KFV60123.1|  putative ATP-dependent RNA helicase DDX17               177   5e-48   
ref|XP_008328998.1|  PREDICTED: probable ATP-dependent RNA helica...    179   5e-48   
ref|XP_003745440.1|  PREDICTED: probable ATP-dependent RNA helica...    177   5e-48   
ref|XP_008283839.1|  PREDICTED: probable ATP-dependent RNA helica...    177   5e-48   
ref|XP_009972429.1|  PREDICTED: probable ATP-dependent RNA helica...    178   5e-48   
ref|XP_010753741.1|  PREDICTED: probable ATP-dependent RNA helica...    177   5e-48   
gb|AAD38874.1|AF110007_1  p68 RNA helicase                              179   5e-48   
ref|XP_003972587.1|  PREDICTED: probable ATP-dependent RNA helica...    179   5e-48   
ref|XP_004700310.1|  PREDICTED: probable ATP-dependent RNA helica...    178   6e-48   
gb|EAW60248.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 17, isofor...    178   6e-48   
ref|XP_009880187.1|  PREDICTED: probable ATP-dependent RNA helica...    178   6e-48   
ref|XP_009436590.1|  PREDICTED: probable ATP-dependent RNA helica...    178   6e-48   
gb|KIW48029.1|  ATP-dependent RNA helicase dbp2                         177   6e-48   
ref|XP_010565532.1|  PREDICTED: probable ATP-dependent RNA helica...    178   6e-48   
ref|XP_004610567.1|  PREDICTED: probable ATP-dependent RNA helica...    178   7e-48   
ref|XP_006174954.1|  PREDICTED: probable ATP-dependent RNA helica...    178   7e-48   
ref|XP_004311417.1|  PREDICTED: probable ATP-dependent RNA helica...    178   7e-48   
ref|XP_008067650.1|  PREDICTED: probable ATP-dependent RNA helica...    178   7e-48   
ref|XP_001275371.1|  RNA helicase (Dbp), putative                       178   7e-48   
ref|XP_009979992.1|  PREDICTED: probable ATP-dependent RNA helica...    178   7e-48   
ref|XP_009863069.1|  PREDICTED: probable ATP-dependent RNA helica...    178   7e-48   
ref|XP_009924066.1|  PREDICTED: probable ATP-dependent RNA helica...    178   7e-48   
ref|XP_009502718.1|  PREDICTED: probable ATP-dependent RNA helica...    178   7e-48   
ref|XP_010307626.1|  PREDICTED: probable ATP-dependent RNA helica...    178   8e-48   
ref|XP_010871155.1|  PREDICTED: probable ATP-dependent RNA helica...    179   8e-48   
ref|XP_010764560.1|  PREDICTED: probable ATP-dependent RNA helica...    179   8e-48   
ref|XP_010225318.1|  PREDICTED: probable ATP-dependent RNA helica...    178   8e-48   
ref|XP_005606692.1|  PREDICTED: probable ATP-dependent RNA helica...    177   9e-48   
ref|XP_008929884.1|  PREDICTED: probable ATP-dependent RNA helica...    178   9e-48   
ref|XP_008939400.1|  PREDICTED: probable ATP-dependent RNA helica...    178   9e-48   
ref|XP_009951301.1|  PREDICTED: probable ATP-dependent RNA helica...    178   9e-48   
ref|XP_009805513.1|  PREDICTED: probable ATP-dependent RNA helica...    178   9e-48   
ref|XP_010013794.1|  PREDICTED: probable ATP-dependent RNA helica...    178   9e-48   
ref|XP_009330949.1|  PREDICTED: probable ATP-dependent RNA helica...    178   9e-48   
ref|XP_001260551.1|  RNA helicase (Dbp), putative                       177   9e-48   
ref|XP_008634834.1|  PREDICTED: probable ATP-dependent RNA helica...    178   9e-48   
ref|XP_010208864.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...    178   9e-48   
ref|XP_009481222.1|  PREDICTED: probable ATP-dependent RNA helica...    178   9e-48   
gb|EOB03912.1|  Putative ATP-dependent RNA helicase DDX17               178   9e-48   
ref|XP_009566745.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
ref|XP_010341891.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
ref|XP_007560355.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
ref|XP_010145760.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
ref|XP_006029913.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
ref|XP_009584901.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
ref|XP_006259008.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
ref|XP_010185205.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
ref|XP_005468521.1|  PREDICTED: probable ATP-dependent RNA helica...    176   1e-47   
ref|XP_007886913.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
ref|XP_010168247.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
ref|XP_010288347.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
gb|KJK61259.1|  hypothetical protein P875_00042524                      177   1e-47   
ref|XP_004066302.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
gb|EQB53300.1|  hypothetical protein CGLO_06986                         176   1e-47   
ref|XP_007723413.1|  ATP-dependent RNA helicase dbp2                    177   1e-47   
ref|XP_005040018.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
ref|XP_416260.2|  PREDICTED: probable ATP-dependent RNA helicase ...    178   1e-47   
ref|XP_002377846.1|  RNA helicase (Dbp), putative                       177   1e-47   
ref|XP_962960.3|  ATP-dependent RNA helicase dbp-2                      177   1e-47   
gb|KIW20248.1|  ATP-dependent RNA helicase dbp2                         177   1e-47   
ref|XP_005812413.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
ref|XP_009085184.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
gb|KIW85218.1|  ATP-dependent RNA helicase dbp2                         177   1e-47   
ref|XP_005488678.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
gb|KHE84667.1|  ATP-dependent RNA helicase dbp-2                        177   1e-47   
ref|XP_009646040.1|  PREDICTED: probable ATP-dependent RNA helica...    177   1e-47   
ref|XP_005488677.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
ref|XP_005232953.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
ref|XP_010126497.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
dbj|GAA82405.1|  RNA helicase Dbp                                       177   1e-47   
ref|XP_005150407.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...    178   1e-47   
ref|XP_009933308.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
ref|XP_005527672.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
sp|Q2U070.1|DBP2_ASPOR  RecName: Full=ATP-dependent RNA helicase ...    177   1e-47   
ref|XP_009850524.1|  ATP-dependent RNA helicase dbp-2                   177   1e-47   
ref|XP_005514775.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
ref|XP_010732910.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
ref|XP_010132422.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
ref|XP_008494759.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
ref|XP_002195734.2|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
ref|XP_010710490.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
gb|KDN71519.1|  putative DEAD/DEAH box helicase                         177   1e-47   
ref|XP_008413683.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
ref|XP_010085938.1|  PREDICTED: probable ATP-dependent RNA helica...    177   1e-47   
ref|XP_008283838.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
ref|XP_009288378.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
ref|XP_005302557.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
ref|XP_007441609.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
gb|EGN99017.1|  hypothetical protein SERLA73DRAFT_137127                172   1e-47   
ref|XP_009217109.1|  ATP-dependent RNA helicase DBP2                    177   1e-47   
ref|XP_005738053.1|  PREDICTED: probable ATP-dependent RNA helica...    176   1e-47   
ref|XP_010004139.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
ref|XP_006865247.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
ref|XP_005016061.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
ref|XP_010746618.1|  PREDICTED: probable ATP-dependent RNA helica...    178   1e-47   
ref|XP_006865246.1|  PREDICTED: probable ATP-dependent RNA helica...    178   2e-47   
ref|XP_004563062.1|  PREDICTED: probable ATP-dependent RNA helica...    176   2e-47   
ref|XP_002140793.1|  DEAD/DEAH box helicase family protein              177   2e-47   
ref|XP_005354345.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_009900873.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_003514725.2|  PREDICTED: probable ATP-dependent RNA helica...    178   2e-47   
ref|NP_001082679.1|  DEAD (Asp-Glu-Ala-Asp) box helicase 17             177   2e-47   
gb|EFQ25261.1|  DEAD/DEAH box helicase                                  177   2e-47   
ref|XP_010895017.1|  PREDICTED: probable ATP-dependent RNA helica...    178   2e-47   
ref|XP_007652929.1|  PREDICTED: probable ATP-dependent RNA helica...    178   2e-47   
ref|XP_006797968.1|  PREDICTED: probable ATP-dependent RNA helica...    176   2e-47   
ref|XP_009347526.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    172   2e-47   
ref|XP_006890184.1|  PREDICTED: probable ATP-dependent RNA helica...    178   2e-47   
ref|XP_005446839.1|  PREDICTED: probable ATP-dependent RNA helica...    178   2e-47   
ref|XP_006890183.1|  PREDICTED: probable ATP-dependent RNA helica...    178   2e-47   
emb|CEP63888.1|  LALA0S09e04742g1_1                                     177   2e-47   
ref|XP_004373916.1|  PREDICTED: probable ATP-dependent RNA helica...    178   2e-47   
ref|XP_010408888.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_006752810.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_008849476.1|  PREDICTED: probable ATP-dependent RNA helica...    178   2e-47   
ref|XP_004650369.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_008849475.1|  PREDICTED: probable ATP-dependent RNA helica...    178   2e-47   
ref|XP_004650368.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_006979214.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_008849477.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_001092491.2|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_006979213.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_011616194.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|NP_001035277.1|  probable ATP-dependent RNA helicase DDX17 is...    177   2e-47   
ref|XP_003821639.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_003227208.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_011601947.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_007939858.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|NP_951062.1|  probable ATP-dependent RNA helicase DDX17 isofo...    177   2e-47   
ref|XP_007939857.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_005994328.1|  PREDICTED: probable ATP-dependent RNA helica...    178   2e-47   
ref|XP_007622847.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_005994327.1|  PREDICTED: probable ATP-dependent RNA helica...    178   2e-47   
ref|XP_007622846.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_008977411.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_003264799.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_008977406.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_002847063.1|  ATP-dependent RNA helicase DBP2                    174   2e-47   
ref|XP_004485165.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD (Asp-Gl...    177   2e-47   
ref|XP_010753739.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_003350404.1|  hypothetical protein SMAC_02116                    177   2e-47   
ref|XP_006102491.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_008142844.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_007503261.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
dbj|BAD92832.1|  DEAD box polypeptide 17 isoform p82 variant            178   2e-47   
ref|XP_008142845.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_002914626.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...    178   2e-47   
ref|XP_007099364.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD (Asp-Gl...    177   2e-47   
ref|XP_005567355.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_005567354.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_005883260.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_003783252.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
gb|AAP88874.1|  DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 17, ...    177   2e-47   
ref|XP_004675717.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_005379316.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_003470541.2|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_005883259.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_006155420.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_004675716.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_007189120.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_006914795.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_005379315.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_005003904.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_006155419.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_004883536.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_007189119.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_004410825.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_008067649.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
emb|CCC11459.1|  unnamed protein product                                177   2e-47   
ref|XP_012031546.1|  PREDICTED: probable ATP-dependent RNA helica...    178   2e-47   
ref|XP_008255265.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_004883535.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_006119019.1|  PREDICTED: probable ATP-dependent RNA helica...    178   2e-47   
ref|XP_008067648.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|NP_006377.2|  probable ATP-dependent RNA helicase DDX17 isofo...    178   2e-47   
ref|XP_006071393.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_007111784.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_005322311.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_004589558.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|NP_001095463.1|  probable ATP-dependent RNA helicase DDX17          177   2e-47   
ref|NP_001091974.1|  probable ATP-dependent RNA helicase DDX17 is...    178   2e-47   
ref|XP_003126098.2|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_006071392.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_005322310.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_004589559.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_004279534.1|  PREDICTED: probable ATP-dependent RNA helica...    177   2e-47   
ref|XP_004743517.1|  PREDICTED: probable ATP-dependent RNA helica...    178   2e-47   
ref|XP_007069155.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...    178   2e-47   
gb|ELR53727.1|  Putative ATP-dependent RNA helicase DDX17               178   2e-47   
gb|KIJ51056.1|  hypothetical protein M422DRAFT_224490                   176   2e-47   
ref|XP_006787631.1|  PREDICTED: probable ATP-dependent RNA helica...    176   2e-47   
ref|XP_006086812.1|  PREDICTED: probable ATP-dependent RNA helica...    177   3e-47   
ref|XP_003771058.1|  PREDICTED: probable ATP-dependent RNA helica...    177   3e-47   
ref|XP_006635273.1|  PREDICTED: probable ATP-dependent RNA helica...    177   3e-47   
ref|XP_009473564.1|  PREDICTED: LOW QUALITY PROTEIN: probable ATP...    177   3e-47   
ref|XP_007519377.1|  PREDICTED: probable ATP-dependent RNA helica...    177   3e-47   
ref|XP_860668.3|  PREDICTED: probable ATP-dependent RNA helicase ...    178   3e-47   
ref|XP_007519378.1|  PREDICTED: probable ATP-dependent RNA helica...    177   3e-47   
gb|EHH65839.1|  hypothetical protein EGM_02689                          177   3e-47   
ref|XP_005681228.1|  PREDICTED: probable ATP-dependent RNA helica...    177   3e-47   
ref|XP_007920211.1|  hypothetical protein MYCFIDRAFT_58038              175   3e-47   
gb|KIW66761.1|  ATP-dependent RNA helicase dbp2, variant                176   3e-47   
ref|XP_007276489.1|  RNA helicase                                       176   3e-47   
ref|XP_007751641.1|  ATP-dependent RNA helicase dbp2                    176   3e-47   
ref|XP_010783938.1|  PREDICTED: probable ATP-dependent RNA helica...    175   3e-47   
ref|XP_009663625.1|  PREDICTED: probable ATP-dependent RNA helica...    177   3e-47   
ref|XP_003443141.1|  PREDICTED: probable ATP-dependent RNA helica...    177   3e-47   
gb|KIW32492.1|  ATP-dependent RNA helicase DBP2                         176   3e-47   
ref|XP_008509242.1|  PREDICTED: probable ATP-dependent RNA helica...    177   3e-47   
ref|XP_008509240.1|  PREDICTED: probable ATP-dependent RNA helica...    177   3e-47   
gb|KIW91519.1|  ATP-dependent RNA helicase DBP2                         176   3e-47   
ref|XP_006934164.2|  PREDICTED: probable ATP-dependent RNA helica...    178   3e-47   
gb|KIY00857.1|  ATP-dependent RNA helicase dbp2                         176   3e-47   
gb|KFH43917.1|  ATP-dependent RNA helicase-like protein                 175   3e-47   
ref|XP_004201815.1|  Piso0_002019                                       176   4e-47   



>gb|EPS60527.1| hypothetical protein M569_14276, partial [Genlisea aurea]
Length=230

 Score =   271 bits (692),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHVE +SESQKY+KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  47   QHVEIISESQKYSKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  106

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEF+AGKSPIMTATDVAARGLDVKDVK+VINYDFPGSLEDYVHRIGRTGRAG
Sbjct  107  QAERDWVLSEFRAGKSPIMTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAG  166

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANA+FAK+LI+IL+EAGQKVSPEL  M
Sbjct  167  AKGTAYTFFTAANAKFAKELINILREAGQKVSPELVAM  204



>gb|KDO65284.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=473

 Score =   276 bits (705),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHV+ VSESQKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  289  QHVDIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  348

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  349  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  408

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI IL+EAGQKVSPELA M
Sbjct  409  AKGTAYTFFTAANARFAKELITILEEAGQKVSPELAAM  446



>ref|XP_006426523.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
 gb|ESR39763.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
Length=473

 Score =   276 bits (705),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHV+ VSESQKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  289  QHVDIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  348

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  349  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  408

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI IL+EAGQKVSPELA M
Sbjct  409  AKGTAYTFFTAANARFAKELITILEEAGQKVSPELAAM  446



>ref|XP_010314157.1| PREDICTED: ethylene-responsive RNA helicase isoform X1 [Solanum 
lycopersicum]
Length=501

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHVE VSESQKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  317  QHVEIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQVTRQLRMDGWPALSIHGDKS  376

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVK+VINYDFPGSLEDYVHRIGRTGRAG
Sbjct  377  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAG  436

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A GTAYTFFTAANARFAKDL++IL+EAGQKVSPELA M
Sbjct  437  ASGTAYTFFTAANARFAKDLVNILEEAGQKVSPELAKM  474



>ref|XP_006645603.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Oryza 
brachyantha]
Length=485

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHVE +SESQKY KLV LLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  303  QHVEILSESQKYNKLVNLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  362

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  363  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  422

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAKDLI+IL+EAGQKVSPELA M
Sbjct  423  AKGTAYTFFTAANARFAKDLINILEEAGQKVSPELANM  460



>gb|EEE54050.1| hypothetical protein OsJ_00740 [Oryza sativa Japonica Group]
Length=468

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHVE +SESQKY KLV LLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  286  QHVEILSESQKYNKLVNLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  345

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  346  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  405

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAKDLI+IL+EAGQKVSPELA M
Sbjct  406  AKGTAYTFFTAANARFAKDLINILEEAGQKVSPELANM  443



>emb|CAA09209.1| RNA helicase [Arabidopsis thaliana]
Length=187

 Score =   266 bits (679),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V+ +SESQKY KLVKLLEDIMDGSRIL+F+DTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  6    QIVDVISESQKYNKLVKLLEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKS  65

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEF++GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  66   QAERDWVLSEFRSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  125

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFT ANARFAK+L +ILQEAGQKVSPELA+M
Sbjct  126  AKGTAYTFFTVANARFAKELTNILQEAGQKVSPELASM  163



>ref|XP_009625322.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nicotiana 
tomentosiformis]
Length=501

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHVE VSESQKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  317  QHVEIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQVTRQLRMDGWPALSIHGDKS  376

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVK+VINYDFPGSLEDYVHRIGRTGRAG
Sbjct  377  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAG  436

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A GTAYT+FTAANARFAKDLI+IL+EAGQKVSPELA M
Sbjct  437  ASGTAYTYFTAANARFAKDLINILEEAGQKVSPELAKM  474



>gb|EEC70110.1| hypothetical protein OsI_00766 [Oryza sativa Indica Group]
Length=470

 Score =   275 bits (703),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHVE +SESQKY KLV LLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  288  QHVEILSESQKYNKLVNLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  347

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  348  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  407

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAKDLI+IL+EAGQKVSPELA M
Sbjct  408  AKGTAYTFFTAANARFAKDLINILEEAGQKVSPELANM  445



>sp|Q5QMN3.2|RH20_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 20 [Oryza sativa 
Japonica Group]
Length=494

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHVE +SESQKY KLV LLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  312  QHVEILSESQKYNKLVNLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  371

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  372  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  431

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAKDLI+IL+EAGQKVSPELA M
Sbjct  432  AKGTAYTFFTAANARFAKDLINILEEAGQKVSPELANM  469



>gb|KDO65286.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=498

 Score =   275 bits (704),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHV+ VSESQKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  314  QHVDIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  373

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  374  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  433

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI IL+EAGQKVSPELA M
Sbjct  434  AKGTAYTFFTAANARFAKELITILEEAGQKVSPELAAM  471



>gb|KDO65287.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=491

 Score =   275 bits (703),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHV+ VSESQKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  307  QHVDIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  366

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  367  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  426

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI IL+EAGQKVSPELA M
Sbjct  427  AKGTAYTFFTAANARFAKELITILEEAGQKVSPELAAM  464



>ref|XP_006426524.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
 gb|ESR39764.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
Length=504

 Score =   275 bits (703),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHV+ VSESQKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  320  QHVDIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  379

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  380  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  439

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI IL+EAGQKVSPELA M
Sbjct  440  AKGTAYTFFTAANARFAKELITILEEAGQKVSPELAAM  477



>ref|XP_006426525.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
 gb|ESR39765.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
Length=505

 Score =   275 bits (703),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHV+ VSESQKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  320  QHVDIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  379

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  380  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  439

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI IL+EAGQKVSPELA M
Sbjct  440  AKGTAYTFFTAANARFAKELITILEEAGQKVSPELAAM  477



>ref|XP_006466042.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Citrus sinensis]
 gb|KDO65283.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=504

 Score =   275 bits (703),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHV+ VSESQKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  320  QHVDIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  379

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  380  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  439

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI IL+EAGQKVSPELA M
Sbjct  440  AKGTAYTFFTAANARFAKELITILEEAGQKVSPELAAM  477



>ref|XP_006426526.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
 gb|ESR39766.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
Length=495

 Score =   275 bits (703),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHV+ VSESQKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  311  QHVDIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  370

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  371  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  430

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI IL+EAGQKVSPELA M
Sbjct  431  AKGTAYTFFTAANARFAKELITILEEAGQKVSPELAAM  468



>ref|XP_006466041.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Citrus sinensis]
 gb|KDO65282.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=505

 Score =   275 bits (703),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHV+ VSESQKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  320  QHVDIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  379

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  380  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  439

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI IL+EAGQKVSPELA M
Sbjct  440  AKGTAYTFFTAANARFAKELITILEEAGQKVSPELAAM  477



>ref|XP_006366150.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006366151.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Solanum tuberosum]
Length=501

 Score =   275 bits (703),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHVE VSESQKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  317  QHVEIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQVTRQLRMDGWPALSIHGDKS  376

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVK+VINYDFPGSLEDYVHRIGRTGRAG
Sbjct  377  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAG  436

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A GTAYTFFTAANARFAKDL++IL+EAGQKV PELA M
Sbjct  437  ASGTAYTFFTAANARFAKDLVNILEEAGQKVGPELAKM  474



>ref|XP_011072507.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Sesamum indicum]
Length=507

 Score =   275 bits (702),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHVE VSE+QKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  323  QHVEIVSENQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  382

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEF+AGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  383  QAERDWVLSEFRAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  442

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAKDLI+IL+EAGQKVSPEL  M
Sbjct  443  AKGTAYTFFTAANARFAKDLINILEEAGQKVSPELVAM  480



>gb|KHG24204.1| DEAD-box ATP-dependent RNA helicase 20 -like protein [Gossypium 
arboreum]
Length=505

 Score =   275 bits (702),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHV  VSESQKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  320  QHVNIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  379

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  380  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  439

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI IL+EAGQKVSPELA M
Sbjct  440  AKGTAYTFFTAANARFAKELIAILEEAGQKVSPELAAM  477



>ref|XP_010106662.1| DEAD-box ATP-dependent RNA helicase 20 [Morus notabilis]
 gb|EXC11111.1| DEAD-box ATP-dependent RNA helicase 20 [Morus notabilis]
Length=494

 Score =   274 bits (701),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHV+ +SE+QKY KLV+LLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  315  QHVDIISENQKYNKLVRLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  374

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  375  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  434

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAKDLI IL+EAGQKVSPELA M
Sbjct  435  AKGTAYTFFTAANARFAKDLITILEEAGQKVSPELAAM  472



>gb|KJB70270.1| hypothetical protein B456_011G066000 [Gossypium raimondii]
 gb|KJB70271.1| hypothetical protein B456_011G066000 [Gossypium raimondii]
Length=505

 Score =   274 bits (701),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHV+ VSESQKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  320  QHVDIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  379

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  380  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  439

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI IL+EAGQKVSPELA M
Sbjct  440  AKGTAYTFFTAANARFAKELIAILKEAGQKVSPELAAM  477



>gb|KHF98903.1| DEAD-box ATP-dependent RNA helicase 20 -like protein [Gossypium 
arboreum]
Length=519

 Score =   275 bits (702),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHV+ VSESQKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  320  QHVDIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  379

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  380  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  439

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI IL+EAGQKVSPELA M
Sbjct  440  AKGTAYTFFTAANARFAKELIAILKEAGQKVSPELAAM  477



>emb|CDO97919.1| unnamed protein product [Coffea canephora]
Length=500

 Score =   274 bits (700),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q+V+ VSESQKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  319  QNVDIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  378

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGK+PIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  379  QAERDWVLSEFKAGKNPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  438

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFT ANARFAKDLI+ILQEAGQKVSPELA+M
Sbjct  439  AKGTAYTFFTVANARFAKDLINILQEAGQKVSPELASM  476



>gb|KJB56890.1| hypothetical protein B456_009G140700 [Gossypium raimondii]
Length=487

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHV  VSESQKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWP LSIHGDKS
Sbjct  320  QHVNIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPTLSIHGDKS  379

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  380  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  439

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI IL+EAGQKVSPELA M
Sbjct  440  AKGTAYTFFTAANARFAKELIAILEEAGQKVSPELAAM  477



>ref|XP_006858286.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Amborella 
trichopoda]
 gb|ERN19753.1| hypothetical protein AMTR_s00064p00050700 [Amborella trichopoda]
Length=501

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHVE VSE+QKY KLVKLLEDIMDGSRILIF+DTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  316  QHVEIVSENQKYNKLVKLLEDIMDGSRILIFIDTKKGCDQVTRQLRMDGWPALSIHGDKS  375

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  376  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  435

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAAN RFAK+LI ILQEAGQKVSPELA M
Sbjct  436  AKGTAYTFFTAANGRFAKELISILQEAGQKVSPELAAM  473



>ref|XP_010242202.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nelumbo nucifera]
Length=512

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 154/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE VSE+QKY+KLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS
Sbjct  327  QIVEIVSENQKYSKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  386

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  387  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  446

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI IL+EAGQKVSPELA M
Sbjct  447  AKGTAYTFFTAANARFAKELITILEEAGQKVSPELAAM  484



>ref|XP_009802114.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nicotiana 
sylvestris]
Length=501

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHVE VSESQKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TR LRMDGWPALSIHGDKS
Sbjct  317  QHVEIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQVTRLLRMDGWPALSIHGDKS  376

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVK+VINYDFPGSLEDYVHRIGRTGRAG
Sbjct  377  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAG  436

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A GTAYT+FTAANARFAKDLI+IL+EAGQKVSPELA M
Sbjct  437  ASGTAYTYFTAANARFAKDLINILEEAGQKVSPELAKM  474



>ref|XP_010262147.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X3 [Nelumbo nucifera]
Length=505

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE VSE+QKY KLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS
Sbjct  321  QIVEIVSENQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  380

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  381  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  440

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI IL+EAGQKVSPELA M
Sbjct  441  AKGTAYTFFTAANARFAKELITILEEAGQKVSPELAAM  478



>ref|XP_010262146.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Nelumbo nucifera]
Length=511

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE VSE+QKY KLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS
Sbjct  327  QIVEIVSENQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  386

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  387  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  446

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI IL+EAGQKVSPELA M
Sbjct  447  AKGTAYTFFTAANARFAKELITILEEAGQKVSPELAAM  484



>ref|XP_010262145.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Nelumbo nucifera]
Length=512

 Score =   273 bits (698),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE VSE+QKY KLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS
Sbjct  328  QIVEIVSENQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  387

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  388  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  447

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI IL+EAGQKVSPELA M
Sbjct  448  AKGTAYTFFTAANARFAKELITILEEAGQKVSPELAAM  485



>gb|KJB56888.1| hypothetical protein B456_009G140700 [Gossypium raimondii]
 gb|KJB56891.1| hypothetical protein B456_009G140700 [Gossypium raimondii]
Length=505

 Score =   273 bits (697),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 149/158 (94%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHV  VSESQKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWP LSIHGDKS
Sbjct  320  QHVNIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPTLSIHGDKS  379

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  380  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  439

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI IL+EAGQKVSPELA M
Sbjct  440  AKGTAYTFFTAANARFAKELIAILEEAGQKVSPELAAM  477



>ref|NP_001142117.1| uncharacterized protein LOC100274281 [Zea mays]
 gb|ACF86539.1| unknown [Zea mays]
 gb|ACF87679.1| unknown [Zea mays]
 tpg|DAA52978.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=494

 Score =   272 bits (696),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHVE +SESQKY KLV LLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS
Sbjct  312  QHVEILSESQKYNKLVNLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  371

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  372  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  431

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI+IL+EAGQKVS ELA M
Sbjct  432  AKGTAYTFFTAANARFAKELINILEEAGQKVSSELAAM  469



>emb|CDM81540.1| unnamed protein product [Triticum aestivum]
Length=496

 Score =   271 bits (694),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHVE +SESQKY KLV LLEDIMDGSRIL+FMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  314  QHVEILSESQKYNKLVNLLEDIMDGSRILVFMDTKKGCDQITRQLRMDGWPALSIHGDKS  373

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  374  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  433

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A GTAY+FFTAANARFAKDLI IL EAGQKVSPELA M
Sbjct  434  ATGTAYSFFTAANARFAKDLISILVEAGQKVSPELANM  471



>ref|XP_007024450.1| DEA(D/H)-box RNA helicase family protein [Theobroma cacao]
 gb|EOY27072.1| DEA(D/H)-box RNA helicase family protein [Theobroma cacao]
Length=505

 Score =   271 bits (694),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 148/158 (94%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHV+ V ESQKY+KLVKLLEDIMDGSRILIFMDTKKGCDQ TR+LRMDGWPALSIHGDKS
Sbjct  320  QHVDIVPESQKYSKLVKLLEDIMDGSRILIFMDTKKGCDQITRRLRMDGWPALSIHGDKS  379

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  380  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  439

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI IL+EAGQKVSPELA M
Sbjct  440  AKGTAYTFFTAANARFAKELIVILEEAGQKVSPELAAM  477



>ref|XP_002527412.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF34978.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=505

 Score =   271 bits (694),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHV+ VSE+QKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  320  QHVDIVSENQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  379

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVK+VINYDFPGSLEDYVHRIGRTGRAG
Sbjct  380  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAG  439

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTA+NARFAK+LI IL+EAGQKVSPELA M
Sbjct  440  AKGTAYTFFTASNARFAKELISILEEAGQKVSPELAAM  477



>ref|XP_012068991.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Jatropha curcas]
 gb|KDP40778.1| hypothetical protein JCGZ_24777 [Jatropha curcas]
Length=503

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHV+ VSE+QKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALS+HGDKS
Sbjct  319  QHVDIVSENQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSLHGDKS  378

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  379  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  438

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTA+NARFAK+LI IL+EAGQKVSPELA M
Sbjct  439  AKGTAYTFFTASNARFAKELITILEEAGQKVSPELAAM  476



>ref|XP_008447604.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Cucumis melo]
Length=505

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHV+ VSE+QKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  320  QHVDIVSENQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  379

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEF++GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  380  QAERDWVLSEFRSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  439

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI IL+EAGQKVSPELA M
Sbjct  440  AKGTAYTFFTAANARFAKELIGILEEAGQKVSPELAAM  477



>ref|XP_004146825.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Cucumis sativus]
 gb|KGN59824.1| hypothetical protein Csa_3G848820 [Cucumis sativus]
Length=505

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHV+ VSE+QKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  320  QHVDIVSENQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  379

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEF++GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  380  QAERDWVLSEFRSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  439

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI IL+EAGQKVSPELA M
Sbjct  440  AKGTAYTFFTAANARFAKELIGILEEAGQKVSPELAAM  477



>ref|XP_008805786.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X2 
[Phoenix dactylifera]
Length=498

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE VSE QKY KL+KLLEDIMDGSRILIFMDTKKGCDQ TRQLR DGWPALSIHGDKS
Sbjct  313  QRVEIVSEGQKYNKLIKLLEDIMDGSRILIFMDTKKGCDQITRQLRTDGWPALSIHGDKS  372

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  373  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  432

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAKDLI+IL+EAGQKVSPELA M
Sbjct  433  AKGTAYTFFTAANARFAKDLINILEEAGQKVSPELAAM  470



>ref|XP_003564953.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Brachypodium 
distachyon]
Length=496

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q+VE +SESQKY KLV LLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  314  QYVEILSESQKYNKLVNLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  373

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  374  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  433

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A GTAYTFFTAANARFAKDLI+IL EAGQKVSPELA M
Sbjct  434  ATGTAYTFFTAANARFAKDLINILVEAGQKVSPELANM  471



>ref|XP_004968530.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Setaria italica]
Length=492

 Score =   270 bits (690),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHVE +SESQKY KLV LLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  310  QHVEILSESQKYNKLVNLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  369

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  370  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  429

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI+IL+EAGQKVS ELA M
Sbjct  430  AKGTAYTFFTAANARFAKELINILEEAGQKVSSELAAM  467



>ref|XP_008805785.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Phoenix dactylifera]
Length=530

 Score =   271 bits (692),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE VSE QKY KL+KLLEDIMDGSRILIFMDTKKGCDQ TRQLR DGWPALSIHGDKS
Sbjct  345  QRVEIVSEGQKYNKLIKLLEDIMDGSRILIFMDTKKGCDQITRQLRTDGWPALSIHGDKS  404

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  405  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  464

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAKDLI+IL+EAGQKVSPELA M
Sbjct  465  AKGTAYTFFTAANARFAKDLINILEEAGQKVSPELAAM  502



>ref|XP_006385358.1| DEAD box RNA helicase family protein [Populus trichocarpa]
 gb|ERP63155.1| DEAD box RNA helicase family protein [Populus trichocarpa]
Length=497

 Score =   270 bits (689),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHV+ VSE+QKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  312  QHVDIVSENQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  371

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  372  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  431

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTA NARFAK+L+ IL+EAGQKVSPEL  M
Sbjct  432  AKGTAYTFFTAGNARFAKELVTILEEAGQKVSPELTAM  469



>ref|XP_004968529.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Setaria italica]
Length=517

 Score =   270 bits (690),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHVE +SESQKY KLV LLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  310  QHVEILSESQKYNKLVNLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  369

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  370  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  429

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI+IL+EAGQKVS ELA M
Sbjct  430  AKGTAYTFFTAANARFAKELINILEEAGQKVSSELAAM  467



>gb|KHN39300.1| DEAD-box ATP-dependent RNA helicase 20 [Glycine soja]
Length=433

 Score =   267 bits (683),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q+V+ VSE QKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  248  QYVDIVSEKQKYDKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  307

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  308  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  367

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYT+FTAANARFAK+LI IL+EAGQKVSPELA M
Sbjct  368  AKGTAYTYFTAANARFAKELIAILEEAGQKVSPELAAM  405



>ref|XP_009380443.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Musa acuminata 
subsp. malaccensis]
Length=497

 Score =   269 bits (687),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE VSE+QKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLR DGWPALSIHGDKS
Sbjct  316  QRVEIVSENQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRTDGWPALSIHGDKS  375

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  376  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  435

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAKDLI IL+EAGQKV+PELA M
Sbjct  436  AKGTAYTFFTAANARFAKDLIKILEEAGQKVNPELAKM  473



>ref|XP_002279117.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Vitis vinifera]
 emb|CBI35942.3| unnamed protein product [Vitis vinifera]
Length=506

 Score =   269 bits (688),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHVE VSE+QKY +LVKLLEDIMDG RILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  321  QHVEIVSENQKYNRLVKLLEDIMDGGRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  380

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVK+VINYDFPGSLEDYVHRIGRTGRAG
Sbjct  381  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAG  440

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI IL+EAGQ+V+PELA M
Sbjct  441  AKGTAYTFFTAANARFAKELITILEEAGQRVAPELAAM  478



>ref|XP_011000790.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Populus euphratica]
Length=506

 Score =   269 bits (687),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHV+ VSE+QKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  321  QHVDIVSENQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  380

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGS+EDYVHRIGRTGRAG
Sbjct  381  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSIEDYVHRIGRTGRAG  440

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTA NARFAK+L+ IL+EAGQKVSPEL  M
Sbjct  441  AKGTAYTFFTAGNARFAKELVTILEEAGQKVSPELTAM  478



>ref|XP_010915213.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Elaeis guineensis]
Length=498

 Score =   269 bits (687),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE VSESQKY KL+KLLEDIMDGSRILIFMDTKKGCDQ TRQLR DGWPALSIHGDKS
Sbjct  313  QRVEIVSESQKYNKLIKLLEDIMDGSRILIFMDTKKGCDQITRQLRTDGWPALSIHGDKS  372

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  373  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  432

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAKDLI+IL+EAGQKVS ELA M
Sbjct  433  AKGTAYTFFTAANARFAKDLINILEEAGQKVSSELAAM  470



>ref|XP_007135556.1| hypothetical protein PHAVU_010G139400g [Phaseolus vulgaris]
 gb|ESW07550.1| hypothetical protein PHAVU_010G139400g [Phaseolus vulgaris]
Length=507

 Score =   269 bits (687),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q+V+ VSE QKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  322  QYVDIVSEKQKYDKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  381

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  382  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  441

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI IL+EAGQKVSPELA M
Sbjct  442  AKGTAYTFFTAANARFAKELIAILEEAGQKVSPELAAM  479



>gb|EYU21378.1| hypothetical protein MIMGU_mgv1a004869mg [Erythranthe guttata]
Length=506

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHVE VSE+QKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  324  QHVEIVSENQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  383

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEF+AGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  384  QAERDWVLSEFRAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  443

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYT+FT ANARFAKDLI+IL+EAGQKVS EL  M
Sbjct  444  AKGTAYTYFTVANARFAKDLINILEEAGQKVSSELVAM  481



>ref|XP_006392681.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
 ref|XP_006392682.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
 gb|ESQ29967.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
 gb|ESQ29968.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
Length=429

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V+ +SESQKY KLVKLLEDIMDGSRIL+F+DTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  248  QIVDVISESQKYNKLVKLLEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKS  307

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEF++GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  308  QAERDWVLSEFRSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  367

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFT ANARFAK+LI ILQEAGQKVSPEL++M
Sbjct  368  AKGTAYTFFTVANARFAKELISILQEAGQKVSPELSSM  405



>ref|XP_006583016.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Glycine max]
Length=496

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q+V+ VSE QKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  322  QYVDIVSEKQKYDKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  381

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  382  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  441

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYT+FTAANARFAK+LI IL+EAGQKVSPELA M
Sbjct  442  AKGTAYTYFTAANARFAKELIAILEEAGQKVSPELAAM  479



>ref|XP_010480030.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Camelina sativa]
Length=464

 Score =   266 bits (681),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V+ ++ESQKY KLVKLLEDIMDGSRIL+F+DTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  283  QIVDVITESQKYNKLVKLLEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKS  342

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  343  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  402

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFT ANARFAK+LI+IL+EAGQKVSPELA+M
Sbjct  403  AKGTAYTFFTVANARFAKELINILEEAGQKVSPELASM  440



>ref|XP_003529884.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Glycine max]
Length=507

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q+V+ VSE QKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  322  QYVDIVSEKQKYDKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  381

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  382  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  441

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYT+FTAANARFAK+LI IL+EAGQKVSPELA M
Sbjct  442  AKGTAYTYFTAANARFAKELIAILEEAGQKVSPELAAM  479



>ref|XP_010501121.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Camelina 
sativa]
Length=502

 Score =   267 bits (682),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V+ ++ESQKY KLVKLLEDIMDGSRIL+F+DTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  321  QIVDVITESQKYNKLVKLLEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKS  380

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  381  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  440

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFT ANARFAK+LI+IL+EAGQKVSPELA+M
Sbjct  441  AKGTAYTFFTVANARFAKELINILEEAGQKVSPELASM  478



>ref|XP_003531619.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Glycine 
max]
 gb|KHN11290.1| DEAD-box ATP-dependent RNA helicase 20 [Glycine soja]
Length=507

 Score =   267 bits (682),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q+V+ VSE QKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  322  QYVDIVSEKQKYDKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  381

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYV+NYDFPGSLEDYVHRIGRTGRAG
Sbjct  382  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVVNYDFPGSLEDYVHRIGRTGRAG  441

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYT+FTAANARFAK+LI IL+EAGQKVSPELA M
Sbjct  442  AKGTAYTYFTAANARFAKELIAILEEAGQKVSPELAAM  479



>ref|XP_006392683.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
 gb|ESQ29969.1| hypothetical protein EUTSA_v10011413mg [Eutrema salsugineum]
Length=501

 Score =   266 bits (681),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V+ +SESQKY KLVKLLEDIMDGSRIL+F+DTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  320  QIVDVISESQKYNKLVKLLEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKS  379

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEF++GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  380  QAERDWVLSEFRSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  439

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFT ANARFAK+LI ILQEAGQKVSPEL++M
Sbjct  440  AKGTAYTFFTVANARFAKELISILQEAGQKVSPELSSM  477



>ref|XP_004486821.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X2 [Cicer arietinum]
Length=501

 Score =   266 bits (680),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q+V+ V E QKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  318  QYVDIVPEKQKYDKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  377

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  378  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  437

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+L+ IL+EAGQ+VSPELA M
Sbjct  438  AKGTAYTFFTAANARFAKELVSILEEAGQRVSPELAAM  475



>ref|XP_010480028.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Camelina sativa]
Length=502

 Score =   266 bits (680),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V+ ++ESQKY KLVKLLEDIMDGSRIL+F+DTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  321  QIVDVITESQKYNKLVKLLEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKS  380

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  381  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  440

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFT ANARFAK+LI+IL+EAGQKVSPELA+M
Sbjct  441  AKGTAYTFFTVANARFAKELINILEEAGQKVSPELASM  478



>ref|XP_010542432.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Tarenaya hassleriana]
Length=503

 Score =   266 bits (680),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V+ VSE+QKY KLVKLLEDIMDGSRILIF+DTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  320  QLVDVVSENQKYNKLVKLLEDIMDGSRILIFLDTKKGCDQITRQLRMDGWPALSIHGDKS  379

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEF++GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  380  QAERDWVLSEFRSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  439

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI IL+EAGQ+VSPELA M
Sbjct  440  AKGTAYTFFTAANARFAKELISILEEAGQRVSPELAAM  477



>ref|XP_010462359.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X2 
[Camelina sativa]
Length=464

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V+ ++ESQKY KLVKLLEDIMDGSRIL+F+DTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  283  QIVDVITESQKYNKLVKLLEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKS  342

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  343  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  402

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFT ANARFAK+L++IL+EAGQKVSPELA+M
Sbjct  403  AKGTAYTFFTVANARFAKELMNILEEAGQKVSPELASM  440



>ref|NP_175911.1| DEAD-box ATP-dependent RNA helicase 20 [Arabidopsis thaliana]
 sp|Q9C718.1|RH20_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 20 [Arabidopsis 
thaliana]
 gb|AAG50841.1|AC073944_8 ethylene-responsive RNA helicase, putative [Arabidopsis thaliana]
 gb|AAL32823.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM91186.1| unknown protein [Arabidopsis thaliana]
 gb|AEE33192.1| DEAD-box ATP-dependent RNA helicase 20 [Arabidopsis thaliana]
Length=501

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V+ +SESQKY KLVKLLEDIMDGSRIL+F+DTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  320  QIVDVISESQKYNKLVKLLEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKS  379

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEF++GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  380  QAERDWVLSEFRSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  439

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFT ANARFAK+L +ILQEAGQKVSPELA+M
Sbjct  440  AKGTAYTFFTVANARFAKELTNILQEAGQKVSPELASM  477



>ref|XP_008228305.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X3 
[Prunus mume]
Length=504

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V+ ++E+QKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  319  QIVDIITENQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  378

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVK+VINYDFPGSLEDYVHRIGRTGRAG
Sbjct  379  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAG  438

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI +L+EAGQKVSPELA M
Sbjct  439  AKGTAYTFFTAANARFAKELIALLEEAGQKVSPELAAM  476



>ref|XP_008228303.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Prunus mume]
Length=504

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V+ ++E+QKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  319  QIVDIITENQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  378

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVK+VINYDFPGSLEDYVHRIGRTGRAG
Sbjct  379  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAG  438

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI +L+EAGQKVSPELA M
Sbjct  439  AKGTAYTFFTAANARFAKELIALLEEAGQKVSPELAAM  476



>ref|XP_010462358.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Camelina sativa]
Length=502

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V+ ++ESQKY KLVKLLEDIMDGSRIL+F+DTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  321  QIVDVITESQKYNKLVKLLEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKS  380

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  381  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  440

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFT ANARFAK+L++IL+EAGQKVSPELA+M
Sbjct  441  AKGTAYTFFTVANARFAKELMNILEEAGQKVSPELASM  478



>ref|XP_008391321.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Malus domestica]
Length=505

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V+ ++E+QKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  320  QIVDIITENQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  379

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVK+VINYDFPGSLEDYVHRIGRTGRAG
Sbjct  380  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAG  439

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI +L+EAGQKVSPELA M
Sbjct  440  AKGTAYTFFTAANARFAKELIALLEEAGQKVSPELAAM  477



>ref|XP_007215261.1| hypothetical protein PRUPE_ppa004545mg [Prunus persica]
 gb|EMJ16460.1| hypothetical protein PRUPE_ppa004545mg [Prunus persica]
Length=504

 Score =   265 bits (677),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V+ ++E+QKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  319  QIVDIITENQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  378

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVK+VINYDFPGSLEDYVHRIGRTGRAG
Sbjct  379  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAG  438

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI +L+EAGQKVSPELA M
Sbjct  439  AKGTAYTFFTAANARFAKELIALLEEAGQKVSPELAAM  476



>ref|XP_009367550.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Pyrus x bretschneideri]
Length=505

 Score =   265 bits (677),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V+ ++E+QKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  320  QIVDIITENQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  379

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVK+VINYDFPGSLEDYVHRIGRTGRAG
Sbjct  380  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAG  439

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI +L+EAGQKVSPELA M
Sbjct  440  AKGTAYTFFTAANARFAKELIALLEEAGQKVSPELAAM  477



>ref|XP_010534903.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X2 
[Tarenaya hassleriana]
Length=432

 Score =   262 bits (670),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V+ +SE+QKY KLVKLLEDIMDGSRILIF+DTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  248  QIVDVISENQKYNKLVKLLEDIMDGSRILIFLDTKKGCDQITRQLRMDGWPALSIHGDKS  307

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEF++GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  308  QAERDWVLSEFRSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  367

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARF KDLI+IL+EA Q+VSPELA M
Sbjct  368  AKGTAYTFFTAANARFVKDLINILEEAEQRVSPELAAM  405



>ref|XP_004486820.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like isoform 
X1 [Cicer arietinum]
Length=546

 Score =   265 bits (678),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q+V+ V E QKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  318  QYVDIVPEKQKYDKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  377

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  378  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  437

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+L+ IL+EAGQ+VSPELA M
Sbjct  438  AKGTAYTFFTAANARFAKELVSILEEAGQRVSPELAAM  475



>ref|XP_002891814.1| hypothetical protein ARALYDRAFT_474570 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68073.1| hypothetical protein ARALYDRAFT_474570 [Arabidopsis lyrata subsp. 
lyrata]
Length=501

 Score =   264 bits (675),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V+ +SESQKY KLVKLLEDIMDGSRIL+F+DTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  320  QIVDVISESQKYNKLVKLLEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKS  379

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEF++GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  380  QAERDWVLSEFRSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  439

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFT ANARFAK+L +IL+EAGQKVSPELA+M
Sbjct  440  AKGTAYTFFTVANARFAKELSNILEEAGQKVSPELASM  477



>ref|XP_010686087.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Beta vulgaris 
subsp. vulgaris]
Length=502

 Score =   264 bits (675),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE VSE+QKY KLV LLEDIMDGSRIL+FMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  319  QIVEIVSENQKYKKLVDLLEDIMDGSRILVFMDTKKGCDQITRQLRMDGWPALSIHGDKS  378

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVK+VINYDFPGSLEDYVHRIGRTGRAG
Sbjct  379  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAG  438

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A GTAYTFFTAANARFAK+LI IL+EAGQKV+PELA M
Sbjct  439  ATGTAYTFFTAANARFAKELIAILEEAGQKVNPELAAM  476



>ref|XP_004297601.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Fragaria vesca 
subsp. vesca]
Length=505

 Score =   264 bits (675),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V+ ++E+QKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  320  QIVDIMTENQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  379

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  380  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  439

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTA+TFFTAANARFAK+LI +L+EAGQKVSP+LA M
Sbjct  440  AKGTAHTFFTAANARFAKELIGLLEEAGQKVSPDLAAM  477



>gb|KCW53605.1| hypothetical protein EUGRSUZ_J028691, partial [Eucalyptus grandis]
 gb|KCW53606.1| hypothetical protein EUGRSUZ_J028691, partial [Eucalyptus grandis]
Length=485

 Score =   263 bits (672),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V+ V E++KY KLV LLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  320  QIVDIVPENKKYNKLVNLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  379

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  380  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  439

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI IL+EAGQKVSP+LA M
Sbjct  440  AKGTAYTFFTAANARFAKELISILEEAGQKVSPDLAAM  477



>emb|CDY10596.1| BnaC03g70180D [Brassica napus]
Length=499

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V+ +SESQKY KLVKLLEDIMDGSRIL+F+DTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  318  QIVDVISESQKYNKLVKLLEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKS  377

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEF++GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  378  QAERDWVLSEFRSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  437

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAY+FFTAANARFAK+LI IL+EAGQKVS ELA+M
Sbjct  438  AKGTAYSFFTAANARFAKELISILEEAGQKVSHELASM  475



>ref|XP_003597619.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 ref|XP_003636418.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|ABN08415.1| Helicase, C-terminal [Medicago truncatula]
 gb|AES67870.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=499

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q+V+ V E QKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  316  QYVDIVPEKQKYDKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  375

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  376  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  435

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI IL+EAGQ+VS ELA M
Sbjct  436  AKGTAYTFFTAANARFAKELISILEEAGQRVSSELAAM  473



>gb|AFK42127.1| unknown [Medicago truncatula]
Length=499

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q+V+ V E QKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  316  QYVDIVPEKQKYDKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  375

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIG+TGRAG
Sbjct  376  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGKTGRAG  435

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI IL+EAGQ+VS ELA M
Sbjct  436  AKGTAYTFFTAANARFAKELISILEEAGQRVSSELAAM  473



>gb|KFK38698.1| hypothetical protein AALP_AA3G148400 [Arabis alpina]
Length=499

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE +SESQKY KLVKLLEDIMDGSRIL+F+DTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  318  QIVEVISESQKYNKLVKLLEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKS  377

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEF++GKSPIMTATDVAARGLDVKDV YVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  378  QAERDWVLSEFRSGKSPIMTATDVAARGLDVKDVMYVINYDFPGSLEDYVHRIGRTGRAG  437

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFT ANARFAK+L++ILQEAGQKVS ELA+M
Sbjct  438  AKGTAYTFFTVANARFAKELVNILQEAGQKVSSELASM  475



>emb|CDY02459.1| BnaA08g00660D [Brassica napus]
Length=499

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V+ +SESQKY KLVKLLEDIMDGSRIL+F+DTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  318  QIVDVISESQKYNKLVKLLEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKS  377

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEF++GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  378  QAERDWVLSEFRSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  437

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAY+FFTAANARFAK+L+ IL+EAGQKVS ELA+M
Sbjct  438  AKGTAYSFFTAANARFAKELVSILEEAGQKVSHELASM  475



>ref|XP_010033787.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Eucalyptus 
grandis]
 ref|XP_010033788.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Eucalyptus 
grandis]
Length=504

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V+ V E++KY KLV LLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  320  QIVDIVPENKKYNKLVNLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  379

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  380  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  439

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARFAK+LI IL+EAGQKVSP+LA M
Sbjct  440  AKGTAYTFFTAANARFAKELISILEEAGQKVSPDLAAM  477



>ref|XP_009106904.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Brassica rapa]
Length=499

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V+ +SESQKY KLVKLLEDIMDGSRIL+F+DTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  318  QIVDVISESQKYNKLVKLLEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKS  377

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEF++GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  378  QAERDWVLSEFRSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  437

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAY+FFTAANARFAK+L+ IL+EAGQKVS ELA+M
Sbjct  438  AKGTAYSFFTAANARFAKELVSILEEAGQKVSHELASM  475



>ref|XP_010534902.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Tarenaya hassleriana]
Length=504

 Score =   263 bits (671),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V+ +SE+QKY KLVKLLEDIMDGSRILIF+DTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  320  QIVDVISENQKYNKLVKLLEDIMDGSRILIFLDTKKGCDQITRQLRMDGWPALSIHGDKS  379

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEF++GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  380  QAERDWVLSEFRSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  439

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFTAANARF KDLI+IL+EA Q+VSPELA M
Sbjct  440  AKGTAYTFFTAANARFVKDLINILEEAEQRVSPELAAM  477



>gb|EMT09661.1| DEAD-box ATP-dependent RNA helicase 20 [Aegilops tauschii]
Length=431

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHVE +SESQKY KLV LLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  248  QHVEILSESQKYNKLVNLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  307

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  308  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  367

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKV  365
            A GTAY+FFTAANARFAKDLI IL EAGQKV
Sbjct  368  ATGTAYSFFTAANARFAKDLISILVEAGQKV  398



>gb|EMS55994.1| DEAD-box ATP-dependent RNA helicase 20 [Triticum urartu]
Length=491

 Score =   261 bits (667),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 141/151 (93%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHVE +SESQKY KLV LLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  314  QHVEILSESQKYNKLVNLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  373

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  374  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  433

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKV  365
            A GTAY+FFTAANARFAKDLI IL EAGQKV
Sbjct  434  ATGTAYSFFTAANARFAKDLISILVEAGQKV  464



>dbj|BAD73320.1| putative ethylene-responsive RNA helicase [Oryza sativa Japonica 
Group]
Length=521

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 142/152 (93%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHVE +SESQKY KLV LLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  286  QHVEILSESQKYNKLVNLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  345

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  346  QAERDWVLSEFKSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  405

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVS  362
            AKGTAYTFFTAANARFAKDLI+IL+EAGQK +
Sbjct  406  AKGTAYTFFTAANARFAKDLINILEEAGQKAT  437



>ref|XP_006306418.1| hypothetical protein CARUB_v10012355mg [Capsella rubella]
 gb|EOA39316.1| hypothetical protein CARUB_v10012355mg [Capsella rubella]
Length=499

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V+ +SESQKY KLVKLLEDIMDGSRIL+F+DTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  318  QIVDVISESQKYNKLVKLLEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKS  377

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVL+EF++GKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  378  QAERDWVLAEFRSGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAG  437

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFT ANARFAK+L++IL+EAGQKVS ELA+M
Sbjct  438  AKGTAYTFFTVANARFAKELVNILEEAGQKVSHELASM  475



>ref|XP_002455005.1| hypothetical protein SORBIDRAFT_03g002860 [Sorghum bicolor]
 gb|EES00125.1| hypothetical protein SORBIDRAFT_03g002860 [Sorghum bicolor]
Length=488

 Score =   256 bits (654),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 147/158 (93%), Gaps = 4/158 (3%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHVE +SESQKY KLV LLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  312  QHVEILSESQKYNKLVNLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  371

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+GKSPIMTATDVAARGL    VKYVINYDFPGSLEDYVHRIGRTGRAG
Sbjct  372  QAERDWVLSEFKSGKSPIMTATDVAARGL----VKYVINYDFPGSLEDYVHRIGRTGRAG  427

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAY+FFTAANARFAK+LI IL+EAGQKVS ELA M
Sbjct  428  AKGTAYSFFTAANARFAKELISILEEAGQKVSSELAAM  465



>gb|ACN39916.1| unknown [Picea sitchensis]
Length=593

 Score =   253 bits (647),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE VSE +KY +L+KLLE+IMDGSRILIFM+TKKGCDQ T+QLRMDGWPALSIHGDKS
Sbjct  391  QIVEVVSEYEKYPRLIKLLEEIMDGSRILIFMETKKGCDQVTKQLRMDGWPALSIHGDKS  450

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVL EFKAGKSPIMTATDVAARGLDVKD+K VINYDFPGSLEDYVHRIGRTGRAG
Sbjct  451  QAERDWVLGEFKAGKSPIMTATDVAARGLDVKDIKCVINYDFPGSLEDYVHRIGRTGRAG  510

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAY+FFTAAN RFA++L+ ILQEAGQ+V+PELA M
Sbjct  511  AKGTAYSFFTAANGRFARELVGILQEAGQRVNPELAAM  548



>gb|ABR16327.1| unknown [Picea sitchensis]
Length=504

 Score =   251 bits (640),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE VSE +KYT+L++LLE+IMDGSR+LIF++TKKGCDQ TR+LRMDGWPALSIHGDKS
Sbjct  320  QIVEIVSEHEKYTRLIQLLEEIMDGSRLLIFLETKKGCDQVTRKLRMDGWPALSIHGDKS  379

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKD+K VINYDFPGS+EDYVHRIGRTGRAG
Sbjct  380  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDIKCVINYDFPGSMEDYVHRIGRTGRAG  439

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYT+FTAANARFA+DLI IL+EAGQ +SP LA M
Sbjct  440  AKGTAYTYFTAANARFARDLIKILEEAGQSISPSLAEM  477



>ref|NP_001234650.1| ethylene-responsive RNA helicase [Solanum lycopersicum]
 gb|AAD46404.1|AF096248_1 ethylene-responsive RNA helicase [Solanum lycopersicum]
Length=474

 Score =   249 bits (635),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 138/149 (93%), Positives = 142/149 (95%), Gaps = 1/149 (1%)
 Frame = -3

Query  790  QKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKSQAERDWVLS  611
            QKY KLVKLLEDIMDGSRILIF  T KGCDQ TRQLRMDGWPALSIHGDKSQAERDWVLS
Sbjct  300  QKYNKLVKLLEDIMDGSRILIFR-TLKGCDQVTRQLRMDGWPALSIHGDKSQAERDWVLS  358

Query  610  EFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgragakgtayTFF  431
            EFKAGKSPIMTATDVAARGLDVKDVK+VINYDFPGSLEDYVHRIGRTGRAGA GTAYTFF
Sbjct  359  EFKAGKSPIMTATDVAARGLDVKDVKFVINYDFPGSLEDYVHRIGRTGRAGASGTAYTFF  418

Query  430  TAANARFAKDLIHILQEAGQKVSPELATM  344
            TAANARFAKDL++IL+EAGQKVSPELA M
Sbjct  419  TAANARFAKDLVNILEEAGQKVSPELAKM  447



>ref|XP_006845267.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Amborella 
trichopoda]
 gb|ERN06942.1| hypothetical protein AMTR_s00005p00263980 [Amborella trichopoda]
Length=670

 Score =   248 bits (633),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE V E++KY +L+KLL+ IMDGSRILIFM+TKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  472  QIVEVVGETEKYPRLIKLLQQIMDGSRILIFMETKKGCDQVTRQLRMDGWPALSIHGDKS  531

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVL+EFK G+SPIMTATDVAARGLDVKD+K VINYDFPGSLEDYVHRIGRTGRAG
Sbjct  532  QAERDWVLAEFKNGRSPIMTATDVAARGLDVKDIKCVINYDFPGSLEDYVHRIGRTGRAG  591

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAY+FFT ANARFA++LI ILQEAGQ VSP+LA +
Sbjct  592  AKGTAYSFFTNANARFARELIKILQEAGQAVSPQLAAL  629



>ref|XP_001763089.1| predicted protein [Physcomitrella patens]
 gb|EDQ71966.1| predicted protein [Physcomitrella patens]
Length=514

 Score =   241 bits (615),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE VSE +KY KL+KLLE+IMDGSR+L+FM+TK+GCDQ TRQLRMDGWPALSIHGDKS
Sbjct  315  QVVEVVSEHEKYPKLIKLLEEIMDGSRLLVFMETKRGCDQVTRQLRMDGWPALSIHGDKS  374

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKD+K VINYDFPGS EDYVHRIGRTGRAG
Sbjct  375  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDIKCVINYDFPGSCEDYVHRIGRTGRAG  434

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKG AYTFFTAANA+ AK+L+ IL EAGQ VS +L  M
Sbjct  435  AKGAAYTFFTAANAKHAKELVSILVEAGQPVSSQLQAM  472



>ref|XP_006439905.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
 gb|ESR53145.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
Length=389

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE V+E++KY +L+KLL+++MDGSRILIF +TKKGCDQ TRQLRMDGWPALSIHGDK+
Sbjct  189  QVVEVVTEAEKYNRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKN  248

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q+ERDWVL+EF++G+SPIMTATDVAARGLDVKD+K V+NYDFP SLEDYVHRIGRTGRAG
Sbjct  249  QSERDWVLAEFRSGRSPIMTATDVAARGLDVKDIKCVVNYDFPTSLEDYVHRIGRTGRAG  308

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A+GTA+TFFT +NA+FA+DLI ILQEAGQ VSP L+ +
Sbjct  309  ARGTAFTFFTHSNAKFARDLIKILQEAGQIVSPALSGL  346



>ref|XP_008807455.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Phoenix 
dactylifera]
Length=683

 Score =   243 bits (620),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE +SE++KY +LVKLL ++MDGSRILIF++TKKGCDQ TRQLRMDGWPALSIHGDK+
Sbjct  487  QIVEVMSENEKYPRLVKLLGELMDGSRILIFLETKKGCDQVTRQLRMDGWPALSIHGDKA  546

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVL+EFK+GKSPIMTATDVAARGLDVKD+K VINYDFP SLEDYVHRIGRTGRAG
Sbjct  547  QAERDWVLAEFKSGKSPIMTATDVAARGLDVKDIKCVINYDFPTSLEDYVHRIGRTGRAG  606

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTA TFFT ANARFA+DLI ILQEAG+ V+P LA+M
Sbjct  607  AKGTALTFFTHANARFARDLIKILQEAGKSVTPALASM  644



>ref|XP_010932245.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Elaeis 
guineensis]
Length=701

 Score =   242 bits (617),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE +SE++KY++LVKLL ++MDGSRIL+F++TKKGCDQ TRQLRMDGWPALSIHGDK+
Sbjct  505  QIVEVMSENEKYSRLVKLLGELMDGSRILVFLETKKGCDQVTRQLRMDGWPALSIHGDKA  564

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVL+EFK+G SPIMTATDVAARGLDVKD+K V+NYDFP SLEDYVHRIGRTGRAG
Sbjct  565  QAERDWVLAEFKSGNSPIMTATDVAARGLDVKDIKCVVNYDFPTSLEDYVHRIGRTGRAG  624

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTA+TFFT ANARFA+DLI ILQEAGQ V+P LA+M
Sbjct  625  AKGTAFTFFTHANARFARDLIKILQEAGQSVTPALASM  662



>ref|XP_002987999.1| hypothetical protein SELMODRAFT_269342 [Selaginella moellendorffii]
 gb|EFJ10791.1| hypothetical protein SELMODRAFT_269342 [Selaginella moellendorffii]
Length=505

 Score =   237 bits (604),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHVE V++ +KY KL+KLL++ MDG +ILIFM+TK+GCDQ T+QLRM+GWPALSIHGDKS
Sbjct  306  QHVEVVNDYEKYQKLIKLLDEFMDGGKILIFMETKRGCDQVTKQLRMEGWPALSIHGDKS  365

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK GKSPIMTATDVAARGLDVKD++YVINYDFPGS EDYVHRIGRTGRAG
Sbjct  366  QAERDWVLSEFKTGKSPIMTATDVAARGLDVKDIRYVINYDFPGSCEDYVHRIGRTGRAG  425

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFT +NA+ A++L+ IL EAGQ+++PEL +M
Sbjct  426  AKGTAYTFFTVSNAKHARELVSILSEAGQRITPELQSM  463



>gb|KDO69502.1| hypothetical protein CISIN_1g013176mg [Citrus sinensis]
Length=448

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE V+E++KY +L+KLL+++MDGSRILIF +TKKGCDQ TRQLRMDGWPALSIHGDK+
Sbjct  248  QVVEVVTEAEKYNRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKN  307

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q+ERDWVL+EF++G+SPIMTATDVAARGLDVKD+K V+NYDFP SLEDYVHRIGRTGRAG
Sbjct  308  QSERDWVLAEFRSGRSPIMTATDVAARGLDVKDIKCVVNYDFPTSLEDYVHRIGRTGRAG  367

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A+GTA+TFFT +NA+FA+DLI ILQEAGQ VSP L+ +
Sbjct  368  ARGTAFTFFTHSNAKFARDLIKILQEAGQIVSPALSGL  405



>ref|XP_002972931.1| hypothetical protein SELMODRAFT_98552 [Selaginella moellendorffii]
 gb|EFJ26152.1| hypothetical protein SELMODRAFT_98552 [Selaginella moellendorffii]
Length=534

 Score =   237 bits (605),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHVE V++ +KY KL+KLL++ MDG +ILIFM+TK+GCDQ T+QLRM+GWPALSIHGDKS
Sbjct  311  QHVEVVNDYEKYQKLIKLLDEFMDGGKILIFMETKRGCDQVTKQLRMEGWPALSIHGDKS  370

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK GKSPIMTATDVAARGLDVKD++YVINYDFPGS EDYVHRIGRTGRAG
Sbjct  371  QAERDWVLSEFKTGKSPIMTATDVAARGLDVKDIRYVINYDFPGSCEDYVHRIGRTGRAG  430

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFT +NA+ A++L+ IL EAGQ+++PEL +M
Sbjct  431  AKGTAYTFFTVSNAKHARELVSILSEAGQRITPELQSM  468



>ref|XP_010663104.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Vitis vinifera]
Length=718

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE V+E++KY +L++LL+++MDGSRILIFM+TKKGCDQ TRQ+RMDGWP+LSIHGDK+
Sbjct  517  QVVEVVTETEKYNRLIRLLKEVMDGSRILIFMETKKGCDQVTRQMRMDGWPSLSIHGDKN  576

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVL+EFK+G+SPIMTATDVAARGLDVKD+K VINYDFP SLEDYVHRIGRTGRAG
Sbjct  577  QAERDWVLAEFKSGRSPIMTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAG  636

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTA TFFT +NA+FA+DLI ILQEAGQ VSP L+ M
Sbjct  637  AKGTAITFFTHSNAKFARDLIKILQEAGQVVSPALSAM  674



>ref|XP_007036326.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY20827.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
Length=626

 Score =   237 bits (604),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE V+E +KY +L+KLL+++MDG+RILIFM+TKKGCDQ TRQLRMDGWPALSIHGDK+
Sbjct  426  QVVEVVTELEKYNRLIKLLKEVMDGNRILIFMETKKGCDQVTRQLRMDGWPALSIHGDKN  485

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q+ERDWVL+EFK+G+SPIMTATDVAARGLDVKD+K VINYDFP SLEDYVHRIGRTGRAG
Sbjct  486  QSERDWVLAEFKSGRSPIMTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAG  545

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTA+TFFT ANA++A+DLI +LQ+AGQ VSP L+T+
Sbjct  546  AKGTAFTFFTQANAKYARDLIKLLQDAGQVVSPALSTL  583



>gb|AAG51573.1|AC027034_19 RNA helicase, 5' partial; 101954-101280 [Arabidopsis thaliana]
Length=155

 Score =   223 bits (567),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 121/131 (92%), Positives = 128/131 (98%), Gaps = 0/131 (0%)
 Frame = -3

Query  736  ILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAAR  557
            IL+F+DTKKGCDQ TRQLRMDGWPALSIHGDKSQAERDWVLSEF++GKSPIMTATDVAAR
Sbjct  1    ILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPIMTATDVAAR  60

Query  556  GLDVKDVKYVINYDFPGSLEDYVHrigrtgragakgtayTFFTAANARFAKDLIHILQEA  377
            GLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFT ANARFAK+L +ILQEA
Sbjct  61   GLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELTNILQEA  120

Query  376  GQKVSPELATM  344
            GQKVSPELA+M
Sbjct  121  GQKVSPELASM  131



>gb|KHN18420.1| DEAD-box ATP-dependent RNA helicase 30 [Glycine soja]
Length=517

 Score =   234 bits (596),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE V++ +KY +L++LL+++MDGSRILIFM+TKKGCDQ TRQ+R+DGWPALSIHGDK+
Sbjct  314  QIVEVVTDMEKYNRLIRLLKEVMDGSRILIFMETKKGCDQVTRQMRVDGWPALSIHGDKN  373

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVL+EFK+G+SPIMTATDVAARGLDVKD+K VINYDFP SLEDYVHRIGRTGRAG
Sbjct  374  QAERDWVLAEFKSGRSPIMTATDVAARGLDVKDIKCVINYDFPTSLEDYVHRIGRTGRAG  433

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFT ANA+FA+DLI ILQ+AGQ VSP L  +
Sbjct  434  AKGTAYTFFTHANAKFARDLIKILQDAGQTVSPALTAL  471



>ref|XP_006476870.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Citrus sinensis]
Length=599

 Score =   235 bits (600),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE V+E++KY +L+KLL+++MDGSRILIF +TKKGCDQ TRQLRMDGWPALSIHGDK+
Sbjct  399  QVVEVVTEAEKYNRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKN  458

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q+ERDWVL+EF++G+SPIMTATDVAARGLDVKD+K V+NYDFP SLEDYVHRIGRTGRAG
Sbjct  459  QSERDWVLAEFRSGRSPIMTATDVAARGLDVKDIKCVVNYDFPTSLEDYVHRIGRTGRAG  518

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A+GTA+TFFT +NA+FA+DLI ILQEAGQ VSP L+ +
Sbjct  519  ARGTAFTFFTHSNAKFARDLIKILQEAGQIVSPALSGL  556



>ref|XP_006439909.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
 gb|ESR53149.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
Length=599

 Score =   235 bits (600),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE V+E++KY +L+KLL+++MDGSRILIF +TKKGCDQ TRQLRMDGWPALSIHGDK+
Sbjct  399  QVVEVVTEAEKYNRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKN  458

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q+ERDWVL+EF++G+SPIMTATDVAARGLDVKD+K V+NYDFP SLEDYVHRIGRTGRAG
Sbjct  459  QSERDWVLAEFRSGRSPIMTATDVAARGLDVKDIKCVVNYDFPTSLEDYVHRIGRTGRAG  518

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A+GTA+TFFT +NA+FA+DLI ILQEAGQ VSP L+ +
Sbjct  519  ARGTAFTFFTHSNAKFARDLIKILQEAGQIVSPALSGL  556



>gb|KHN34349.1| DEAD-box ATP-dependent RNA helicase 30 [Glycine soja]
Length=517

 Score =   233 bits (594),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE +++ +KY +L++LL+++MDGSRILIFM+TKKGCDQ TRQ+R+DGWPALSIHGDK+
Sbjct  314  QVVEVLTDMEKYNRLIRLLKEVMDGSRILIFMETKKGCDQVTRQMRVDGWPALSIHGDKN  373

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVL+EFK+G+SPIMTATDVAARGLDVKD+K VINYDFP SLEDYVHRIGRTGRAG
Sbjct  374  QAERDWVLAEFKSGRSPIMTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAG  433

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFT ANA+FA+DLI ILQ+AGQ VSP L+ +
Sbjct  434  AKGTAYTFFTHANAKFARDLIKILQDAGQVVSPALSAL  471



>gb|KDP31038.1| hypothetical protein JCGZ_11414 [Jatropha curcas]
Length=627

 Score =   235 bits (599),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE V+E +KY +L+KLL+++MDGS+ILIFM+TKKGCDQ TRQLRMDGWPALSIHGDK+
Sbjct  428  QIVEVVTEVEKYNRLIKLLKEVMDGSKILIFMETKKGCDQVTRQLRMDGWPALSIHGDKN  487

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK G+SPIMTATDVAARGLDVKD+K VINYDFP SLEDY+HRIGRTGRAG
Sbjct  488  QAERDWVLSEFKCGRSPIMTATDVAARGLDVKDIKCVINYDFPSSLEDYIHRIGRTGRAG  547

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A+GTA TFFT ANA+FA+DLI ILQEA Q + P L+ M
Sbjct  548  ARGTAITFFTHANAKFARDLIKILQEARQILPPTLSAM  585



>gb|KJB40103.1| hypothetical protein B456_007G047000 [Gossypium raimondii]
Length=623

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE +++ +KY +L+KLL+D+MDG+RILIFM+TKKGCDQ TR LRMDGWPALSIHGDK+
Sbjct  422  QVVEVITDLEKYNRLIKLLKDLMDGNRILIFMETKKGCDQVTRHLRMDGWPALSIHGDKN  481

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVL+EFK+G+SPIMTATDVAARGLDVKD+K VINYDFP SLEDYVHRIGRTGRAG
Sbjct  482  QAERDWVLAEFKSGRSPIMTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAG  541

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTA+TFFT ANA++A+DLI +LQ+AGQ VSP L+T+
Sbjct  542  AKGTAFTFFTQANAKYARDLIKLLQDAGQVVSPALSTL  579



>ref|XP_007155472.1| hypothetical protein PHAVU_003G204200g [Phaseolus vulgaris]
 gb|ESW27466.1| hypothetical protein PHAVU_003G204200g [Phaseolus vulgaris]
Length=603

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE V++ +KY +L++LL+++MDGSR+LIFM+TKKGCDQ TRQ+RMDGWPALSIHGDK+
Sbjct  400  QVVEVVTDMEKYNRLIRLLKEVMDGSRVLIFMETKKGCDQVTRQMRMDGWPALSIHGDKN  459

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVL+EFK+G+SPIMTATDVAARGLDVKD+K VINYDFP SLEDYVHRIGRTGRAG
Sbjct  460  QAERDWVLAEFKSGRSPIMTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAG  519

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFT  NA+FA+DLI ILQ+AGQ VSP L+ +
Sbjct  520  AKGTAYTFFTHGNAKFARDLIKILQDAGQVVSPALSAL  557



>gb|KEH31793.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=625

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE V++ +KY +L+KLL+++MDGSRILIF +TKKGCDQ TRQLRMDGWPALSIHGDK+
Sbjct  422  QVVEVVTDMEKYNRLIKLLKEVMDGSRILIFTETKKGCDQVTRQLRMDGWPALSIHGDKN  481

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVL+EFK+G+SPIMTATDVAARGLDVKD+K V+NYDFP SLEDYVHRIGRTGRAG
Sbjct  482  QAERDWVLAEFKSGRSPIMTATDVAARGLDVKDIKCVVNYDFPSSLEDYVHRIGRTGRAG  541

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAY+FFT+ANA++A+DLI ILQ+AGQ VSP L+ +
Sbjct  542  AKGTAYSFFTSANAKYARDLIKILQDAGQIVSPALSAL  579



>ref|XP_012079989.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 [Jatropha curcas]
Length=641

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE V+E +KY +L+KLL+++MDGS+ILIFM+TKKGCDQ TRQLRMDGWPALSIHGDK+
Sbjct  442  QIVEVVTEVEKYNRLIKLLKEVMDGSKILIFMETKKGCDQVTRQLRMDGWPALSIHGDKN  501

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK G+SPIMTATDVAARGLDVKD+K VINYDFP SLEDY+HRIGRTGRAG
Sbjct  502  QAERDWVLSEFKCGRSPIMTATDVAARGLDVKDIKCVINYDFPSSLEDYIHRIGRTGRAG  561

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A+GTA TFFT ANA+FA+DLI ILQEA Q + P L+ M
Sbjct  562  ARGTAITFFTHANAKFARDLIKILQEARQILPPTLSAM  599



>ref|XP_003549600.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Glycine max]
Length=602

 Score =   233 bits (595),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE V++ +KY +L++LL+++MDGSRILIFM+TKKGCDQ TRQ+R+DGWPALSIHGDK+
Sbjct  399  QIVEVVTDMEKYNRLIRLLKEVMDGSRILIFMETKKGCDQVTRQMRVDGWPALSIHGDKN  458

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVL+EFK+G+SPIMTATDVAARGLDVKD+K VINYDFP SLEDYVHRIGRTGRAG
Sbjct  459  QAERDWVLAEFKSGRSPIMTATDVAARGLDVKDIKCVINYDFPTSLEDYVHRIGRTGRAG  518

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFT ANA+FA+DLI ILQ+AGQ VSP L  +
Sbjct  519  AKGTAYTFFTHANAKFARDLIKILQDAGQTVSPALTAL  556



>ref|XP_006579582.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Glycine max]
Length=605

 Score =   233 bits (594),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE +++ +KY +L++LL+++MDGSRILIFM+TKKGCDQ TRQ+R+DGWPALSIHGDK+
Sbjct  402  QVVEVLTDMEKYNRLIRLLKEVMDGSRILIFMETKKGCDQVTRQMRVDGWPALSIHGDKN  461

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVL+EFK+G+SPIMTATDVAARGLDVKD+K VINYDFP SLEDYVHRIGRTGRAG
Sbjct  462  QAERDWVLAEFKSGRSPIMTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAG  521

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFT ANA+FA+DLI ILQ+AGQ VSP L+ +
Sbjct  522  AKGTAYTFFTHANAKFARDLIKILQDAGQVVSPALSAL  559



>ref|XP_009412685.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Musa 
acuminata subsp. malaccensis]
Length=695

 Score =   234 bits (598),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE +SE +KY +L+KLL ++MDGSRILIF++TKKGCDQ TRQLRMDGWPALSIHGDK+
Sbjct  501  QIVEVISELEKYPRLIKLLGEVMDGSRILIFLETKKGCDQVTRQLRMDGWPALSIHGDKA  560

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q+ERDWVL+EFK+G+SPIMTATDVAARGLDVKD+K V+N+DFP SLEDYVHRIGRTGRAG
Sbjct  561  QSERDWVLAEFKSGRSPIMTATDVAARGLDVKDIKCVVNFDFPTSLEDYVHRIGRTGRAG  620

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTA+TFFT AN RFA++L+ ILQ+AGQ VSP LA+M
Sbjct  621  AKGTAFTFFTQANIRFARELVKILQDAGQNVSPALASM  658



>ref|XP_004515873.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Cicer arietinum]
Length=622

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE V++ +KY +L+KLL+++MDGSRILIF +TKKGCDQ T+QLRMDGWPALSIHGDK+
Sbjct  418  QVVEVVTDMEKYNRLLKLLKEVMDGSRILIFTETKKGCDQVTKQLRMDGWPALSIHGDKN  477

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVL+EFK+G+SPIMTATDVAARGLDVKD+K V+NYDFP SLEDYVHRIGRTGRAG
Sbjct  478  QAERDWVLAEFKSGRSPIMTATDVAARGLDVKDIKCVVNYDFPSSLEDYVHRIGRTGRAG  537

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAY+FFT ANA+FA+DLI ILQ+AGQ VSP L+ +
Sbjct  538  AKGTAYSFFTRANAKFARDLIKILQDAGQVVSPALSEL  575



>ref|XP_008239580.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Prunus mume]
Length=609

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE VS+ +KY +L+KLL++ + GSRILIF++TKKGCDQ T+QLRMDGWPALSIHGDK+
Sbjct  411  QVVEVVSDGEKYNRLIKLLKEAIVGSRILIFVETKKGCDQVTKQLRMDGWPALSIHGDKN  470

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVL+EFK+G++PIMTATDVAARGLDVKD+K VINYDFP SLEDYVHRIGRTGRAG
Sbjct  471  QAERDWVLAEFKSGRNPIMTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAG  530

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A GTA TFFT ANA+FA++LI ILQEAGQ VSP LA M
Sbjct  531  ATGTALTFFTHANAKFARELIKILQEAGQVVSPALAAM  568



>ref|XP_007210287.1| hypothetical protein PRUPE_ppa002741mg [Prunus persica]
 gb|EMJ11486.1| hypothetical protein PRUPE_ppa002741mg [Prunus persica]
Length=638

 Score =   231 bits (589),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE VS+ +KY +L+KLL++ + GSRILIF++TKKGCDQ T+QLRMDGWPALSIHGDK+
Sbjct  440  QVVEVVSDGEKYNRLIKLLKEAIVGSRILIFVETKKGCDQVTKQLRMDGWPALSIHGDKN  499

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVL+EFK+G++PIMTATDVAARGLDVKD+K VINYDFP SLEDYVHRIGRTGRAG
Sbjct  500  QAERDWVLAEFKSGRNPIMTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAG  559

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A GTA TFFT ANA+FA++LI ILQEAGQ VSP LA M
Sbjct  560  ATGTALTFFTHANAKFARELIKILQEAGQVVSPALAAM  597



>ref|XP_010251083.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Nelumbo 
nucifera]
Length=719

 Score =   233 bits (593),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE +++ +KY +L KLL ++MDGSR+LIF++TKKGCDQ TRQLRMDGWPALSIHGDK+
Sbjct  517  QVVEVMTDLEKYKRLTKLLTEMMDGSRVLIFLETKKGCDQVTRQLRMDGWPALSIHGDKN  576

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVL+EFK+G+SPIMTATDVAARGLDVKD+K VINYDFP SLEDYVHRIGRTGRAG
Sbjct  577  QAERDWVLAEFKSGRSPIMTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAG  636

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A+G A+TFFT ANARFA+DLI ILQ+ GQ V+P LA M
Sbjct  637  ARGNAFTFFTHANARFARDLIKILQDCGQVVNPALAAM  674



>ref|XP_002322195.2| hypothetical protein POPTR_0015s09460g [Populus trichocarpa]
 gb|EEF06322.2| hypothetical protein POPTR_0015s09460g [Populus trichocarpa]
Length=609

 Score =   230 bits (586),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE + + +KY +L+KLL+++MDGSRILIFM+TKKGCDQ TRQLRMDGW ALSIHGDK+
Sbjct  413  QVVEVMMDLEKYKRLIKLLKEVMDGSRILIFMETKKGCDQVTRQLRMDGWAALSIHGDKN  472

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVL+EFK+G+SPIMTATDVAARGLDVKD+K V+NYDFP SLEDYVHRIGRTGRAG
Sbjct  473  QAERDWVLAEFKSGRSPIMTATDVAARGLDVKDIKCVVNYDFPSSLEDYVHRIGRTGRAG  532

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A+GTA TFFT +NA+FA+DLI ILQEAGQ V P L+ M
Sbjct  533  ARGTALTFFTESNAKFARDLIKILQEAGQIVPPSLSAM  570



>ref|XP_008365657.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Malus 
domestica]
Length=643

 Score =   229 bits (583),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V+ V+E +KY +L+KLL++ M GSRILIF++TKKGCD  T+QLRMDGWPALSIHGDK+
Sbjct  443  QVVDVVTEVEKYNRLIKLLKEAMVGSRILIFVETKKGCDHVTKQLRMDGWPALSIHGDKN  502

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVL+EFK+G++PIMTATDVAARGLDVKD+K VINYDFP SLEDYVHRIGRTGRAG
Sbjct  503  QAERDWVLAEFKSGRNPIMTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAG  562

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A GTA TFFT ANA+F +DLI ILQEAGQ VSP LA M
Sbjct  563  AAGTALTFFTHANAKFTRDLIKILQEAGQVVSPALAAM  600



>ref|XP_004299135.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Fragaria vesca 
subsp. vesca]
Length=606

 Score =   228 bits (581),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE V+E +KY +L+KLL+D + GSRILIF++TKKGCD  T+QLRMDGWPALSIHGDK+
Sbjct  411  QVVEVVTEFEKYNRLLKLLKDSIVGSRILIFVETKKGCDHVTKQLRMDGWPALSIHGDKN  470

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVLSEFK+G+SPIMTATDVAARGLDVKD+K VINYDFP SLEDYVHRIGRTGRAG
Sbjct  471  QAERDWVLSEFKSGRSPIMTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAG  530

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A GTA TFFT +N +FA++LI ILQEAGQ VSP L+ M
Sbjct  531  ATGTALTFFTESNGKFARELIKILQEAGQVVSPALSAM  568



>ref|XP_002318665.2| ethylene-responsive DEAD box RNA helicase family protein [Populus 
trichocarpa]
 gb|EEE96885.2| ethylene-responsive DEAD box RNA helicase family protein [Populus 
trichocarpa]
Length=543

 Score =   226 bits (575),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE + + +KY +L+KLL+++MDGSR+LIFM+TKKGCDQ TRQLRMDGWPALSIHGDK+
Sbjct  343  QVVEVIMDMEKYNRLIKLLKEVMDGSRLLIFMETKKGCDQVTRQLRMDGWPALSIHGDKN  402

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVL+EFK+G+S IMTATDVAARGLDVKD+K VINYDFP SLEDYVHRIGRTGRAG
Sbjct  403  QAERDWVLAEFKSGRSAIMTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAG  462

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A+GTA+TFFT +NA+FA+ LI ILQE+GQ V P L+ +
Sbjct  463  ARGTAFTFFTDSNAKFARGLIRILQESGQIVPPALSAL  500



>ref|XP_011047813.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 [Populus euphratica]
Length=625

 Score =   227 bits (579),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE V + +KY +L+KLL+++MDGSRILIFM+TKKGCDQ TRQLRMDGWPALSIHGDK+
Sbjct  425  QVVEVVMDMEKYNRLIKLLKEVMDGSRILIFMETKKGCDQVTRQLRMDGWPALSIHGDKN  484

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVL+EFK+G+S IMTATDVAARGLDVKD+K VINYDFP SLEDYVHRIGRTGRAG
Sbjct  485  QAERDWVLAEFKSGRSAIMTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAG  544

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A+GTA+TFFT +NA+FA+ LI ILQE+GQ V P L+ +
Sbjct  545  ARGTAFTFFTDSNAKFARGLIRILQESGQIVPPALSAL  582



>ref|XP_011071940.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X2 
[Sesamum indicum]
Length=600

 Score =   227 bits (578),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q +E +++ +KY +L++LL+D+MDGS+ILIF++TKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  400  QVIEVMTDLEKYNRLIRLLKDVMDGSKILIFVETKKGCDQVTRQLRMDGWPALSIHGDKS  459

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q ERDWVL+EFK G+SPIM ATDVAARGLDVKD+K V+NYDFP SLEDYVHRIGRTGRAG
Sbjct  460  QDERDWVLAEFKTGRSPIMIATDVAARGLDVKDIKCVVNYDFPSSLEDYVHRIGRTGRAG  519

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A GTA++FFT  NA++A+DLI ILQ+AGQ V P+LA +
Sbjct  520  ASGTAFSFFTHGNAKYARDLIKILQQAGQVVPPQLAAL  557



>ref|XP_011046220.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Populus 
euphratica]
Length=612

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE + + +KY +L+KLL+++MDGSRILIFM+TKKGCDQ TRQLRMDGW ALSIHGDK+
Sbjct  416  QVVEVMMDLEKYKRLIKLLKEVMDGSRILIFMETKKGCDQVTRQLRMDGWAALSIHGDKN  475

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVL+EFK+G+S IMTATDVAARGLDVKD+K V+NYDFP SLEDYVHRIGRTGRAG
Sbjct  476  QAERDWVLAEFKSGRSAIMTATDVAARGLDVKDIKCVVNYDFPSSLEDYVHRIGRTGRAG  535

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A GTA TFFT +NA+FA+DLI ILQEAGQ V P L+ M
Sbjct  536  ASGTALTFFTESNAKFARDLIKILQEAGQIVPPSLSAM  573



>ref|XP_011071939.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Sesamum indicum]
Length=626

 Score =   226 bits (577),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q +E +++ +KY +L++LL+D+MDGS+ILIF++TKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  426  QVIEVMTDLEKYNRLIRLLKDVMDGSKILIFVETKKGCDQVTRQLRMDGWPALSIHGDKS  485

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q ERDWVL+EFK G+SPIM ATDVAARGLDVKD+K V+NYDFP SLEDYVHRIGRTGRAG
Sbjct  486  QDERDWVLAEFKTGRSPIMIATDVAARGLDVKDIKCVVNYDFPSSLEDYVHRIGRTGRAG  545

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A GTA++FFT  NA++A+DLI ILQ+AGQ V P+LA +
Sbjct  546  ASGTAFSFFTHGNAKYARDLIKILQQAGQVVPPQLAAL  583



>ref|XP_009345779.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Pyrus 
x bretschneideri]
Length=612

 Score =   226 bits (576),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -3

Query  787  KYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKSQAERDWVLSE  608
            KY +L+KLL++ M GSRILIF++TKKGCD  T+QLRMDGWPALSIHGDK+QAERDWVL+E
Sbjct  422  KYNRLIKLLKEAMVGSRILIFVETKKGCDHVTKQLRMDGWPALSIHGDKNQAERDWVLAE  481

Query  607  FKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgragakgtayTFFT  428
            FK+G++PIMTATDVAARGLDVKD+K+VINYDFP SLEDYVHRIGRTGRAGA GTA TFFT
Sbjct  482  FKSGRNPIMTATDVAARGLDVKDIKFVINYDFPSSLEDYVHRIGRTGRAGATGTALTFFT  541

Query  427  AANARFAKDLIHILQEAGQKVSPELATM  344
             ANA+FA+DLI ILQEAGQ VSP LA M
Sbjct  542  HANAKFARDLIKILQEAGQVVSPALAAM  569



>ref|XP_009363040.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Pyrus 
x bretschneideri]
Length=611

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = -3

Query  787  KYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKSQAERDWVLSE  608
            KY +L+KLL++ M GSRILIF++TKKGCD  T+QLRMDGWPALSIHGDK+QAERDWVL+E
Sbjct  421  KYNRLIKLLKEAMVGSRILIFVETKKGCDHVTKQLRMDGWPALSIHGDKNQAERDWVLAE  480

Query  607  FKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgragakgtayTFFT  428
            FK+G++PIMTATDVAARGLDVKD+K+VINYDFP SLEDYVHRIGRTGRAGA GTA TFFT
Sbjct  481  FKSGRNPIMTATDVAARGLDVKDIKFVINYDFPSSLEDYVHRIGRTGRAGATGTALTFFT  540

Query  427  AANARFAKDLIHILQEAGQKVSPELATM  344
             ANA+FA+DLI ILQEAGQ VSP LA M
Sbjct  541  HANAKFARDLIKILQEAGQVVSPALAAM  568



>emb|CDP12744.1| unnamed protein product [Coffea canephora]
Length=624

 Score =   226 bits (575),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q +E V++ +KY +L++LL+++MDGSRILIF++TKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  427  QIIEIVTDVEKYNRLIRLLKEVMDGSRILIFVETKKGCDQVTRQLRMDGWPALSIHGDKS  486

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q ERDWVL++FK+G++PIM ATDVAARGLDVKD+K V+NYDFP SLEDYVHRIGRTGRAG
Sbjct  487  QDERDWVLADFKSGRNPIMIATDVAARGLDVKDIKCVVNYDFPSSLEDYVHRIGRTGRAG  546

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A GTA+TFFT ANA+FA+DLI IL++AGQ + P+L+ M
Sbjct  547  ATGTAFTFFTHANAKFARDLIKILRDAGQIIPPDLSAM  584



>gb|KDP40781.1| hypothetical protein JCGZ_24780 [Jatropha curcas]
Length=361

 Score =   219 bits (557),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/111 (93%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHV+ VSE+QKY KLVKLLEDIMDG RILIFMDTKKGCDQ  RQLRMDGWPALS HGDKS
Sbjct  248  QHVDIVSENQKYNKLVKLLEDIMDGCRILIFMDTKKGCDQIIRQLRMDGWPALSFHGDKS  307

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVH  485
            QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVH
Sbjct  308  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVH  358



>ref|XP_010102487.1| DEAD-box ATP-dependent RNA helicase 20 [Morus notabilis]
 gb|EXB93551.1| DEAD-box ATP-dependent RNA helicase 20 [Morus notabilis]
Length=625

 Score =   225 bits (573),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE V++ +KY +L+KLL++++D  +ILIF++TKK CDQ TRQLRMDGWPALSIHGDK+
Sbjct  425  QVVEVVTDMEKYNRLIKLLKEMVDSGKILIFIETKKACDQVTRQLRMDGWPALSIHGDKN  484

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERDWVL+EFK+G+SPIMTATDVAARGLDVKD+K VINYDFP SLEDYVHRIGRTGRAG
Sbjct  485  QAERDWVLAEFKSGRSPIMTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAG  544

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A+GTA TFFT ANA+FA++LI ILQEAGQ V+P L+ +
Sbjct  545  ARGTALTFFTHANAKFARELIKILQEAGQVVTPALSAL  582



>ref|XP_008464517.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Cucumis melo]
Length=622

 Score =   224 bits (570),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE + E++KY +L+KLL ++MDGSRILIF++TKKGCD+ TRQLRMDGWPALSIHGDK 
Sbjct  422  QVVEVLPEAEKYRRLIKLLVEVMDGSRILIFVETKKGCDKVTRQLRMDGWPALSIHGDKK  481

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERD VLSEFK+G++PIMTATDVAARGLDVKD+K VINYDFP SLEDYVHRIGRTGRAG
Sbjct  482  QAERDLVLSEFKSGRNPIMTATDVAARGLDVKDIKCVINYDFPSSLEDYVHRIGRTGRAG  541

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTA+TFFT  NA+ A+DLI IL+EAGQ V+P L+T+
Sbjct  542  AKGTAFTFFTHENAKHARDLIKILREAGQIVTPALSTL  579



>ref|XP_004236255.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Solanum lycopersicum]
Length=651

 Score =   223 bits (569),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q +E V++ +KY++L+ LL+++MDGSRILIF++TKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  451  QVIEVVTDLEKYSRLIGLLKEVMDGSRILIFVETKKGCDQVTRQLRMDGWPALSIHGDKS  510

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q ERDWVL++FK+G+SPIM ATDVAARGLDVKD+K VINYDFP SLEDY+HRIGRTGRAG
Sbjct  511  QDERDWVLADFKSGRSPIMIATDVAARGLDVKDIKCVINYDFPSSLEDYIHRIGRTGRAG  570

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A GTA+TFFT ANA+F ++LI ILQ+AGQ V P+L+ +
Sbjct  571  ATGTAFTFFTHANAKFTRELIKILQQAGQIVPPQLSAL  608



>ref|XP_006344459.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Solanum tuberosum]
Length=648

 Score =   223 bits (568),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q +E V++ +KY++L+ LL+++MDGSRILIF++TKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  449  QVIEVVTDLEKYSRLIGLLKEVMDGSRILIFVETKKGCDQVTRQLRMDGWPALSIHGDKS  508

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q ERDWVL++FK G+SPIM ATDVAARGLDVKD+K VINYDFP SLEDY+HRIGRTGRAG
Sbjct  509  QDERDWVLADFKTGRSPIMIATDVAARGLDVKDIKCVINYDFPSSLEDYIHRIGRTGRAG  568

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A GTAYTFFT ANA+F ++LI ILQ+AGQ V P+L+ +
Sbjct  569  ATGTAYTFFTHANAKFTRELIKILQQAGQIVPPQLSAL  606



>ref|XP_004138092.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Cucumis sativus]
Length=622

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE + E++KY +L+KLL ++MDGSRILIF++TKKGCD+ TRQLRMDGWPALSIHGDK 
Sbjct  422  QVVEVLPEAEKYRRLIKLLGEVMDGSRILIFVETKKGCDKVTRQLRMDGWPALSIHGDKK  481

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERD VLSEFK+G++PIMTATDVAARGLDVKD+K VIN+DFP SLEDYVHRIGRTGRAG
Sbjct  482  QAERDLVLSEFKSGRNPIMTATDVAARGLDVKDIKCVINFDFPSSLEDYVHRIGRTGRAG  541

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTA+TFFT  NA+ A+DLI IL+EAGQ V+P L+ +
Sbjct  542  AKGTAFTFFTHENAKHARDLIKILREAGQIVTPALSAL  579



>ref|XP_010027294.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Eucalyptus 
grandis]
 gb|KCW83292.1| hypothetical protein EUGRSUZ_B00227 [Eucalyptus grandis]
Length=624

 Score =   221 bits (562),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE + ES+KY++L+KLL+ +MDGSRILIF++TKKGCDQ T+QLRMDGWPALSIHGDKS
Sbjct  418  QIVEVIKESEKYSRLIKLLKAVMDGSRILIFVETKKGCDQVTKQLRMDGWPALSIHGDKS  477

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q+ER+WVL+EFK+G+S IMTATDVAARGLDVKD+K VINYDFP +LEDYVHRIGRTGRAG
Sbjct  478  QSEREWVLAEFKSGRSLIMTATDVAARGLDVKDIKCVINYDFPMTLEDYVHRIGRTGRAG  537

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTA+TFFT +N+RFA +L+ ILQ+AGQ V P L+ +
Sbjct  538  AKGTAFTFFTDSNSRFAGELLKILQDAGQVVPPALSDL  575



>ref|XP_002458964.1| hypothetical protein SORBIDRAFT_03g043450 [Sorghum bicolor]
 gb|EES04084.1| hypothetical protein SORBIDRAFT_03g043450 [Sorghum bicolor]
Length=578

 Score =   219 bits (559),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE +S+ +KY +L KLL D+MDGSRILIF  TKK CD+ TRQLRMDGWPALSIHGDK+
Sbjct  380  QIVEVISDHEKYPRLSKLLSDLMDGSRILIFFQTKKDCDKITRQLRMDGWPALSIHGDKA  439

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERD+VL+EFK+GKSPIM ATDVAARGLDVKD+K VINYDFP +LEDY+HRIGRTGRAG
Sbjct  440  QAERDYVLAEFKSGKSPIMAATDVAARGLDVKDIKCVINYDFPTTLEDYIHRIGRTGRAG  499

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A GTA+TFFT ANA+F+++L+ IL+EAGQ V+P L +M
Sbjct  500  ASGTAFTFFTHANAKFSRNLVKILREAGQAVNPALESM  537



>ref|XP_009594348.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nicotiana 
tomentosiformis]
Length=646

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE V++ +KY +L+ LL+++MDGSRILIF++TKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  449  QIVEVVTDLEKYRRLIGLLKEMMDGSRILIFVETKKGCDQVTRQLRMDGWPALSIHGDKS  508

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q ERDWVL+EFK G+SPIM ATDVAARGLDVKD+K VINYDFP SLEDY+HRIGRTGRAG
Sbjct  509  QDERDWVLAEFKNGRSPIMIATDVAARGLDVKDIKCVINYDFPSSLEDYIHRIGRTGRAG  568

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A GTA+TFFT ANA++ + LI ILQ+AGQ V P+L+ +
Sbjct  569  ATGTAFTFFTHANAKYTRQLIKILQQAGQIVPPQLSAL  606



>gb|KHN25107.1| DEAD-box ATP-dependent RNA helicase 20 [Glycine soja]
Length=378

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 127/148 (86%), Gaps = 10/148 (7%)
 Frame = -3

Query  787  KYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKSQAERDWVLSE  608
            +Y  LVKL EDIMDGSRILIFM TKKGCDQ TRQLRMDGWPALSIHGDKS AERDWVLSE
Sbjct  224  RYFILVKLPEDIMDGSRILIFMGTKKGCDQITRQLRMDGWPALSIHGDKSHAERDWVLSE  283

Query  607  FKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgragakgtayTFFT  428
            FK+GKSP          GLDVKDVKYVINYDF GSLEDYVHRIGR GRAGAKGTAY +FT
Sbjct  284  FKSGKSP----------GLDVKDVKYVINYDFRGSLEDYVHRIGRIGRAGAKGTAYPYFT  333

Query  427  AANARFAKDLIHILQEAGQKVSPELATM  344
            AANARFAKDLI IL+EAGQKVSPELA M
Sbjct  334  AANARFAKDLIAILEEAGQKVSPELAAM  361



>tpg|DAA56213.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=571

 Score =   219 bits (558),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE +S+ +KY +L KLL D+MDGSRILIF  TKK CD+ TRQLRMDGWPALSIHGDK+
Sbjct  374  QIVEVISDHEKYPRLSKLLSDLMDGSRILIFFQTKKDCDKITRQLRMDGWPALSIHGDKA  433

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERD+VL+EFK+GKSPIM ATDVAARGLDVKD+K VINYDFP +LEDY+HRIGRTGRAG
Sbjct  434  QAERDYVLAEFKSGKSPIMAATDVAARGLDVKDIKCVINYDFPTTLEDYIHRIGRTGRAG  493

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A GTA+TFFT ANA+F+++L+ IL+EAGQ V+P L +M
Sbjct  494  ASGTAFTFFTHANAKFSRNLVKILREAGQVVNPALESM  531



>ref|XP_006646592.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Oryza 
brachyantha]
Length=547

 Score =   218 bits (556),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q +E +SE +KY +L KLL D+MDGSRILIF  TKK CD+ TRQLRMDGWPALSIHGDK+
Sbjct  353  QIIEVISEHEKYPRLSKLLSDLMDGSRILIFFQTKKDCDKVTRQLRMDGWPALSIHGDKA  412

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERD+VL+EFK+GKSPIM ATDVAARGLDVKD+K VIN+DFP +LEDY+HRIGRTGRAG
Sbjct  413  QAERDYVLAEFKSGKSPIMAATDVAARGLDVKDIKCVINFDFPTTLEDYIHRIGRTGRAG  472

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A GTA+TFFT +NA+F+++L+ IL+EAGQ V+P L +M
Sbjct  473  ASGTAFTFFTHSNAKFSRNLVKILREAGQVVNPALESM  510



>ref|XP_009769444.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nicotiana 
sylvestris]
Length=646

 Score =   220 bits (560),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE V++ +KY +L+ LL+++MDGSRILIF++TKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  449  QIVEVVTDLEKYRRLIGLLKEMMDGSRILIFVETKKGCDQVTRQLRMDGWPALSIHGDKS  508

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q ERDWVL+EFK G+SPIM ATDVAARGLDVKD+K V+NYDFP SLEDY+HRIGRTGRAG
Sbjct  509  QDERDWVLAEFKNGRSPIMIATDVAARGLDVKDIKCVVNYDFPSSLEDYIHRIGRTGRAG  568

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A GTA+TFFT ANA++ + LI ILQ+AGQ V P+L+ +
Sbjct  569  ATGTAFTFFTHANAKYTRQLIKILQQAGQIVPPQLSAL  606



>ref|XP_010550696.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 [Tarenaya hassleriana]
Length=576

 Score =   218 bits (556),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q +E V  S+KY +L+KLL+ +MDGS+ILIF++TKKGCDQ T+QLRMDGWPAL+IHGDK+
Sbjct  380  QIIEIVPASEKYIRLIKLLKQLMDGSKILIFVETKKGCDQVTKQLRMDGWPALAIHGDKT  439

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q+ERD VLSEFK+G+SPIMTATDVAARGLDVKD+K VINYDFP SLEDY+HRIGRTGRAG
Sbjct  440  QSERDRVLSEFKSGRSPIMTATDVAARGLDVKDIKCVINYDFPTSLEDYIHRIGRTGRAG  499

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKG A+TFFT  NARFA++LI IL EAGQ V P L+ +
Sbjct  500  AKGMAFTFFTHDNARFARELIKILHEAGQVVPPSLSDL  537



>dbj|BAD82427.1| putative DEAD box RNA helicase [Oryza sativa Japonica Group]
 dbj|BAD82339.1| putative DEAD box RNA helicase [Oryza sativa Japonica Group]
 gb|EEE55863.1| hypothetical protein OsJ_04500 [Oryza sativa Japonica Group]
Length=571

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q +E +SE +KY +L KLL D+MDGSRILIF  TKK CD+ TRQLRMDGWPALSIHGDK+
Sbjct  377  QIIEVISEHEKYPRLSKLLSDLMDGSRILIFFQTKKDCDKVTRQLRMDGWPALSIHGDKA  436

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERD+VL+EFK+GKSPIM ATDVAARGLDVKD+K VIN+DFP +LEDY+HRIGRTGRAG
Sbjct  437  QAERDYVLAEFKSGKSPIMAATDVAARGLDVKDIKCVINFDFPTTLEDYIHRIGRTGRAG  496

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A GTA+TFFT +NA+F+++L+ IL+EAGQ V+P L +M
Sbjct  497  ASGTAFTFFTLSNAKFSRNLVKILREAGQVVNPALESM  534



>sp|Q5N7W4.2|RH30_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 30 [Oryza sativa 
Japonica Group]
Length=666

 Score =   218 bits (556),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q +E +SE +KY +L KLL D+MDGSRILIF  TKK CD+ TRQLRMDGWPALSIHGDK+
Sbjct  472  QIIEVISEHEKYPRLSKLLSDLMDGSRILIFFQTKKDCDKVTRQLRMDGWPALSIHGDKA  531

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERD+VL+EFK+GKSPIM ATDVAARGLDVKD+K VIN+DFP +LEDY+HRIGRTGRAG
Sbjct  532  QAERDYVLAEFKSGKSPIMAATDVAARGLDVKDIKCVINFDFPTTLEDYIHRIGRTGRAG  591

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A GTA+TFFT +NA+F+++L+ IL+EAGQ V+P L +M
Sbjct  592  ASGTAFTFFTLSNAKFSRNLVKILREAGQVVNPALESM  629



>ref|XP_006394312.1| hypothetical protein EUTSA_v10003871mg [Eutrema salsugineum]
 gb|ESQ31598.1| hypothetical protein EUTSA_v10003871mg [Eutrema salsugineum]
Length=596

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q +E V   +KY +L+ LL+ +MDGS+ILIF++TK+GCDQ TRQLRMDGWPAL+IHGDK+
Sbjct  392  QVIEIVPTPEKYNRLLTLLKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKN  451

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERD VLSEFK+G+SPIMTATDVAARGLDVKD+K V+NYDFP SLEDY+HRIGRTGRAG
Sbjct  452  QAERDRVLSEFKSGRSPIMTATDVAARGLDVKDIKCVVNYDFPTSLEDYIHRIGRTGRAG  511

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKG A+TFFT  NA+FA++LI ILQEAGQ V P L+ +
Sbjct  512  AKGMAFTFFTHDNAKFARELIKILQEAGQVVPPTLSAL  549



>emb|CDY48128.1| BnaCnng15700D [Brassica napus]
Length=594

 Score =   217 bits (552),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q +E V   +KYT+L+ LL+ +MDGS+ILIF++TK+GCDQ TRQLRMDGWPAL+IHGDK+
Sbjct  390  QVIEIVQTPEKYTRLLTLLKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKN  449

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q ERD VLSEFK+G+SPIMTATDVAARGLDVKD+K V+NYDFP SLEDY+HRIGRTGRAG
Sbjct  450  QTERDRVLSEFKSGRSPIMTATDVAARGLDVKDIKCVVNYDFPTSLEDYIHRIGRTGRAG  509

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKG A TFFT  NA+FA++LI ILQEAGQ V P L+ +
Sbjct  510  AKGMAMTFFTHDNAKFARELIKILQEAGQVVPPTLSAL  547



>ref|XP_004971011.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X2 [Setaria italica]
Length=569

 Score =   216 bits (549),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE +S+ +KY +L KLL D+MDGSRILIF  TKK CD+ TRQLRMDGWPALSIHGDK+
Sbjct  372  QIVEVISDQEKYPRLSKLLSDLMDGSRILIFFQTKKDCDKITRQLRMDGWPALSIHGDKA  431

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q+ERD+VL+EFK+GKSPIM ATDVAARGLDVKD+K VINYDFP +LEDY+HRIGRTGRAG
Sbjct  432  QSERDYVLAEFKSGKSPIMAATDVAARGLDVKDIKCVINYDFPTTLEDYIHRIGRTGRAG  491

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPEL  353
            A GTA+TFFT ANA+F+++L+ IL+EAGQ V+P L
Sbjct  492  ASGTAFTFFTHANAKFSRNLVKILREAGQVVNPAL  526



>gb|AFW97645.1| cold responsive DEAD-box RNA helicase [Chorispora bungeana]
 gb|AHZ57094.1| cold responsive DEAD-box RNA helicase [Chorispora bungeana]
Length=595

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q +E V   +KY +L+ LL+ +MDGS+ILIF++TK+GCDQ TRQLRMDGWPAL+IHGDK+
Sbjct  388  QVIEIVPTPEKYARLLALLKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKN  447

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q+ERD VLSEFK+G+SPIMTATDVAARGLDVKD+K V+NYDFP SLEDY+HRIGRTGRAG
Sbjct  448  QSERDRVLSEFKSGRSPIMTATDVAARGLDVKDIKCVVNYDFPTSLEDYIHRIGRTGRAG  507

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKG A+TFFT  NA+FA++LI ILQEAGQ V P L+ +
Sbjct  508  AKGMAFTFFTHDNAKFARELIKILQEAGQVVPPTLSAL  545



>ref|XP_009112063.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 isoform X1 
[Brassica rapa]
Length=591

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q +E V   +KY++L+ LL+ +MDGS+ILIF++TK+GCDQ TRQLRMDGWPAL+IHGDK+
Sbjct  387  QVIEIVQTPEKYSRLLTLLKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKN  446

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q ERD VLSEFK+G+SPIMTATDVAARGLDVKD+K V+NYDFP SLEDY+HRIGRTGRAG
Sbjct  447  QTERDRVLSEFKSGRSPIMTATDVAARGLDVKDIKCVVNYDFPTSLEDYIHRIGRTGRAG  506

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKG A TFFT  NA+FA++LI ILQEAGQ V P L+ +
Sbjct  507  AKGMAMTFFTHDNAKFARELIKILQEAGQVVPPTLSAL  544



>emb|CDY16735.1| BnaA09g06470D [Brassica napus]
Length=591

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q +E V   +KY++L+ LL+ +MDGS+ILIF++TK+GCDQ TRQLRMDGWPAL+IHGDK+
Sbjct  388  QVIEIVQTPEKYSRLLTLLKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKN  447

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q ERD VLSEFK+G+SPIMTATDVAARGLDVKD+K V+NYDFP SLEDY+HRIGRTGRAG
Sbjct  448  QTERDRVLSEFKSGRSPIMTATDVAARGLDVKDIKCVVNYDFPTSLEDYIHRIGRTGRAG  507

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKG A TFFT  NA+FA++LI ILQEAGQ V P L+ +
Sbjct  508  AKGMAMTFFTHDNAKFARELIKILQEAGQVVPPTLSAL  545



>gb|EYU22173.1| hypothetical protein MIMGU_mgv1a003417mg [Erythranthe guttata]
Length=586

 Score =   215 bits (548),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE +++ +KY +L++LL+D MDGS+ILIF++TKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  389  QVVEIMTDMEKYNRLIRLLKDFMDGSKILIFVETKKGCDQVTRQLRMDGWPALSIHGDKS  448

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q ERDWVL++FK+G+SPIM ATDVAARGLDVKD+K V+NYDFP SLEDYVHRIGRTGRAG
Sbjct  449  QDERDWVLADFKSGRSPIMIATDVAARGLDVKDIKCVVNYDFPSSLEDYVHRIGRTGRAG  508

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A GTA+TFFT AN + A  LI ILQ+A Q V P+LA +
Sbjct  509  ATGTAFTFFTHANVKSAGHLIKILQQARQAVPPQLAAL  546



>ref|XP_004971010.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Setaria italica]
Length=596

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE +S+ +KY +L KLL D+MDGSRILIF  TKK CD+ TRQLRMDGWPALSIHGDK+
Sbjct  372  QIVEVISDQEKYPRLSKLLSDLMDGSRILIFFQTKKDCDKITRQLRMDGWPALSIHGDKA  431

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q+ERD+VL+EFK+GKSPIM ATDVAARGLDVKD+K VINYDFP +LEDY+HRIGRTGRAG
Sbjct  432  QSERDYVLAEFKSGKSPIMAATDVAARGLDVKDIKCVINYDFPTTLEDYIHRIGRTGRAG  491

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPEL  353
            A GTA+TFFT ANA+F+++L+ IL+EAGQ V+P L
Sbjct  492  ASGTAFTFFTHANAKFSRNLVKILREAGQVVNPAL  526



>ref|XP_006280218.1| hypothetical protein CARUB_v10026128mg [Capsella rubella]
 gb|EOA13116.1| hypothetical protein CARUB_v10026128mg [Capsella rubella]
Length=594

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q +E V   +KY +L+ LL+ +MDGS+ILIF++TK+GCDQ TRQLRMDGWPAL+IHGDK+
Sbjct  387  QVIEIVPTPEKYNRLLALLKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKN  446

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q+ERD VL+EFK+G+SPIMTATDVAARGLDVKD+K V+NYDFP +LEDY+HRIGRTGRAG
Sbjct  447  QSERDRVLAEFKSGRSPIMTATDVAARGLDVKDIKCVVNYDFPNTLEDYIHRIGRTGRAG  506

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKG A+TFFT  NA+FA++LI ILQEAGQ V P L+ +
Sbjct  507  AKGMAFTFFTHDNAKFARELIKILQEAGQAVPPTLSAL  544



>ref|XP_010484038.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Camelina sativa]
Length=594

 Score =   214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q +E V   +KY +L+ LL+ +MDGS+ILIF++TK+GCDQ TRQLRMDGWPAL+IHGDK+
Sbjct  388  QVIEIVPTPEKYNRLLALLKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKN  447

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q+ERD VL+EFK+G+SPIMTATDVAARGLDVKD+K V+NYDFP +LEDY+HRIGRTGRAG
Sbjct  448  QSERDRVLAEFKSGRSPIMTATDVAARGLDVKDIKCVVNYDFPNTLEDYIHRIGRTGRAG  507

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKG A+TFFT  NA+FA++LI ILQEAGQ V P L+ +
Sbjct  508  AKGMAFTFFTHDNAKFARELIKILQEAGQVVPPTLSAL  545



>gb|KFK25761.1| hypothetical protein AALP_AA8G156100 [Arabis alpina]
Length=582

 Score =   214 bits (545),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q +E V   +KY +L+KLL+ + DGS+ILIF++TK+GCDQ TRQLRMDGWPAL+IHGDK+
Sbjct  380  QVIEIVPTPEKYDRLLKLLKQLSDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKT  439

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q+ERD VLSEFK+G+SPIMTATDVAARGLDVKD+K V+NYDFP SLEDY+HRIGRTGRAG
Sbjct  440  QSERDRVLSEFKSGRSPIMTATDVAARGLDVKDIKCVVNYDFPTSLEDYIHRIGRTGRAG  499

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKG A+TFFT  NA+FA++LI ILQEAGQ V P L+ +
Sbjct  500  AKGMAFTFFTHDNAKFARELIKILQEAGQVVPPTLSAL  537



>dbj|BAB10554.1| ATP-dependent RNA helicase-like protein [Arabidopsis thaliana]
Length=564

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q +E V   +KY +L+ LL+ +MDGS+ILIF++TK+GCDQ TRQLRMDGWPAL+IHGDK+
Sbjct  359  QVIEIVPTPEKYNRLLTLLKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKT  418

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q+ERD VL+EFK+G+SPIMTATDVAARGLDVKD+K V+NYDFP +LEDY+HRIGRTGRAG
Sbjct  419  QSERDRVLAEFKSGRSPIMTATDVAARGLDVKDIKCVVNYDFPNTLEDYIHRIGRTGRAG  478

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKG A+TFFT  NA+FA++L+ ILQEAGQ V P L+ +
Sbjct  479  AKGMAFTFFTHDNAKFARELVKILQEAGQVVPPTLSAL  516



>ref|NP_974985.1| DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis thaliana]
 sp|Q8W4R3.2|RH30_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis 
thaliana]
 dbj|BAE98724.1| ATP-dependent RNA helicase-like protein [Arabidopsis thaliana]
 gb|AED97706.1| DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis thaliana]
Length=591

 Score =   214 bits (545),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q +E V   +KY +L+ LL+ +MDGS+ILIF++TK+GCDQ TRQLRMDGWPAL+IHGDK+
Sbjct  386  QVIEIVPTPEKYNRLLTLLKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKT  445

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q+ERD VL+EFK+G+SPIMTATDVAARGLDVKD+K V+NYDFP +LEDY+HRIGRTGRAG
Sbjct  446  QSERDRVLAEFKSGRSPIMTATDVAARGLDVKDIKCVVNYDFPNTLEDYIHRIGRTGRAG  505

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKG A+TFFT  NA+FA++L+ ILQEAGQ V P L+ +
Sbjct  506  AKGMAFTFFTHDNAKFARELVKILQEAGQVVPPTLSAL  543



>ref|XP_010444189.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Camelina sativa]
Length=591

 Score =   214 bits (545),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q +E V   +KY +L+ LL+ +MDGS+ILIF++TK+GCDQ TRQLRMDGWPAL+IHGDK+
Sbjct  386  QVIEIVPTPEKYNRLLALLKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKN  445

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q+ERD VL+EFK+G+SPIMTATDVAARGLDVKD+K V+NYDFP +LEDY+HRIGRTGRAG
Sbjct  446  QSERDRVLAEFKSGRSPIMTATDVAARGLDVKDIKCVVNYDFPNTLEDYIHRIGRTGRAG  505

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKG A+TFFT  NA+FA++LI ILQEAGQ V P L+ +
Sbjct  506  AKGMAFTFFTHDNAKFARELIKILQEAGQVVPPTLSAL  543



>ref|XP_002866536.1| hypothetical protein ARALYDRAFT_496494 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42795.1| hypothetical protein ARALYDRAFT_496494 [Arabidopsis lyrata subsp. 
lyrata]
Length=588

 Score =   214 bits (545),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q +E V   +KY +L+ LL+ +MDGS+ILIF++TK+GCDQ TRQLRMDGWPAL+IHGDK+
Sbjct  383  QVIEIVPTPEKYNRLLTLLKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKT  442

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q ERD VL+EFK+G+SPIMTATDVAARGLDVKD+K V+NYDFP +LEDY+HRIGRTGRAG
Sbjct  443  QPERDRVLAEFKSGRSPIMTATDVAARGLDVKDIKCVVNYDFPNTLEDYIHRIGRTGRAG  502

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKG A+TFFT  NA+FA++LI ILQEAGQ V P L+ +
Sbjct  503  AKGMAFTFFTHDNAKFARELIKILQEAGQVVPPTLSAL  540



>ref|XP_010459851.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 isoform X1 
[Camelina sativa]
Length=598

 Score =   214 bits (545),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q +E V   +KY +L+ LL+ +MDGS+ILIF++TK+GCDQ TRQLRMDGWPAL+IHGDK+
Sbjct  392  QVIEIVPTPEKYNRLLALLKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKN  451

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q+ERD VL+EFK+G+SPIMTATDVAARGLDVKD+K V+NYDFP +LEDY+HRIGRTGRAG
Sbjct  452  QSERDRVLAEFKSGRSPIMTATDVAARGLDVKDIKCVVNYDFPNTLEDYIHRIGRTGRAG  511

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKG A+TFFT  NA+FA++LI ILQEAGQ V P L+ +
Sbjct  512  AKGMAFTFFTHDNAKFARELIKILQEAGQVVPPTLSAL  549



>ref|XP_010678860.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Beta vulgaris 
subsp. vulgaris]
Length=643

 Score =   215 bits (547),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q +E +++ +KY +L+ LL++IMD S+ILIF++TKKGCDQ TRQLR+DGWPAL+IHGDK 
Sbjct  447  QVIEVMTDLEKYNRLISLLKEIMDRSKILIFVETKKGCDQVTRQLRVDGWPALAIHGDKD  506

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q+ERDWVLSEFK+G+SPIM ATDVAARGLDVKD+K VINYDFP SLEDY+HRIGRTGRAG
Sbjct  507  QSERDWVLSEFKSGRSPIMIATDVAARGLDVKDIKCVINYDFPTSLEDYIHRIGRTGRAG  566

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKGTAYTFFT +NA+F ++LI IL+EAGQ + P L+ M
Sbjct  567  AKGTAYTFFTHSNAKFTRELIKILREAGQMIPPALSAM  604



>ref|NP_001105241.1| DEAD box RNA helicase1 [Zea mays]
 gb|AAR29370.1| DEAD box RNA helicase [Zea mays]
Length=566

 Score =   213 bits (542),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE +S+ +     VKLL D+MDGSRILIF+ TKK CD+ TRQLRMDGWPALSIHGDK+
Sbjct  371  QIVEVISDHESIQDSVKLLSDLMDGSRILIFLQTKKDCDKITRQLRMDGWPALSIHGDKA  430

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            QAERD+VL+EFK+GKSPIM ATDVAARGLDVKD+K VINYDFP +LEDY+HRIGRTGRAG
Sbjct  431  QAERDYVLAEFKSGKSPIMAATDVAARGLDVKDIKCVINYDFPTTLEDYIHRIGRTGRAG  490

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A GTA+TFFT ANA+F+++L+ IL+EAGQ V+P L +M
Sbjct  491  ASGTAFTFFTHANAKFSRNLVKILREAGQVVNPALESM  528



>ref|XP_003564892.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 [Brachypodium 
distachyon]
Length=571

 Score =   213 bits (542),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE +S+ +KY +L KLL D+MDGSRILIF  TKK CD+ TRQLRMDGWPALSIHGDK+
Sbjct  378  QIVEVISDHEKYPRLSKLLSDLMDGSRILIFFQTKKECDKVTRQLRMDGWPALSIHGDKA  437

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q+ERD+VLSEFK+GKSPIM ATDVAARGLDVKD+K VIN+DFP ++EDY+HRIGRTGRAG
Sbjct  438  QSERDYVLSEFKSGKSPIMAATDVAARGLDVKDIKCVINFDFPTTIEDYIHRIGRTGRAG  497

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A G A+TFFT +N++++++L+ IL+EAGQ V+P L  M
Sbjct  498  ATGMAFTFFTHSNSKYSRNLVKILREAGQVVNPALEAM  535



>gb|EMS66298.1| DEAD-box ATP-dependent RNA helicase 30 [Triticum urartu]
Length=587

 Score =   212 bits (540),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE +S+ +KY +L KLL D+MDGSRILIF  TKK CD+ TRQLRMDGWPALSIHGDK+
Sbjct  375  QIVEVISDHEKYPRLSKLLSDLMDGSRILIFFQTKKECDKVTRQLRMDGWPALSIHGDKA  434

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q+ERD+VL+EFK GKSPIM ATDVAARGLDVKD+K VIN+DFP ++EDY+HRIGRTGRAG
Sbjct  435  QSERDYVLAEFKNGKSPIMAATDVAARGLDVKDIKCVINFDFPTTIEDYIHRIGRTGRAG  494

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A G A+TFFT +NA+++++L+ IL+EAGQ V+P L  M
Sbjct  495  ATGMAFTFFTHSNAKYSRNLVKILREAGQVVNPALEAM  532



>emb|CDM85602.1| unnamed protein product [Triticum aestivum]
Length=574

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE +S+ +KY +L KLL D+MDGSRILIF  TKK CD+ TRQLRMDGWPALSIHGDK+
Sbjct  375  QIVEVISDHEKYPRLSKLLSDLMDGSRILIFFQTKKECDKVTRQLRMDGWPALSIHGDKA  434

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q+ERD+VL+EFK GKSPIM ATDVAARGLDVKD+K VIN+DFP ++EDY+HRIGRTGRAG
Sbjct  435  QSERDYVLAEFKNGKSPIMAATDVAARGLDVKDIKCVINFDFPTTIEDYIHRIGRTGRAG  494

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A G A+TFFT +NA+++++L+ IL+EAGQ V+P L  M
Sbjct  495  ATGMAFTFFTHSNAKYSRNLVKILREAGQVVNPALEAM  532



>ref|XP_005850349.1| hypothetical protein CHLNCDRAFT_30080, partial [Chlorella variabilis]
 gb|EFN58247.1| hypothetical protein CHLNCDRAFT_30080, partial [Chlorella variabilis]
Length=551

 Score =   211 bits (537),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = -3

Query  799  SESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKSQAERDW  620
            +E +KY KLV++LE  MDG RILIF++TKKGCD  TRQLRMDGWPALSIHGDKSQ ERDW
Sbjct  355  AEHEKYQKLVRVLEKEMDGRRILIFLETKKGCDAVTRQLRMDGWPALSIHGDKSQHERDW  414

Query  619  VLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgragakgtay  440
            VL+EFKAGK PIM ATDVAARGLDVKD+K VINYD P   EDYVHRIGRTGRAGA G AY
Sbjct  415  VLAEFKAGKHPIMIATDVAARGLDVKDIKMVINYDMPSCAEDYVHRIGRTGRAGASGAAY  474

Query  439  TFFTAANARFAKDLIHILQEAGQKVSPEL  353
            +FFTAAN R A+ L+ IL+EA Q V PEL
Sbjct  475  SFFTAANGRMARQLVQILEEASQAVPPEL  503



>ref|XP_005650016.1| DEAD-box RNA helicase [Coccomyxa subellipsoidea C-169]
 gb|EIE25472.1| DEAD-box RNA helicase [Coccomyxa subellipsoidea C-169]
Length=461

 Score =   200 bits (508),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 123/155 (79%), Gaps = 0/155 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QH + +SE  KY  L +LLE  MDGSR+LIF +TK+GCD  TRQLR +GWPALSIHGDKS
Sbjct  264  QHFQFLSEDDKYRALSRLLEREMDGSRLLIFCETKRGCDAVTRQLRTEGWPALSIHGDKS  323

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q ERDWVL+EFKAGKSPIM ATDVAARGLDVKD+K V+NYD P + EDYVHRIGRT RAG
Sbjct  324  QQERDWVLAEFKAGKSPIMLATDVAARGLDVKDIKMVVNYDMPNTAEDYVHRIGRTARAG  383

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPEL  353
            A G A +FFT+AN R A+ ++ IL EA Q V  +L
Sbjct  384  ASGLAVSFFTSANGRMARQIVDILSEAHQTVPDQL  418



>ref|XP_002771918.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
 gb|EER03734.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
Length=521

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 128/158 (81%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q+V+ V E +K  +L +LLE +MDGS++LIF DTK+G D  TR LRMDGWPAL IHGDK 
Sbjct  338  QYVDVVQEYEKRDRLKQLLERVMDGSKLLIFTDTKRGADDLTRTLRMDGWPALCIHGDKK  397

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q ERDWVL EFK+GKSPIM ATDVA+RGLDVKD+++V+NYDFPG +EDYVHRIGRTGRAG
Sbjct  398  QEERDWVLHEFKSGKSPIMIATDVASRGLDVKDIRHVVNYDFPGQIEDYVHRIGRTGRAG  457

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
             KG AYTFFTA   + A+ L+ IL+EA Q VSPEL  +
Sbjct  458  CKGNAYTFFTADKIKMARGLVQILREANQTVSPELERL  495



>ref|XP_002774608.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
 gb|EER06424.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
Length=520

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 127/158 (80%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q+V+ V E +K  +L  LLE +MDGS++LIF DTK+G D  TR LRMDGWPAL IHGDK 
Sbjct  333  QYVDVVQEYEKRDRLKVLLERVMDGSKLLIFTDTKRGADDLTRTLRMDGWPALCIHGDKK  392

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q ERDWVL EFK+GKSPIM ATDVA+RGLDVKD+++V+NYDFPG +EDYVHRIGRTGRAG
Sbjct  393  QEERDWVLHEFKSGKSPIMIATDVASRGLDVKDIRHVVNYDFPGQIEDYVHRIGRTGRAG  452

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
             KG AYTFFT    + A+DL+ IL+EA Q VSPEL  +
Sbjct  453  CKGNAYTFFTPDKIKMARDLVQILREANQTVSPELERL  490



>ref|XP_002777393.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
 gb|EER09209.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
Length=515

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q+V+ V + +K  KL +LLE IMDGS+I+IF DTK+  D  TR LRMDGWPALSIHGDK 
Sbjct  323  QYVDIVQDYEKKDKLKQLLERIMDGSKIVIFTDTKRAADDLTRMLRMDGWPALSIHGDKK  382

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q ERDWVL EFK+GKSPIM ATDVA+RGLDVKD+++VINYDFPG +EDYVHRIGRTGRAG
Sbjct  383  QEERDWVLQEFKSGKSPIMIATDVASRGLDVKDLRHVINYDFPGQIEDYVHRIGRTGRAG  442

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPEL  353
            AKG+AY+FFT    + AKDLI +L+EA Q V PEL
Sbjct  443  AKGSAYSFFTPDKYKLAKDLIGVLREAEQAVPPEL  477



>ref|XP_002777392.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
 gb|EER09208.1| RNA helicase, putative [Perkinsus marinus ATCC 50983]
Length=531

 Score =   196 bits (497),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q+V+ V + +K  KL +LLE IMDGS+I+IF DTK+  D  TR LRMDGWPALSIHGDK 
Sbjct  339  QYVDIVQDYEKKDKLKQLLERIMDGSKIVIFTDTKRAADDLTRMLRMDGWPALSIHGDKK  398

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q ERDWVL EFK+GKSPIM ATDVA+RGLDVKD+++VINYDFPG +EDYVHRIGRTGRAG
Sbjct  399  QEERDWVLQEFKSGKSPIMIATDVASRGLDVKDLRHVINYDFPGQIEDYVHRIGRTGRAG  458

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPEL  353
            AKG+AY+FFT    + AKDLI +L+EA Q V PEL
Sbjct  459  AKGSAYSFFTPDKYKLAKDLIGVLREAEQAVPPEL  493



>ref|XP_009336746.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Pyrus 
x bretschneideri]
 ref|XP_009336748.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Pyrus 
x bretschneideri]
Length=140

 Score =   184 bits (468),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/112 (94%), Positives = 110/112 (98%), Gaps = 0/112 (0%)
 Frame = -3

Query  679  MDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSL  500
            MDGWPALSIHGDKSQAERDWVLS+FKAGKSPIMTATDVAARGLDVKDVK+VINYDFPGSL
Sbjct  1    MDGWPALSIHGDKSQAERDWVLSKFKAGKSPIMTATDVAARGLDVKDVKFVINYDFPGSL  60

Query  499  EDYVHrigrtgragakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            EDYVHRIGRTGRAGAKGTAYTFFTAANARFAK+LI +L+EAGQKVSPELA M
Sbjct  61   EDYVHRIGRTGRAGAKGTAYTFFTAANARFAKELIALLEEAGQKVSPELAAM  112



>ref|XP_002780686.1| DEAD box ATP-dependent RNA helicase, putative [Perkinsus marinus 
ATCC 50983]
 gb|EER12481.1| DEAD box ATP-dependent RNA helicase, putative [Perkinsus marinus 
ATCC 50983]
Length=166

 Score =   182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = -3

Query  751  MDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTAT  572
            MDGS++LIF DTK+G D  TR LRMDGWPAL IHGDK Q ERDWVL EFK+GKSPIM AT
Sbjct  1    MDGSKLLIFTDTKRGADDLTRTLRMDGWPALCIHGDKKQEERDWVLHEFKSGKSPIMIAT  60

Query  571  DVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgragakgtayTFFTAANARFAKDLIH  392
            DVA+RGLDVKD+++V+NYDFPG +EDYVHRIGRTGRAG KG AYTFFTA   + A+ L+ 
Sbjct  61   DVASRGLDVKDIRHVVNYDFPGQIEDYVHRIGRTGRAGCKGNAYTFFTADKIKMARGLVQ  120

Query  391  ILQEAGQKVSPEL  353
            IL+EA Q VSPEL
Sbjct  121  ILREANQTVSPEL  133



>emb|CAA09215.1| RNA helicase [Arabidopsis thaliana]
Length=263

 Score =   185 bits (469),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q +E V   +KY +L+ LL+ +MDGS+ILIF++TK+GCDQ TRQLRMDGWPAL+IHGDK+
Sbjct  130  QVIEIVPTPEKYNRLLTLLKQLMDGSKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKT  189

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q+ERD VL+EFK+G+SPIMTATDVAARGLDVKD+K V+NYDFP +LEDY+HRIGRTGRAG
Sbjct  190  QSERDRVLAEFKSGRSPIMTATDVAARGLDVKDIKCVVNYDFPNTLEDYIHRIGRTGRAG  249

Query  457  akgtayTFFTAANA  416
            AKG A+TFFT  NA
Sbjct  250  AKGMAFTFFTHDNA  263



>ref|XP_002955411.1| DEAD-box RNA helicase, ATP-dependent [Volvox carteri f. nagariensis]
 gb|EFJ43482.1| DEAD-box RNA helicase, ATP-dependent [Volvox carteri f. nagariensis]
Length=535

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 123/158 (78%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE V    KY +L KLL+  MDG RILIF +TK+GCD+  RQLR DG+PAL +HGDKS
Sbjct  334  QIVEMVEGYAKYPRLRKLLDTEMDGRRILIFCETKRGCDELVRQLRTDGYPALGLHGDKS  393

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q ERDWVL EFK G  PIM ATDVAARGLDVKD+K V+NYD P + EDYVHRIGRTGRAG
Sbjct  394  QQERDWVLQEFKNGTHPIMLATDVAARGLDVKDIKVVVNYDMPKTAEDYVHRIGRTGRAG  453

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A GTAY+FFT A+AR A+ ++ ++QEAGQ+  PEL  M
Sbjct  454  AHGTAYSFFTGADARLARQVVEVMQEAGQQPPPELLQM  491



>emb|CCF73942.1| unnamed protein product [Babesia microti strain RI]
Length=530

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 123/158 (78%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q +  V E QK   L  LL  +MDGS+I+IF DTKKG D  TR+LRMDGWPALSIHGDK 
Sbjct  342  QEIMLVQEHQKKPTLKSLLPKLMDGSKIIIFADTKKGADILTRELRMDGWPALSIHGDKK  401

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q ER WVL+EFK+GK PIM ATDVA+RGLDVKDV++VINYDFP  +EDYVHRIGRTGRAG
Sbjct  402  QDERTWVLNEFKSGKHPIMIATDVASRGLDVKDVRFVINYDFPNQIEDYVHRIGRTGRAG  461

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
             KG AYTF T    + AKDL+ IL+EA Q +SPEL+ +
Sbjct  462  TKGVAYTFLTPDKHKVAKDLVKILREANQPISPELSRI  499



>emb|CDI80731.1| hypothetical protein, conserved [Eimeria acervulina]
Length=199

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 120/153 (78%), Gaps = 0/153 (0%)
 Frame = -3

Query  802  VSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKSQAERD  623
            + E +K  +L+ LL  IMDGS+IL+F +TK+G D  TR LRM+GWPALS+HGDK Q ER 
Sbjct  1    MQEYEKRGQLMSLLRRIMDGSKILVFAETKRGADNLTRDLRMEGWPALSLHGDKKQEERT  60

Query  622  WVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgragakgta  443
            WVL EFK G++PIM ATDVA+RGLDVKD+++VIN+D P  +EDYVHRIGRTGRAGAKG A
Sbjct  61   WVLDEFKQGRNPIMVATDVASRGLDVKDIRHVINFDMPNQIEDYVHRIGRTGRAGAKGNA  120

Query  442  yTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            YTFFT    R A+DL+ +L+EA Q V PEL  +
Sbjct  121  YTFFTTDKQRLARDLVRVLKEANQTVPPELEAL  153



>ref|XP_002776976.1| helicase, putative [Perkinsus marinus ATCC 50983]
 gb|EER08792.1| helicase, putative, partial [Perkinsus marinus ATCC 50983]
Length=181

 Score =   180 bits (456),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = -3

Query  751  MDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKSQAERDWVLSEFKAGKSPIMTAT  572
            MDGS+I+IF DTK+  D  TR LRMDGWPALSIHGDK Q ERDWVL EFK+GKSPIM AT
Sbjct  1    MDGSKIVIFTDTKRAADDLTRMLRMDGWPALSIHGDKKQEERDWVLQEFKSGKSPIMIAT  60

Query  571  DVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgragakgtayTFFTAANARFAKDLIH  392
            DVA+RGLDVKD+++VINYDFPG +EDYVHRIGRTGRAGAKG+AY+FFT    + AKDLI 
Sbjct  61   DVASRGLDVKDLRHVINYDFPGQIEDYVHRIGRTGRAGAKGSAYSFFTPDKYKLAKDLIG  120

Query  391  ILQEAGQKVSPEL  353
            +L+EA Q V PEL
Sbjct  121  VLREAEQAVPPEL  133



>ref|XP_004831007.1| DEAD box ATP-dependent RNA helicase family member protein [Babesia 
equi]
 gb|AFZ81341.1| DEAD box ATP-dependent RNA helicase family member protein [Babesia 
equi strain WA]
Length=518

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V  + + +K   L  LL  +MDGS+ILIF +TKKG D  TR+LR+DGWPALSIHGDK 
Sbjct  325  QEVILLQDFEKRNTLKNLLPKLMDGSKILIFTETKKGADSLTRELRLDGWPALSIHGDKK  384

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q ER+WVL+EFK GK PIM ATDVA+RGLDV DVKYVINYDFP  +EDYVHRIGRTGRAG
Sbjct  385  QEERNWVLNEFKLGKHPIMIATDVASRGLDVHDVKYVINYDFPNQIEDYVHRIGRTGRAG  444

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
             KG +YTF T    R A+DL+ +L+EA Q VSPEL+ +
Sbjct  445  TKGASYTFLTPDKNRIARDLVRVLREANQPVSPELSRL  482



>ref|XP_001690022.1| DEAD-box RNA helicase [Chlamydomonas reinhardtii]
 gb|EDP09760.1| DEAD-box RNA helicase [Chlamydomonas reinhardtii]
Length=513

 Score =   188 bits (478),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 123/158 (78%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q VE V    KY +L KLL+  MDG RILIF++TK+GCD+  RQLR DG+PAL +HGDKS
Sbjct  330  QVVEMVEGFAKYPRLRKLLDGEMDGRRILIFVETKRGCDELVRQLRTDGYPALGLHGDKS  389

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q ERDWVL EFK G  PIM ATDVAARGLDVKD+K V+NYD P + EDYVHRIGRTGRAG
Sbjct  390  QQERDWVLQEFKNGTHPIMLATDVAARGLDVKDIKVVVNYDMPKTAEDYVHRIGRTGRAG  449

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            A GTAY+FFT  +AR A+ ++ ++QEAGQ+  PEL  M
Sbjct  450  ATGTAYSFFTNGDARLARQVVDVMQEAGQQPPPELMQM  487



>ref|XP_004349647.1| ATPdependent RNA helicase dbp2, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR22559.1| ATPdependent RNA helicase dbp2, putative [Acanthamoeba castellanii 
str. Neff]
Length=706

 Score =   189 bits (480),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 125/155 (81%), Gaps = 0/155 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V+ V E +K  KL+KLLE IMDG RILIF  TKKG DQ  R LR +GWPAL+IHGDK+
Sbjct  423  QIVDIVQEYEKRPKLMKLLETIMDGGRILIFTQTKKGADQLQRALRGEGWPALAIHGDKT  482

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q ERD  L+EF++G+SPIM ATDVAARGLDVKDV+YVINYDF  + EDYVHRIGRTGRAG
Sbjct  483  QQERDATLAEFRSGRSPIMVATDVAARGLDVKDVRYVINYDFASTAEDYVHRIGRTGRAG  542

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPEL  353
            A GTAY+FFT+ + + AK LI +L EAGQ+V P+L
Sbjct  543  ATGTAYSFFTSGDFKLAKRLIKVLSEAGQEVPPQL  577



>gb|KIZ00407.1| ATP-dependent RNA helicase DDX5/DBP2 [Monoraphidium neglectum]
Length=552

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 128/162 (79%), Gaps = 4/162 (2%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMD----GSRILIFMDTKKGCDQTTRQLRMDGWPALSIH  650
            Q VE + E +KY +LV LL+ +M     GS++LIF +TK+GCD+ TR LR +GWPAL++H
Sbjct  361  QIVEVLGEHEKYPRLVALLKQVMATSGAGSKVLIFCETKRGCDEVTRSLRAEGWPALALH  420

Query  649  GDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrt  470
            GDK Q ERDWVL+EFK+GK P+M ATDVAARGLDVKD+K V+N+D P + EDYVHRIGRT
Sbjct  421  GDKQQRERDWVLAEFKSGKHPLMLATDVAARGLDVKDIKVVVNFDMPNNAEDYVHRIGRT  480

Query  469  gragakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            GRAGA GTAY+FFTAAN R A+++I I+ EA Q V  EL ++
Sbjct  481  GRAGATGTAYSFFTAANGRLAREIIKIMNEANQVVPTELQSI  522



>emb|CCF44879.1| ATP-dependent RNA helicase dbp2, partial [Colletotrichum higginsianum]
Length=228

 Score =   178 bits (451),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 127/160 (79%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDG--SRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q VE V+ES+K  +++K LE +MD   +++LIF+ TK+  D+ TR LR DGWPALSIHGD
Sbjct  39   QVVEVVNESEKRDRMIKHLEKMMDNKENKVLIFVGTKRVADEITRFLRQDGWPALSIHGD  98

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            K Q ERDWVL +FK GKSPIM ATDVA+RG+DV+++ +V+NYD+P + EDY+HRIGRTGR
Sbjct  99   KQQNERDWVLDQFKTGKSPIMVATDVASRGIDVRNITHVLNYDYPNNSEDYIHRIGRTGR  158

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AGA G A TFFT  N++ A+DL+++L+EA Q++ P LA M
Sbjct  159  AGALGXAVTFFTTDNSKQARDLVNVLREAKQEIDPRLAEM  198



>gb|EXX56938.1| Dbp2p [Rhizophagus irregularis DAOM 197198w]
Length=601

 Score =   186 bits (473),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 130/160 (81%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMD--GSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q VE  +E +K  KLVK LE IMD   ++ LIF  TK+  D+ T+ LR DGWPAL+IHGD
Sbjct  414  QIVEVCAEYEKRAKLVKHLERIMDQKDNKTLIFTGTKRTADEITKYLRQDGWPALAIHGD  473

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            K+Q+ERDWVLSEF++GKSPIM ATDVA+RG+DVKDVK VINYDFP ++EDYVHRIGRTGR
Sbjct  474  KAQSERDWVLSEFRSGKSPIMVATDVASRGIDVKDVKLVINYDFPTNVEDYVHRIGRTGR  533

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
             GAKG+A TFFT  NA+ AKDL++IL+EA Q+V P+LA +
Sbjct  534  GGAKGSATTFFTMDNAKQAKDLVNILREANQEVDPKLADL  573



>gb|KFG62415.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17, partial [Toxoplasma 
gondii RUB]
Length=193

 Score =   175 bits (444),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 119/151 (79%), Gaps = 0/151 (0%)
 Frame = -3

Query  796  ESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKSQAERDWV  617
            E +K  +L+ LL  IMDGS+ILIF +TK+G D  TR +R++GWPALS+HGDK Q ER WV
Sbjct  1    EYEKRGQLMSLLRRIMDGSKILIFAETKRGADNLTRDMRVEGWPALSLHGDKKQEERTWV  60

Query  616  LSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgragakgtayT  437
            L EFK G++PIM ATDVA+RGLDVKD+++VINYD P  +EDY+HRIGRTGRAGAKG AYT
Sbjct  61   LDEFKNGRNPIMVATDVASRGLDVKDIRHVINYDMPNQIEDYIHRIGRTGRAGAKGCAYT  120

Query  436  FFTAANARFAKDLIHILQEAGQKVSPELATM  344
            FFT    R A++L+ +L+ A Q V PEL ++
Sbjct  121  FFTPDKPRLARELVRVLRGANQPVPPELESL  151



>dbj|BAN64363.1| p68-like protein [Babesia bovis]
Length=305

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 123/158 (78%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V  + E +K ++L K+L  I  G++ILIF DTKK  D  T++LR+DGWPALSIHGDK 
Sbjct  106  QEVFVIEEHEKRSQLKKILGQIGQGTKILIFTDTKKTADSITKELRLDGWPALSIHGDKK  165

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q ER+WVL+EFK+GK PIM ATDVA+RGLDV+DVK VIN+DFP  +EDYVHRIGRTGR G
Sbjct  166  QEERNWVLNEFKSGKHPIMVATDVASRGLDVRDVKVVINFDFPNQIEDYVHRIGRTGRGG  225

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
             KG +YTF T    R A++L+ +++EA Q++SPEL+ +
Sbjct  226  NKGASYTFLTPDKNRVARELVKLMREAKQQISPELSKL  263



>ref|XP_006521353.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 isoform 
X2 [Mus musculus]
Length=378

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 127/157 (81%), Gaps = 2/157 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   ES+K  KL++L+E+IM    ++ +IF++TK+ CD  TR++R DGWPA+ IHGD
Sbjct  39   QIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGD  98

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDYVHRIGRT R
Sbjct  99   KSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTAR  158

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPEL  353
            +  KGTAYTFFT  N + A++LI +L+EA Q ++P+L
Sbjct  159  STNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKL  195



>gb|AAI54494.1| LOC556764 protein [Danio rerio]
Length=519

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 129/160 (81%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   E++K  KL++L+E+IM    ++ +IF++TKK CD+ TR++R DGWPA+ IHGD
Sbjct  316  QIVDVCMENEKDNKLIQLMEEIMAEKENKTIIFVETKKRCDELTRRMRRDGWPAMCIHGD  375

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDYVHRIGRT R
Sbjct  376  KSQPERDWVLTEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTAR  435

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            +  KGTAYTFFT  N R A+DL+ +L+EA Q ++P+L  +
Sbjct  436  STNKGTAYTFFTPGNLRQARDLVRVLEEARQAINPKLLQL  475



>gb|AAI17661.1| LOC556764 protein [Danio rerio]
Length=519

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 129/160 (81%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   E++K  KL++L+E+IM    ++ +IF++TKK CD+ TR++R DGWPA+ IHGD
Sbjct  316  QIVDVCMENEKDNKLIQLMEEIMAEKENKTIIFVETKKRCDELTRRMRRDGWPAMCIHGD  375

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDYVHRIGRT R
Sbjct  376  KSQPERDWVLTEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTAR  435

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            +  KGTAYTFFT  N R A+DL+ +L+EA Q ++P+L  +
Sbjct  436  STNKGTAYTFFTPGNLRQARDLVRVLEEARQAINPKLLQL  475



>gb|AAI34864.1| LOC556764 protein [Danio rerio]
Length=519

 Score =   181 bits (460),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 129/160 (81%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   E++K  KL++L+E+IM    ++ +IF++TKK CD+ TR++R DGWPA+ IHGD
Sbjct  316  QIVDVCMENEKDNKLIQLMEEIMAEKENKTIIFVETKKRCDELTRRMRRDGWPAMCIHGD  375

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDYVHRIGRT R
Sbjct  376  KSQPERDWVLTEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTAR  435

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            +  KGTAYTFFT  N R A+DL+ +L+EA Q ++P+L  +
Sbjct  436  STNKGTAYTFFTPGNLRQARDLVRVLEEARQAINPKLLQL  475



>ref|XP_004563118.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like isoform 
X3 [Maylandia zebra]
Length=498

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   ES+K  KL++L+E+IM    ++ +IF++TKK CD  TR++R DGWPA+ IHGD
Sbjct  315  QIVDVCVESEKDQKLIQLMEEIMAEKENKTIIFVETKKRCDDLTRRMRRDGWPAMCIHGD  374

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVLSEF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDY+HRIGRT R
Sbjct  375  KSQPERDWVLSEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTAR  434

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            +  KGTAYTFFT  N R A++LI +L+EA Q ++P+L  +
Sbjct  435  STNKGTAYTFFTPGNLRQARELIRVLEEARQAINPKLLQL  474



>ref|XP_011476846.1| PREDICTED: probable ATP-dependent RNA helicase DDX5 isoform X3 
[Oryzias latipes]
Length=498

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 126/160 (79%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDG--SRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+  ++ +K  KLV+LLE+IM    ++ +IF++TK+ CD  TR++R DGWPA+ IHGD
Sbjct  323  QIVDVCTDGEKENKLVRLLEEIMSEKENKTIIFVETKRRCDDLTRRMRRDGWPAMGIHGD  382

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EFK GK+PI+ ATDVA+RGLDV+DVK+VINYD+P + EDY+HRIGRT R
Sbjct  383  KSQQERDWVLNEFKFGKAPILIATDVASRGLDVEDVKFVINYDYPNNSEDYIHRIGRTAR  442

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            +   GTAYTFFTA N R A DLI +L+EA Q ++P+L  M
Sbjct  443  SSKTGTAYTFFTANNMRQASDLIAVLREANQAINPKLLQM  482



>emb|CDW55278.1| ATP dependent RNA helicase DDX5 [Trichuris trichiura]
Length=532

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 127/160 (79%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGS--RILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q VE V E +K+ +L+KLL++I  G   + LIF++TK+  D+ TR LR  GWPAL IHGD
Sbjct  323  QVVEIVQEFEKHDRLLKLLQEITHGEDPKTLIFVETKRKADELTRWLRQKGWPALCIHGD  382

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            K+Q ER+WVL+EF++GKSPI+ ATDVAARGLDV D+KYVINYD+P   EDYVHRIGRTGR
Sbjct  383  KAQTEREWVLTEFRSGKSPILIATDVAARGLDVDDIKYVINYDYPQCSEDYVHRIGRTGR  442

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
               KGTAYTFF + NAR+AKDL+ +L+EA Q+++P+L  M
Sbjct  443  CNRKGTAYTFFNSTNARYAKDLLEVLKEAKQEINPKLYEM  482



>emb|CAF95263.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=514

 Score =   181 bits (458),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   E++K  KL++L+E+IM    ++ +IF++TKK CD  TR++R DGWPA+ IHGD
Sbjct  282  QIVDVCMETEKDDKLIQLMEEIMAEKENKTIIFVETKKRCDDLTRRMRRDGWPAMCIHGD  341

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDYVHRIGRT R
Sbjct  342  KSQPERDWVLAEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTAR  401

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            +  KGTAYTFFT  N R A+DL+ +L+EA Q ++P+L  +
Sbjct  402  STNKGTAYTFFTPGNLRQARDLVRVLEEARQAINPKLRQL  441



>ref|XP_006426527.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
 gb|ESR39767.1| hypothetical protein CICLE_v10025421mg [Citrus clementina]
 gb|KDO65285.1| hypothetical protein CISIN_1g010649mg [Citrus sinensis]
Length=433

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHV+ VSESQKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWPALSIHGDKS
Sbjct  320  QHVDIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPALSIHGDKS  379

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGL  551
            QAERDWVLSEFKAGKSPIMTATDVAARGL
Sbjct  380  QAERDWVLSEFKAGKSPIMTATDVAARGL  408



>gb|KFD69250.1| hypothetical protein M514_04547 [Trichuris suis]
Length=589

 Score =   182 bits (461),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 126/160 (79%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGS--RILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q VE V E +K+ +L+KLL++I  G   + LIF++TK+  D+ TR LR  GWPAL IHGD
Sbjct  311  QVVEIVPEFEKHDRLLKLLQEITHGEDPKTLIFVETKRKADELTRWLRQKGWPALCIHGD  370

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            K+Q ERDWVL+EF+ GKSPI+ ATDVAARGLDV D+KYVINYD+P   EDYVHRIGRTGR
Sbjct  371  KAQTERDWVLTEFRTGKSPILIATDVAARGLDVDDIKYVINYDYPQCSEDYVHRIGRTGR  430

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
               KGTAYTFF + NAR+AKDL+ +L+EA Q+++P+L  M
Sbjct  431  CNRKGTAYTFFNSTNARYAKDLLEVLKEAKQEINPKLYEM  470



>gb|KHJ49547.1| hypothetical protein D918_00674 [Trichuris suis]
Length=603

 Score =   182 bits (461),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 126/160 (79%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGS--RILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q VE V E +K+ +L+KLL++I  G   + LIF++TK+  D+ TR LR  GWPAL IHGD
Sbjct  325  QVVEIVPEFEKHDRLLKLLQEITHGEDPKTLIFVETKRKADELTRWLRQKGWPALCIHGD  384

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            K+Q ERDWVL+EF+ GKSPI+ ATDVAARGLDV D+KYVINYD+P   EDYVHRIGRTGR
Sbjct  385  KAQTERDWVLTEFRTGKSPILIATDVAARGLDVDDIKYVINYDYPQCSEDYVHRIGRTGR  444

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
               KGTAYTFF + NAR+AKDL+ +L+EA Q+++P+L  M
Sbjct  445  CNRKGTAYTFFNSTNARYAKDLLEVLKEAKQEINPKLYEM  484



>ref|XP_007370735.1| DEAD-domain-containing protein [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF56503.1| DEAD-domain-containing protein [Dichomitus squalens LYAD-421 
SS1]
Length=487

 Score =   180 bits (456),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 126/159 (79%), Gaps = 1/159 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDI-MDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDK  641
            Q VE VS+ +K TKL+K LE I  + +++LIF+ TK+  D  T+ LR DGWPAL+IHGDK
Sbjct  282  QIVEVVSDFEKRTKLIKHLEQISQENAKVLIFVGTKRVADDITKYLRQDGWPALAIHGDK  341

Query  640  SQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgra  461
             Q ERDWVLSEFKAG+SPI+ ATDVA+RGLDVKDV+YVINYDFP + EDY+HRIGRTGRA
Sbjct  342  EQRERDWVLSEFKAGRSPILIATDVASRGLDVKDVRYVINYDFPNNCEDYIHRIGRTGRA  401

Query  460  gakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            G  GT+YT+FT  NA+ A++LI IL+EA   V P+L  M
Sbjct  402  GMTGTSYTYFTTDNAKQARELIGILREAKAHVPPQLEEM  440



>ref|XP_007231410.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like [Astyanax 
mexicanus]
Length=667

 Score =   182 bits (462),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 128/157 (82%), Gaps = 2/157 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   E++K  KL++L+E+IM    ++ +IF++TKK CD+ TR++R DGWPA+ IHGD
Sbjct  316  QIVDVCMENEKDNKLIQLMEEIMAEKENKTIIFVETKKRCDELTRRMRRDGWPAMCIHGD  375

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDYVHRIGRT R
Sbjct  376  KSQPERDWVLTEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTAR  435

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPEL  353
            +  KGTAYTFFT  N R A+DL+ +L+EA Q ++P+L
Sbjct  436  STNKGTAYTFFTPGNLRQARDLVRVLEEARQAINPKL  472



>ref|XP_010746314.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 isoform 
X1 [Larimichthys crocea]
Length=651

 Score =   182 bits (461),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 128/157 (82%), Gaps = 2/157 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+  +ES+K  KL++L+E+IM    ++ +IF++TKK CD  TR++R DGWPA+ IHGD
Sbjct  315  QIVDVCTESEKDHKLIQLMEEIMAEKENKTIIFVETKKRCDDLTRRMRRDGWPAMCIHGD  374

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVLSEF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDY+HRIGRT R
Sbjct  375  KSQPERDWVLSEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTAR  434

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPEL  353
            +  KGTAYTFFT  N R A++LI +L+EA Q ++P+L
Sbjct  435  STNKGTAYTFFTPGNLRQARELIRVLEEARQAINPKL  471



>ref|XP_009160472.1| ATP-dependent RNA helicase dbp2 [Exophiala dermatitidis NIH/UT8656]
 gb|EHY60011.1| ATP-dependent RNA helicase dbp2 [Exophiala dermatitidis NIH/UT8656]
Length=538

 Score =   180 bits (457),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 124/160 (78%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMD--GSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q VE VSE +K  ++VK LE IM+   ++ILIF  TK+  D+ TR LR DGWPALSIHGD
Sbjct  336  QIVEVVSEFEKRDRMVKHLEQIMEDRNNKILIFTGTKRVADEITRFLRQDGWPALSIHGD  395

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            K Q ERDWVL+EFK GKSP+M ATDVA+RG+DV+D+ +V NYD+P + EDYVHRIGRTGR
Sbjct  396  KQQNERDWVLNEFKTGKSPVMVATDVASRGIDVRDITHVFNYDYPNNSEDYVHRIGRTGR  455

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AG KGTA T FT  NA+ A+DL+HILQE+ Q + P LA M
Sbjct  456  AGRKGTAITLFTTENAKQARDLLHILQESKQNIDPRLAEM  495



>gb|KFP69316.1| putative ATP-dependent RNA helicase DDX17, partial [Acanthisitta 
chloris]
Length=415

 Score =   178 bits (451),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   ES+K  KL++L+E+IM    ++ +IF++TK+ CD  TR++R DGWPA+ IHGD
Sbjct  245  QIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGD  304

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDYVHRIGRT R
Sbjct  305  KSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTAR  364

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            +  KGTAYTFFT  N + A++LI +L+EA Q ++P+L  +
Sbjct  365  STNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQL  404



>emb|CDR95325.1| p68-like protein, putative [Babesia bigemina]
Length=535

 Score =   180 bits (457),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V  + E +K  +L K+L  I +G+++LIF DTKK  D  TR+LR+DGWPALSIHGDK 
Sbjct  333  QEVYVIDEHEKRAQLKKILTKISEGTKVLIFADTKKTADSLTRELRLDGWPALSIHGDKK  392

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q ER+WVL+EFK+GK PIM ATDVA+RGLDV+DVK VIN+DFP  +EDYVHRIGRTGR G
Sbjct  393  QEERNWVLNEFKSGKHPIMVATDVASRGLDVRDVKVVINFDFPNQIEDYVHRIGRTGRGG  452

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
             KG +YTF T    R A++L+ +++EA Q +SPEL+ +
Sbjct  453  NKGASYTFLTPDKGRIARELVKLMREANQTISPELSKL  490



>ref|XP_011476809.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 [Oryzias 
latipes]
Length=630

 Score =   181 bits (460),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 128/157 (82%), Gaps = 2/157 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+  +ES+K  KL++L+E+IM    ++ +IF++TKK CD  TR++R DGWPA+ IHGD
Sbjct  314  QIVDVCTESEKDQKLIQLMEEIMAEKENKTIIFVETKKRCDDLTRRMRRDGWPAMCIHGD  373

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVLSEF++GK+P++ ATDVA+RGLDV+DVK+VINYD+P S EDY+HRIGRT R
Sbjct  374  KSQPERDWVLSEFRSGKAPVLIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTAR  433

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPEL  353
            +  KGTAYTFFT  N R A++L+ +L+EA Q ++P+L
Sbjct  434  STNKGTAYTFFTPGNVRQARELVRVLEEARQAINPKL  470



>gb|KFH65694.1| hypothetical protein MVEG_09167 [Mortierella verticillata NRRL 
6337]
Length=597

 Score =   181 bits (459),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 124/160 (78%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGS--RILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q VE  +E +K  KL+K LE IMD    + LIF  TK+  D  T+ LR DGWPAL+IHGD
Sbjct  389  QQVEVCAEHEKRGKLIKHLERIMDEREHKTLIFTGTKRTADDITKYLRQDGWPALAIHGD  448

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            K+Q ERDWVL+EFK+GKSPIM ATDVA+RG+DVKDVK+VINYDFP ++EDYVHRIGRTGR
Sbjct  449  KAQNERDWVLNEFKSGKSPIMVATDVASRGIDVKDVKFVINYDFPNNVEDYVHRIGRTGR  508

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
             G  G+++TFFT  NA+ AK+L+ IL+EA Q++ P L  M
Sbjct  509  GGNTGSSFTFFTMDNAKQAKELVGILKEASQEIDPRLLDM  548



>ref|XP_011476845.1| PREDICTED: probable ATP-dependent RNA helicase DDX5 isoform X2 
[Oryzias latipes]
Length=623

 Score =   181 bits (460),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 126/160 (79%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDG--SRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+  ++ +K  KLV+LLE+IM    ++ +IF++TK+ CD  TR++R DGWPA+ IHGD
Sbjct  322  QIVDVCTDGEKENKLVRLLEEIMSEKENKTIIFVETKRRCDDLTRRMRRDGWPAMGIHGD  381

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EFK GK+PI+ ATDVA+RGLDV+DVK+VINYD+P + EDY+HRIGRT R
Sbjct  382  KSQQERDWVLNEFKFGKAPILIATDVASRGLDVEDVKFVINYDYPNNSEDYIHRIGRTAR  441

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            +   GTAYTFFTA N R A DLI +L+EA Q ++P+L  M
Sbjct  442  SSKTGTAYTFFTANNMRQASDLIAVLREANQAINPKLLQM  481



>ref|XP_003655899.1| hypothetical protein THITE_2120154 [Thielavia terrestris NRRL 
8126]
 gb|AEO69563.1| hypothetical protein THITE_2120154 [Thielavia terrestris NRRL 
8126]
Length=568

 Score =   181 bits (458),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 126/162 (78%), Gaps = 4/162 (2%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDG----SRILIFMDTKKGCDQTTRQLRMDGWPALSIH  650
            Q VE VSES+K  +++K LE IMDG    +++LIF  TK+  D  TR LR DGWPALSIH
Sbjct  361  QIVEVVSESEKRDRMIKHLEKIMDGRDTQNKVLIFTGTKRVADDITRFLRQDGWPALSIH  420

Query  649  GDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrt  470
            GDK Q ERDWVL +FK GKSPIM ATDVA+RG+DV+++ +V+NYD+P + EDY+HRIGRT
Sbjct  421  GDKQQNERDWVLDQFKTGKSPIMVATDVASRGIDVRNITHVLNYDYPNNSEDYIHRIGRT  480

Query  469  gragakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            GRAGAKGTA TFFT  NA+ A+DL+ +LQEA Q + P LA M
Sbjct  481  GRAGAKGTAITFFTTDNAKQARDLVSVLQEAKQHIDPRLAEM  522



>ref|XP_004071866.1| PREDICTED: probable ATP-dependent RNA helicase DDX5 isoform X1 
[Oryzias latipes]
Length=624

 Score =   181 bits (459),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 126/160 (79%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDG--SRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+  ++ +K  KLV+LLE+IM    ++ +IF++TK+ CD  TR++R DGWPA+ IHGD
Sbjct  323  QIVDVCTDGEKENKLVRLLEEIMSEKENKTIIFVETKRRCDDLTRRMRRDGWPAMGIHGD  382

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EFK GK+PI+ ATDVA+RGLDV+DVK+VINYD+P + EDY+HRIGRT R
Sbjct  383  KSQQERDWVLNEFKFGKAPILIATDVASRGLDVEDVKFVINYDYPNNSEDYIHRIGRTAR  442

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            +   GTAYTFFTA N R A DLI +L+EA Q ++P+L  M
Sbjct  443  SSKTGTAYTFFTANNMRQASDLIAVLREANQAINPKLLQM  482



>ref|XP_001923830.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 isoform 
X1 [Danio rerio]
Length=671

 Score =   181 bits (460),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 128/157 (82%), Gaps = 2/157 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   E++K  KL++L+E+IM    ++ +IF++TKK CD+ TR++R DGWPA+ IHGD
Sbjct  316  QIVDVCMENEKDNKLIQLMEEIMAEKENKTIIFVETKKRCDELTRRMRRDGWPAMCIHGD  375

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDYVHRIGRT R
Sbjct  376  KSQPERDWVLTEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTAR  435

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPEL  353
            +  KGTAYTFFT  N R A+DL+ +L+EA Q ++P+L
Sbjct  436  STNKGTAYTFFTPGNLRQARDLVRVLEEARQAINPKL  472



>ref|XP_003381848.1| ATP-dependent RNA helicase Dbp2 [Trichinella spiralis]
 gb|EFV62098.1| ATP-dependent RNA helicase Dbp2 [Trichinella spiralis]
Length=540

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 124/157 (79%), Gaps = 2/157 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGS--RILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q VE VSE +K+ +L+KLL+++   S  ++LIF++TK+  D+ TR LR  GWP LSIHGD
Sbjct  318  QVVEIVSEFEKHERLLKLLQEVTKDSDPKVLIFVETKRKADELTRWLRQKGWPVLSIHGD  377

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            K+Q ERDWVL+EF+ GKSPI+ ATDVAARGLDV D+K+V+NYD+P   EDYVHRIGRTGR
Sbjct  378  KAQGERDWVLNEFRTGKSPIVIATDVAARGLDVDDIKFVVNYDYPQCSEDYVHRIGRTGR  437

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPEL  353
                GTAYTFF A NAR+AKDLI +L EA Q V+P+L
Sbjct  438  CNRTGTAYTFFNANNARYAKDLIDVLIEAKQHVNPKL  474



>gb|EQK99950.1| ATP-dependent RNA helicase dbp-2 [Ophiocordyceps sinensis CO18]
Length=440

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDG--SRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q VE VSE++K  +++K LE +MD   ++IL+F+ TK+  D+ TR LR DGWPALSIHGD
Sbjct  234  QIVEVVSENEKRDRMIKHLEKVMDNKDNKILLFVGTKRVADEITRFLRQDGWPALSIHGD  293

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            K Q ERDWVL +FK GKSPIM ATDVA+RG+DV+++ +V+NYD+P + EDY+HRIGRTGR
Sbjct  294  KQQNERDWVLDQFKTGKSPIMVATDVASRGIDVRNITHVLNYDYPNNSEDYIHRIGRTGR  353

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AGAKGTA TFFT  N + A+DL+++LQEA Q++ P LA M
Sbjct  354  AGAKGTAITFFTTDNQKQARDLVNVLQEAKQQIDPRLAEM  393



>ref|XP_006798015.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like [Neolamprologus 
brichardi]
Length=625

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 127/157 (81%), Gaps = 2/157 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   ES+K  KL++L+E+IM    ++ +IF++TKK CD  TR++R DGWPA+ IHGD
Sbjct  315  QIVDVCVESEKDQKLIQLMEEIMAEKENKTIIFVETKKRCDDLTRRMRRDGWPAMCIHGD  374

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVLSEF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDY+HRIGRT R
Sbjct  375  KSQPERDWVLSEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTAR  434

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPEL  353
            +  KGTAYTFFT  N R A++LI +L+EA Q ++P+L
Sbjct  435  STNKGTAYTFFTPGNLRQARELIRVLEEARQAINPKL  471



>ref|XP_005737994.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like isoform 
X1 [Pundamilia nyererei]
Length=625

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 127/157 (81%), Gaps = 2/157 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   ES+K  KL++L+E+IM    ++ +IF++TKK CD  TR++R DGWPA+ IHGD
Sbjct  315  QIVDVCVESEKDQKLIQLMEEIMAEKENKTIIFVETKKRCDDLTRRMRRDGWPAMCIHGD  374

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVLSEF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDY+HRIGRT R
Sbjct  375  KSQPERDWVLSEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTAR  434

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPEL  353
            +  KGTAYTFFT  N R A++LI +L+EA Q ++P+L
Sbjct  435  STNKGTAYTFFTPGNLRQARELIRVLEEARQAINPKL  471



>ref|XP_004563116.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like isoform 
X1 [Maylandia zebra]
Length=623

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 127/157 (81%), Gaps = 2/157 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   ES+K  KL++L+E+IM    ++ +IF++TKK CD  TR++R DGWPA+ IHGD
Sbjct  315  QIVDVCVESEKDQKLIQLMEEIMAEKENKTIIFVETKKRCDDLTRRMRRDGWPAMCIHGD  374

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVLSEF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDY+HRIGRT R
Sbjct  375  KSQPERDWVLSEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTAR  434

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPEL  353
            +  KGTAYTFFT  N R A++LI +L+EA Q ++P+L
Sbjct  435  STNKGTAYTFFTPGNLRQARELIRVLEEARQAINPKL  471



>ref|XP_005737995.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like isoform 
X2 [Pundamilia nyererei]
Length=631

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 127/157 (81%), Gaps = 2/157 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   ES+K  KL++L+E+IM    ++ +IF++TKK CD  TR++R DGWPA+ IHGD
Sbjct  321  QIVDVCVESEKDQKLIQLMEEIMAEKENKTIIFVETKKRCDDLTRRMRRDGWPAMCIHGD  380

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVLSEF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDY+HRIGRT R
Sbjct  381  KSQPERDWVLSEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTAR  440

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPEL  353
            +  KGTAYTFFT  N R A++LI +L+EA Q ++P+L
Sbjct  441  STNKGTAYTFFTPGNLRQARELIRVLEEARQAINPKL  477



>ref|XP_005940780.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like [Haplochromis 
burtoni]
Length=625

 Score =   181 bits (458),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 127/157 (81%), Gaps = 2/157 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   ES+K  KL++L+E+IM    ++ +IF++TKK CD  TR++R DGWPA+ IHGD
Sbjct  315  QIVDVCVESEKDQKLIQLMEEIMAEKENKTIIFVETKKRCDDLTRRMRRDGWPAMCIHGD  374

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVLSEF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDY+HRIGRT R
Sbjct  375  KSQPERDWVLSEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTAR  434

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPEL  353
            +  KGTAYTFFT  N R A++LI +L+EA Q ++P+L
Sbjct  435  STNKGTAYTFFTPGNLRQARELIRVLEEARQAINPKL  471



>ref|XP_009073300.1| PREDICTED: probable ATP-dependent RNA helicase DDX17, partial 
[Acanthisitta chloris]
Length=476

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   ES+K  KL++L+E+IM    ++ +IF++TK+ CD  TR++R DGWPA+ IHGD
Sbjct  246  QIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGD  305

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDYVHRIGRT R
Sbjct  306  KSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTAR  365

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            +  KGTAYTFFT  N + A++LI +L+EA Q ++P+L  +
Sbjct  366  STNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQL  405



>ref|XP_004563117.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like isoform 
X2 [Maylandia zebra]
Length=629

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 127/157 (81%), Gaps = 2/157 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   ES+K  KL++L+E+IM    ++ +IF++TKK CD  TR++R DGWPA+ IHGD
Sbjct  321  QIVDVCVESEKDQKLIQLMEEIMAEKENKTIIFVETKKRCDDLTRRMRRDGWPAMCIHGD  380

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVLSEF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDY+HRIGRT R
Sbjct  381  KSQPERDWVLSEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTAR  440

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPEL  353
            +  KGTAYTFFT  N R A++LI +L+EA Q ++P+L
Sbjct  441  STNKGTAYTFFTPGNLRQARELIRVLEEARQAINPKL  477



>ref|XP_003453852.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like [Oreochromis 
niloticus]
Length=653

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 127/157 (81%), Gaps = 2/157 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   E++K  KL++L+E+IM    ++ +IF++TKK CD  TR++R DGWPA+ IHGD
Sbjct  316  QIVDVCMETEKDNKLIQLMEEIMAEKENKTIIFVETKKRCDDLTRRMRRDGWPAMCIHGD  375

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDYVHRIGRT R
Sbjct  376  KSQPERDWVLTEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPSSSEDYVHRIGRTAR  435

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPEL  353
            +  KGTAYTFFT  N R A+DL+ +L+EA Q ++P+L
Sbjct  436  STNKGTAYTFFTPGNLRQARDLVRVLEEARQAINPKL  472



>ref|XP_005797285.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like [Xiphophorus 
maculatus]
Length=652

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 127/157 (81%), Gaps = 2/157 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   E++K  KL++L+E+IM    ++ +IF++TKK CD  TR++R DGWPA+ IHGD
Sbjct  319  QIVDVCMETEKDNKLIQLMEEIMAEKENKTIIFVETKKRCDDLTRRMRRDGWPAMCIHGD  378

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDYVHRIGRT R
Sbjct  379  KSQPERDWVLTEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPSSSEDYVHRIGRTAR  438

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPEL  353
            +  KGTAYTFFT  N R A+DL+ +L+EA Q ++P+L
Sbjct  439  STNKGTAYTFFTPGNLRQARDLVRVLEEARQAINPKL  475



>ref|XP_002402985.1| ATP-dependent RNA helicase, putative [Ixodes scapularis]
 gb|EEC11603.1| ATP-dependent RNA helicase, putative, partial [Ixodes scapularis]
Length=431

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 126/160 (79%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDG--SRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q ++   ES+K TKL+KLL++IM+   ++ +IF +TK+  D+ TR++R DGWPA+ IHGD
Sbjct  212  QIIDVCQESEKDTKLLKLLQEIMNERENKTIIFAETKRKVDELTRRMRRDGWPAMCIHGD  271

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EF++GKSPI+ ATDVAARGLDV D+K+VINYD+P   EDYVHRIGRT R
Sbjct  272  KSQPERDWVLTEFRSGKSPILVATDVAARGLDVDDIKFVINYDYPNCSEDYVHRIGRTAR  331

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            +   GTAYTFFT  N++ A +LI +L+EA Q V+P+L  M
Sbjct  332  SNKTGTAYTFFTPHNSKQANELISVLKEANQVVNPKLYEM  371



>ref|XP_008407161.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 [Poecilia 
reticulata]
Length=652

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 127/157 (81%), Gaps = 2/157 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   E++K  KL++L+E+IM    ++ +IF++TKK CD  TR++R DGWPA+ IHGD
Sbjct  319  QIVDVCMETEKDNKLIQLMEEIMAEKENKTIIFVETKKRCDDLTRRMRRDGWPAMCIHGD  378

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDYVHRIGRT R
Sbjct  379  KSQPERDWVLTEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPSSSEDYVHRIGRTAR  438

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPEL  353
            +  KGTAYTFFT  N R A+DL+ +L+EA Q ++P+L
Sbjct  439  STNKGTAYTFFTPGNLRQARDLVRVLEEARQAINPKL  475



>ref|XP_004198636.1| Piso0_002019 [Millerozyma farinosa CBS 7064]
 emb|CCE82299.1| Piso0_002019 [Millerozyma farinosa CBS 7064]
Length=534

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 119/157 (76%), Gaps = 2/157 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q VE VSE +K  +L+K LE     + +++LIF  TKK CD+ TR LR DGWPAL+IHGD
Sbjct  322  QLVEVVSEFEKRDRLIKHLETATTDNEAKVLIFASTKKTCDEITRYLRSDGWPALAIHGD  381

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            K QAERDWVL EFK GKSPIM ATDVAARG+DVK + YVIN D PG++EDYVHRIGRTGR
Sbjct  382  KQQAERDWVLKEFKTGKSPIMVATDVAARGIDVKGISYVINLDMPGNIEDYVHRIGRTGR  441

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPEL  353
            AG  GTA +FFT AN++   DL  I++EA Q + PEL
Sbjct  442  AGTTGTAVSFFTEANSKLGGDLCKIMREAKQTIPPEL  478



>ref|XP_006790684.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like isoform 
X1 [Neolamprologus brichardi]
Length=536

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   E++K  KL++L+E+IM    ++ +IF++TKK CD  TR++R DGWPA+ IHGD
Sbjct  316  QIVDVCMETEKDDKLIQLMEEIMAEKENKTIIFVETKKRCDDLTRRMRRDGWPAMCIHGD  375

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDYVHRIGRT R
Sbjct  376  KSQPERDWVLTEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPSSSEDYVHRIGRTAR  435

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            +  KGTAYTFFT  N R A+DL+ +L+EA Q ++P+L  +
Sbjct  436  STNKGTAYTFFTPGNLRQARDLVRVLEEAHQAINPKLLQL  475



>ref|XP_003712846.1| ATP-dependent RNA helicase DBP2 [Magnaporthe oryzae 70-15]
 sp|A4QSS5.1|DBP2_MAGO7 RecName: Full=ATP-dependent RNA helicase DBP2 [Magnaporthe oryzae 
70-15]
 gb|EHA53039.1| ATP-dependent RNA helicase DBP2 [Magnaporthe oryzae 70-15]
Length=548

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 129/162 (80%), Gaps = 4/162 (2%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDG----SRILIFMDTKKGCDQTTRQLRMDGWPALSIH  650
            Q VE VSES+K  ++++ +E +MDG    ++ILIF+ TK+  D+ TR LR DGWPALSIH
Sbjct  346  QIVEVVSESEKRDRMIRHMEKVMDGKDSKNKILIFVGTKRVADEITRFLRQDGWPALSIH  405

Query  649  GDKSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrt  470
            GDK Q ERDWVL +FK GKSPIM ATDVA+RG+DV+++ +V+NYD+P + EDY+HRIGRT
Sbjct  406  GDKQQNERDWVLDQFKTGKSPIMVATDVASRGIDVRNITHVLNYDYPNNSEDYIHRIGRT  465

Query  469  gragakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            GRAGAKGTA TFFT  N++ A+DL+ +LQEA Q++ P LA M
Sbjct  466  GRAGAKGTAITFFTTENSKQARDLLGVLQEAKQEIDPRLAEM  507



>ref|XP_007543657.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 [Poecilia 
formosa]
Length=653

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 127/157 (81%), Gaps = 2/157 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   E++K  KL++L+E+IM    ++ +IF++TKK CD  TR++R DGWPA+ IHGD
Sbjct  319  QIVDVCMETEKDNKLIQLMEEIMAEKENKTIIFVETKKRCDDLTRRMRRDGWPAMCIHGD  378

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDYVHRIGRT R
Sbjct  379  KSQPERDWVLTEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPSSSEDYVHRIGRTAR  438

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPEL  353
            +  KGTAYTFFT  N R A+DL+ +L+EA Q ++P+L
Sbjct  439  STNKGTAYTFFTPGNLRQARDLVRVLEEARQAINPKL  475



>ref|XP_008315636.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 [Cynoglossus 
semilaevis]
Length=643

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 127/157 (81%), Gaps = 2/157 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   E++K  KL++L+E+IM    ++ +IF++TKK CD  TR++R DGWPA+ IHGD
Sbjct  316  QIVDVCMENEKDNKLIQLMEEIMAEKENKTIIFVETKKRCDDLTRRMRRDGWPAMCIHGD  375

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDYVHRIGRT R
Sbjct  376  KSQPERDWVLTEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTAR  435

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPEL  353
            +  KGTAYTFFT  N R A+DL+ +L+EA Q ++P+L
Sbjct  436  STNKGTAYTFFTPGNLRQARDLVRVLEEARQAINPKL  472



>ref|XP_008328999.1| PREDICTED: probable ATP-dependent RNA helicase DDX5 isoform X2 
[Cynoglossus semilaevis]
Length=498

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 126/160 (79%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDG--SRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+  ++ +K  KL++LLE+IM    ++ +IF++TK+ CD  TR++R DGWPA+ IHGD
Sbjct  321  QIVDVCNDGEKENKLIRLLEEIMSEKENKTIIFVETKRKCDDLTRRMRRDGWPAMGIHGD  380

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EFK GK+PI+ ATDVA+RGLDV+DVK+VIN+D+P + EDY+HRIGRT R
Sbjct  381  KSQQERDWVLNEFKYGKAPILIATDVASRGLDVEDVKFVINFDYPNNSEDYIHRIGRTAR  440

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            +   GTAYTFFT  N R A+DLI +L+EA Q ++P+L  M
Sbjct  441  SQKTGTAYTFFTPNNMRQARDLISVLREANQAINPKLLQM  480



>gb|KFQ42674.1| putative ATP-dependent RNA helicase DDX17, partial [Nestor notabilis]
Length=468

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   ES+K  KL++L+E+IM    ++ +IF++TK+ CD  TR++R DGWPA+ IHGD
Sbjct  298  QIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGD  357

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDYVHRIGRT R
Sbjct  358  KSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTAR  417

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            +  KGTAYTFFT  N + A++LI +L+EA Q ++P+L  +
Sbjct  418  STNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQL  457



>gb|KFO61287.1| putative ATP-dependent RNA helicase DDX17, partial [Corvus brachyrhynchos]
 gb|KFU83595.1| putative ATP-dependent RNA helicase DDX17, partial [Chaetura 
pelagica]
 gb|KFU97427.1| putative ATP-dependent RNA helicase DDX17, partial [Pterocles 
gutturalis]
 gb|KFW87328.1| putative ATP-dependent RNA helicase DDX17, partial [Manacus vitellinus]
Length=467

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   ES+K  KL++L+E+IM    ++ +IF++TK+ CD  TR++R DGWPA+ IHGD
Sbjct  297  QIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGD  356

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDYVHRIGRT R
Sbjct  357  KSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTAR  416

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            +  KGTAYTFFT  N + A++LI +L+EA Q ++P+L  +
Sbjct  417  STNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQL  456



>ref|XP_007914595.1| putative atp-dependent rna helicase dbp-2 protein [Togninia minima 
UCRPA7]
 gb|EOO00620.1| putative atp-dependent rna helicase dbp-2 protein [Togninia minima 
UCRPA7]
Length=536

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 127/160 (79%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMD--GSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q VE VSE +K  +++K +E IMD   ++ILIF  TK+  D+ TR LR DGWPALSIHGD
Sbjct  339  QIVEVVSEGEKRERMIKHMEKIMDDKANKILIFTGTKRVADEITRFLRQDGWPALSIHGD  398

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            K Q ERDWVL +FK GKSPIM ATDVA+RG+DV+++ +V+NYD+P + EDY+HRIGRTGR
Sbjct  399  KQQNERDWVLDQFKTGKSPIMVATDVASRGIDVRNITHVLNYDYPNNSEDYIHRIGRTGR  458

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AGAKGTA TFFT  N++ A+DL+++LQEA Q++ P LA M
Sbjct  459  AGAKGTAITFFTTDNSKQARDLVNVLQEAKQQIDPRLAEM  498



>gb|KFO81715.1| putative ATP-dependent RNA helicase DDX17, partial [Cuculus canorus]
Length=467

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   ES+K  KL++L+E+IM    ++ +IF++TK+ CD  TR++R DGWPA+ IHGD
Sbjct  297  QIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGD  356

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDYVHRIGRT R
Sbjct  357  KSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTAR  416

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            +  KGTAYTFFT  N + A++LI +L+EA Q ++P+L  +
Sbjct  417  STNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQL  456



>gb|KFO06156.1| putative ATP-dependent RNA helicase DDX17, partial [Balearica 
regulorum gibbericeps]
 gb|KFP95123.1| putative ATP-dependent RNA helicase DDX17, partial [Haliaeetus 
albicilla]
 gb|KFW01323.1| putative ATP-dependent RNA helicase DDX17, partial [Eurypyga 
helias]
Length=474

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   ES+K  KL++L+E+IM    ++ +IF++TK+ CD  TR++R DGWPA+ IHGD
Sbjct  298  QIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGD  357

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDYVHRIGRT R
Sbjct  358  KSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTAR  417

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            +  KGTAYTFFT  N + A++LI +L+EA Q ++P+L  +
Sbjct  418  STNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQL  457



>gb|EMC76814.1| putative ATP-dependent RNA helicase DDX17, partial [Columba livia]
Length=481

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   ES+K  KL++L+E+IM    ++ +IF++TK+ CD  TR++R DGWPA+ IHGD
Sbjct  296  QIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGD  355

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDYVHRIGRT R
Sbjct  356  KSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTAR  415

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            +  KGTAYTFFT  N + A++LI +L+EA Q ++P+L  +
Sbjct  416  STNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQL  455



>gb|KFZ49707.1| putative ATP-dependent RNA helicase DDX17, partial [Podiceps 
cristatus]
Length=473

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   ES+K  KL++L+E+IM    ++ +IF++TK+ CD  TR++R DGWPA+ IHGD
Sbjct  297  QIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGD  356

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDYVHRIGRT R
Sbjct  357  KSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTAR  416

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            +  KGTAYTFFT  N + A++LI +L+EA Q ++P+L  +
Sbjct  417  STNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQL  456



>gb|EPR60274.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Toxoplasma gondii 
GT1]
 gb|ESS30986.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Toxoplasma gondii 
VEG]
 gb|KFG36774.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Toxoplasma gondii 
p89]
 gb|KFG44036.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Toxoplasma gondii 
FOU]
 gb|KFH07497.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Toxoplasma gondii 
VAND]
Length=550

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V  V E +K  +L+ LL  IMDGS+ILIF +TK+G D  TR +R++GWPALS+HGDK 
Sbjct  351  QEVMVVQEYEKRGQLMSLLRRIMDGSKILIFAETKRGADNLTRDMRVEGWPALSLHGDKK  410

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q ER WVL EFK G++PIM ATDVA+RGLDVKD+++VINYD P  +EDY+HRIGRTGRAG
Sbjct  411  QEERTWVLDEFKNGRNPIMVATDVASRGLDVKDIRHVINYDMPNQIEDYIHRIGRTGRAG  470

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKG AYTFFT    R A++L+ +L+ A Q V PEL ++
Sbjct  471  AKGCAYTFFTPDKPRLARELVRVLRGANQPVPPELESL  508



>ref|XP_002369028.1| DEAD/DEAH box helicase, putative [Toxoplasma gondii ME49]
 gb|EPT26653.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Toxoplasma gondii 
ME49]
 gb|KFG31703.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Toxoplasma gondii 
GAB2-2007-GAL-DOM2]
 gb|KFH16252.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Toxoplasma gondii 
MAS]
Length=550

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V  V E +K  +L+ LL  IMDGS+ILIF +TK+G D  TR +R++GWPALS+HGDK 
Sbjct  351  QEVMVVQEYEKRGQLMSLLRRIMDGSKILIFAETKRGADNLTRDMRVEGWPALSLHGDKK  410

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q ER WVL EFK G++PIM ATDVA+RGLDVKD+++VINYD P  +EDY+HRIGRTGRAG
Sbjct  411  QEERTWVLDEFKNGRNPIMVATDVASRGLDVKDIRHVINYDMPNQIEDYIHRIGRTGRAG  470

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKG AYTFFT    R A++L+ +L+ A Q V PEL ++
Sbjct  471  AKGCAYTFFTPDKPRLARELVRVLRGANQPVPPELESL  508



>gb|KFZ60114.1| putative ATP-dependent RNA helicase DDX17, partial [Caprimulgus 
carolinensis]
Length=482

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   ES+K  KL++L+E+IM    ++ +IF++TK+ CD  TR++R DGWPA+ IHGD
Sbjct  298  QIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGD  357

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDYVHRIGRT R
Sbjct  358  KSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTAR  417

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            +  KGTAYTFFT  N + A++LI +L+EA Q ++P+L  +
Sbjct  418  STNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQL  457



>ref|XP_007560356.1| PREDICTED: probable ATP-dependent RNA helicase DDX5 isoform X2 
[Poecilia formosa]
Length=493

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 125/160 (78%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDG--SRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+  ++ +K  KL++LLE+IM    ++ +IF++TK+ CD  TR++R DGWPA+ IHGD
Sbjct  316  QIVDVCNDGEKENKLIRLLEEIMSEKENKTIIFVETKRRCDDLTRRMRRDGWPAMGIHGD  375

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EFK GK+PI+ ATDVA+RGLDV+DVK+VINYD+P + EDY+HRIGRT R
Sbjct  376  KSQQERDWVLNEFKFGKAPILIATDVASRGLDVEDVKFVINYDYPNNSEDYIHRIGRTAR  435

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            +   GTAYTFFT  N R A DL+ +L+EA Q ++P+L  M
Sbjct  436  SQKTGTAYTFFTPNNMRQASDLVSVLREANQAINPKLLQM  475



>ref|XP_008294587.1| PREDICTED: probable ATP-dependent RNA helicase DDX17 [Stegastes 
partitus]
Length=646

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 127/157 (81%), Gaps = 2/157 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   E++K  KL++L+E+IM    ++ +IF++TKK CD  TR++R DGWPA+ IHGD
Sbjct  315  QIVDVCMENEKDNKLIQLMEEIMAEKENKTIIFVETKKRCDDLTRRMRRDGWPAMCIHGD  374

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVLSEF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDY+HRIGRT R
Sbjct  375  KSQPERDWVLSEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTAR  434

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPEL  353
            +  KGTAYTFFT  N R A++LI +L+EA Q ++P+L
Sbjct  435  STNKGTAYTFFTPGNLRQARELIRVLEEARQAINPKL  471



>gb|KJB56889.1| hypothetical protein B456_009G140700 [Gossypium raimondii]
Length=424

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            QHV  VSESQKY KLVKLLEDIMDGSRILIFMDTKKGCDQ TRQLRMDGWP LSIHGDKS
Sbjct  320  QHVNIVSESQKYNKLVKLLEDIMDGSRILIFMDTKKGCDQITRQLRMDGWPTLSIHGDKS  379

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGL  551
            QAERDWVLSEFKAGKSPIMTATDVAARGL
Sbjct  380  QAERDWVLSEFKAGKSPIMTATDVAARGL  408



>dbj|BAB28651.1| unnamed protein product [Mus musculus]
Length=304

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 123/157 (78%), Gaps = 2/157 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDG--SRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   + +K  KL++L+E+IM    ++ ++F++TK+ CD+ TR++R DGWPA+ IHGD
Sbjct  4    QIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGD  63

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EFK GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDY+HRIGRT R
Sbjct  64   KSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTAR  123

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPEL  353
            +   GTAYTFFT  N +   DLI +L+EA Q ++P+L
Sbjct  124  STKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKL  160



>gb|KFV68880.1| putative ATP-dependent RNA helicase DDX17, partial [Picoides 
pubescens]
Length=473

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   ES+K  KL++L+E+IM    ++ +IF++TK+ CD  TR++R DGWPA+ IHGD
Sbjct  297  QIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGD  356

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDYVHRIGRT R
Sbjct  357  KSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTAR  416

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            +  KGTAYTFFT  N + A++LI +L+EA Q ++P+L  +
Sbjct  417  STNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQL  456



>ref|XP_008885470.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Hammondia hammondi]
 gb|KEP63938.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Hammondia hammondi]
Length=550

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMDGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGDKS  638
            Q V  V E +K  +L+ LL  IMDGS+ILIF +TK+G D  TR +R++GWPALS+HGDK 
Sbjct  351  QEVMVVQEYEKRGQLMSLLRRIMDGSKILIFAETKRGADNLTRDMRVEGWPALSLHGDKK  410

Query  637  QAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgrag  458
            Q ER WVL EFK G++PIM ATDVA+RGLDVKD+++VINYD P  +EDY+HRIGRTGRAG
Sbjct  411  QEERTWVLDEFKNGRNPIMVATDVASRGLDVKDIRHVINYDMPNQIEDYIHRIGRTGRAG  470

Query  457  akgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AKG AYTFFT    R A++L+ +L+ A Q V PEL ++
Sbjct  471  AKGCAYTFFTPDKPRLARELVRVLRGANQPVPPELESL  508



>ref|XP_663535.1| hypothetical protein AN5931.2 [Aspergillus nidulans FGSC A4]
 sp|Q5B0J9.1|DBP2_EMENI RecName: Full=ATP-dependent RNA helicase dbp2 [Aspergillus nidulans 
FGSC A4]
 gb|EAA57794.1| hypothetical protein AN5931.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF70542.1| TPA: ATP-dependent RNA helicase dbp2 (EC 3.6.1.-) [Source:UniProtKB/Swiss-Prot;Acc:Q5B0J9] 
[Aspergillus nidulans FGSC A4]
Length=563

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 126/160 (79%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIMD--GSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q VE +SE +K  +++K LE IM+  G++ L+F  TK+  D+ TR LR DGWPALSIHGD
Sbjct  361  QIVEVISEFEKRDRMIKHLEKIMENRGNKCLVFTGTKRIADEITRFLRQDGWPALSIHGD  420

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            K Q ERDWVL+EFK GKSPIM ATDVA+RG+DV+D+ +VINYD+P + EDYVHRIGRTGR
Sbjct  421  KQQQERDWVLNEFKTGKSPIMVATDVASRGIDVRDITHVINYDYPNNSEDYVHRIGRTGR  480

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            AGAKGTA TFFT  NA+ A+DL+ IL EA Q++ P LA M
Sbjct  481  AGAKGTAITFFTTDNAKQARDLVTILSEAKQQIDPRLAEM  520



>gb|KFQ18808.1| putative ATP-dependent RNA helicase DDX17, partial [Merops nubicus]
Length=481

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   ES+K  KL++L+E+IM    ++ +IF++TK+ CD  TR++R DGWPA+ IHGD
Sbjct  297  QIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGD  356

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDYVHRIGRT R
Sbjct  357  KSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTAR  416

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            +  KGTAYTFFT  N + A++LI +L+EA Q ++P+L  +
Sbjct  417  STNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQL  456



>gb|KFP10244.1| putative ATP-dependent RNA helicase DDX17, partial [Egretta garzetta]
Length=476

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   ES+K  KL++L+E+IM    ++ +IF++TK+ CD  TR++R DGWPA+ IHGD
Sbjct  300  QIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGD  359

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDYVHRIGRT R
Sbjct  360  KSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTAR  419

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            +  KGTAYTFFT  N + A++LI +L+EA Q ++P+L  +
Sbjct  420  STNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQL  459



>gb|KFP74117.1| putative ATP-dependent RNA helicase DDX17, partial [Apaloderma 
vittatum]
Length=473

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = -3

Query  817  QHVEXVSESQKYTKLVKLLEDIM--DGSRILIFMDTKKGCDQTTRQLRMDGWPALSIHGD  644
            Q V+   ES+K  KL++L+E+IM    ++ +IF++TK+ CD  TR++R DGWPA+ IHGD
Sbjct  298  QIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGD  357

Query  643  KSQAERDWVLSEFKAGKSPIMTATDVAARGLDVKDVKYVINYDFPGSLEDYVHrigrtgr  464
            KSQ ERDWVL+EF++GK+PI+ ATDVA+RGLDV+DVK+VINYD+P S EDYVHRIGRT R
Sbjct  358  KSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTAR  417

Query  463  agakgtayTFFTAANARFAKDLIHILQEAGQKVSPELATM  344
            +  KGTAYTFFT  N + A++LI +L+EA Q ++P+L  +
Sbjct  418  STNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQL  457



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1738401790104