BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13673

Length=964
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009603861.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    194   4e-54   Nicotiana tomentosiformis
ref|XP_009798338.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    192   1e-53   Nicotiana sylvestris
ref|XP_004235805.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    186   3e-51   Solanum lycopersicum
ref|XP_006341612.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    178   3e-48   Solanum tuberosum [potatoes]
ref|XP_007044348.1|  B-box type zinc finger protein with CCT doma...    174   1e-46   Theobroma cacao [chocolate]
emb|CDO98435.1|  unnamed protein product                                173   2e-46   Coffea canephora [robusta coffee]
ref|XP_002282578.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    171   2e-45   Vitis vinifera
gb|KJB16228.1|  hypothetical protein B456_002G218400                    168   2e-44   Gossypium raimondii
gb|KHG17662.1|  Zinc finger CONSTANS-LIKE 16 -like protein              165   3e-43   Gossypium arboreum [tree cotton]
ref|XP_010263709.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    165   3e-43   Nelumbo nucifera [Indian lotus]
ref|XP_006440964.1|  hypothetical protein CICLE_v10020440mg             164   4e-43   Citrus clementina [clementine]
ref|XP_006448477.1|  hypothetical protein CICLE_v10015173mg             165   5e-43   Citrus clementina [clementine]
ref|XP_006468698.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    165   5e-43   Citrus sinensis [apfelsine]
ref|XP_002533412.1|  transcription factor, putative                     163   1e-42   Ricinus communis
ref|XP_009627333.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    163   2e-42   Nicotiana tomentosiformis
ref|XP_011022115.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     163   2e-42   Populus euphratica
gb|AFX73409.1|  constans-like protein 5                                 162   2e-42   Gossypium hirsutum [American cotton]
ref|XP_010265147.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    162   4e-42   Nelumbo nucifera [Indian lotus]
ref|XP_002311458.2|  zinc finger family protein                         162   4e-42   Populus trichocarpa [western balsam poplar]
ref|XP_009397482.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    159   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN05568.1|  Zinc finger protein CONSTANS-LIKE 16                    153   1e-40   Glycine soja [wild soybean]
ref|XP_010031966.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    158   2e-40   Eucalyptus grandis [rose gum]
ref|XP_002276181.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    157   2e-40   Vitis vinifera
ref|XP_008775153.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    157   2e-40   Phoenix dactylifera
ref|XP_009347093.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    157   3e-40   Pyrus x bretschneideri [bai li]
ref|XP_006485786.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    156   4e-40   Citrus sinensis [apfelsine]
ref|XP_009777706.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    157   4e-40   Nicotiana sylvestris
emb|CAN73757.1|  hypothetical protein VITISV_026326                     157   4e-40   Vitis vinifera
ref|NP_001278940.1|  zinc finger protein CONSTANS-LIKE 16-like          155   5e-40   Glycine max [soybeans]
ref|XP_011007910.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    155   8e-40   Populus euphratica
ref|XP_007152761.1|  hypothetical protein PHAVU_004G157300g             155   9e-40   Phaseolus vulgaris [French bean]
gb|KHN11420.1|  Zinc finger protein CONSTANS-LIKE 16                    155   9e-40   Glycine soja [wild soybean]
ref|XP_003555902.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    155   1e-39   Glycine max [soybeans]
ref|XP_010916170.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    155   1e-39   Elaeis guineensis
ref|XP_010103762.1|  Zinc finger protein CONSTANS-LIKE 16               155   2e-39   Morus notabilis
ref|XP_002315940.1|  Zinc finger protein CONSTANS-LIKE 6                154   3e-39   
gb|AHI45078.1|  COL domain class transcription factor                   154   3e-39   Boehmeria nivea [Chinese silk-plant]
gb|AHI45077.1|  COL domain class transcription factor                   154   3e-39   Boehmeria nivea [Chinese silk-plant]
ref|XP_009602362.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    152   5e-39   Nicotiana tomentosiformis
ref|XP_008374747.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     153   5e-39   Malus domestica [apple tree]
ref|XP_002531628.1|  conserved hypothetical protein                     154   6e-39   Ricinus communis
emb|CDP00619.1|  unnamed protein product                                153   9e-39   Coffea canephora [robusta coffee]
ref|XP_010066724.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    153   1e-38   Eucalyptus grandis [rose gum]
ref|XP_007210807.1|  hypothetical protein PRUPE_ppa017267mg             152   1e-38   
gb|AGM20692.1|  COL6-2                                                  152   1e-38   Populus tomentosa [Chinese white poplar]
ref|XP_012093002.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     152   2e-38   Jatropha curcas
ref|XP_007036519.1|  Transcription factor, putative                     152   2e-38   
gb|KHG04097.1|  Zinc finger CONSTANS-LIKE 16 -like protein              151   3e-38   Gossypium arboreum [tree cotton]
ref|XP_009360161.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    152   3e-38   Pyrus x bretschneideri [bai li]
gb|KJB34352.1|  hypothetical protein B456_006G061600                    150   4e-38   Gossypium raimondii
gb|KJB34354.1|  hypothetical protein B456_006G061600                    150   4e-38   Gossypium raimondii
ref|XP_011007901.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    150   7e-38   Populus euphratica
ref|XP_008240273.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    150   1e-37   Prunus mume [ume]
ref|XP_006829901.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     149   1e-37   Amborella trichopoda
ref|NP_001239992.1|  uncharacterized protein LOC100802113               148   1e-37   
ref|XP_011076793.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    150   1e-37   
ref|XP_008446600.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...    149   1e-37   Cucumis melo [Oriental melon]
ref|XP_004135402.2|  PREDICTED: zinc finger protein CONSTANS-LIKE...    149   2e-37   Cucumis sativus [cucumbers]
ref|XP_006367940.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    149   2e-37   Solanum tuberosum [potatoes]
gb|AEF12205.1|  CONSTANS-like zinc finger protein                       148   3e-37   Glycine max [soybeans]
ref|XP_008802436.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    148   4e-37   
ref|XP_004300528.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    148   5e-37   Fragaria vesca subsp. vesca
gb|KEH44219.1|  zinc finger constans-like protein                       148   5e-37   Medicago truncatula
ref|XP_004238926.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    148   5e-37   Solanum lycopersicum
ref|XP_010320765.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    147   6e-37   
gb|AEF12203.1|  CONSTANS-like zinc finger protein                       147   8e-37   Glycine max [soybeans]
ref|XP_006374368.1|  hypothetical protein POPTR_0015s06480g             147   1e-36   
ref|XP_004236986.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    147   1e-36   Solanum lycopersicum
ref|XP_009356747.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    147   2e-36   Pyrus x bretschneideri [bai li]
ref|XP_011072947.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     145   2e-36   Sesamum indicum [beniseed]
ref|XP_007142909.1|  hypothetical protein PHAVU_007G027200g             145   2e-36   Phaseolus vulgaris [French bean]
ref|XP_009765495.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    144   1e-35   Nicotiana sylvestris
gb|AIE41597.1|  zinc finger protein CONSTANS-LIKE 6                     142   2e-35   Lagerstroemia indica [crape-myrtle]
ref|XP_003637430.1|  Zinc finger protein CONSTANS-like protein          137   3e-35   
ref|XP_011016373.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    143   3e-35   Populus euphratica
ref|XP_009356271.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    143   4e-35   Pyrus x bretschneideri [bai li]
ref|XP_008389292.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    142   5e-35   
ref|XP_008360050.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    142   5e-35   
emb|CDY07383.1|  BnaA07g24620D                                          137   9e-35   Brassica napus [oilseed rape]
gb|KJB23747.1|  hypothetical protein B456_004G113000                    141   1e-34   Gossypium raimondii
ref|XP_010094760.1|  Zinc finger protein CONSTANS-LIKE 16               141   1e-34   Morus notabilis
ref|XP_008339676.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     141   2e-34   
ref|XP_009409257.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    140   2e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011071256.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    141   2e-34   
ref|XP_012082090.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    140   2e-34   Jatropha curcas
ref|XP_008352923.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    140   3e-34   
emb|CDY53119.1|  BnaCnng24470D                                          139   4e-34   Brassica napus [oilseed rape]
ref|XP_004497095.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    140   4e-34   Cicer arietinum [garbanzo]
ref|XP_006344138.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    139   6e-34   Solanum tuberosum [potatoes]
ref|XP_006656860.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    138   6e-34   
gb|KFK44524.1|  hypothetical protein AALP_AA1G267800                    139   8e-34   Arabis alpina [alpine rockcress]
emb|CDY03851.1|  BnaC07g10760D                                          137   1e-33   
gb|ADK63396.1|  B-box type zinc finger protein                          135   1e-33   Brassica rapa
ref|XP_004140861.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     135   4e-33   Cucumis sativus [cucumbers]
gb|AIE41596.1|  zinc finger protein CONSTANS-LIKE 5                     136   4e-33   Lagerstroemia indica [crape-myrtle]
emb|CDY51133.1|  BnaA07g37160D                                          135   7e-33   Brassica napus [oilseed rape]
ref|XP_008445668.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    134   1e-32   Cucumis melo [Oriental melon]
ref|XP_010551268.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    134   3e-32   Tarenaya hassleriana [spider flower]
ref|XP_003525256.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    134   3e-32   
ref|XP_010926126.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    134   4e-32   
ref|XP_009127638.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     134   5e-32   Brassica rapa
ref|NP_001051053.1|  Os03g0711100                                       133   7e-32   
ref|XP_004299078.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    133   9e-32   Fragaria vesca subsp. vesca
ref|XP_009105041.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    132   1e-31   
emb|CDY44890.1|  BnaA02g13920D                                          132   1e-31   Brassica napus [oilseed rape]
ref|XP_006415872.1|  hypothetical protein EUTSA_v10007685mg             133   1e-31   Eutrema salsugineum [saltwater cress]
ref|XP_007222133.1|  hypothetical protein PRUPE_ppa005713mg             133   1e-31   Prunus persica
ref|XP_004512860.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    132   2e-31   Cicer arietinum [garbanzo]
emb|CDX81527.1|  BnaC02g18310D                                          132   2e-31   
gb|ACX42573.1|  CONSTANS-like zinc finger protein                       131   2e-31   Glycine max [soybeans]
ref|XP_009410076.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    131   3e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008243227.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    132   4e-31   Prunus mume [ume]
emb|CDY04230.1|  BnaC06g25850D                                          127   4e-31   
gb|AAG52391.1|AC011915_5  putative B-box zinc finger protein; 520...    131   4e-31   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564932.1|  zinc finger protein CONSTANS-LIKE 6                   131   4e-31   Arabidopsis thaliana [mouse-ear cress]
emb|CDY67920.1|  BnaAnng25560D                                          130   5e-31   Brassica napus [oilseed rape]
ref|XP_010667660.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    131   6e-31   Beta vulgaris subsp. vulgaris [field beet]
gb|EAZ36554.1|  hypothetical protein OsJ_20892                          130   7e-31   Oryza sativa Japonica Group [Japonica rice]
gb|EEE59794.1|  hypothetical protein OsJ_12314                          126   7e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002888669.1|  zinc finger (B-box type) family protein            130   1e-30   Arabidopsis lyrata subsp. lyrata
ref|XP_006391130.1|  hypothetical protein EUTSA_v10018663mg             130   1e-30   Eutrema salsugineum [saltwater cress]
gb|EYU26768.1|  hypothetical protein MIMGU_mgv1a006045mg                130   1e-30   Erythranthe guttata [common monkey flower]
gb|AAM61001.1|  putative B-box zinc finger protein                      129   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009103068.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    129   1e-30   Brassica rapa
ref|XP_010499109.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    129   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010460379.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    129   1e-30   Camelina sativa [gold-of-pleasure]
emb|CDY65591.1|  BnaC05g50730D                                          128   2e-30   Brassica napus [oilseed rape]
ref|XP_010460378.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    129   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_007160372.1|  hypothetical protein PHAVU_002G316100g             128   3e-30   Phaseolus vulgaris [French bean]
ref|XP_002466587.1|  hypothetical protein SORBIDRAFT_01g010420          129   3e-30   Sorghum bicolor [broomcorn]
gb|EMS53816.1|  Zinc finger protein CONSTANS-LIKE 16                    125   5e-30   Triticum urartu
ref|XP_003560836.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    128   6e-30   Brachypodium distachyon [annual false brome]
ref|XP_006302328.1|  hypothetical protein CARUB_v10020384mg             127   6e-30   Capsella rubella
ref|XP_006307606.1|  hypothetical protein CARUB_v10009230mg             127   7e-30   Capsella rubella
ref|XP_004982006.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    127   8e-30   Setaria italica
ref|XP_010477926.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    127   8e-30   Camelina sativa [gold-of-pleasure]
emb|CDX77359.1|  BnaC08g04040D                                          122   1e-29   
ref|XP_010527538.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    127   1e-29   
ref|XP_010460380.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    127   1e-29   Camelina sativa [gold-of-pleasure]
gb|EMT27110.1|  hypothetical protein F775_43077                         125   2e-29   
gb|EAZ00428.1|  hypothetical protein OsI_22452                          126   2e-29   Oryza sativa Indica Group [Indian rice]
gb|AAM13173.1|  unknown protein                                         126   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003559520.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6     126   3e-29   Brachypodium distachyon [annual false brome]
ref|NP_173915.2|  zinc finger protein CONSTANS-LIKE 16                  125   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010470801.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    125   4e-29   Camelina sativa [gold-of-pleasure]
gb|AAG50803.1|AC079281_5  zinc finger protein, putative                 125   4e-29   Arabidopsis thaliana [mouse-ear cress]
gb|ABF98510.1|  CCT motif family protein, expressed                     124   5e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010415472.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    125   5e-29   Camelina sativa [gold-of-pleasure]
ref|XP_009115317.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    125   5e-29   Brassica rapa
ref|XP_011648856.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    124   6e-29   Cucumis sativus [cucumbers]
ref|XP_009381448.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    125   7e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008453390.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    124   9e-29   Cucumis melo [Oriental melon]
ref|NP_001048022.1|  Os02g0731700                                       123   1e-28   
gb|EEC73943.1|  hypothetical protein OsI_08813                          123   1e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_006649016.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    123   1e-28   Oryza brachyantha
gb|AFK49208.1|  unknown                                                 120   1e-28   Medicago truncatula
ref|XP_010428333.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    123   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010907326.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    123   2e-28   Elaeis guineensis
ref|NP_001149548.1|  CCT motif family protein                           123   3e-28   Zea mays [maize]
ref|XP_010511849.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    123   3e-28   Camelina sativa [gold-of-pleasure]
ref|NP_001057333.2|  Os06g0264200                                       123   4e-28   
ref|XP_002890690.1|  hypothetical protein ARALYDRAFT_472829             122   4e-28   
ref|XP_007153446.1|  hypothetical protein PHAVU_003G036000g             122   5e-28   Phaseolus vulgaris [French bean]
dbj|BAD15937.1|  zinc finger protein-like                               122   5e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003630849.1|  CONSTANS-like zinc finger protein                  122   5e-28   Medicago truncatula
dbj|BAK04456.1|  predicted protein                                      122   5e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY24402.1|  BnaCnng04690D                                          122   6e-28   Brassica napus [oilseed rape]
ref|XP_010416209.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    122   6e-28   Camelina sativa [gold-of-pleasure]
ref|NP_177528.1|  zinc finger protein CONSTANS-LIKE 7                   121   9e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010471465.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7     121   1e-27   Camelina sativa [gold-of-pleasure]
dbj|BAK01505.1|  predicted protein                                      121   1e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004965182.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    121   1e-27   Setaria italica
ref|NP_001149457.1|  zinc finger protein CONSTANS-LIKE 16               121   2e-27   Zea mays [maize]
gb|AFW87599.1|  zinc finger protein CONSTANS-LIKE 16                    120   2e-27   
gb|EPS73837.1|  hypothetical protein M569_00919                         120   2e-27   Genlisea aurea
ref|XP_003530677.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    120   2e-27   
gb|AEF12200.1|  CONSTANS-like zinc finger protein                       120   3e-27   Glycine max [soybeans]
gb|EYU45446.1|  hypothetical protein MIMGU_mgv1a026677mg                119   4e-27   Erythranthe guttata [common monkey flower]
gb|AFK37106.1|  unknown                                                 119   7e-27   Medicago truncatula
ref|XP_002436824.1|  hypothetical protein SORBIDRAFT_10g009480          119   8e-27   Sorghum bicolor [broomcorn]
ref|XP_006302335.1|  hypothetical protein CARUB_v10020393mg             119   8e-27   Capsella rubella
ref|NP_001140584.1|  uncharacterized protein LOC100272654               119   1e-26   Zea mays [maize]
gb|AGI62036.1|  CONSTANS-like 12                                        117   1e-26   Erycina pusilla
ref|XP_004953821.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    118   2e-26   
gb|AFX97569.1|  K                                                       113   2e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004953820.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    118   2e-26   
ref|XP_009109881.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    117   3e-26   
ref|XP_002887511.1|  zinc finger (B-box type) family protein            117   3e-26   
ref|XP_004953822.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    117   4e-26   
gb|AFX97570.1|  K                                                       112   5e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008801158.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16    116   6e-26   Phoenix dactylifera
gb|EYU29978.1|  hypothetical protein MIMGU_mgv1a007591mg                115   1e-25   Erythranthe guttata [common monkey flower]
dbj|BAJ87752.1|  predicted protein                                      115   1e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009381104.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    114   2e-25   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACL53155.1|  unknown                                                 109   3e-25   Zea mays [maize]
gb|ACF84125.1|  unknown                                                 110   5e-25   Zea mays [maize]
ref|XP_002452605.1|  hypothetical protein SORBIDRAFT_04g028920          113   1e-24   
ref|XP_003573014.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    112   2e-24   
ref|XP_008646195.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    111   4e-24   Zea mays [maize]
ref|XP_010511850.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    109   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_002961709.1|  hypothetical protein SELMODRAFT_438000             108   3e-23   Selaginella moellendorffii
gb|EMT01944.1|  hypothetical protein F775_21198                         107   3e-23   
ref|XP_002964778.1|  hypothetical protein SELMODRAFT_266834             108   4e-23   Selaginella moellendorffii
ref|XP_001769011.1|  predicted protein                                  108   8e-23   
ref|XP_001771896.1|  predicted protein                                  107   9e-23   
ref|XP_007206389.1|  hypothetical protein PRUPE_ppa018053mg           99.8    6e-21   Prunus persica
ref|XP_008354841.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  99.4    6e-21   
ref|XP_008665284.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    101   1e-20   Zea mays [maize]
ref|XP_010685899.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   98.6    1e-20   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI15893.3|  unnamed protein product                              95.5    1e-20   Vitis vinifera
ref|XP_009354295.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  98.6    1e-20   Pyrus x bretschneideri [bai li]
ref|XP_008233500.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   98.6    1e-20   Prunus mume [ume]
ref|XP_010519197.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...    100   2e-20   Tarenaya hassleriana [spider flower]
ref|XP_006488582.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  98.2    2e-20   Citrus sinensis [apfelsine]
ref|XP_006425148.1|  hypothetical protein CICLE_v10029146mg           97.4    4e-20   Citrus clementina [clementine]
ref|XP_004294775.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   97.1    4e-20   Fragaria vesca subsp. vesca
ref|XP_008384739.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  96.7    6e-20   Malus domestica [apple tree]
ref|XP_012078538.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  96.7    6e-20   Jatropha curcas
ref|XP_009369559.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  96.7    6e-20   Pyrus x bretschneideri [bai li]
ref|XP_011003377.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   95.5    1e-19   Populus euphratica
ref|XP_007016977.1|  CCT motif family protein isoform 2               95.5    2e-19   
ref|XP_002274679.2|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   95.1    2e-19   Vitis vinifera
ref|XP_008797174.1|  PREDICTED: uncharacterized protein LOC103712429  95.5    2e-19   Phoenix dactylifera
ref|XP_010519196.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  97.8    2e-19   Tarenaya hassleriana [spider flower]
ref|XP_008354834.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  94.7    2e-19   
gb|KHN40106.1|  Protein CHLOROPLAST IMPORT APPARATUS 2                94.0    4e-19   Glycine soja [wild soybean]
ref|XP_001769217.1|  predicted protein                                98.2    4e-19   
ref|XP_003544900.2|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  94.4    5e-19   Glycine max [soybeans]
ref|XP_009354286.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  94.0    5e-19   Pyrus x bretschneideri [bai li]
ref|XP_006574444.1|  PREDICTED: uncharacterized protein LOC100803...  93.2    6e-19   
ref|XP_002298500.1|  CONSTANS-like family protein                     93.2    7e-19   
ref|XP_008799931.1|  PREDICTED: uncharacterized protein LOC103714457  94.0    8e-19   Phoenix dactylifera
ref|XP_010938521.1|  PREDICTED: uncharacterized protein LOC105057575  93.2    9e-19   Elaeis guineensis
ref|XP_009125969.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  91.3    1e-18   
ref|XP_003615824.1|  Zinc finger protein CONSTANS-like protein        92.4    1e-18   Medicago truncatula
ref|XP_010927568.1|  PREDICTED: uncharacterized protein LOC105049568  92.4    1e-18   
ref|XP_001765504.1|  predicted protein                                95.5    2e-18   
ref|XP_009383142.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  93.2    2e-18   
ref|XP_011010948.1|  PREDICTED: uncharacterized protein LOC105115687  93.2    2e-18   Populus euphratica
ref|XP_007142158.1|  hypothetical protein PHAVU_008G257300g           91.7    3e-18   Phaseolus vulgaris [French bean]
ref|XP_008799492.1|  PREDICTED: LOW QUALITY PROTEIN: protein CHLO...  94.0    3e-18   
ref|XP_006393307.1|  hypothetical protein EUTSA_v10011633mg           92.8    3e-18   
ref|XP_006453246.1|  hypothetical protein CICLE_v10008308mg           94.4    3e-18   Citrus clementina [clementine]
ref|XP_004490653.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  90.9    3e-18   Cicer arietinum [garbanzo]
ref|XP_009144991.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 8   92.8    3e-18   
emb|CDX70561.1|  BnaC03g06450D                                        89.7    3e-18   
ref|XP_006393308.1|  hypothetical protein EUTSA_v10011633mg           92.8    3e-18   Eutrema salsugineum [saltwater cress]
gb|KFK36040.1|  hypothetical protein AALP_AA4G070200                  92.8    4e-18   Arabis alpina [alpine rockcress]
ref|XP_010111554.1|  Protein CHLOROPLAST IMPORT APPARATUS 2           94.0    4e-18   
gb|KFK25676.1|  hypothetical protein AALP_AA8G144900                  92.4    4e-18   Arabis alpina [alpine rockcress]
ref|XP_010046933.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  93.2    5e-18   Eucalyptus grandis [rose gum]
ref|XP_010273555.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  93.2    6e-18   Nelumbo nucifera [Indian lotus]
emb|CBI17712.3|  unnamed protein product                              92.0    6e-18   Vitis vinifera
ref|XP_010264549.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 7   90.9    6e-18   Nelumbo nucifera [Indian lotus]
ref|XP_002268929.1|  PREDICTED: uncharacterized protein LOC100254358  91.7    6e-18   Vitis vinifera
ref|XP_010557193.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 8   90.1    6e-18   Tarenaya hassleriana [spider flower]
ref|XP_010539413.1|  PREDICTED: LOW QUALITY PROTEIN: protein CHLO...  93.6    7e-18   Tarenaya hassleriana [spider flower]
ref|XP_009420122.1|  PREDICTED: uncharacterized protein LOC103999941  91.7    7e-18   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY09849.1|  BnaC09g43120D                                        92.0    7e-18   Brassica napus [oilseed rape]
ref|XP_002894160.1|  hypothetical protein ARALYDRAFT_891757           91.7    8e-18   Arabidopsis lyrata subsp. lyrata
ref|XP_006286526.1|  hypothetical protein CARUB_v10001375mg           91.7    8e-18   
emb|CDX91067.1|  BnaC02g05300D                                        91.7    9e-18   
gb|AGI62031.1|  CONSTANS-like 7                                       91.3    1e-17   Erycina pusilla
gb|KJB56256.1|  hypothetical protein B456_009G113000                  89.7    1e-17   Gossypium raimondii
ref|XP_002268213.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  92.0    1e-17   Vitis vinifera
emb|CAN72725.1|  hypothetical protein VITISV_015092                   92.0    1e-17   Vitis vinifera
ref|XP_010927244.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  92.4    1e-17   Elaeis guineensis
emb|CAN75558.1|  hypothetical protein VITISV_028190                   90.9    1e-17   Vitis vinifera
ref|XP_010690879.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  92.4    1e-17   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS70097.1|  hypothetical protein M569_04667                       85.9    1e-17   Genlisea aurea
emb|CDX69586.1|  BnaA10g19350D                                        90.9    1e-17   
ref|XP_009121672.1|  PREDICTED: uncharacterized protein LOC103846490  90.9    1e-17   Brassica rapa
emb|CDX78575.1|  BnaA03g04870D                                        90.5    1e-17   
ref|XP_008230480.1|  PREDICTED: uncharacterized protein LOC103329755  90.9    2e-17   Prunus mume [ume]
emb|CBI40095.3|  unnamed protein product                              91.7    2e-17   Vitis vinifera
ref|XP_007014423.1|  Chloroplast import apparatus 2, putative iso...  91.7    2e-17   
ref|XP_010932278.1|  PREDICTED: uncharacterized protein LOC105052987  89.7    2e-17   Elaeis guineensis
ref|XP_010500456.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  90.5    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006417850.1|  hypothetical protein EUTSA_v10008808mg           88.6    2e-17   Eutrema salsugineum [saltwater cress]
gb|EMS59726.1|  Zinc finger protein CONSTANS-LIKE 6                   87.8    2e-17   
ref|XP_011017668.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  92.0    2e-17   
ref|XP_012071491.1|  PREDICTED: uncharacterized protein LOC105633500  90.5    2e-17   
ref|XP_001759088.1|  predicted protein                                92.4    2e-17   
gb|EMS51379.1|  Zinc finger protein CONSTANS-LIKE 6                   89.4    2e-17   
ref|XP_009340847.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  90.9    3e-17   
ref|XP_006399947.1|  hypothetical protein EUTSA_v10014044mg           90.1    3e-17   
emb|CDP09243.1|  unnamed protein product                              86.7    3e-17   
ref|XP_012068462.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  91.3    3e-17   
ref|XP_010479338.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  90.1    4e-17   
emb|CDX85600.1|  BnaA02g02130D                                        89.4    4e-17   
ref|XP_010487064.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.4    5e-17   
ref|XP_010457868.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.4    5e-17   
ref|XP_002324691.2|  hypothetical protein POPTR_0018s13890g           90.9    5e-17   
gb|AAM63153.1|  unknown                                               89.0    5e-17   
ref|XP_006305351.1|  hypothetical protein CARUB_v10009731mg           89.4    5e-17   
ref|XP_010248760.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   89.7    6e-17   
ref|NP_568300.1|  CCT motif family protein                            89.4    6e-17   
ref|XP_009131400.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  88.6    7e-17   
ref|XP_008379178.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   89.0    1e-16   
ref|XP_010492239.1|  PREDICTED: uncharacterized protein LOC104769672  88.6    1e-16   
ref|XP_010500455.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  88.6    1e-16   
ref|XP_011648958.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  89.7    1e-16   
ref|XP_006362450.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  89.4    1e-16   
ref|XP_006447220.1|  hypothetical protein CICLE_v10015864mg           88.2    1e-16   
ref|XP_008451201.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  89.4    1e-16   
ref|XP_011024893.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  86.7    2e-16   
ref|XP_007216840.1|  hypothetical protein PRUPE_ppa022528mg           87.4    2e-16   
ref|XP_010453557.1|  PREDICTED: uncharacterized protein LOC104735456  88.2    2e-16   
gb|KFK43009.1|  hypothetical protein AALP_AA1G067400                  85.9    2e-16   
ref|XP_010420071.1|  PREDICTED: uncharacterized protein LOC104705709  87.8    2e-16   
ref|XP_004242804.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  89.0    2e-16   
ref|XP_004507897.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  88.6    2e-16   
ref|XP_003543009.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  88.6    2e-16   
ref|XP_010929359.1|  PREDICTED: LOW QUALITY PROTEIN: protein CHLO...  88.6    3e-16   
ref|XP_009590839.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.4    3e-16   
ref|XP_006425147.1|  hypothetical protein CICLE_v10029146mg           86.3    3e-16   
emb|CDY52734.1|  BnaC09g53340D                                        88.2    3e-16   
ref|XP_009370323.1|  PREDICTED: uncharacterized protein LOC103959692  87.8    3e-16   
ref|XP_007016976.1|  CCT motif family protein isoform 1               86.3    3e-16   
ref|XP_011097346.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  87.0    3e-16   
ref|XP_009371730.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 8   87.4    3e-16   
gb|KHN46121.1|  Protein CHLOROPLAST IMPORT APPARATUS 2                85.5    4e-16   
gb|EYU18216.1|  hypothetical protein MIMGU_mgv1a007342mg              87.8    4e-16   
ref|XP_002873661.1|  hypothetical protein ARALYDRAFT_488277           86.7    5e-16   
ref|XP_002308112.2|  hypothetical protein POPTR_0006s07490g           88.2    5e-16   
ref|XP_009593986.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  87.8    5e-16   
ref|XP_009801175.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  87.8    5e-16   
emb|CDY66177.1|  BnaC08g46470D                                        84.7    5e-16   
gb|EMT29986.1|  hypothetical protein F775_13638                       85.9    5e-16   
gb|KDO45660.1|  hypothetical protein CISIN_1g017778mg                 86.7    6e-16   
ref|XP_001752335.1|  predicted protein                                80.9    6e-16   
ref|XP_010927243.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  87.4    6e-16   
ref|XP_007225066.1|  hypothetical protein PRUPE_ppa018578mg           87.8    6e-16   
ref|XP_004231827.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 16  86.3    6e-16   
ref|XP_009349161.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.5    6e-16   
ref|XP_004296491.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  87.4    7e-16   
gb|KDO67019.1|  hypothetical protein CISIN_1g025320mg                 85.1    7e-16   
ref|XP_001758440.1|  predicted protein                                87.8    7e-16   
ref|XP_010433566.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  87.0    7e-16   
ref|XP_007031686.1|  CCT motif family protein, putative               86.7    7e-16   
ref|XP_008223874.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  87.0    9e-16   
ref|NP_568852.2|  chloroplast import apparatus 2 protein              87.0    9e-16   
ref|XP_009410222.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  87.0    9e-16   
ref|XP_007154713.1|  hypothetical protein PHAVU_003G141200g           86.7    1e-15   
ref|XP_011020038.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  87.0    1e-15   
ref|XP_010099464.1|  Protein CHLOROPLAST IMPORT APPARATUS 2           84.3    1e-15   
dbj|BAK01784.1|  predicted protein                                    85.1    1e-15   
ref|XP_009110963.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  83.6    1e-15   
ref|XP_006401232.1|  hypothetical protein EUTSA_v10013517mg           86.7    1e-15   
ref|NP_563778.1|  CCT motif family protein                            83.2    2e-15   
gb|KJB33887.1|  hypothetical protein B456_006G036400                  85.5    2e-15   
emb|CDY38274.1|  BnaA10g11220D                                        86.3    2e-15   
ref|XP_002892377.1|  predicted protein                                83.2    2e-15   
ref|XP_009120241.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  86.3    2e-15   
gb|KFK27272.1|  hypothetical protein AALP_AA8G360600                  86.3    2e-15   
ref|XP_010451861.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  86.3    2e-15   
ref|XP_006338638.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  84.3    3e-15   
ref|XP_006280489.1|  hypothetical protein CARUB_v10026429mg           85.9    3e-15   
gb|KJB33888.1|  hypothetical protein B456_006G036400                  84.7    3e-15   
ref|XP_009359939.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.5    3e-15   
ref|XP_009403041.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.5    3e-15   
ref|XP_010483220.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.5    3e-15   
ref|XP_010448341.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.1    4e-15   
ref|XP_008388630.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.5    4e-15   
ref|XP_010690870.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.5    4e-15   
ref|XP_002451540.1|  hypothetical protein SORBIDRAFT_04g003470        85.5    4e-15   
ref|XP_001751672.1|  predicted protein                                85.5    4e-15   
ref|XP_010443395.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  85.1    5e-15   
gb|EMT06010.1|  hypothetical protein F775_08552                       84.3    5e-15   
ref|XP_011094103.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  84.7    5e-15   
ref|XP_008811451.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  84.7    6e-15   
dbj|BAJ85986.1|  predicted protein                                    82.8    6e-15   
ref|XP_002520096.1|  hypothetical protein RCOM_1709850                78.2    7e-15   
ref|NP_567737.1|  CIA2-like transcription factor                      84.3    7e-15   
ref|XP_006596439.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  82.4    7e-15   
emb|CDP15779.1|  unnamed protein product                              84.3    8e-15   
ref|XP_006646882.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  84.3    9e-15   
dbj|BAJ92256.1|  predicted protein                                    84.3    9e-15   
ref|XP_002867585.1|  hypothetical protein ARALYDRAFT_354188           84.0    9e-15   
emb|CDY10244.1|  BnaC05g04870D                                        80.9    1e-14   
emb|CDY42238.1|  BnaC02g11770D                                        83.6    1e-14   
gb|ABF00989.1|  putative stress resistance-related protein            84.0    1e-14   
ref|XP_001769056.1|  predicted protein                                77.4    1e-14   
ref|XP_002864503.1|  hypothetical protein ARALYDRAFT_495815           83.6    1e-14   
ref|XP_004499509.1|  PREDICTED: uncharacterized protein LOC101500...  82.4    1e-14   
emb|CDY47926.1|  BnaA02g08300D                                        83.6    1e-14   
ref|XP_010438814.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  83.2    2e-14   
gb|EYU34766.1|  hypothetical protein MIMGU_mgv1a008504mg              82.8    2e-14   
ref|XP_006453248.1|  hypothetical protein CICLE_v10008308mg           83.2    2e-14   
ref|XP_004304686.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 8   82.8    2e-14   
ref|XP_006453244.1|  hypothetical protein CICLE_v10008308mg           83.6    2e-14   
ref|XP_002993117.1|  hypothetical protein SELMODRAFT_136568           77.4    2e-14   
gb|KDO61917.1|  hypothetical protein CISIN_1g0135002mg                83.2    2e-14   
gb|KHG21982.1|  Zinc finger CONSTANS-LIKE 7 -like protein             82.4    2e-14   
gb|KDO61918.1|  hypothetical protein CISIN_1g0135002mg                83.2    2e-14   
ref|XP_002964550.1|  hypothetical protein SELMODRAFT_38981            77.0    2e-14   
ref|XP_003549301.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  82.8    2e-14   
ref|XP_008677196.1|  PREDICTED: LOC100281423 isoform X1               83.2    2e-14   
ref|NP_001147813.1|  LOC100281423                                     83.2    2e-14   
ref|XP_010524282.1|  PREDICTED: uncharacterized protein LOC104802388  82.4    2e-14   
ref|XP_001754240.1|  predicted protein                                76.6    3e-14   
ref|XP_010487055.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  79.7    3e-14   
ref|XP_002962768.1|  hypothetical protein SELMODRAFT_141010           81.3    3e-14   
emb|CDY06672.1|  BnaA10g04510D                                        79.7    3e-14   
ref|XP_006283882.1|  hypothetical protein CARUB_v10004999mg           82.4    3e-14   
ref|XP_009119001.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  79.7    3e-14   
ref|XP_007140857.1|  hypothetical protein PHAVU_008G147400g           81.3    4e-14   
ref|XP_009410221.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  82.0    4e-14   
ref|NP_001169082.1|  uncharacterized protein LOC100382924             82.4    4e-14   
ref|XP_011467357.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  82.4    4e-14   
ref|XP_007142159.1|  hypothetical protein PHAVU_008G257300g           79.3    4e-14   
ref|XP_006850881.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  82.0    5e-14   
ref|XP_009126853.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  81.6    6e-14   
ref|XP_010236261.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  81.6    7e-14   
ref|XP_004142772.2|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   80.5    8e-14   
ref|NP_001031160.1|  zinc finger protein CONSTANS-LIKE 8              80.1    8e-14   
gb|AAF69700.1|AC016041_5  F27J15.10                                   80.1    9e-14   
ref|XP_008645243.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  81.6    9e-14   
ref|XP_008458850.1|  PREDICTED: zinc finger protein CONSTANS-LIKE 6   80.1    9e-14   
ref|NP_175339.2|  zinc finger protein CONSTANS-LIKE 8                 80.1    9e-14   
ref|XP_007014424.1|  Chloroplast import apparatus 2, putative iso...  80.9    1e-13   
ref|XP_004490652.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  79.0    2e-13   
ref|XP_002526951.1|  hypothetical protein RCOM_0531220                78.2    2e-13   
emb|CDY36106.1|  BnaA08g19420D                                        79.7    3e-13   
ref|XP_008811450.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  79.7    3e-13   
ref|XP_010323337.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  79.7    3e-13   
emb|CDX94392.1|  BnaC01g17920D                                        79.3    4e-13   
ref|XP_008363941.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  79.3    4e-13   
gb|KJB56255.1|  hypothetical protein B456_009G113000                  76.6    4e-13   
ref|XP_006362451.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  79.3    4e-13   
gb|EYU38741.1|  hypothetical protein MIMGU_mgv1a008071mg              79.0    5e-13   
emb|CAB87776.1|  putative protein                                     78.6    5e-13   
emb|CDX89377.1|  BnaA01g15160D                                        78.6    6e-13   
ref|XP_006413244.1|  hypothetical protein EUTSA_v10025322mg           79.0    6e-13   
ref|XP_003622266.1|  CONSTANS-like zinc finger protein                78.2    6e-13   
ref|XP_004149511.2|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  79.0    6e-13   
ref|XP_006305953.1|  hypothetical protein CARUB_v10011200mg           75.5    8e-13   
ref|XP_008451210.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  78.6    8e-13   
ref|XP_010029065.1|  PREDICTED: uncharacterized protein LOC104419187  77.8    1e-12   
ref|XP_011098790.1|  PREDICTED: uncharacterized protein LOC105177...  76.6    1e-12   
ref|XP_003553886.1|  PREDICTED: uncharacterized protein LOC100811815  77.0    1e-12   
emb|CDP16632.1|  unnamed protein product                              77.4    2e-12   
ref|XP_007154712.1|  hypothetical protein PHAVU_003G141200g           77.0    2e-12   
ref|XP_002518229.1|  CIL, putative                                    77.0    2e-12   
ref|XP_011462373.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  76.6    4e-12   
ref|XP_009139739.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  76.3    4e-12   
ref|XP_011020039.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  76.3    5e-12   
ref|NP_851201.1|  chloroplast import apparatus 2 protein              75.9    6e-12   
ref|XP_006599067.1|  PREDICTED: DNA topoisomerase 1-like isoform X2   74.7    1e-11   
ref|XP_003547688.2|  PREDICTED: DNA topoisomerase 1-like isoform X1   74.3    1e-11   
gb|KJB53720.1|  hypothetical protein B456_009G002400                  74.3    2e-11   
ref|XP_009120242.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  74.3    2e-11   
gb|KGN65847.1|  hypothetical protein Csa_1G533540                     71.2    2e-11   
ref|XP_011097348.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  73.6    2e-11   
ref|XP_006401233.1|  hypothetical protein EUTSA_v10013517mg           74.3    2e-11   
ref|XP_001776067.1|  predicted protein                                68.6    2e-11   
ref|NP_849445.1|  CIA2-like transcription factor                      73.6    3e-11   
emb|CAB39664.1|  putative protein                                     73.2    4e-11   
gb|KHG01643.1|  chloroplast import apparatus 2 -like protein          72.8    6e-11   
gb|KDO45661.1|  hypothetical protein CISIN_1g017778mg                 72.4    7e-11   
ref|XP_004499508.1|  PREDICTED: uncharacterized protein LOC101500...  71.6    1e-10   
ref|XP_009137564.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  72.0    1e-10   
gb|KJB34353.1|  hypothetical protein B456_006G061600                  71.2    2e-10   
emb|CDY42769.1|  BnaA03g47700D                                        69.7    2e-10   
ref|XP_008804437.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  71.2    2e-10   
ref|XP_011625727.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  71.6    2e-10   
ref|XP_011467358.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  71.2    2e-10   
emb|CDX92740.1|  BnaC07g39980D                                        70.5    3e-10   
ref|XP_006379128.1|  hypothetical protein POPTR_0009s08080g           67.4    3e-10   
ref|XP_010111661.1|  Protein CHLOROPLAST IMPORT APPARATUS 2           70.1    4e-10   
gb|EMT12233.1|  hypothetical protein F775_25319                       67.0    4e-10   
gb|ABG57263.1|  CONSTANS-like 1                                       68.9    7e-10   
ref|XP_003560384.1|  PREDICTED: zinc finger protein CONSTANS-LIKE...  68.9    1e-09   
gb|AFV78277.1|  constans-like 1                                       68.9    1e-09   
ref|XP_010048577.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  68.6    1e-09   
gb|EPS64862.1|  hypothetical protein M569_09916                       64.3    2e-09   
emb|CAK26119.1|  constans-like 1                                      68.6    2e-09   
ref|XP_009126854.1|  PREDICTED: protein CHLOROPLAST IMPORT APPARA...  68.2    2e-09   
gb|AFK31575.1|  Hd1                                                   68.6    2e-09   
gb|KHM99279.1|  Protein CHLOROPLAST IMPORT APPARATUS 2                65.9    2e-09   
gb|AFV79556.1|  constans-like 1                                       68.6    2e-09   
emb|CAK26151.1|  constans-like 1                                      68.6    2e-09   
emb|CAK26110.1|  constans-like 1                                      68.6    2e-09   
emb|CAK26109.1|  constans-like 1                                      68.6    2e-09   
emb|CAK26106.1|  constans-like 1                                      68.2    2e-09   
emb|CAK26129.1|  constans-like 1                                      68.2    2e-09   
gb|AAD22518.1|AF001136_1  zinc finger protein                         68.6    2e-09   
emb|CAK26107.1|  constans-like 1                                      68.2    2e-09   
emb|CAK26112.1|  constans-like 1                                      68.2    2e-09   
emb|CAK26149.1|  constans-like 1                                      68.2    2e-09   
dbj|BAD36814.1|  zinc finger protein-like                             64.7    2e-09   
emb|CAK26108.1|  constans-like 1                                      68.2    2e-09   
emb|CAK26123.1|  constans-like 1                                      68.2    2e-09   
gb|AAX47173.1|  CONSTANS-LIKE b                                       67.8    2e-09   
emb|CAK26141.1|  constans-like 1                                      68.2    2e-09   
gb|EEC84137.1|  hypothetical protein OsI_30489                        64.7    2e-09   
emb|CAK26147.1|  constans-like 1                                      68.2    2e-09   
gb|AAX20015.1|  CONSTANS-like b                                       67.8    2e-09   
gb|ACF81408.1|  unknown                                               65.1    2e-09   
gb|ACF79190.1|  unknown                                               64.3    2e-09   



>ref|XP_009603861.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
tomentosiformis]
Length=420

 Score =   194 bits (492),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 118/238 (50%), Positives = 146/238 (61%), Gaps = 39/238 (16%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDD--DVGEDKATA-----------AVKIEINGGD---------  851
            S++ELAEFAADVE+LLG++   V E++  +           A+KIE+   +         
Sbjct  190  SEIELAEFAADVESLLGEEFRVVAEEEEQSRLINGSVEDNKAIKIEVEDEEMRAVVACHL  249

Query  850  ------CTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRMLLSLN  689
                    EALNW F  E+ VEQKV MT  + F        +     +   K R+LL LN
Sbjct  250  DPELDMAREALNWDFEYEETVEQKVNMTAATEF-----VPSAECGGSKADAKRRLLLRLN  304

Query  688  YEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG---GDHHHHHPYGSAMMMRRSDEGRE  518
            YE VISAW +Q  PWT+G RPHF+P+ CWPDF+    G+   H PYG   +      GRE
Sbjct  305  YEAVISAWPNQSSPWTNGIRPHFNPDDCWPDFLETCIGEGGVHQPYGGGKVRGGD-GGRE  363

Query  517  ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  344
             RVSRYREKRRTRLFSKKIRY+VRKLNAEKRPRLKGRFVKR++ F  PP FP YL+N+
Sbjct  364  ERVSRYREKRRTRLFSKKIRYQVRKLNAEKRPRLKGRFVKRTTSFS-PPGFP-YLMNK  419



>ref|XP_009798338.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Nicotiana 
sylvestris]
Length=417

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 122/245 (50%), Positives = 144/245 (59%), Gaps = 52/245 (21%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDD-----------------DVGEDKATAAVKIEINGGD-----  851
            S++ELAEFAADVE+LLG++                  V ED    A+KIE+   +     
Sbjct  186  SEIELAEFAADVESLLGEEFRVVAEEEDEEQSRLISGVVED--NKAIKIEVEDEEMRAVV  243

Query  850  ----------CTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRML  701
                        EALNW F  E+ VEQKV M   + F        +     +   K RML
Sbjct  244  ACHLDPELDMAREALNWDFEYEETVEQKVNMAAATEF-----VPSAECGGSKADAKRRML  298

Query  700  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFM------GGDHHHHHPYGSAMMMR  539
            L LNYEEVISAW +Q  PWT+G RPHF+P+ CWPDF+      GG    H PYG   +  
Sbjct  299  LRLNYEEVISAWPNQSSPWTNGIRPHFNPDDCWPDFLETCIGEGG----HQPYGGGNVRG  354

Query  538  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPN  359
                GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR++ F   P FP 
Sbjct  355  GD-GGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRTTSFS-APGFP-  411

Query  358  YLLNR  344
            YL+N+
Sbjct  412  YLMNK  416



>ref|XP_004235805.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
lycopersicum]
Length=408

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 116/238 (49%), Positives = 148/238 (62%), Gaps = 43/238 (18%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKATA----------AVKIEINGGD------C-----  848
            SD+ELAEFAADVETLLG +   E+++T           A+KIE+   +      C     
Sbjct  182  SDIELAEFAADVETLLGGE---EEQSTQLLNADFENNKAIKIEVEDEEMRAVVACHLDPE  238

Query  847  ----TEALNWSFGE--EQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRMLLSLNY  686
                 EALNW+F E  E+ VEQKVM    +  +  +S+ E      +  +K+R+ LSLN+
Sbjct  239  LDMEREALNWNFDEYYEETVEQKVMAADAAVTEFIASAEEYSGSSTKSDEKNRLFLSLNH  298

Query  685  EEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG----GDHHHHHPYGSAMMMRRSDEGRE  518
            E VISAW +Q  PWT+G RPHF+P+  WPDF      G++  H        +R  D GRE
Sbjct  299  EAVISAWPNQSSPWTNGIRPHFNPDDYWPDFFSETSVGNYGGH--------VRCGDGGRE  350

Query  517  ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  344
            ARVSRYREKR+ RLFSKKIRYEVRKLNAEKRPRLKGRF+KRSS     P F +Y++N+
Sbjct  351  ARVSRYREKRQNRLFSKKIRYEVRKLNAEKRPRLKGRFIKRSSSLFSVPGF-SYMMNK  407



>ref|XP_006341612.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
tuberosum]
Length=402

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 116/235 (49%), Positives = 143/235 (61%), Gaps = 38/235 (16%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKA-------TAAVKIEINGGD------C--------  848
            SD+ELAEFAADVETLLG ++    +          A+KIE+   +      C        
Sbjct  177  SDIELAEFAADVETLLGGEEEQSTRLLNADFEDNKAIKIEVEDEEMRAVVACHLDPELDM  236

Query  847  -TEALNWSFGE--EQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRMLLSLNYEEV  677
              E LNW+F E  E+ VEQKVM  +        +S E      +  +K+R+ L LN+E V
Sbjct  237  EREGLNWNFDEYYEERVEQKVMAAVTE----FVASAEYSGSSTKSDEKNRLFLRLNHEAV  292

Query  676  ISAWASQGCPWTDGTRPHFDPNHCWPDF---MGGDHHHHHPYGSAMMMRRSDEGREARVS  506
            ISAW +Q  PWT+G RPHF+P+  WPDF    GG+  +   YG    +R  D GREARV 
Sbjct  293  ISAWPNQSSPWTNGIRPHFNPDDYWPDFSETCGGNLGY---YGG--HVRSGDGGREARVL  347

Query  505  RYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR-SSLFQPPPPFPNYLLNR  344
            RYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF+KR SS     P FP Y++N+
Sbjct  348  RYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFIKRNSSSSFSVPGFP-YMMNK  401



>ref|XP_007044348.1| B-box type zinc finger protein with CCT domain, putative [Theobroma 
cacao]
 gb|EOY00180.1| B-box type zinc finger protein with CCT domain, putative [Theobroma 
cacao]
Length=440

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 116/251 (46%), Positives = 142/251 (57%), Gaps = 59/251 (24%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGD---------DDVG---------EDKATAAVKIEINGGDCTEA  839
            S+++LAEFAADVE+LLG          +D+G          D +    K++I   +  EA
Sbjct  199  SEMDLAEFAADVESLLGKGLENESFGMEDLGLKDSKEKYFRDCSLGNGKVKIEDEESFEA  258

Query  838  ------------------LNWSF------GEEQE-VEQKVMMTMLSGFDessssmesgsc  734
                              LN+S       GEE E V+++V +     ++E ++       
Sbjct  259  VGACHVDSEIDMAREPFKLNFSCDSPGNCGEEDELVKEEVTVKSYEEYEEDTAKK-----  313

Query  733  keEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-GDHHHHHPYG  557
                 KK ++LLSLNYE VI+AWASQG PWT G RP FDP+ CWPD MG G    HH Y 
Sbjct  314  -----KKRKILLSLNYESVITAWASQGSPWTSGGRPDFDPDECWPDCMGTGGTEVHHTYS  368

Query  556  SAMMM----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
              + M       D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S
Sbjct  369  DLIGMGAHQALGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAS  428

Query  388  LFQPPP-PFPN  359
                P  PF N
Sbjct  429  FLAGPAFPFVN  439



>emb|CDO98435.1| unnamed protein product [Coffea canephora]
Length=431

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 111/244 (45%), Positives = 131/244 (54%), Gaps = 55/244 (23%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG-------------------------------------DDDVGE  896
            SD ELAEFAADVE+LLG                                     D+D  E
Sbjct  195  SDAELAEFAADVESLLGTGLDEDSCHMEDPGMMVCKEEDDVVDVSFEDKLVKVEDEDDQE  254

Query  895  DKATAAVKIEINGGDCTEALNWSFGE-----EQEVEQKVMMTMLSGFDessssmesgsck  731
             +A  A  ++       E+LNW F       E+E E KV   M                K
Sbjct  255  VQAVIACHLDPALDMARESLNWDFDSSSPVIEEEEELKVTKDM-----------PDKDIK  303

Query  730  eEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHH-HHPYGS  554
             +  ++  M L LNYEEVI+AWASQG PW DGT+P F+   CWPDFMG   +  HHP G+
Sbjct  304  SKEEERRMMHLKLNYEEVITAWASQGSPWADGTKPEFNLGDCWPDFMGMSLNELHHPNGA  363

Query  553  AM-MMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  377
                +   DE REARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S   P
Sbjct  364  GGGRVSSHDEEREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSFAGP  423

Query  376  PPPF  365
              P+
Sbjct  424  SFPY  427



>ref|XP_002282578.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Vitis vinifera]
 emb|CBI27020.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 112/249 (45%), Positives = 140/249 (56%), Gaps = 52/249 (21%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDD--------------DVGEDKA------TAAVKIE----ING  857
            SD++LAEFAADVE+LLG                D  E ++      +  VK+E    I G
Sbjct  194  SDMDLAEFAADVESLLGKGLDNESFGMEGLGLIDCKEKESVEYSLHSGRVKLEEEEDIGG  253

Query  856  GDCTEA------------LNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKK  713
                +A            LN+ +G     E++     +   D ++   +         KK
Sbjct  254  VMACQADAEIDMTREPFELNFDYGSPATCEEEEEKVAVGAMDMNNKVDDPK-------KK  306

Query  712  SRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG-DHHHHHPYGSAMMMRR  536
            +++LL L+YE +I+AWASQG PWT+G RP  DP+ CWPD +G      HHPYG    M  
Sbjct  307  NKILLRLDYEAIITAWASQGSPWTNGHRPELDPDDCWPDCLGTCGIQVHHPYGEFGGMGE  366

Query  535  -----SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPP  371
                  D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S F  P 
Sbjct  367  QQAAMGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAS-FGGPA  425

Query  370  PFPNYLLNR  344
             FP  LLN+
Sbjct  426  AFP--LLNK  432



>gb|KJB16228.1| hypothetical protein B456_002G218400 [Gossypium raimondii]
Length=421

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 112/244 (46%), Positives = 136/244 (56%), Gaps = 48/244 (20%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG-----------------DDDVGE-DKATAAVKIE----INGGD  851
            S+++LAEFAADVE+LLG                   D+ E       VKIE      GG 
Sbjct  189  SEMDLAEFAADVESLLGKGLENESFTMVELGLTGSKDLREYSYGNGQVKIEDEESFEGGM  248

Query  850  CTEALNWSF---------GEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRMLL  698
              E    SF         G ++ V+++V +    G +   ++ +         KK + LL
Sbjct  249  AREPFELSFNYDSPPSCGGVDELVKEEVEVKSKEGGECQENTAKK--------KKRKTLL  300

Query  697  SLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-GDHHHHHPYGSAMMM-----RR  536
            SL+YE VI+AWA+QG PWT G +P  DP+ CWPD MG G       Y   M M       
Sbjct  301  SLDYEAVITAWATQGSPWTSGGKPDLDPDECWPDCMGNGGTEVQQSYSGLMGMGGQQQAM  360

Query  535  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNY  356
             D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S F   P FP  
Sbjct  361  GDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAS-FLTGPAFP--  417

Query  355  LLNR  344
            LLN+
Sbjct  418  LLNK  421



>gb|KHG17662.1| Zinc finger CONSTANS-LIKE 16 -like protein [Gossypium arboreum]
Length=417

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 112/246 (46%), Positives = 132/246 (54%), Gaps = 50/246 (20%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG-------------------DDDVGE-DKATAAVKIE----ING  857
            S+++LAEFAADVE+LLG                   D D+ E       VKIE      G
Sbjct  183  SEMDLAEFAADVESLLGKGLENESFTMVELGLTGSKDKDLREYSYGNGQVKIEDEESFEG  242

Query  856  GDCTEALNWSF---------GEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRM  704
            G   E    SF         G ++ V+++V M         S             KK + 
Sbjct  243  GMGREPFELSFNYDSPPSCGGVDELVKEEVAM--------KSKEDGECQESTAKKKKRKT  294

Query  703  LLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFM-GGDHHHHHPYGSAMMM-----  542
            LLSL+YE VI+AWA+QG PWT G +P  DP+ CWPD M  G       Y   + M     
Sbjct  295  LLSLDYEAVITAWATQGSPWTSGGKPDLDPDECWPDCMRNGGTEVQQSYSGLIGMGGQQQ  354

Query  541  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  362
               D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S F   P FP
Sbjct  355  AMGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAS-FLAGPAFP  413

Query  361  NYLLNR  344
              LLN+
Sbjct  414  --LLNK  417



>ref|XP_010263709.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Nelumbo nucifera]
Length=451

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 111/259 (43%), Positives = 134/259 (52%), Gaps = 69/259 (27%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG----DDDVG-EDKATAAVKIEINGGDC----------------  848
            SD+++AEFAADVETLLG    DD  G ED      K E N   C                
Sbjct  203  SDMDIAEFAADVETLLGRGLDDDSFGMEDLGLLDCKEEENMEHCFRSGRVKVEVEEVEAV  262

Query  847  -------------TEALNWSFGEEQEV----------------EQKVMMTMLSGFDesss  755
                          E+L+ +F  +                      V+  M SG+     
Sbjct  263  VGCQQVEPGLGMTRESLDLNFNSDSPTTAEEEEVEEKAVKEAANSNVVTNMNSGY-----  317

Query  754  smesgsckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH-CWPDFMGG--  584
                    ++++ K  + L LNYE VI AWAS+G PWT G RP F+P+  CWPD MG   
Sbjct  318  ------KGDKMSSKISLRLRLNYEGVICAWASKGSPWTTGERPQFNPDDDCWPDCMGTYP  371

Query  583  -DHHHHHPYGS----AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR  419
             + +HHHPYG        +   + GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR
Sbjct  372  MEVYHHHPYGEMGGVGGHVTMGNGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR  431

Query  418  LKGRFVKRSSLFQPPPPFP  362
            +KGRFVKR+SL     PFP
Sbjct  432  MKGRFVKRTSLMGVAAPFP  450



>ref|XP_006440964.1| hypothetical protein CICLE_v10020440mg [Citrus clementina]
 gb|ESR54204.1| hypothetical protein CICLE_v10020440mg [Citrus clementina]
Length=403

 Score =   164 bits (415),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 106/214 (50%), Positives = 127/214 (59%), Gaps = 21/214 (10%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTE----ALNWSFGEEQEVEQK  797
            SD++LAEFAADVE+LLG      D+ +  VK      DC E    ALN     E EVE+ 
Sbjct  181  SDLDLAEFAADVESLLGGGGGALDEDSCDVKEFGTLLDCKEEETIALNLKIKAE-EVEEA  239

Query  796  VMMTML-----SGFDessssmesgsckeEVAK-KSRML----LSLNYEEVISAWASQGCP  647
            V+           FD  S      +      + K +++    L LNY+ VI+AWASQGCP
Sbjct  240  VIAAATREAIDCNFDYQSPVTGDDTAGLMSTECKPKLMRNVCLKLNYDAVITAWASQGCP  299

Query  646  WTDGTRPHFDPNHCWPDFMG--GDHHHHHPYGSAMMMRR----SDEGREARVSRYREKRR  485
            WT G+RP  + NHCWP   G      HHH  G   ++R     +  GREARVSRYREKRR
Sbjct  300  WTAGSRPEINLNHCWPHCTGLCCKDVHHHTCGGGAVLRGCHLGAGGGREARVSRYREKRR  359

Query  484  TRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  383
            TRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S  
Sbjct  360  TRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSFM  393



>ref|XP_006448477.1| hypothetical protein CICLE_v10015173mg [Citrus clementina]
 gb|ESR61717.1| hypothetical protein CICLE_v10015173mg [Citrus clementina]
Length=461

 Score =   165 bits (417),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 91/124 (73%), Gaps = 9/124 (7%)
 Frame = -1

Query  706  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-----GDHHHHHPYGSAMMM  542
            +LLSL+YE VI +WASQG PWT+G RP+FDP  CWPD MG     G  +  HPYG    +
Sbjct  332  ILLSLDYESVIKSWASQGSPWTNGDRPNFDPEECWPDCMGTCGTEGHKYLQHPYGDFSGI  391

Query  541  ----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  374
                   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S    P
Sbjct  392  GAHPATVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFAGGP  451

Query  373  PPFP  362
            P FP
Sbjct  452  PAFP  455



>ref|XP_006468698.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Citrus 
sinensis]
 gb|KDO76999.1| hypothetical protein CISIN_1g012558mg [Citrus sinensis]
Length=461

 Score =   165 bits (417),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 91/124 (73%), Gaps = 9/124 (7%)
 Frame = -1

Query  706  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-----GDHHHHHPYGSAMMM  542
            +LLSL+YE VI+ WASQG PWT G RP+FDP+ CWPD MG     G  +  HPYG    +
Sbjct  332  ILLSLDYEAVINTWASQGSPWTTGDRPNFDPDECWPDCMGTCGTEGHKYLQHPYGDFSGI  391

Query  541  ----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  374
                   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S    P
Sbjct  392  GAHPATVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFAGGP  451

Query  373  PPFP  362
            P FP
Sbjct  452  PAFP  455



>ref|XP_002533412.1| transcription factor, putative [Ricinus communis]
 gb|EEF28970.1| transcription factor, putative [Ricinus communis]
Length=430

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 110/243 (45%), Positives = 132/243 (54%), Gaps = 52/243 (21%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG-------------------DDDV-----GEDKATAAVKIEING  857
            SD++LAEFAADVE LLG                   +DD       +DK    VK E   
Sbjct  198  SDMDLAEFAADVENLLGVNEDSPDIEDLCLLHCKEEEDDQKCFFDDQDKVVMKVKDEQEV  257

Query  856  GDCT--------EALNWSFGEEQ------EVEQKVMMTMLSGFDessssmesgsckeEVA  719
              C         E+L+WSF  E       EVE+K  + +              S +++  
Sbjct  258  EACDHFDQAFERESLDWSFNYESPTITADEVEEKKRVPV-----------AINSQQKKET  306

Query  718  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG--DHHHHHPYGSAMM  545
            K +  LL LNYE+VI+AWASQG PWT G+RP  + + CWPD M       HHHPYG    
Sbjct  307  KSTASLLRLNYEDVINAWASQGSPWTSGSRPELNSDDCWPDCMDICLKDGHHHPYGGMGG  366

Query  544  MRRSDEG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPP  368
              R   G REARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S      P
Sbjct  367  HTRGGNGAREARVLRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSFMGNGFP  426

Query  367  FPN  359
            + N
Sbjct  427  YMN  429



>ref|XP_009627333.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
tomentosiformis]
Length=446

 Score =   163 bits (413),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 109/252 (43%), Positives = 136/252 (54%), Gaps = 67/252 (27%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG--------------------------------------DDDVG  899
            S++ELAEFAADVE+LLG                                      +D+V 
Sbjct  213  SEMELAEFAADVESLLGKGLEDESFDMEGLGLLGGCNKEENSMECSMVSNEKVKIEDEVV  272

Query  898  EDKATAAVKIEINGGDCTEALNW----SFGEEQEVEQKVMMTMLSGFDessssmesgsck  731
             D  T +  I+ING      +++    +   E EV + VM   ++G D            
Sbjct  273  MDTTTTSHDIDINGDTFEFKIDYDSPININGEDEVGEVVMK--INGEDGVVGDGNYN---  327

Query  730  eEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYG--  557
                +K ++LL+L+YE V++AWA Q  PWT+G RP  D N CWPD MG +    HPYG  
Sbjct  328  ----EKKKILLNLDYESVLTAWADQRSPWTNGERPELDSNDCWPDCMG-NCGTIHPYGIM  382

Query  556  ---SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
               + M+    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRS+L
Sbjct  383  NGHTTMI----DRGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSNL  438

Query  385  FQPPPPFPNYLL  350
                   PNY L
Sbjct  439  ------VPNYPL  444



>ref|XP_011022115.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Populus euphratica]
Length=440

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 92/120 (77%), Gaps = 14/120 (12%)
 Frame = -1

Query  715  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-GDHHHHHPYG------  557
            K ++LLSL+YE V++AWASQG PWT+G RP FDP+ CWPD MG      HHPYG      
Sbjct  322  KRKILLSLDYEAVMTAWASQGSPWTNGNRPDFDPDECWPDCMGICGAQLHHPYGDMISGL  381

Query  556  ---SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
                AMM    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++L
Sbjct  382  GAHPAMM----DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTTL  437



>gb|AFX73409.1| constans-like protein 5 [Gossypium hirsutum]
Length=423

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 111/246 (45%), Positives = 132/246 (54%), Gaps = 50/246 (20%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG-------------------DDDVGE-DKATAAVKIE----ING  857
            S+++LAEFAADVE+LLG                   D D+ E       VKIE       
Sbjct  189  SEMDLAEFAADVESLLGKGLENESFTMVELGLTGSKDKDLREYSYGNGQVKIEDEESFED  248

Query  856  GDCTEALNWSF---------GEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRM  704
            G   E   +SF         G ++ V+++V M         S             KK + 
Sbjct  249  GMGREPFEFSFNYDSPPSCGGVDELVKEEVAM--------KSKEDGECQENTAKKKKRKT  300

Query  703  LLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFM-GGDHHHHHPYGSAMMM-----  542
            LLSL+YE VI+AWA+QG PWT G +P  DP+ CWPD M  G       Y   + M     
Sbjct  301  LLSLDYEAVITAWATQGSPWTSGGKPDLDPDECWPDCMRNGGTEVQQSYSGLIGMGGQQQ  360

Query  541  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  362
               D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S F   P FP
Sbjct  361  AMGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAS-FLAGPAFP  419

Query  361  NYLLNR  344
              LLN+
Sbjct  420  --LLNK  423



>ref|XP_010265147.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nelumbo 
nucifera]
Length=439

 Score =   162 bits (410),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 107/241 (44%), Positives = 133/241 (55%), Gaps = 49/241 (20%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG----DDDVG-----------EDKATAA----------------  878
            SD++L EFAADVETLLG    +D  G           E+K                    
Sbjct  198  SDMDLVEFAADVETLLGKGLDEDSFGMEGLGLLDCKDEEKTDCCFGSGRVKVEEEEVEAA  257

Query  877  ------VKIEINGGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAK  716
                  V++E +    T  LN+ +      E +V   M++G   +      G   EE  +
Sbjct  258  VECHVEVELEHDMARETLDLNFDYDSPTTAEDEVEEKMVTG--ATMMVTNGGCKAEETTR  315

Query  715  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG----DHHHHHPYGS--  554
            K+   L L+YE +ISAWA++G PWT G RP F+P+ CWPD MG     + HH+HPYG   
Sbjct  316  KTS--LKLDYEAIISAWANKGLPWTTGDRPLFNPDDCWPDCMGTCPMTEVHHYHPYGEMG  373

Query  553  --AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ  380
                 +   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S   
Sbjct  374  GVGGHVTAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASCTG  433

Query  379  P  377
            P
Sbjct  434  P  434



>ref|XP_002311458.2| zinc finger family protein [Populus trichocarpa]
 gb|ABK95116.1| unknown [Populus trichocarpa]
 gb|EEE88825.2| zinc finger family protein [Populus trichocarpa]
Length=444

 Score =   162 bits (410),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 91/116 (78%), Gaps = 6/116 (5%)
 Frame = -1

Query  715  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-GDHHHHHPYGSAMMMR  539
            K ++LLSL+YE V++AWASQG PWT+G RP FDP+ CWPD MG      HHPYG  +   
Sbjct  326  KRKILLSLDYEAVMTAWASQGSPWTNGNRPDFDPDECWPDCMGICGAQLHHPYGDMISGL  385

Query  538  RS-----DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
             +     D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++L
Sbjct  386  GAHPAMVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTTL  441



>ref|XP_009397482.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Musa acuminata 
subsp. malaccensis]
Length=406

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 121/213 (57%), Gaps = 27/213 (13%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG---------------DDDVGEDKATAAVKIEINGGDCTEALNW  830
            SD++LAEFA+D+E LLG                D   ED     VK+E     C      
Sbjct  193  SDLDLAEFASDMEALLGRGLDDHSFCIDGLGLADATLEDDGMEHVKVEDGDAAC------  246

Query  829  SFGEEQEVEQKVM-MTMLSGFDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQG  653
             FG E  + +  M +   S     +  ++      E A K R +L L+YE VI+AW+S G
Sbjct  247  GFGVEIALSKDTMDLDFDSRTATMAVQVKDQKPSPEAATKRRPILRLDYEAVIAAWSSNG  306

Query  652  C-PWTDGTRPHFDPNHCWPDFM----GGDHHHHHPYGSAMMMRRSDEGREARVSRYREKR  488
            C PWTDG RP FDP+  W DF+    GG       Y  A  M   D GREARVSRYREKR
Sbjct  307  CSPWTDGERPQFDPSDAWADFLVAEAGGGGEVQGMYQQAGHMAAVDGGREARVSRYREKR  366

Query  487  RTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            RTRLFSKKIRYEVRKLNAEKRPR+KGRFVK+++
Sbjct  367  RTRLFSKKIRYEVRKLNAEKRPRMKGRFVKQAA  399



>gb|KHN05568.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=242

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 103/242 (43%), Positives = 130/242 (54%), Gaps = 44/242 (18%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG----DDDVG--------------------------EDKATAAV  875
            SD ELAEFAADVE+LLG    ++ VG                          E+     +
Sbjct  10   SDAELAEFAADVESLLGRGLENECVGMEELGLVDAKEEECSVGSGKVKMEDQEESPLVEM  69

Query  874  KIEINGGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRMLLS  695
            ++++  G   ++   SF  E   E KV    L                ++  K+ ++ L 
Sbjct  70   EMDMVVGRDDQSFELSFDYETCEEVKVCDLGLGN-----ELGAKKENDDDEVKRKKVSLQ  124

Query  694  LNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG-DHHHHHPYGS----AMMMRRSD  530
            L+YE +I AWASQ  PWT   +P+ DP+ CW   MG  +  +HHP G      +     D
Sbjct  125  LDYEAIIIAWASQKSPWTTADKPNLDPDECWKQCMGSCETAYHHPCGEMGGFGIHPVIID  184

Query  529  EGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLL  350
             GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S    PP FP  LL
Sbjct  185  GGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF--APPTFP--LL  240

Query  349  NR  344
            N+
Sbjct  241  NK  242



>ref|XP_010031966.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Eucalyptus 
grandis]
 gb|KCW83853.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
 gb|KCW83854.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
 gb|KCW83855.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
 gb|KCW83856.1| hypothetical protein EUGRSUZ_B00721 [Eucalyptus grandis]
Length=461

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 111/263 (42%), Positives = 138/263 (52%), Gaps = 78/263 (30%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVG---EDKAT------------------------------  884
            SD++LAEFAADVE LL +D+ G   ED A                               
Sbjct  208  SDMDLAEFAADVENLLSNDNEGGTEEDFACDVKDLGVLLECKEEGHHEEGVIGVCFDRRD  267

Query  883  -AAVKIE--INGG--DC-----------TEALNWSFG------------EEQEVEQKVMM  788
               VK+E  + GG  DC            + ++W F             EE+E E+  M 
Sbjct  268  QGVVKVEGLVGGGALDCHMEIGFDATGAGDDVDWDFDFYNDDHVQSLGIEEKEDEENKMR  327

Query  787  TMLSGFDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH  608
            T++SG             +  + KK +MLL LNYE V++AWASQG PWT G RP F+ + 
Sbjct  328  TVVSG---------DAEEQATMKKKRKMLLRLNYEGVMAAWASQGSPWTTGDRPDFELDE  378

Query  607  CWPDF-MGGDHH---HHHPYGSAMMMRR----SDEGREARVSRYREKRRTRLFSKKIRYE  452
             WP+  MG   H   +H P+  AM +R      D GREARVSRYREKRRTR+FSKKIRY+
Sbjct  379  GWPNSNMGTASHSLKYHLPFAEAMGLRAHVGAEDGGREARVSRYREKRRTRMFSKKIRYQ  438

Query  451  VRKLNAEKRPRLKGRFVKRSSLF  383
            VRKLNAEKRPR+KGRFVKR S  
Sbjct  439  VRKLNAEKRPRMKGRFVKRMSFI  461



>ref|XP_002276181.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Vitis vinifera]
Length=410

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 131/233 (56%), Gaps = 34/233 (15%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEA-LNWSFGE------EQEV  806
            S+++LAEFAADVE+ LG    G D+ +  +K  I   DC +  ++  FG+      E+ V
Sbjct  183  SEMDLAEFAADVESYLG---AGLDEDSCGIK-GIGVLDCEQGDMDACFGDQKVKVKEERV  238

Query  805  EQKVMMTMLSGFDessssme---------------sgsckeEVAKKSRMLLSLNYEEVIS  671
            E      +    D +   +                       V  + ++ LSLNYE+VI+
Sbjct  239  ETDATFHLDPELDMTKELLAWNLDYESTVMDEEEHEEKMVAAVEMRRKISLSLNYEDVIT  298

Query  670  AWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHH-----PYGSAMMMRRSDEGREARVS  506
            AWASQG PWT G RP FDPN  WPD+MG    + H       G        D GREARV 
Sbjct  299  AWASQGSPWTTGNRPEFDPNDYWPDYMGACPTNVHGPCGDVGGVGGNFGGRDGGREARVL  358

Query  505  RYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLN  347
            RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S F   P FP  +LN
Sbjct  359  RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAS-FAAGPCFP--ILN  408



>ref|XP_008775153.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Phoenix dactylifera]
Length=420

 Score =   157 bits (396),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 106/253 (42%), Positives = 133/253 (53%), Gaps = 68/253 (27%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG---DDDV-------------GEDKATAAVKIEINGGD------  851
            SD++LAEFAADVE+LLG   DDD              G+DK    +++++  G       
Sbjct  183  SDLDLAEFAADVESLLGRGLDDDKFCIDALGLMDPAEGDDKGRVKLELDVGAGGERSDIV  242

Query  850  -CT---------EALNWSFG----------EEQEVEQKVMMTMLSGFDessssmesgsck  731
             C          E L+  FG          E+Q+  ++  M    G              
Sbjct  243  ACDIDMEIDLSRETLDLDFGCGSPAAVEELEDQKAAEEAAMASGGGC-----------VT  291

Query  730  eEVAKKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGGDHHHHH----  566
            E VA   RM L L+YE VI+AW+ +GC PWTDG RP F+P+ CWPDF G           
Sbjct  292  EAVAAGRRMTLRLDYEAVIAAWSCKGCSPWTDGERPQFNPDDCWPDFAGMMWGGAGGGGG  351

Query  565  -----PYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFV  401
                 P    + M   + GREA+V+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFV
Sbjct  352  GGEVAPVYGEVGMVAGNGGREAKVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFV  411

Query  400  KRSSLFQPPPPFP  362
            KR++      PFP
Sbjct  412  KRAAA-----PFP  419



>ref|XP_009347093.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=441

 Score =   157 bits (396),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 103/224 (46%), Positives = 124/224 (55%), Gaps = 36/224 (16%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG---DDDVGEDKATAAV--------------KIEINGGDCTEAL  836
            SD+ELAEFAADVE LLG   D+D  + K    +               IE N       L
Sbjct  197  SDMELAEFAADVENLLGGGLDEDCSDIKGILGLLDEGKEVKVEEEVEGIEFN----PSIL  252

Query  835  NWSFGEEQEVEQKVMM-----------TMLSGFDessssmesgsckeEVAKKSRMLLSLN  689
            +W+   EQ     V+M            +L    +SS  +     K+ V K+  + L L+
Sbjct  253  DWNLYYEQSSAVPVLMGSEEDKEEEEKVVLFMGAQSSDEIGFMENKQIVMKRKNICLKLD  312

Query  688  YEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG----GDHHHHHPYGSAMMMRRSDEGR  521
            YE VI+AWASQG PWT GTRP  +P+  W D MG      H  H      +  R  D  R
Sbjct  313  YEAVITAWASQGSPWTTGTRPELNPDEGWLDCMGMWPTEIHQAHGDSAGCVSGRGDDPRR  372

Query  520  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  373  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTT  416



>ref|XP_006485786.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Citrus 
sinensis]
 gb|KDO57445.1| hypothetical protein CISIN_1g015643mg [Citrus sinensis]
Length=403

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 103/213 (48%), Positives = 126/213 (59%), Gaps = 19/213 (9%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTE----ALNWSFGEEQEVEQK  797
            SD++LAEFAADVE+LLG      D+ +  VK      DC E    ALN    +E+  E  
Sbjct  181  SDLDLAEFAADVESLLGGGGGALDEDSCDVKEFWTLLDCKEEETIALNLKIKDEEVEEAV  240

Query  796  VMM----TMLSGFDessssmesgsckeEVAK-KSRML----LSLNYEEVISAWASQGCPW  644
            +       +   FD  S      +      + K +++    L LNY+ VI+AWASQGCPW
Sbjct  241  IAEATREAIGCNFDYQSPVTGDDTAGLMSTECKPKLMRNVSLKLNYDAVITAWASQGCPW  300

Query  643  TDGTRPHFDPNHCWPDFMG--GDHHHHHPYGSAMMMRR----SDEGREARVSRYREKRRT  482
            T G+RP  + NHCWP   G      HHH  G   ++R     +  GREARVSRYREKRRT
Sbjct  301  TAGSRPEINLNHCWPYCTGLCCKGVHHHTCGGGAVLRGCHLGAGGGREARVSRYREKRRT  360

Query  481  RLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  383
            RLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S  
Sbjct  361  RLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSFM  393



>ref|XP_009777706.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
sylvestris]
Length=447

 Score =   157 bits (396),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 111/258 (43%), Positives = 135/258 (52%), Gaps = 76/258 (29%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGD------------------------------------------  911
            S++ELAEFAADVE LLG                                           
Sbjct  211  SEMELAEFAADVENLLGKGLDDESFDMEGLGLLGGCNKEENSMECSMVSIHEKVKIEDEG  270

Query  910  --DDVGEDKATAAVKIEINGG------DCTEALNWSFGEEQEVEQKVMMTMLSGFDesss  755
              D+V  D  T    I+ING       D    +N + G+E  V + VM   ++G D   +
Sbjct  271  EGDEVVMDTTTTNHDIDINGDTFEFKFDYDSPMNINGGDE--VGEVVMK--INGEDGDGN  326

Query  754  smesgsckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHH  575
                        +K ++LL+L+YE V++AWA Q  PWT+G RP  D N CWPD MG +  
Sbjct  327  YN----------EKKKILLNLDYESVLTAWADQRSPWTNGERPELDSNDCWPDCMG-NCG  375

Query  574  HHHPYGSAMMMRRS---DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  404
              HPYG  +M   +   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRF
Sbjct  376  TIHPYG--IMNGHTTIIDRGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  433

Query  403  VKRSSLFQPPPPFPNYLL  350
            VKRS+L       PNY L
Sbjct  434  VKRSNL------VPNYPL  445



>emb|CAN73757.1| hypothetical protein VITISV_026326 [Vitis vinifera]
Length=475

 Score =   157 bits (397),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 131/233 (56%), Gaps = 34/233 (15%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEA-LNWSFGE------EQEV  806
            S+++LAEFAADVE+ LG    G D+ +  +K  I   DC +  ++  FG+      E+ V
Sbjct  248  SEMDLAEFAADVESYLG---AGLDEDSCGIK-GIGVLDCEQGDMDACFGDQKVKVKEERV  303

Query  805  EQKVMMTMLSGFDessssme---------------sgsckeEVAKKSRMLLSLNYEEVIS  671
            E      +    D +   +                       V  + ++ LSLNYE+VI+
Sbjct  304  ETDATFHLDPELDMTKELLAWNLDYESTVMDEEEHEEKMVAAVEMRRKISLSLNYEDVIT  363

Query  670  AWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHH-----PYGSAMMMRRSDEGREARVS  506
            AWASQG PWT G RP FDPN  WPD+MG    + H       G        D GREARV 
Sbjct  364  AWASQGSPWTTGNRPEFDPNDYWPDYMGACPTNVHGPCGDVGGVGGNFGGRDGGREARVL  423

Query  505  RYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLN  347
            RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S F   P FP  +LN
Sbjct  424  RYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAS-FAAGPCFP--ILN  473



>ref|NP_001278940.1| zinc finger protein CONSTANS-LIKE 16-like [Glycine max]
 gb|AEF12204.1| CONSTANS-like zinc finger protein [Glycine max]
Length=419

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 108/243 (44%), Positives = 135/243 (56%), Gaps = 47/243 (19%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG----DDDVGEDK-------------ATAAVKIE----------  866
            SD ELAEFAADVE+LLG    ++ VG ++              +  VK+E          
Sbjct  188  SDAELAEFAADVESLLGRGLENECVGMEELGLVDAKEEECSVGSGKVKMEDQEESPLVEM  247

Query  865  ----INGGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRMLL  698
                + G D  ++   SF  E   E KV    L         + +    ++  KK+++ L
Sbjct  248  EMDMVVGRD-DQSFELSFDYETCEEVKVCDLGLGN------ELGAKKENDDEVKKNKISL  300

Query  697  SLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG-DHHHHHPYGS----AMMMRRS  533
             L+YE VI AWASQ  PWT   +P+ DP+ CW   MG  +  +HHP G      +     
Sbjct  301  QLDYEAVIIAWASQKSPWTTADKPNLDPDECWKQCMGSCETAYHHPCGEMGGFGIHPVII  360

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYL  353
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S    PP FP  L
Sbjct  361  DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF--APPTFP--L  416

Query  352  LNR  344
            LN+
Sbjct  417  LNK  419



>ref|XP_011007910.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Populus euphratica]
Length=445

 Score =   155 bits (393),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 88/117 (75%), Gaps = 6/117 (5%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-GDHHHHHPYG-----  557
            KK R LLSL+Y+ V++AWASQG PWT+G RP FD + CWPD MG      H PYG     
Sbjct  326  KKRRTLLSLDYDAVMTAWASQGSPWTNGYRPDFDADECWPDCMGICGAQLHQPYGDVSGL  385

Query  556  SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            +A      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++ 
Sbjct  386  AAHPAALVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTTF  442



>ref|XP_007152761.1| hypothetical protein PHAVU_004G157300g [Phaseolus vulgaris]
 gb|ESW24755.1| hypothetical protein PHAVU_004G157300g [Phaseolus vulgaris]
Length=406

 Score =   155 bits (391),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 126/210 (60%), Gaps = 16/210 (8%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG---DDDVGEDKATAAVKIEINGGD-----CTEALN-----WSF  824
            SD++LAEFAADVE+LLG   D+D  E    + + ++    D     C + +         
Sbjct  190  SDMDLAEFAADVESLLGNGADEDSSEHVKGSEIVLDCKEEDDEMDACVDGVGEKDAMVKV  249

Query  823  GEEQEVEQKVMMTMLSG-FDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQGCP  647
             +E+E++      + S   D + + +       +   K  M L LNYE+VI+AWASQGCP
Sbjct  250  KDEEELDADTSCHLDSIILDMNWNDIVESESLAQEQDKKEMFLRLNYEDVIAAWASQGCP  309

Query  646  WTDGTRPHFDPNHCWPDFMGGDHHH-HHPYGSAMMMR-RSDEGREARVSRYREKRRTRLF  473
            WT GT P+F+ +   P F+G +       YG    +R  +D GREARV RYREKRRTRLF
Sbjct  310  WTTGTPPNFNSDDFLPGFLGSNGEDVLCCYGEMRSLRGHADGGREARVLRYREKRRTRLF  369

Query  472  SKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  383
            +KKIRYEVRKLNAEKRPR+KGRFVKR+S  
Sbjct  370  AKKIRYEVRKLNAEKRPRMKGRFVKRTSFL  399



>gb|KHN11420.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=417

 Score =   155 bits (392),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 131/237 (55%), Gaps = 36/237 (15%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDD--------------DVGEDKATAA---VKIE--------IN  860
            SD ELAEFAADVE+ LG                D  E++ +     VK+E        ++
Sbjct  187  SDAELAEFAADVESFLGRGLENKCVGMEELGLVDTKEEECSVGSGKVKVEEEESPLMEMD  246

Query  859  GGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRMLLSLNYEE  680
             G   ++   SF  E   E K M   +S  +  +   E     ++  K+ ++ L L+YE 
Sbjct  247  MGRDDQSFELSFDYETCEEVKEMK--VSDLELGNELGEMKENDDDEVKRKKVSLQLDYEA  304

Query  679  VISAWASQGCPWTDGTRPHFDPNHCWPDFMGG-DHHHHHPYGS----AMMMRRSDEGREA  515
            +I AWASQ  PWT   + + DP+ CW   MG      HHPYG      +     D GREA
Sbjct  305  IIIAWASQKSPWTTADKQNLDPDECWHQCMGSCGTAFHHPYGELGGFGIHSVIVDGGREA  364

Query  514  RVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  344
            RVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S    PP FP  LLN+
Sbjct  365  RVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF--APPTFP--LLNK  417



>ref|XP_003555902.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Glycine 
max]
Length=418

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 105/237 (44%), Positives = 131/237 (55%), Gaps = 36/237 (15%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDD--------------DVGEDKATAA---VKIE--------IN  860
            SD ELAEFAADVE+ LG                D  E++ +     VK+E        ++
Sbjct  188  SDAELAEFAADVESFLGRGLENKCVGMEELGLVDTKEEECSVGSGKVKVEEEESPLMEMD  247

Query  859  GGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRMLLSLNYEE  680
             G   ++   SF  E   E K M   +S  +  +   E     ++  K+ ++ L L+YE 
Sbjct  248  MGRDDQSFELSFDYETCEEVKEMK--VSDLELGNELGEMKENDDDEVKRKKVSLQLDYEA  305

Query  679  VISAWASQGCPWTDGTRPHFDPNHCWPDFMGG-DHHHHHPYGS----AMMMRRSDEGREA  515
            +I AWASQ  PWT   + + DP+ CW   MG      HHPYG      +     D GREA
Sbjct  306  IIIAWASQKSPWTTADKQNLDPDECWHQCMGSCGTAFHHPYGELGGFGIHSVIVDGGREA  365

Query  514  RVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  344
            RVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S    PP FP  LLN+
Sbjct  366  RVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF--APPTFP--LLNK  418



>ref|XP_010916170.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Elaeis 
guineensis]
Length=424

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 101/231 (44%), Positives = 133/231 (58%), Gaps = 38/231 (16%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG---DDDV-----------GEDKATAAVKIEIN---GGDCTEAL  836
            SD++LAEFAADVE+LLG   DDD             ED     VK+E++   GG+ T+ +
Sbjct  182  SDLDLAEFAADVESLLGRGLDDDTFCIDALGLMDSAEDDNKGRVKVELDVDAGGERTDFV  241

Query  835  NWSFGEEQEVEQKVM--------------MTMLSGFDessssmesgsckeEVAKKSRMLL  698
                  E ++ ++ +              +      +E++ + + G   E VA   RM L
Sbjct  242  ACDIDVEIDLSRETLDLDFGCGSPAAVEDLEEQEAAEEAAMASDGGCGTEAVAAGRRMTL  301

Query  697  SLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGGDHHHHH------PYGSAMMMR  539
             L+YE VI+AW+ + C PWTDG RP F+P+ CWPDF G             P    + M 
Sbjct  302  RLDYEAVIAAWSCKDCSPWTDGERPQFNPDDCWPDFTGMMWGGAGGGREVAPVYGELGMV  361

Query  538  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
              D GREA+V+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++ 
Sbjct  362  AGDGGREAKVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAAF  412



>ref|XP_010103762.1| Zinc finger protein CONSTANS-LIKE 16 [Morus notabilis]
 gb|EXB97040.1| Zinc finger protein CONSTANS-LIKE 16 [Morus notabilis]
Length=464

 Score =   155 bits (391),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 92/129 (71%), Gaps = 10/129 (8%)
 Frame = -1

Query  706  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGD-----HHHHHPYGSAMMM  542
            +LL L+YE VI+AWASQG PWT G RP FDP+ CWPD MG       HHH +   S + +
Sbjct  338  ILLRLDYEAVITAWASQGSPWTTGDRPDFDPDACWPDCMGTYYPTQLHHHQYMDLSGVEL  397

Query  541  R---RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPP  371
                 +D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFV R+S     P
Sbjct  398  NPAILADGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVNRASF--AGP  455

Query  370  PFPNYLLNR  344
             FP  L+ +
Sbjct  456  TFPAMLITK  464



>ref|XP_002315940.1| Zinc finger protein CONSTANS-LIKE 6 [Populus trichocarpa]
 gb|EEF02111.1| Zinc finger protein CONSTANS-LIKE 6 [Populus trichocarpa]
Length=447

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 88/119 (74%), Gaps = 8/119 (7%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPD--FMG-GDHHHHHPYG---  557
            KK R LLSL+YE V++AWASQG PWT+G RP FD + CWPD   MG      HHPYG   
Sbjct  326  KKRRTLLSLDYEAVMTAWASQGSPWTNGYRPDFDADECWPDADCMGICGAQLHHPYGDVS  385

Query  556  --SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
               A      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++ 
Sbjct  386  GLGAHPAALVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTTF  444



>gb|AHI45078.1| COL domain class transcription factor [Boehmeria nivea]
Length=458

 Score =   154 bits (390),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 107/157 (68%), Gaps = 10/157 (6%)
 Frame = -1

Query  829  SFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQGC  650
            S GE +E +QKV +++ +  + S +       K+   KK ++LL LNYE VI+ WASQG 
Sbjct  299  SCGENEE-DQKVDVSLAAQHEVSKAKNGEEDVKKSKKKKKKILLRLNYEAVITEWASQGS  357

Query  649  PWTDGTRPHFDPNHCWPDFMGG----DHHHHHPYGSAMMM-----RRSDEGREARVSRYR  497
            PWT G RP FDP+ CWP+ MG      HHHHH    + ++       +D GREARVSRYR
Sbjct  358  PWTTGDRPDFDPDTCWPNCMGTFDTQLHHHHHYMDLSGLVGGNPAALADGGREARVSRYR  417

Query  496  EKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            EKRR RLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S 
Sbjct  418  EKRRNRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF  454



>gb|AHI45077.1| COL domain class transcription factor [Boehmeria nivea]
Length=453

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 103/235 (44%), Positives = 126/235 (54%), Gaps = 36/235 (15%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG------------------------DDDVGEDKATAAVKIEIN-  860
            +++ELAEFAADVE+LLG                        D D  E+     + ++++ 
Sbjct  204  TELELAEFAADVESLLGVAGIEEDQSCIDHDVKGFGLMDDLDQDRREEDGDFDIDVDVDL  263

Query  859  GGDCTEALNWSFGEEQEV---EQKVMMTMLSGFDessssmesgsckeEVAKKSRMLLSLN  689
            GG C    N +   EQ V   E + ++      +  S      +      KK  +LL LN
Sbjct  264  GGVCA---NTAAKSEQRVKVEEDESVLGFQVNPNFGSELSSPATTPATEMKKRDILLRLN  320

Query  688  YEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDH----HHHHPYGSAMMMRRSDEGR  521
            YE VI+AWASQG PWT G RP   P H WPD M   H      +  +   +   R D GR
Sbjct  321  YEAVIAAWASQGSPWTTGIRPEVKPEHGWPDCMDMCHPDFSQINGDWRGLVGSGRRDGGR  380

Query  520  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ-PPPPFPN  359
            EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S        FPN
Sbjct  381  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSFMGINNSTFPN  435



>ref|XP_009602362.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
tomentosiformis]
Length=394

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 101/233 (43%), Positives = 130/233 (56%), Gaps = 36/233 (15%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG----------------------DDDVGEDKATAAVKIEINGGD  851
            S++ELAEFAADVE+LLG                      DD +G       +K+E N G+
Sbjct  172  SEMELAEFAADVESLLGRRLDDEESFNYMELGLGFLEKHDDSMGCSLVDEKIKVE-NEGE  230

Query  850  CTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRMLLSLNYEEVIS  671
                ++ S   + +      + +    D  S  +      +   K +++LL+L+Y  V++
Sbjct  231  MEVVIDRSSYNQVDYSDTFDLKL----DCDSPIITLEEDDKGDTKNNKILLNLDYGGVLN  286

Query  670  AWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR----RSDEGREARVSR  503
            AWA Q  PWT G RP  D N CWP  MG +   +H YG    M       DEGREARV R
Sbjct  287  AWADQRSPWTTGERPEVDFNDCWPVCMG-NCGKNHLYGDMGTMTGHGPTVDEGREARVLR  345

Query  502  YREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  344
            Y+EKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++    P PFP+  LNR
Sbjct  346  YKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTNF--APTPFPS--LNR  394



>ref|XP_008374747.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Malus domestica]
Length=442

 Score =   153 bits (387),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 106/226 (47%), Positives = 128/226 (57%), Gaps = 39/226 (17%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG---DDDVGEDKATAAV--------------KIEINGGDCTEAL  836
            SD+ELAEFAADVE LLG   D+D  + K    +               IE N       L
Sbjct  197  SDMELAEFAADVENLLGGGLDEDCSDIKGVLGLLDEGKEVKVEEEVEGIEFN----PSIL  252

Query  835  NWSFGEEQEVEQKVMM------------TMLSGFDessssmesgsckeEVAKKSRMLLSL  692
            +WS   +Q     V+M             +L G  +SS  +     K+ V K+  + L L
Sbjct  253  DWSLYYDQSSAVPVLMGSEEDREEEEKVVLLMGA-QSSDEIGFMENKQIVMKRKNICLKL  311

Query  691  NYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG-DHHHHHPYG-SAMMMRRS---DE  527
            +YE VI+AWASQG  WT GTRP  + +  W D MG      H P+G SA  + R    D 
Sbjct  312  DYEAVITAWASQGSQWTTGTRPELNADEGWLDCMGMWPTEIHQPHGDSAGCVSRGKGDDP  371

Query  526  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  372  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTT  417



>ref|XP_002531628.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30756.1| conserved hypothetical protein [Ricinus communis]
Length=468

 Score =   154 bits (388),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 90/130 (69%), Gaps = 11/130 (8%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGG-DHHHHHPYGSAMM  545
            KK ++LLSL+YE VI+AWA+QG  PWTDGTR   DP+ CW D MG      HHPYG    
Sbjct  335  KKRKILLSLDYEAVITAWATQGTSPWTDGTRRDVDPDECWQDCMGTCGAEFHHPYGDTNG  394

Query  544  MRRSDE---------GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  392
            +              GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  395  LGGVGGGGNPAMAGGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA  454

Query  391  SLFQPPPPFP  362
            +    P  FP
Sbjct  455  TFAGGPSAFP  464



>emb|CDP00619.1| unnamed protein product [Coffea canephora]
Length=446

 Score =   153 bits (386),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 103/249 (41%), Positives = 129/249 (52%), Gaps = 49/249 (20%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG-------------------------DDDVG------EDKATAA  878
            S++ELAEFAADVE+LLG                         ++ +G      ED+  A 
Sbjct  195  SEMELAEFAADVESLLGKGLDDESFDIEGLGLSDCKEADLVDNNSLGRGRVKVEDEGEAE  254

Query  877  V---------KIEINGGDCTEALNWSFGEE-----QEVEQKVMMTMLSGFDessssmesg  740
            V         +I+++ GD  E    SF  +     +E + K  +       +   S +  
Sbjct  255  VAMGNNQIDGEIDMSRGD-HEPFELSFDYDSPMTCEEEDNKAGVERAIALKDHLKSEDCK  313

Query  739  sckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPY  560
                 +    ++LLSL+YE VISAWA Q  PWT G RP  D N CWPD +G     H+ Y
Sbjct  314  VEDAGINTNKKILLSLDYEGVISAWADQRSPWTTGERPELDSNDCWPDCLGTCGTIHNLY  373

Query  559  GSAMMMRRS---DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            G   M       D GREARVSRYREKRRTRLF KKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  374  GEVGMFGHPAMMDGGREARVSRYREKRRTRLFCKKIRYEVRKLNAEKRPRMKGRFVKRAT  433

Query  388  LFQPPPPFP  362
                   FP
Sbjct  434  FSAAAAAFP  442



>ref|XP_010066724.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Eucalyptus grandis]
 gb|KCW64739.1| hypothetical protein EUGRSUZ_G02322 [Eucalyptus grandis]
Length=463

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 115/264 (44%), Positives = 141/264 (53%), Gaps = 60/264 (23%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG---------------------DDD-------------VGEDKA  887
            SD +LAEFAADVE+LLG                     DD+             V E + 
Sbjct  203  SDADLAEFAADVESLLGRALDTESFGIEGLGFVDCKERDDNSMDCSLGSGGAIKVEEKEG  262

Query  886  TAAVKIEINGGDC-------TEALNWSF------GEEQEVEQKVMMTMLSGFDess----  758
             A V +E+   D        T  LN+ +      G+E+E E KV++ +    +  +    
Sbjct  263  VAEVVVELGHDDMEMDVSKETFELNFDYDSPTTCGDEEE-EAKVIVELEGEKNVENCGAD  321

Query  757  ssmesgsckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-GD  581
                  S + +  KK  + L L+YE VISAWA QG PWT G RP F P++CWPDFMG   
Sbjct  322  EGTNISSEERKKKKKREIFLRLDYEAVISAWAGQGSPWTTGERPDFSPDNCWPDFMGMSG  381

Query  580  HHHHHPYGSAMMMRRS----DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLK  413
                + YG A +        D GREA+VSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+K
Sbjct  382  LEFQNLYGEAGVHGGHVGMGDAGREAKVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMK  441

Query  412  GRFVKR-SSLFQPPPPFPNYLLNR  344
            GRFVKR SS     P FP  LLN+
Sbjct  442  GRFVKRASSASSSAPAFP--LLNK  463



>ref|XP_007210807.1| hypothetical protein PRUPE_ppa017267mg [Prunus persica]
 gb|EMJ12006.1| hypothetical protein PRUPE_ppa017267mg [Prunus persica]
Length=440

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 104/237 (44%), Positives = 129/237 (54%), Gaps = 63/237 (27%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG----DDDVGEDKATAAV----KIEINGG--------DCTE---  842
            SD+ELAEFAADVE L+G    D+D G+ K    +    K+E NGG        D  E   
Sbjct  215  SDMELAEFAADVENLIGGGLDDEDSGDIKGVLGLLDDSKLEGNGGVDVCMKNVDINEDRK  274

Query  841  ----------------ALNWSFGEEQEV----------EQKVMMTMLSGFDessssmesg  740
                             L+W+   E  +          E+KV+  M       SS   + 
Sbjct  275  AVKVEEEAEGMEFNPSMLDWNSDYELRLSSSPLPMGGEEEKVVFLM----GARSSDEVAL  330

Query  739  sckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPY  560
               +++  K ++ L L+YE +I+AWA+QG PWT GTRP  +P+  W D MGG        
Sbjct  331  MDNKQMMMKRKICLRLDYEAIITAWANQGSPWTTGTRPELNPDDGWLDCMGG--------  382

Query  559  GSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
                  R  D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S
Sbjct  383  ------RGDDRGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTS  433



>gb|AGM20692.1| COL6-2 [Populus tomentosa]
Length=447

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 87/119 (73%), Gaps = 8/119 (7%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPD--FMG-GDHHHHHPYGSAM  548
            KK R LLSL+YE V+SAWASQG PWT+G RP FD + CWPD   MG      HHPYG   
Sbjct  326  KKRRTLLSLDYEAVMSAWASQGSPWTNGYRPDFDADECWPDADCMGICGAQLHHPYGDVS  385

Query  547  MMRRS-----DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
             +        D  REARVSRYREKRRTRLFSKK+RYEVRKLNAEKRPR+KGRFVKR++ 
Sbjct  386  GLGADPAALVDGAREARVSRYREKRRTRLFSKKLRYEVRKLNAEKRPRMKGRFVKRTTF  444



>ref|XP_012093002.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Jatropha curcas]
 gb|KDP20116.1| hypothetical protein JCGZ_05885 [Jatropha curcas]
Length=431

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 106/251 (42%), Positives = 129/251 (51%), Gaps = 63/251 (25%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGD--DDVGEDKAT------------------------------A  881
            SD++LAEFAADVE LLG   DD   D+                                 
Sbjct  182  SDMDLAEFAADVENLLGAGLDDNSPDRNNDLGFLEYCNKKQEQEESDYYSNNKFYFDEEK  241

Query  880  AVKI-------EINGGDCT--EALN------WSFGEEQ--------EVEQKVMMTMLSGF  770
             VK+       EI  G C   +A +      WSF  +Q        E E+KV +  ++  
Sbjct  242  VVKVKNEQQMEEIVAGGCNLGQAFDQMGKEDWSFSYDQSSLVTGDEEEEEKVALPAVTN-  300

Query  769  DessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFM  590
               ++     S + +   K  + L LNYE VI+AWAS G PWT GTRP  +P+ CWPD +
Sbjct  301  ---TTVKVVSSDQHKKEMKRDVSLRLNYEAVITAWASHGSPWTTGTRPELNPDDCWPDCL  357

Query  589  GG--DHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRL  416
            G      HHHPY           GREARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPRL
Sbjct  358  GTCPKDGHHHPYRGHNGGGNG--GREARVLRYKEKRRTRLFSKKIRYEVRKLNAEKRPRL  415

Query  415  KGRFVKRSSLF  383
            +GRFVKR+S  
Sbjct  416  QGRFVKRTSFM  426



>ref|XP_007036519.1| Transcription factor, putative [Theobroma cacao]
 gb|EOY21020.1| Transcription factor, putative [Theobroma cacao]
Length=431

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 110/244 (45%), Positives = 135/244 (55%), Gaps = 68/244 (28%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG---DDDVG-------------EDKATA-----AVKI----EIN  860
            SD++LA+FAADVE LLG   DDD               ED +        VK+    E+ 
Sbjct  196  SDMDLADFAADVENLLGVGLDDDACCDTKGIELLHSKEEDGSNVLHEGKIVKVKDEEEVE  255

Query  859  G---------GDCT-EALNWSFGEE-----QEVEQKVM----MTMLSGFDessssmesgs  737
            G          D T E+LNWS+  E     +E E+KV+     T ++G            
Sbjct  256  GITACCFDSAFDVTRESLNWSYDYESPTIGEEEEEKVLPATETTTMNG------------  303

Query  736  ckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGD----HHHH  569
             + +   K  MLL LNYE VI+AWA QG PWT G+RP F+P+    DFMG +    HH  
Sbjct  304  -ESKAEMKRNMLLRLNYESVITAWARQGSPWTAGSRPEFNPD----DFMGSNLKEGHHLS  358

Query  568  HPYGSAMMMR---RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  398
               G    ++    +D  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVK
Sbjct  359  GGIGGIYSLQGRGNTDGEREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK  418

Query  397  RSSL  386
            R+S 
Sbjct  419  RTSF  422



>gb|KHG04097.1| Zinc finger CONSTANS-LIKE 16 -like protein [Gossypium arboreum]
Length=416

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 104/235 (44%), Positives = 130/235 (55%), Gaps = 55/235 (23%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGD-----------------DDVGEDKATAAVKIEINGG------  854
            SD++LA+FAADVE+LLGD                 D   ED++ A  + +I         
Sbjct  184  SDLDLAQFAADVESLLGDGLDENNTCNHTKGTELMDCKQEDESNAFQERKIKDEEEEEEG  243

Query  853  -----------DCT-EALNWSFGEE------QEVEQKVMMTMLSGFDessssmesgscke  728
                       D T  +LNWSF  E      QE E+KV+    +              + 
Sbjct  244  IITACCFDSDFDVTRSSLNWSFDYESPTIGDQEEEEKVVPVAETPI---------MDGEI  294

Query  727  EVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAM  548
            +  KK  MLL L+YE VI+AWA+QG PWT GTRP F+P+    DFMG + +       + 
Sbjct  295  KAEKKRSMLLRLDYESVITAWATQGSPWTSGTRPEFNPD----DFMGSNPNEGIGGICSQ  350

Query  547  MMRRSDEG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
              R   +G REARVSRYREKRRTRLFSKKIRY+VRKLNAEKRPR+KGRFVKR+S 
Sbjct  351  GKRNITDGEREARVSRYREKRRTRLFSKKIRYQVRKLNAEKRPRIKGRFVKRASF  405



>ref|XP_009360161.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=447

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 125/223 (56%), Gaps = 35/223 (16%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG---DDDVGEDKATAAV--------------KIEINGG------  854
            +++ELAEFAADVE LLG   D+D  + K    +               +E N        
Sbjct  204  TEMELAEFAADVENLLGGGLDEDCSDIKGVLGLLDDGKEVKVEEEVEGMEFNPSILDWNL  263

Query  853  --DCTEALNWSFGEE--QEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRMLLSLNY  686
              D + A+    G E  +E E+ V++T     DE +             K+ ++ L L+Y
Sbjct  264  DYDKSSAVPVQMGNEDNEEEEKLVLLTGAQSSDEMAFMENKHMEM----KRKKICLRLDY  319

Query  685  EEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG----GDHHHHHPYGSAMMMRRSDEGRE  518
            E VI+AWASQG PWT+GTRP  +P+  W D MG         H      +  R  D GRE
Sbjct  320  ETVITAWASQGSPWTNGTRPELNPDDGWLDCMGMWPTEIPQPHGDTAGCVSGRGDDRGRE  379

Query  517  ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  380  ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTT  422



>gb|KJB34352.1| hypothetical protein B456_006G061600 [Gossypium raimondii]
Length=414

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 105/235 (45%), Positives = 130/235 (55%), Gaps = 57/235 (24%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGD-----------------DDVGEDKATAAVKIEINGG------  854
            SD++LA+FAADVE+LLGD                 D   ED++ A  + +I         
Sbjct  184  SDLDLAQFAADVESLLGDGLDENNTCNHTKGTELMDCKQEDESNAFQERKIKDEEEEEEG  243

Query  853  -----------DCT-EALNWSFGEE------QEVEQKVMMTMLSGFDessssmesgscke  728
                       D T  +LNWSF  E      QE E+KV+              E+   + 
Sbjct  244  IITACCFDSDFDVTRSSLNWSFDYESPTIGDQEEEEKVVPVA-----------ETMDGEN  292

Query  727  EVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAM  548
            +  KK  MLL L+YE VI+AWA+QG PWT GTRP F+P+    DFMG +         + 
Sbjct  293  KAEKKRNMLLRLDYESVITAWATQGSPWTSGTRPEFNPD----DFMGSNPKEGIGGICSQ  348

Query  547  MMRRSDEG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
              R   +G REARVSRYREKRRTRLFSKKIRY+VRKLNAEKRPR+KGRFVKR+S 
Sbjct  349  GKRNITDGEREARVSRYREKRRTRLFSKKIRYQVRKLNAEKRPRIKGRFVKRASF  403



>gb|KJB34354.1| hypothetical protein B456_006G061600 [Gossypium raimondii]
Length=404

 Score =   150 bits (379),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 105/235 (45%), Positives = 130/235 (55%), Gaps = 57/235 (24%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGD-----------------DDVGEDKATAAVKIEINGG------  854
            SD++LA+FAADVE+LLGD                 D   ED++ A  + +I         
Sbjct  174  SDLDLAQFAADVESLLGDGLDENNTCNHTKGTELMDCKQEDESNAFQERKIKDEEEEEEG  233

Query  853  -----------DCT-EALNWSFGEE------QEVEQKVMMTMLSGFDessssmesgscke  728
                       D T  +LNWSF  E      QE E+KV+              E+   + 
Sbjct  234  IITACCFDSDFDVTRSSLNWSFDYESPTIGDQEEEEKVVPVA-----------ETMDGEN  282

Query  727  EVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAM  548
            +  KK  MLL L+YE VI+AWA+QG PWT GTRP F+P+    DFMG +         + 
Sbjct  283  KAEKKRNMLLRLDYESVITAWATQGSPWTSGTRPEFNPD----DFMGSNPKEGIGGICSQ  338

Query  547  MMRRSDEG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
              R   +G REARVSRYREKRRTRLFSKKIRY+VRKLNAEKRPR+KGRFVKR+S 
Sbjct  339  GKRNITDGEREARVSRYREKRRTRLFSKKIRYQVRKLNAEKRPRIKGRFVKRASF  393



>ref|XP_011007901.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Populus euphratica]
Length=447

 Score =   150 bits (380),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 88/119 (74%), Gaps = 8/119 (7%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPD--FMG-GDHHHHHPYG---  557
            KK R LLSL+Y+ V++AWASQG PWT+G RP FD + CWPD   MG      H PYG   
Sbjct  326  KKRRTLLSLDYDAVMTAWASQGSPWTNGYRPDFDADECWPDPDCMGICGAQLHQPYGDVS  385

Query  556  --SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
              +A      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++ 
Sbjct  386  GLAAHPAALVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTTF  444



>ref|XP_008240273.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Prunus mume]
Length=480

 Score =   150 bits (380),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 105/244 (43%), Positives = 133/244 (55%), Gaps = 57/244 (23%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG----DDDVGEDKATAAV----KIEINGG--------DCTE---  842
            SD+ELAEFAADVE L+G    D+D G+ K    +    K+E +GG        D  E   
Sbjct  214  SDMELAEFAADVENLIGGGLDDEDSGDIKGVLGLLDDSKLEGDGGVDVCMKNVDINEDRK  273

Query  841  ----------------ALNWSFGEE-----------QEVEQKVMMTMLSGFDessssmes  743
                             L+W+   E            E E+KV+  M +     SS   +
Sbjct  274  AVKVEEEAEGMEFNPSMLDWNSDYELRLSSSPLPMGGEEEEKVVFLMGA----QSSDEVA  329

Query  742  gsckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG--GDHHHH  569
                +++  K ++ L L+YE +I+AWA+QG PWT GTRP  +P+  W D MG  G    H
Sbjct  330  LMDNKQMMMKRKICLRLDYEAIITAWANQGSPWTTGTRPELNPDDGWLDCMGMWGSDQIH  389

Query  568  HPYG-----SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  404
              +G       +  R  D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRF
Sbjct  390  QSHGHGESAGCVGGRGDDRGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  449

Query  403  VKRS  392
            VKR+
Sbjct  450  VKRT  453



>ref|XP_006829901.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Amborella trichopoda]
 gb|ERM97317.1| hypothetical protein AMTR_s00073p00061640 [Amborella trichopoda]
Length=390

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 94/219 (43%), Positives = 123/219 (56%), Gaps = 23/219 (11%)
 Frame = -1

Query  961  DVELAEFAADVETLLGD---------------DDVGEDKATAAVKIEINGGDCTEALNWS  827
            D++LA+FAADVE+LLG                D+  E++   A ++++   +  + +   
Sbjct  175  DMDLADFAADVESLLGQGLDEDAFGIEGLGLLDNYREEEEGVASRVKVEEEEDEDGIFGC  234

Query  826  FGEEQEVEQKVMMTMLS---GFDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQ  656
                   E ++    L     +D  +++ E    K  +  +  + L L+YE VISAW   
Sbjct  235  SHHPDVAEVELSSETLEFNFDYDTPTTAGEDDEEKCRIVLEKSISLRLDYEAVISAWGRS  294

Query  655  GCPWTDGTRPHFDPNHCWPD-FMGGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTR  479
              PWT G RP F+P+ CWPD F G        Y        SD GREARVSRYREKRRTR
Sbjct  295  --PWTTGQRPEFNPDDCWPDPFTGNCVPEMSTYSEVGNATASDGGREARVSRYREKRRTR  352

Query  478  LFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  362
            LFSKKIRYEVRKLNAEKRPR+KGRFVKR+S   PP P+P
Sbjct  353  LFSKKIRYEVRKLNAEKRPRMKGRFVKRTSF--PPTPYP  389



>ref|NP_001239992.1| uncharacterized protein LOC100802113 [Glycine max]
 gb|ACU23240.1| unknown [Glycine max]
Length=350

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 100/252 (40%), Positives = 124/252 (49%), Gaps = 80/252 (32%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG--------DDD------------------------------VG  899
            SD +LAEF ADV++ LG        DDD                              +G
Sbjct  112  SDTDLAEFTADVKSFLGNGADEDSPDDDEHVKESELLILDCKEEEGDEEMDECIDGVLIG  171

Query  898  EDKATAAVK------------------IEINGGDCTEALNWSFGEEQEVEQKVMMTMLSG  773
               A   VK                  +++NG    EA NW+  E +   Q         
Sbjct  172  AKDAMVKVKDEEELDADDDTACHLDSILDMNG----EAFNWNIVESESPAQ---------  218

Query  772  FDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRP-HFDPNHCWPD  596
                           +V  K  + L LNYEEVI+AWASQG PWT+GT P  F+ + CW D
Sbjct  219  --------AQEDEVSKVGTKKDIFLRLNYEEVITAWASQGSPWTNGTPPKFFNSDDCWLD  270

Query  595  FMGGDHHH-HHPYGSAMMMR-RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRP  422
            F+G +  +    YG+   +R  +D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRP
Sbjct  271  FLGSNGGNVQCCYGAVGSLRVHADGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRP  330

Query  421  RLKGRFVKRSSL  386
            R+KGRFVKR+  
Sbjct  331  RMKGRFVKRTPF  342



>ref|XP_011076793.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Sesamum indicum]
Length=439

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 106/245 (43%), Positives = 129/245 (53%), Gaps = 59/245 (24%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG------------------DDDVGEDK----ATAAVKIE-----  866
            S+++LAEFAADVE+LLG                  D  V E +     +  VK+E     
Sbjct  198  SEMDLAEFAADVESLLGKGLENESFDMEGLGLLDCDGKVKESRECSLGSGRVKVEDEEIG  257

Query  865  -----------INGGDCTEALNWSF-----GEEQEVE-QKVMMTMLSGFDessssmesgs  737
                       I+ G  T  LN+ +     GEE+ ++ + V     + FD+ S+      
Sbjct  258  EVANHRIDAEFIDMGSETFELNFDYDSPITGEEEYIKAENVEPITPNNFDQDSNK-----  312

Query  736  ckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYG  557
                V    R+ L L+YE V+SAW  Q  PWT G RP  D   CWPD MG      H YG
Sbjct  313  ----VHDSKRIFLRLDYEGVLSAWDDQKSPWTTGERPDLDSAGCWPDCMG-TCGTVHVYG  367

Query  556  SAMMM-----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  392
               MM        D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  368  EMGMMIGHAVAVGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA  427

Query  391  SLFQP  377
            +L  P
Sbjct  428  NLVAP  432



>ref|XP_008446600.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein CONSTANS-LIKE 
6-like [Cucumis melo]
Length=402

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 104/250 (42%), Positives = 135/250 (54%), Gaps = 60/250 (24%)
 Frame = -1

Query  961  DVELAEFAADVETLLGDD------DVGEDKATAA-----------------VKIEINGGD  851
            D++ AEFAADVE+LLG+       D+ E    A+                 +KIE    D
Sbjct  154  DMDPAEFAADVESLLGNSLDNECFDMEELGLAASKDHSLTNDDYSLNSHEIIKIE---PD  210

Query  850  CTEALNWSFGEEQEV----------------------EQKVMMTMLSGFDessssmesgs  737
              E L    G E +                       E KVMM +++       + E   
Sbjct  211  EIEELTPMLGSEADTMREPFELNFMDFGSNPTTCGEDEDKVMMEVMA----VVKNGELEM  266

Query  736  ckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG--DHHHHHP  563
             +++  K+ ++ LSL+ E VI AW S+G PWT G RP+ D ++ WPD+MG      ++ P
Sbjct  267  EEKDCXKQKKISLSLDSEAVIIAWGSRGTPWTSGDRPNLDLDYYWPDYMGTYESDCYYQP  326

Query  562  YG--SAMMMRRSDEG----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFV  401
            YG   + + R +  G    REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFV
Sbjct  327  YGEFGSGIGRHAVTGVEGEREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFV  386

Query  400  KRSSLFQPPP  371
            KRSS F PPP
Sbjct  387  KRSSCFAPPP  396



>ref|XP_004135402.2| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
sativus]
 gb|KGN52081.1| hypothetical protein Csa_5G609670 [Cucumis sativus]
Length=403

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 103/250 (41%), Positives = 133/250 (53%), Gaps = 59/250 (24%)
 Frame = -1

Query  961  DVELAEFAADVETLLGDD------DVGEDKATAA-----------------VKIEINGGD  851
            D++ AEFAADVE+LLG+       D+ E    A+                 +KIE    D
Sbjct  154  DMDPAEFAADVESLLGNSLDNECFDMEELGLVASKDHSLTNDDYSLNSHEIIKIE---PD  210

Query  850  CTEALNWSFGEE----------------------QEVEQKVMMTMLSGFDessssmesgs  737
              E L    G E                       E + K+MM +++      +      
Sbjct  211  EIEVLTPMLGIEADTMREPFELNFMDFGSNPTTCSEEDDKMMMEVMA---VVKNGELEME  267

Query  736  ckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG--DHHHHHP  563
              + V  K ++ LSL+ E VI AW S+G PWT G RP+ D ++ WPD+MG      ++ P
Sbjct  268  ETKIVKNKKKVSLSLDSEAVIIAWGSRGTPWTSGDRPNLDLDYYWPDYMGTYESDCYYQP  327

Query  562  YG--SAMMMRRSDEG----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFV  401
            YG   + + R++  G    REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFV
Sbjct  328  YGEFGSGIGRQAVTGVEGEREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFV  387

Query  400  KRSSLFQPPP  371
            KRSS F PPP
Sbjct  388  KRSSCFAPPP  397



>ref|XP_006367940.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
tuberosum]
Length=428

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 99/234 (42%), Positives = 126/234 (54%), Gaps = 36/234 (15%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG---DDDVG----------EDKATAAVKIE------------IN  860
            S++ELA+FAADVE LLG   DD+            E      VK+E             N
Sbjct  194  SEMELADFAADVECLLGKGLDDEESFNYMEGLGFLEKHDEKLVKVEDEGEMGFVNMVSTN  253

Query  859  GGDCTEALNWSF---GEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRMLLSLN  689
              D  +     F   GE  E++      ++S  DE           +     ++++L+L+
Sbjct  254  NHDINQVDYSDFDMVGETFELKFDYDSQVMSNLDEDKKVEFGEINYDSGKNNNKIMLNLD  313

Query  688  YEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRS-----DEG  524
            YE V+ +WA +  PWT G RP  D N CWP  MG +    H YG   ++ R      DEG
Sbjct  314  YESVLKSWADKRSPWTMGERPEVDFNDCWPVCMG-NCGKIHSYGDIGIVNRHGGGGVDEG  372

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  362
            REARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++    P PFP
Sbjct  373  REARVLRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTNF--APTPFP  424



>gb|AEF12205.1| CONSTANS-like zinc finger protein [Glycine max]
Length=430

 Score =   148 bits (374),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 99/228 (43%), Positives = 129/228 (57%), Gaps = 32/228 (14%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG---DDDVGEDKATAAVKIEIN--GGDCTEALNWSFGEEQEVEQ  800
            +D++LAEF+ADVE+LLG   D+D    K +  V ++    G D  +A     G  ++   
Sbjct  190  TDMDLAEFSADVESLLGNGVDEDSPVKKGSELVLLDCKEEGDDEMDACVNGIGANKDAMV  249

Query  799  KV---------------------MMTMLSGFDessssmesgsckeEVAK----KSRMLLS  695
            KV                     M +    ++ + S   + + ++EV+K    K  + L 
Sbjct  250  KVKDEEELDADDDTACHLDSILDMNSEAFNWNIAESESPAQAQEDEVSKVGTNKKDIFLR  309

Query  694  LNYEEVISAWASQGCPWTDGTRPHF-DPNHCWPDFMGGDHHHHHPYGSAMMMR-RSDEGR  521
            LNYEEVI+AWASQG PWT GT P F + + CW D           YG    +R  +D GR
Sbjct  310  LNYEEVITAWASQGSPWTTGTPPKFFNSDDCWLDLGSNGGGVQCYYGEVRSLRVHADGGR  369

Query  520  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  377
            EARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVK   L +P
Sbjct  370  EARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKSVPLLEP  417



>ref|XP_008802436.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Phoenix 
dactylifera]
Length=440

 Score =   148 bits (374),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 99/236 (42%), Positives = 129/236 (55%), Gaps = 33/236 (14%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG---DD-----------DVGEDKATAAVKIEINGGDCTEALNWS  827
            +D++LAEF ADVETLLG   DD           +  ED     VK+E++ G  ++ +  +
Sbjct  188  TDLDLAEFVADVETLLGRGLDDGAFCIDGLGLMNSAEDDGKGRVKVELDIGAGSDVMACT  247

Query  826  FGEEQEVEQKVMMTMLSGFDesss---------------smesgsckeEVAKKSRMLLSL  692
               E    +K +  +  GF   ++               +   G   E VA    M+L L
Sbjct  248  IDMEINPSRKTL-DLDFGFRSPAAGEELEEQKAAEEAAMASGGGCGVETVAAGRGMILKL  306

Query  691  NYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSA--MMMRRSDEGR  521
            +YE VI+AW+  GC PWTDG RP F+P+ C P F G         G A  + M     GR
Sbjct  307  DYEAVIAAWSCNGCSPWTDGERPQFNPDDCCPIFTGMMWSGGVGEGDAGEVGMMAGGGGR  366

Query  520  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYL  353
            EARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++     P    ++
Sbjct  367  EARVARYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTAFSAAGPAASPFI  422



>ref|XP_004300528.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Fragaria 
vesca subsp. vesca]
Length=457

 Score =   148 bits (374),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 100/239 (42%), Positives = 125/239 (52%), Gaps = 50/239 (21%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG---------------------DDDVG-------EDKATAAVKI  869
            SD+ELAEFAADVE +LG                     ++D G       E++    ++ 
Sbjct  197  SDMELAEFAADVENMLGKGLDEDCSDIKGLGLLDETKEEEDYGMDVCIGIEERKLVKIEE  256

Query  868  EINGGDC---TEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSR--M  704
            E  G +C      L+W+     + + +    +L G   +    E        A+K R  +
Sbjct  257  EDQGMECEFNPSMLDWNL----DYDDESAAVLLGGSTSTDQEEEDKVAVLMEAEKKRKKI  312

Query  703  LLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG----------GDHHHHHPYGS  554
             L LN+E VISAWAS+G PWT G +P  +P+  WPD MG            H        
Sbjct  313  CLRLNHEAVISAWASKGSPWTTGVKPELNPDDGWPDCMGVWGTNQIMNLQGHGDSSAAAH  372

Query  553  AMMMRRSDE---GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
             M MR   E   GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S 
Sbjct  373  RMGMRGDTEQRPGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSF  431



>gb|KEH44219.1| zinc finger constans-like protein [Medicago truncatula]
Length=436

 Score =   148 bits (373),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 106/232 (46%), Positives = 130/232 (56%), Gaps = 36/232 (16%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFG----EEQE----  809
            SD+ELAEFAADVE+LLG     E++     ++ +      E+  W  G    EE E    
Sbjct  207  SDIELAEFAADVESLLGRG--LENECIGMEELGLIDTKHEESEKWKCGGKVKEEGEECYE  264

Query  808  -VEQKVMMTM--LSGFDessssmesgsckeEVAKKS--------------RMLLSLNYEE  680
             VE   MM +   S F+ +    +S    EEV +K               ++ L L+Y+ 
Sbjct  265  VVEGDNMMEIGKESSFELNFDYDDSHETCEEVKEKCGEQNENNDYNKGKRKISLQLDYDA  324

Query  679  VISAWASQGCPWTDGTRPHFDPNHCWPDFMG--GDHHHHH-----PYGSAMMMRRSDEGR  521
            VI AW SQ CPWT+G +P  D +  WPD MG  G   H+       YG   +M   D GR
Sbjct  325  VIIAWDSQKCPWTNGDKPILDADENWPDCMGTFGTEVHYAYGEFGGYGCHPVM--VDGGR  382

Query  520  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPF  365
            EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S   P  P 
Sbjct  383  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFAVPTFPL  434



>ref|XP_004238926.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Solanum lycopersicum]
Length=437

 Score =   148 bits (373),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 99/236 (42%), Positives = 122/236 (52%), Gaps = 40/236 (17%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGD--DDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVM  791
            S++ELAEFAADVE+LLG   DD   D     +    N  + +   +     E E E +V+
Sbjct  209  SEMELAEFAADVESLLGKGLDDESFDMEGLGLLGVCNKEENSMISHEKVKIEDEGEMEVV  268

Query  790  MTMLS---------------------------GFDessssmesgsckeEVAKKSRMLLSL  692
                S                            +D S + +           K ++LL+L
Sbjct  269  TKTTSPTTHNHQYNHTHDHDIDINEDTFEFKFDYDSSINIIGDDEVVTNDENKKKILLNL  328

Query  691  NYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRS--DEGRE  518
            +YE V+ AWA Q CPWT+G RP  D N  WPD MG        Y   M    +  D GRE
Sbjct  329  DYEGVLKAWADQRCPWTNGERPELDSNESWPDCMGN-------YMGIMNENVTIVDRGRE  381

Query  517  ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLL  350
            ARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++        PNY L
Sbjct  382  ARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANFVTTST--PNYPL  435



>ref|XP_010320765.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X2 [Solanum lycopersicum]
Length=424

 Score =   147 bits (372),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 99/236 (42%), Positives = 122/236 (52%), Gaps = 40/236 (17%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGD--DDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVM  791
            S++ELAEFAADVE+LLG   DD   D     +    N  + +   +     E E E +V+
Sbjct  196  SEMELAEFAADVESLLGKGLDDESFDMEGLGLLGVCNKEENSMISHEKVKIEDEGEMEVV  255

Query  790  MTMLS---------------------------GFDessssmesgsckeEVAKKSRMLLSL  692
                S                            +D S + +           K ++LL+L
Sbjct  256  TKTTSPTTHNHQYNHTHDHDIDINEDTFEFKFDYDSSINIIGDDEVVTNDENKKKILLNL  315

Query  691  NYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRS--DEGRE  518
            +YE V+ AWA Q CPWT+G RP  D N  WPD MG        Y   M    +  D GRE
Sbjct  316  DYEGVLKAWADQRCPWTNGERPELDSNESWPDCMGN-------YMGIMNENVTIVDRGRE  368

Query  517  ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLL  350
            ARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++        PNY L
Sbjct  369  ARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANFVTTST--PNYPL  422



>gb|AEF12203.1| CONSTANS-like zinc finger protein [Glycine max]
 gb|KHN20727.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=427

 Score =   147 bits (371),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 100/252 (40%), Positives = 124/252 (49%), Gaps = 80/252 (32%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG--------DDD------------------------------VG  899
            SD +LAEF ADV++ LG        DDD                              +G
Sbjct  189  SDTDLAEFTADVKSFLGNGADEDSPDDDEHVKESELLILDCKEEEGDEEMDECIDGVLIG  248

Query  898  EDKATAAVK------------------IEINGGDCTEALNWSFGEEQEVEQKVMMTMLSG  773
               A   VK                  +++NG    EA NW+  E +   Q         
Sbjct  249  AKDAMVKVKDEEELDADDDTACHLDSILDMNG----EAFNWNIVESESPAQ---------  295

Query  772  FDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHF-DPNHCWPD  596
                           +V  K  + L LNYEEVI+AWASQG PWT+GT P F + + CW D
Sbjct  296  --------AQEDEVSKVGTKKDIFLRLNYEEVITAWASQGSPWTNGTPPKFFNSDDCWLD  347

Query  595  FMGGDHHH-HHPYGSAMMMR-RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRP  422
            F+G +  +    YG+   +R  +D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRP
Sbjct  348  FLGSNGGNVQCCYGAVGSLRVHADGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRP  407

Query  421  RLKGRFVKRSSL  386
            R+KGRFVKR+  
Sbjct  408  RMKGRFVKRTPF  419



>ref|XP_006374368.1| hypothetical protein POPTR_0015s06480g [Populus trichocarpa]
 gb|ERP52165.1| hypothetical protein POPTR_0015s06480g [Populus trichocarpa]
Length=425

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 102/239 (43%), Positives = 126/239 (53%), Gaps = 55/239 (23%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG----------------DDDVGEDK-----ATAAVKIEINGG--  854
            SD++LAEFAADVE LLG                D   GED+     A   VK++      
Sbjct  191  SDMDLAEFAADVENLLGREADEEYHDTKDLELLDCSKGEDEGQFCFADKVVKMKDEQEME  250

Query  853  ---DC----------TEALNWSF-------GEEQEVEQKVMMTMLSGFDessssmesgsc  734
               DC             L W+F       G+E+  E+KV +      + +         
Sbjct  251  TIIDCHFDQDFNMARESLLGWNFDYETLVDGDEEVEEKKVPVPETEMMNSTGYKEM----  306

Query  733  keEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG-DHHHHHPYG  557
                  K  + L L+YE VI AWA+QGCPWT G+RP  +P+  W D MG      ++PYG
Sbjct  307  ------KRNVSLRLDYESVIIAWANQGCPWTTGSRPELNPDDSWTDSMGACPKDVNNPYG  360

Query  556  SAMMMRRSDEG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  383
                  R  +G REARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL 
Sbjct  361  GLGSHTRGGDGEREARVMRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSLM  419



>ref|XP_004236986.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Solanum lycopersicum]
Length=428

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 98/231 (42%), Positives = 130/231 (56%), Gaps = 33/231 (14%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG---DDDVG----------EDKATAAVKIE-------INGGDCT  845
            S++ELAEFAADV +LLG   DD+            E      VK+E       +N     
Sbjct  197  SEMELAEFAADVVSLLGKGLDDEESFNYMEGLGFLEKHDEKLVKVEDEGEVGFVNMISTN  256

Query  844  EALNWS----FGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKS-RMLLSLNYEE  680
              +++S     GE  E++      +++  DE +  +E      +  K + +++L+L+YE 
Sbjct  257  NQVDYSEFDMVGETFELKFDYDSQVINNLDEDNKKVEFLEINYDSGKNNNKIMLNLDYES  316

Query  679  VISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR-----RSDEGREA  515
            V+ +W  +  PWT G RP  D N CWP  MG +    H YG   +M        DEGREA
Sbjct  317  VLKSWGDKRFPWTTGVRPEVDFNDCWPVCMG-NCGKIHSYGDIAIMNGHGGGVVDEGREA  375

Query  514  RVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  362
            RV RY+EKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++    P PFP
Sbjct  376  RVLRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTNF--APTPFP  424



>ref|XP_009356747.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=453

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 103/240 (43%), Positives = 131/240 (55%), Gaps = 50/240 (21%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG----DD-----------DVGEDKATAAVKIE----INGGDCTE  842
            SD++LAEFAADV++LLG    DD           D  E ++   VK+E     +G D  +
Sbjct  207  SDMDLAEFAADVDSLLGRGLNDDQCIGMEGLGLRDCKEKESKGRVKLEEDDDQDGIDGVD  266

Query  841  ALNWSFGEEQ-----------------------EVEQKVMMTMLSGFDessssmesgsck  731
             +    GE +                       E + K+++ + S   E     E+    
Sbjct  267  FMGCQLGESEIDMMKEPFVLNFEDYDDSPASCGEQDDKMIVGIDSNCTEDHEHEEADEDA  326

Query  730  eEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-GDHHHHHPYGS  554
             + +KK + +L L+YE VI+AW   G PWT G RP FD + C PD+MG      H+PYG 
Sbjct  327  IDNSKKRKTILRLDYEAVITAW--DGSPWTSGDRPDFD-SECLPDYMGVCGPGLHYPYGD  383

Query  553  ----AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
                 +     D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS 
Sbjct  384  LNGIGVHPAMVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSF  443



>ref|XP_011072947.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Sesamum indicum]
Length=393

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 103/242 (43%), Positives = 124/242 (51%), Gaps = 52/242 (21%)
 Frame = -1

Query  961  DVELAEFAADVETLLG--------------DDDVGEDKATAAVKIEINGGDCTEA-----  839
            D +LAEFAADVE LLG              D+D G D+      ++I   D  +      
Sbjct  168  DDDLAEFAADVENLLGTGVEEGSGCPIHCKDEDNGSDELLHGKGVKIEEDDDDDDEVQAV  227

Query  838  ------------LNWSFG-----EEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKS  710
                        LNW F        QE +    +   S  D  S S            K+
Sbjct  228  IACHFDPALDMELNWDFDYVSSMARQETKNVAAIETTSSMDSGSESHA----------KT  277

Query  709  RMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSD  530
            RM L LNYE VI+AWA+QG PWT+G RPHF+ +      + GD H      S      +D
Sbjct  278  RMFLRLNYEAVIAAWAAQGSPWTNGVRPHFNLDDFMVTCLEGDSHPSCGGRSGA----ND  333

Query  529  EGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLL  350
              REARV RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++ F      P YL+
Sbjct  334  AEREARVLRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTN-FSGSSSLP-YLI  391

Query  349  NR  344
            N+
Sbjct  392  NK  393



>ref|XP_007142909.1| hypothetical protein PHAVU_007G027200g [Phaseolus vulgaris]
 gb|ESW14903.1| hypothetical protein PHAVU_007G027200g [Phaseolus vulgaris]
Length=409

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 104/237 (44%), Positives = 135/237 (57%), Gaps = 44/237 (19%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGD---------DDVG------EDKATAAVKIEIN----------  860
            SD ELAEFAADVE+LLG          +D+G      E+ +  + K+++           
Sbjct  185  SDAELAEFAADVESLLGRGLENECVGMEDLGLIDAKEEECSEGSGKVKVEEESPEMEMEM  244

Query  859  -GGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRMLLSLNYE  683
             G D +  L++ +   +EV++ V               +    +EE+ KK ++ L L+YE
Sbjct  245  VGRDVSFELSFDYETCEEVKENVCDLEFG---------KEEEKEEEMMKKKKISLQLDYE  295

Query  682  EVISAWASQGCPWTDGTRPHFDPNHCWPDFM-----GGDHHHHHPYGSAMMMRRSDEGRE  518
             VI+AWASQ  PWT   +P+ DP+ CW   M     G D  +    G  +    +D GRE
Sbjct  296  SVITAWASQKSPWTTPHKPNLDPDECWHHCMESCGTGMDDPYGEVGGFGIHPMINDGGRE  355

Query  517  ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLN  347
            ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S    PP FP  LLN
Sbjct  356  ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF--APPTFP--LLN  408



>ref|XP_009765495.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Nicotiana 
sylvestris]
Length=405

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 91/130 (70%), Gaps = 9/130 (7%)
 Frame = -1

Query  721  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMM  542
            +K +++LL+L+Y  V++AWA Q  PWT G RP  D N CWP  MG +    H YG   +M
Sbjct  281  SKNNKILLNLDYGGVLNAWADQRSPWTTGERPQVDSNDCWPVCMG-NCGQIHAYGDMEIM  339

Query  541  R----RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  374
                   DEGREARV RY+EKRRTRLFSKKIRYEVRKLNAE RPR+KGRFVKR++    P
Sbjct  340  TGHGPMIDEGREARVLRYKEKRRTRLFSKKIRYEVRKLNAEMRPRMKGRFVKRTNF--AP  397

Query  373  PPFPNYLLNR  344
             PFP+  LNR
Sbjct  398  TPFPS--LNR  405



>gb|AIE41597.1| zinc finger protein CONSTANS-LIKE 6 [Lagerstroemia indica]
Length=376

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 99/221 (45%), Positives = 124/221 (56%), Gaps = 39/221 (18%)
 Frame = -1

Query  955  ELAEFAADVETL-----------------LGDDDVGEDKATAAVKIEINGGDCTEALNWS  827
            +LAEFAADVE L                 + + +  E K      +++ G        W 
Sbjct  178  DLAEFAADVECLLGGGEDLGLMDCRERVKVEEREDEEVKGVVQCNLDVEG-------KWG  230

Query  826  FGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQGCP  647
             GEE        +  +SG +E++S  ++   KE   KK RMLL LNYE VI++WA+QG P
Sbjct  231  CGEE--------VKRVSGGNETTSLSKNDVEKESQVKK-RMLLRLNYEAVIASWATQGSP  281

Query  646  WTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSK  467
            WTDG RP F+ +      +GG       Y    + R    GREARVSRYREKRRTRLFSK
Sbjct  282  WTDGIRPQFNLDEFMVACLGGS-----CYELGGLSRAKIGGREARVSRYREKRRTRLFSK  336

Query  466  KIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  344
            KIRYEVRKLNAEKRPR+KGRFVKRS+ F      P  L+N+
Sbjct  337  KIRYEVRKLNAEKRPRMKGRFVKRSTTFS-GSSLPYQLINK  376



>ref|XP_003637430.1| Zinc finger protein CONSTANS-like protein [Medicago truncatula]
Length=166

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 85/124 (69%), Gaps = 9/124 (7%)
 Frame = -1

Query  715  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG--GDHHHHH-----PYG  557
            K ++ L L+Y+ VI AW SQ CPWT+G +P  D +  WPD MG  G   H+       YG
Sbjct  43   KRKISLQLDYDAVIIAWDSQKCPWTNGDKPILDADENWPDCMGTFGTEVHYAYGEFGGYG  102

Query  556  SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  377
               +M   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S   P
Sbjct  103  CHPVM--VDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFAVP  160

Query  376  PPPF  365
              P 
Sbjct  161  TFPL  164



>ref|XP_011016373.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Populus 
euphratica]
Length=426

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 102/242 (42%), Positives = 127/242 (52%), Gaps = 61/242 (25%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG----------------DDDVGEDK-----ATAAVKIEINGG--  854
            SD++LAEFAADVE LLG                D   GED+     A   VK++      
Sbjct  192  SDMDLAEFAADVENLLGRETDEEYHDTKDLELLDCSKGEDEGQFCFADKVVKMKDEQEME  251

Query  853  ---DC----------TEALNWSF-------GEEQEVEQKVMMT---MLSGFDessssmes  743
               DC             L W+F       G+E+  E+KV +    M++  +        
Sbjct  252  TIIDCHFDQDFNMARESLLGWNFDYETLVDGDEEVEERKVPVPETEMMTSTEYKEM----  307

Query  742  gsckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHH-HH  566
                     K  + L L+YE VI AWA+QGCPWT G+RP  + +  W D MG      ++
Sbjct  308  ---------KRNVSLRLDYESVIIAWANQGCPWTTGSRPELNADDSWTDSMGTSPKDVNN  358

Query  565  PYGSAMMMRRSDEG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            PYG      R  +G REARV RY+EKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S
Sbjct  359  PYGGLGSHTRGGDGEREARVMRYKEKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTS  418

Query  388  LF  383
            L 
Sbjct  419  LM  420



>ref|XP_009356271.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Pyrus x 
bretschneideri]
Length=454

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 102/241 (42%), Positives = 132/241 (55%), Gaps = 51/241 (21%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG----DD-----------DVGEDKATAAVKIEIN----GGDCTE  842
            SD++LAEFAADV++LLG    DD           D  + ++   VK+E +    G D  +
Sbjct  207  SDMDLAEFAADVDSLLGRGVDDDECFGMERLGFMDCKKKESNGRVKLEEDDDQEGTDDVD  266

Query  841  ALNWSFGE-EQEVEQKVMMTMLSGFDessssmesgsckeEV-------------------  722
             +    GE E ++ ++        +D+S +S      K  V                   
Sbjct  267  FMGCQLGESEIDMMREPFALNFEDYDDSPASCGEQDDKLRVGSYSKCSTEDHEREDADDD  326

Query  721  ----AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG-DHHHHHPYG  557
                +KK +M+L L+YE VI+AW   G PWT G RP FD + C PD+MG      H+PYG
Sbjct  327  ARDNSKKRKMILRLDYEAVITAW--DGSPWTSGDRPDFD-SECLPDYMGACGAELHYPYG  383

Query  556  S----AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
                  +     D GREARVSRYREKRRTRLFSKKIRYEVRKLNA+KRPR+KGRFVKR+S
Sbjct  384  EMNGLGVHPAMVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAQKRPRMKGRFVKRAS  443

Query  388  L  386
             
Sbjct  444  F  444



>ref|XP_008389292.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Malus domestica]
Length=454

 Score =   142 bits (359),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 102/249 (41%), Positives = 134/249 (54%), Gaps = 51/249 (20%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG----DD-----------DVGEDKATAAVKIEIN----GGDCTE  842
            SD++LAEFAADV++LLG    DD           D  + ++   VK+E +    G D  +
Sbjct  207  SDMDLAEFAADVDSLLGRGLDDDECFGMERLGLMDCXKKESNGRVKLEEDDDQEGTDNVD  266

Query  841  ALNWSFGE-EQEVEQKVMMTMLSGFDessssmesgsckeEV-------------------  722
             +    GE E ++ ++     +  +D+S +S      K  V                   
Sbjct  267  FMGCQLGESEIDMXREPFALNIEDYDDSPASCGEQDDKLRVGIYSNCSTEDHEREEADDD  326

Query  721  ----AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG-DHHHHHPYG  557
                +KK +M+L L+YE VI+AW   G PWT G RP FD + C PD+M       H+PYG
Sbjct  327  AXDNSKKRKMILRLDYEAVITAW--DGSPWTSGDRPDFD-SECLPDYMSACGAELHYPYG  383

Query  556  SAMMM----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
                +      +D  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVK++S
Sbjct  384  DXNGLGXHPAMADGXREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKKAS  443

Query  388  LFQPPPPFP  362
                  P P
Sbjct  444  FAGSAFPVP  452



>ref|XP_008360050.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Malus domestica]
Length=454

 Score =   142 bits (359),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 102/249 (41%), Positives = 134/249 (54%), Gaps = 51/249 (20%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG----DD-----------DVGEDKATAAVKIEIN----GGDCTE  842
            SD++LAEFAADV++LLG    DD           D  + ++   VK+E +    G D  +
Sbjct  207  SDMDLAEFAADVDSLLGRGLDDDECFGMERLGLMDCKKKESNGRVKLEEDDDQEGTDNVD  266

Query  841  ALNWSFGE-EQEVEQKVMMTMLSGFDessssmesgsckeEV-------------------  722
             +    GE E ++ ++     +  +D+S +S      K  V                   
Sbjct  267  FMGCQLGESEIDMXREPFALNIEDYDDSPASCGEQDDKLRVGIYSNCSTEDHEREEADDD  326

Query  721  ----AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG-DHHHHHPYG  557
                +KK +M+L L+YE VI+AW   G PWT G RP FD + C PD+M       H+PYG
Sbjct  327  AXDNSKKRKMILRLDYEAVITAW--DGSPWTSGDRPDFD-SECLPDYMSACGAELHYPYG  383

Query  556  SAMMM----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
                +      +D  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVK++S
Sbjct  384  DXNGLGXHPAMADGXREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKKAS  443

Query  388  LFQPPPPFP  362
                  P P
Sbjct  444  FAGSAFPVP  452



>emb|CDY07383.1| BnaA07g24620D [Brassica napus]
Length=230

 Score =   137 bits (345),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 123/201 (61%), Gaps = 29/201 (14%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMT  785
            +++ELA+F+ADVETLLG    G D+   A++               FGE  ++E++ +  
Sbjct  47   TEMELAQFSADVETLLGG---GTDREFHAME------------EIGFGEMLKIEKEEVKE  91

Query  784  MLSGFDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPH---FDP  614
                     ++ E     +E  K+  ++L L+YE VIS W SQG PWT   +P     D 
Sbjct  92   EEE-----VATREVTGRIKEEKKEKVLMLRLDYETVISTWGSQGTPWT-ALKPSEIDLDM  145

Query  613  NHCWPDFM---GGD-HHHHHPYGSAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEV  449
              C  + M   GG+ HHH+H  G  + MR + D GREARVSRYREKRRTRLFSKKIRYEV
Sbjct  146  LCCQTNSMCESGGEAHHHNHFPGLGLHMREAGDGGREARVSRYREKRRTRLFSKKIRYEV  205

Query  448  RKLNAEKRPRLKGRFVKRSSL  386
            RKLNAEKRPR+KGRFVKRSS+
Sbjct  206  RKLNAEKRPRMKGRFVKRSSI  226



>gb|KJB23747.1| hypothetical protein B456_004G113000 [Gossypium raimondii]
Length=418

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 98/230 (43%), Positives = 122/230 (53%), Gaps = 38/230 (17%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMT  785
            SD++LA FAADVE+LLG   V  D+ +  +K +I   DCT+        E+++ +     
Sbjct  195  SDLDLANFAADVESLLG---VRLDEDSCDIK-KIESLDCTDENGSELFHERKIMKVEEEE  250

Query  784  MLSG----------------------FDessssmesgsckeEVAKKSRMLLSLNYEEVIS  671
             + G                      +D    + E          K   LL LNYE VI+
Sbjct  251  EVEGITACFCESAFEVTRASLNWTFDYDSLIITEEEEKEIPVAKTKRNKLLRLNYESVIT  310

Query  670  AWASQGCPWTDGTRPHFDPNHCWPDFMGG----DHHHHHPYGSA---MMMRRSDEGREAR  512
            AWASQG   T GTRP  +P+    DFMG     +HH +   G     +    +D  REAR
Sbjct  311  AWASQG-SRTTGTRPELNPD----DFMGSYPKDEHHQNGGIGGINRPVRANNTDGEREAR  365

Query  511  VSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFP  362
            VSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S       FP
Sbjct  366  VSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTSFVGLGTAFP  415



>ref|XP_010094760.1| Zinc finger protein CONSTANS-LIKE 16 [Morus notabilis]
 gb|EXB56925.1| Zinc finger protein CONSTANS-LIKE 16 [Morus notabilis]
Length=444

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 98/215 (46%), Positives = 120/215 (56%), Gaps = 34/215 (16%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKATAAVK-IEINGGDCTE------------ALNWSF  824
            S++ELAEFAADVE+LLG      D++   +  +E+    C E             +N S 
Sbjct  217  SELELAEFAADVESLLGGGLEDHDQSCQDINGLELELLGCKEEDDFDIDIDVDVCINPS-  275

Query  823  GEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQGCPW  644
              EQ V+ K         + ++S M          KK  ++L LNYE VI+AWASQG PW
Sbjct  276  --EQRVKVKEEKETCVFHETANSPMVQ-------TKKRDIILRLNYEAVIAAWASQGSPW  326

Query  643  TDGTRPHFDPNHCWPDFM-----------GGDHHHHHPYGSAMMMRRSDEGREARVSRYR  497
            T G RP F+P+  WPD +            GD          +     D GREARVSRYR
Sbjct  327  TTGNRPDFNPDDGWPDCLDVCHTDHVGPANGDSSRGGLGLGGVGGSVGDGGREARVSRYR  386

Query  496  EKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  392
            EKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  387  EKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRT  421



>ref|XP_008339676.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Malus domestica]
Length=453

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 102/240 (43%), Positives = 129/240 (54%), Gaps = 50/240 (21%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG----DD-----------DVGEDKATAAVKIE----INGGDCTE  842
            SD++LAEFAADV++LLG    DD           D  E ++   VK+E     +G D  +
Sbjct  207  SDMDLAEFAADVDSLLGRGLNDDQCFGMEGLGLRDCKEKESKGRVKLEEDDDQDGIDGVD  266

Query  841  ALNWSFGEEQ-----------------------EVEQKVMMTMLSGFDessssmesgsck  731
             +    GE +                       E + K+++ + S   E     E+    
Sbjct  267  FMGCQLGESENDMMREPFVLNFEDYDDSPASCGEQDDKMIVGIDSNCTEDHEHEEADEDA  326

Query  730  eEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-GDHHHHHPYGS  554
             +  KK + +L L+YE VI+AW   G PWT G RP FD +   PD+MG      H+PYG 
Sbjct  327  TDNXKKRKTILRLDYEAVITAW--DGSPWTSGDRPDFD-SEFLPDYMGVCGPGLHYPYGD  383

Query  553  ----AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
                 +     D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS 
Sbjct  384  LNGIGVHPAMVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSF  443



>ref|XP_009409257.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=411

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/215 (41%), Positives = 121/215 (56%), Gaps = 25/215 (12%)
 Frame = -1

Query  961  DVELAEFAADVETLLGDDDVGEDKATAAVKIEI------NGGDCTE------ALNWSFGE  818
            D+E++EFAA +++LLG D VG D A     +E+      N G   E       +     +
Sbjct  189  DLEISEFAARIKSLLGGDLVGGDDAFCMANLELAEPVAENTGFSIEDDARHVKMEQPDRD  248

Query  817  EQEVEQKVMMTMLSGFD-------essssmesgsckeEVAKKSRMLLSLNYEEVISAWAS  659
            E E + ++ + +   F             +   + K E   + +  L L+YE +I AW+S
Sbjct  249  EDESQGELELNLECSFPFTRGEEESEEDEVAGTAVKVEQGAEKKAKLRLDYESIIMAWSS  308

Query  658  QGC-PWTDGTRPHFDPNHCWPDFM-----GGDHHHHHPYGSAMMMRRSDEGREARVSRYR  497
            QG  PWTDG RP  + ++CWPD+M      G       +G  + +   D  REARV+RYR
Sbjct  309  QGSSPWTDGERPQINVDNCWPDYMDMWTGSGMETERACHGGEIGVYLGDGKREARVTRYR  368

Query  496  EKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  392
            EKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  369  EKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRT  403



>ref|XP_011071256.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Sesamum 
indicum]
Length=458

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 97/242 (40%), Positives = 121/242 (50%), Gaps = 53/242 (22%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG----------------------------------------DDD  905
            SD++LAEFAADVE+LLG                                        D+D
Sbjct  207  SDMDLAEFAADVESLLGKGLEDESFHMEELGLFDCDEKGKELHDCSNLLPSGRVKVEDED  266

Query  904  VGEDKATAA----VKIEINGGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgs  737
            V E  A       + +E + G  T  L + +G     E++ +       +E      S  
Sbjct  267  VAELMAMGHENHHLDVEFDMGRETFELKFDYGSPVACEEEDIKAQ----NEERIGWNSCF  322

Query  736  ckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYG  557
             + ++   S+  L L+YE V+SAW  +  PWT G RP+ D   CWPD   G     H YG
Sbjct  323  QECKMGDSSKTFLRLDYEGVLSAWDDKKSPWTTGERPNLDSCDCWPDHCLGTSGAMHVYG  382

Query  556  -----SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  392
                 S      +D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRS
Sbjct  383  EMGRMSGHAAAMADGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRS  442

Query  391  SL  386
            + 
Sbjct  443  NF  444



>ref|XP_012082090.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Jatropha curcas]
 gb|KDP29405.1| hypothetical protein JCGZ_18326 [Jatropha curcas]
Length=438

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 81/116 (70%), Gaps = 7/116 (6%)
 Frame = -1

Query  691  NYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG--GDHHHHHPYGS-----AMMMRRS  533
            +YE VI+AWASQG PW  G +P  +P+ CW D MG  G    HH YG       +    +
Sbjct  320  DYEAVITAWASQGSPWITGNQPDINPDDCWLDCMGIYGAEVLHHSYGDHNGGIGIQPAMT  379

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPF  365
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++   P  P 
Sbjct  380  DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANFAAPVFPL  435



>ref|XP_008352923.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Malus domestica]
Length=453

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 102/240 (43%), Positives = 129/240 (54%), Gaps = 50/240 (21%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG----DD-----------DVGEDKATAAVKIE----INGGDCTE  842
            SD++LAEFAADV++LLG    DD           D  E ++   VK+E     +G D  +
Sbjct  207  SDMDLAEFAADVDSLLGRGLNDDQCFGMEGLGLRDCKEKESKGRVKLEEDDDQDGIDGVD  266

Query  841  ALNWSFGEEQ-----------------------EVEQKVMMTMLSGFDessssmesgsck  731
             +    GE +                       E + K+++ + S   E     E+    
Sbjct  267  FMGCQLGESENDMMREPFVLNFEDYDDSPASCGEQDDKMIVGIDSNCTEDHEHEEADEDA  326

Query  730  eEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-GDHHHHHPYGS  554
             +  KK + +L L+YE VI+AW   G PWT G RP FD +   PD+MG      H+PYG 
Sbjct  327  TDNRKKRKTILRLDYEAVITAW--DGSPWTSGDRPDFD-SEFLPDYMGVCGPGLHYPYGD  383

Query  553  ----AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
                 +     D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS 
Sbjct  384  LNGIGVHPAMVDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSF  443



>emb|CDY53119.1| BnaCnng24470D [Brassica napus]
Length=376

 Score =   139 bits (349),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 113/199 (57%), Gaps = 23/199 (12%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMT  785
            +D+EL E+AADVE+LL D ++G         I  +  D T     SF  E     + ++ 
Sbjct  182  TDMELEEYAADVESLL-DMNIG---------ICDDDRDATAPFELSFDYESHNTYEEVIK  231

Query  784  MLSGFDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-H  608
             + G  E     E         KK+ ++L LNY+ VIS W  QG PWT G  P  D +  
Sbjct  232  NIEGSGECVKVKEEE-------KKNVLMLRLNYDSVISTWGGQGPPWTSGEPPERDIDIS  284

Query  607  CWPDF-MGGD----HHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRK  443
             WP   MGG+       HH  G        D GREARVSRYREKRRTRLFSKKIRYEVRK
Sbjct  285  SWPFVSMGGNVRESQQKHHVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRK  344

Query  442  LNAEKRPRLKGRFVKRSSL  386
            LNAEKRPR+KGRFVKR+SL
Sbjct  345  LNAEKRPRMKGRFVKRASL  363



>ref|XP_004497095.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Cicer arietinum]
Length=445

 Score =   140 bits (352),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 124/240 (52%), Gaps = 44/240 (18%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG-------------------------------DDDVGEDKATAA  878
            SD+ELAEFAADVE+LLG                               D++  E      
Sbjct  208  SDIELAEFAADVESLLGRGLENECIGMEELGLVDTKREVYSEGKVKVEDEESHEVVVLEG  267

Query  877  VKIEIN----GGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKS  710
             KIE +    G + +  LN+ + +  E  ++V   +     +     E+ + K     K 
Sbjct  268  YKIEGDNIEMGKESSFELNFDYDDSNETSEEVKEKVELEIGKCGEQNENNNNKG----KR  323

Query  709  RMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG-DHHHHHPYGSAMMMR--  539
            ++ L L+Y+ VI AW  + CPWT G +P+ D +  WPD  G       +PYG        
Sbjct  324  KISLQLDYDAVIIAWDGRKCPWTTGDKPNLDADETWPDCTGSCGTEVLYPYGELGGYECH  383

Query  538  --RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPF  365
               +D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S   P  P 
Sbjct  384  PVMADGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASFAVPTFPL  443



>ref|XP_006344138.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Solanum 
tuberosum]
Length=447

 Score =   139 bits (351),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 99/239 (41%), Positives = 127/239 (53%), Gaps = 43/239 (18%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG---DDDVGEDKATAAVKI---EINGGDCTEALNWSFGEEQEVE  803
            S++ELAEFAADVE+LLG   DD+  + +    + +   E N  + +   +     E E E
Sbjct  216  SEMELAEFAADVESLLGKGLDDESFDMEGLGLLGVCNKEENSMEYSMISHEKVKIEDEGE  275

Query  802  QKVMMTMLSG------------------------FDessssmesgsckeEVA--KKSRML  701
             +V+   +S                         FD  S     G  +  +    K ++L
Sbjct  276  IEVVRKTISATTHDHQYNHTHHDIDINEDTFEFKFDCDSPMNIIGEDEVIMKDENKKKIL  335

Query  700  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRS--DE  527
            L+L+YE V++AWA Q  PWT+G RP  D N  WP  MG        Y   M    +  D 
Sbjct  336  LNLDYEGVLTAWADQRSPWTNGERPELDSNDSWPHCMGN-------YMGIMNENVTIVDR  388

Query  526  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLL  350
            GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++        PNY L
Sbjct  389  GREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTNFVTTTT--PNYPL  445



>ref|XP_006656860.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Oryza brachyantha]
Length=336

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 100/222 (45%), Positives = 117/222 (53%), Gaps = 35/222 (16%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG---DDDVGEDKAT--------------AAVKIEINGGDCTEAL  836
            +D EL EFAAD+E LLG   DD   ED                   VK+E +G D    L
Sbjct  111  TDAELREFAADMEALLGRGLDDGNDEDSFCMETLGLIEPGGDDGGRVKVEADG-DAGLTL  169

Query  835  NWSFGEEQEVEQKVMMTMLSGFDessssmes-----gsckeEVAKKSRMLLSLNYEEVIS  671
             W    + E     M+ +   FD  S    +      S     A +S + LSLNYE +I 
Sbjct  170  PWCNDLDPETSSGEMLDI--DFDCGSPQAATPDEKVASSGAADALQSSLALSLNYEAIIE  227

Query  670  AWASQGCPWTDGTRPHFDPNHCWP-DFMG-----GDHHHHHPYGSAMMMRRS--DEGREA  515
            +W S   PWTDG RPH   N  WP D+ G          H     A+  R    D GREA
Sbjct  228  SWGSS--PWTDGERPHVKLNDSWPHDYSGVWMAAAGVFGHGEEQQALTPRLQGMDGGREA  285

Query  514  RVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            RVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  286  RVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAT  327



>gb|KFK44524.1| hypothetical protein AALP_AA1G267800 [Arabis alpina]
Length=407

 Score =   139 bits (349),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 96/226 (42%), Positives = 125/226 (55%), Gaps = 40/226 (18%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGD---------DDVGEDKA---------------TAAVKIEING  857
            +D+EL EFAADVETLLG          +++G   +               + A+ +E   
Sbjct  176  TDMELEEFAADVETLLGRGLDNESYVMEELGLSNSEMFKIEKDEDEEEDESKAMNMETFD  235

Query  856  GDCTEALNWSFGEE--QEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRMLLSLNYE  683
             + T A   +F  E  +  E++V+ ++    +E     E         +K+ ++L LNY+
Sbjct  236  ENKTVAFELTFDYESHKTCEEEVIKSVERSSNECIKVKEEE-------QKNVLMLRLNYD  288

Query  682  EVISAWASQGCPWTDGTRPHFDPN--HCWPDF-MG--GDHHHHHPYGSAMMMRR--SDEG  524
             VIS W  QG PW+ G RP  D +  + WP   MG  G   H  P+    +      D G
Sbjct  289  SVISTWGGQGPPWSPGERPELDIDIINTWPSVSMGENGGESHQKPFVGGCLPSSGFGDGG  348

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSSL
Sbjct  349  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSL  394



>emb|CDY03851.1| BnaC07g10760D [Brassica napus]
Length=372

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 113/199 (57%), Gaps = 27/199 (14%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMT  785
            + +EL E+AADVE+LLG    G D  + A+          E L + +      E++ +  
Sbjct  182  TGMELEEYAADVESLLGR---GLDTESYAM----------EELGFDYESHNTYEEEALKN  228

Query  784  MLSGFDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-H  608
            + S  +  +   E         +K+ ++L LNYE VIS W  QG PWT G  P  D +  
Sbjct  229  VESSGECITVKEEE--------QKNVLMLRLNYESVISTWGGQGPPWTSGEPPERDVDIS  280

Query  607  CWPDF-MGGD----HHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRK  443
             WP   MGG+       HH  G        D GREARVSRYREKRRTRLFSKKIRYEVRK
Sbjct  281  GWPVVSMGGNVRESQQKHHVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRK  340

Query  442  LNAEKRPRLKGRFVKRSSL  386
            LNAEKRPR+KGRFVKR+SL
Sbjct  341  LNAEKRPRMKGRFVKRASL  359



>gb|ADK63396.1| B-box type zinc finger protein [Brassica rapa]
Length=265

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 76/110 (69%), Gaps = 4/110 (4%)
 Frame = -1

Query  703  LLSLNYEEVISAWASQGCPWTDGTRPHFDPNH--CWPDFM--GGDHHHHHPYGSAMMMRR  536
            +L L+YE VIS W  QG PWT    P  D N   C  D M   G   HHH Y   + +  
Sbjct  152  MLRLDYESVISTWGGQGTPWTARETPQIDLNMLCCPTDSMVESGGEAHHHNYVRGLGLHM  211

Query  535  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
             + GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  212  GEAGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  261



>ref|XP_004140861.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Cucumis sativus]
 gb|KGN45963.1| hypothetical protein Csa_6G039540 [Cucumis sativus]
Length=334

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 92/221 (42%), Positives = 117/221 (53%), Gaps = 28/221 (13%)
 Frame = -1

Query  961  DVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEE---------QE  809
            DV +++F  DVE  L  +    ++    VK+E    DC     W  GE           +
Sbjct  126  DVNVSDFGGDVERNLEREWFDIEEELGLVKVE---EDC-----WRIGEGFDSDQVDFFMD  177

Query  808  VEQKVMMTMLSGFDessssmesgsckeEVAKKSRML-LSLNYEEVISAWASQGCPWTDGT  632
             E+  M  ++ G        E          K R+L L L+ E VI+AW +   PWT+G 
Sbjct  178  FEEIKMPPLVVGVKNERHEDEGDESGITDKNKRRVLSLRLDCEAVIAAWGNLQSPWTNGQ  237

Query  631  RPHFDPNHCWPDFMG------GDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFS  470
            RP FDP+  WP+ M       G     + + +A +    D GREARVSRYREKRRTRLFS
Sbjct  238  RPDFDPDQPWPNSMDLCEVRYGQRCGEYGFRTAAI---GDGGREARVSRYREKRRTRLFS  294

Query  469  KKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLN  347
            KKIRYEVRKLNAEKRPR+KGRFVKR+  F P P  P   +N
Sbjct  295  KKIRYEVRKLNAEKRPRMKGRFVKRTP-FAPQPTLPIITIN  334



>gb|AIE41596.1| zinc finger protein CONSTANS-LIKE 5 [Lagerstroemia indica]
Length=379

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 93/212 (44%), Positives = 113/212 (53%), Gaps = 17/212 (8%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKATAAVKI------EINGGDCTEALNWSFGEEQE--  809
            S+++LAEFAADVE+LLG     E      + +      E    DC          E E  
Sbjct  169  SELDLAEFAADVESLLGKGLEDESFYMEELGLVDCHDYEKESKDCCLMSGRMVKVEDEEI  228

Query  808  --VEQKVMMTMLSGFDessssmesgsckeEVAKKSRM------LLSLNYEEVISAWASQG  653
              VE K  +  L+ FD +   ME    K     + +        L L+YE V+S+W  + 
Sbjct  229  GDVEDKNQVFELN-FDLTCEEMEEEEYKPRNILEMKQDDFRSNFLKLDYEGVMSSWDDRK  287

Query  652  CPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLF  473
             PWT G RP F+   CWPD +         YG   M+     GREARV RYREKRRTRLF
Sbjct  288  SPWTTGERPEFNSADCWPDSLVSASGAMQAYGGMAMVSGDARGREARVMRYREKRRTRLF  347

Query  472  SKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  377
            SKKIRYEVRKLNAEKRPR+KGRFVKR+ L  P
Sbjct  348  SKKIRYEVRKLNAEKRPRMKGRFVKRACLVAP  379



>emb|CDY51133.1| BnaA07g37160D [Brassica napus]
Length=377

 Score =   135 bits (341),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 91/201 (45%), Positives = 114/201 (57%), Gaps = 26/201 (13%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVG--EDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVM  791
            +D+EL E+AADVETLL D ++G  +D   A    E         L++ +      E++V+
Sbjct  182  TDMELEEYAADVETLL-DMNIGICDDDRDATAPFE---------LSFDYESHNTYEEEVI  231

Query  790  MTMLSGFDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN  611
              +    +      E         +K+ ++L LNY+ VIS W  QG PWT G  P  D +
Sbjct  232  KNIEGSGECVKVKEEE--------QKNVLMLRLNYDSVISTWGGQGPPWTSGEPPERDID  283

Query  610  -HCWPDF-MGGD----HHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEV  449
               WP   MGG+       HH           D GREARVSRYREKRRTRLFSKKIRYEV
Sbjct  284  ISSWPFVSMGGNVRESQQKHHVGVCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEV  343

Query  448  RKLNAEKRPRLKGRFVKRSSL  386
            RKLNAEKRPR+KGRFVKR+SL
Sbjct  344  RKLNAEKRPRMKGRFVKRASL  364



>ref|XP_008445668.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Cucumis 
melo]
 gb|ADN34083.1| zinc finger (B-box type) family protein [Cucumis melo subsp. 
melo]
Length=335

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 90/222 (41%), Positives = 114/222 (51%), Gaps = 29/222 (13%)
 Frame = -1

Query  961  DVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMT-  785
            DV +++F  DVE  L  +    ++    VK+E +         W  GE  + +Q   +  
Sbjct  126  DVNVSDFGGDVEKNLEREWFDIEEELGFVKVEESC--------WRIGEGFDSDQVDFLMD  177

Query  784  --------MLSGFDessssmesgsckeEVAKKSRMLLSL--NYEEVISAWASQGCPWTDG  635
                    ++ G                  K  R +LSL  + E VI+AW +   PWT+G
Sbjct  178  FEEIKIPPLVVGVKNERHEDNEDDESGITNKNKRRVLSLRLDCEAVIAAWGNLQSPWTNG  237

Query  634  TRPHFDPNHCWPDFMG------GDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLF  473
             RP FDP+  WP+ M       G     H   +A M    D GREARVSRYREKRRTRLF
Sbjct  238  QRPDFDPDQPWPNSMEVCEVRYGQRCGEHGLRTAAM---GDGGREARVSRYREKRRTRLF  294

Query  472  SKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLN  347
            SKKIRYEVRKLNAEKRPR+KGRFVKR+  F P P  P   +N
Sbjct  295  SKKIRYEVRKLNAEKRPRMKGRFVKRTP-FPPQPTLPFITIN  335



>ref|XP_010551268.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Tarenaya 
hassleriana]
Length=424

 Score =   134 bits (338),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 78/111 (70%), Gaps = 4/111 (4%)
 Frame = -1

Query  706  MLLSLNYEEVISAWASQGCPWTDGTRPHFD-PNHCWPDFMG---GDHHHHHPYGSAMMMR  539
            ++L L+YE VIS+W  QG PWT G  P  D  N  WP  MG   G  +     G  + M 
Sbjct  303  LMLRLDYESVISSWGGQGPPWTAGEPPELDLKNDSWPISMGEVNGGQYGSGICGVGLTMA  362

Query  538  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
              D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL
Sbjct  363  MGDVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASL  413



>ref|XP_003525256.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Glycine 
max]
Length=365

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 97/224 (43%), Positives = 124/224 (55%), Gaps = 35/224 (16%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMT  785
            SD++ AEFAADVE+LL  +D   D+ +A V     GG+  +       +E+E++  V   
Sbjct  155  SDMDFAEFAADVESLLDKED---DEISACV----GGGEGVQGAMVKVKDEEEIDGDVACY  207

Query  784  MLSGFD--------essssmesgsckeEVA-----------KKSRMLLSLNYEEVISAWA  662
            + S FD        ES  S      +  VA            K  + L LNY+EVI+AW+
Sbjct  208  LESVFDDAFHWNNIESVLSDAREEKEGVVACDGGVGDEEGGTKRDIFLRLNYDEVITAWS  267

Query  661  SQGC-PWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR-RSDEGREARVSRYREKR  488
            SQG  PWT    P F+ ++ +   + G        G    +R   D GREARVSRYREKR
Sbjct  268  SQGSSPWTTSNPPKFNSDYDFSLGLSG------VGGEVRSLRGHLDGGREARVSRYREKR  321

Query  487  RTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNY  356
            RTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR + F     FP Y
Sbjct  322  RTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR-TCFVGANAFPAY  364



>ref|XP_010926126.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Elaeis 
guineensis]
Length=424

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 100/240 (42%), Positives = 122/240 (51%), Gaps = 67/240 (28%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG----------------DDDVGEDKATAAVKIEINGGD------  851
            SD++L EFAA+VETLLG                D    +DK    V+++I+ G       
Sbjct  185  SDLDLDEFAANVETLLGRGLDDGTFCIDALGLIDSAKDDDKGRVKVELDIDAGGGSDVVA  244

Query  850  ---------CTEALNWSFG--------EEQEVEQKVMMTMLSGFDessssmesgsckeEV  722
                      TE L+  FG        EEQ+V ++  M               G   E  
Sbjct  245  CNTDMEIDLSTETLDIDFGRRLRGEEHEEQKVAEEAAMA-----------SGGGGGVERA  293

Query  721  AKKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFM-----------GGDH  578
            A    M+L L+YE VI+AW+  GC PWTDG RP F+ +    DFM           GG  
Sbjct  294  AAGRGMMLRLDYEAVIAAWSCNGCSPWTDGERPQFNLD----DFMMMMWSGGSVREGGGW  349

Query  577  HHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  398
                 YG  + M   + GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVK
Sbjct  350  KVAPVYGE-VGMAAGNGGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVK  408



>ref|XP_009127638.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Brassica rapa]
Length=401

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 96/228 (42%), Positives = 121/228 (53%), Gaps = 40/228 (18%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG----------DDDVGE-----------DKATAAVKI-EINGGD  851
            +D ELA+F+ADVE LLG          +  +GE           ++  A +++ +++  D
Sbjct  175  TDTELAQFSADVEILLGGGTDREYNMEELGLGEMLKVEKEEVEEEEEVATIEVCDLDAAD  234

Query  850  CTEALNWSFG---------EEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRMLL  698
                   SF          EE++ +Q V   M+       S        E+V      +L
Sbjct  235  EITPFVISFEYEYSQKTNLEEEDEKQDVENNMIDVGVNEMSCSIKEEKNEKVH-----ML  289

Query  697  SLNYEEVISAWASQGCPWTDGTRPHFDPNH-CWP-DFM--GGDHHHHHPYGSAMMMRRSD  530
             L+YE VIS W  QG PWT    P  D N  C P D M   G   HHH Y   + +   +
Sbjct  290  RLDYESVISTWGGQGTPWTARETPQIDLNMLCCPTDSMVESGGEAHHHNYVRGLGLHMGE  349

Query  529  EGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
             GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  350  AGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  397



>ref|NP_001051053.1| Os03g0711100 [Oryza sativa Japonica Group]
 gb|AAX95654.1| CCT motif, putative [Oryza sativa Japonica Group]
 gb|ABF98509.1| CCT motif family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF12967.1| Os03g0711100 [Oryza sativa Japonica Group]
 gb|EAY91607.1| hypothetical protein OsI_13241 [Oryza sativa Indica Group]
 dbj|BAH00071.1| unnamed protein product [Oryza sativa Japonica Group]
Length=421

 Score =   133 bits (335),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 88/196 (45%), Positives = 112/196 (57%), Gaps = 37/196 (19%)
 Frame = -1

Query  961  DVELAEFAADVETLL-----GDDDVG-EDKATAAVKIEINGGDCTEALNWSFGEEQEVEQ  800
            D+ELA FAAD+E+LL     G DD+G  D     VK++++      +++ +   E+E  +
Sbjct  215  DMELASFAADMESLLMGVDEGFDDLGFLDDEKPHVKLDLDMDMDFASISPAPAPEREERK  274

Query  799  KVMMTMLSGFDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQGC-PWTDGTRPH  623
            +                          K+  M+L L+YE VI +WA  G  PW  G RP 
Sbjct  275  R--------------------------KRPEMILKLDYEGVIDSWARDGASPWFHGERPR  308

Query  622  FDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRK  443
            FDP+  WPDF  G        G+A+      E REARVSRYREKRRTRLF+KKIRYEVRK
Sbjct  309  FDPSESWPDFPAGSRGG---LGAAVTAVTGGE-REARVSRYREKRRTRLFAKKIRYEVRK  364

Query  442  LNAEKRPRLKGRFVKR  395
            LNAEKRPR+KGRFVKR
Sbjct  365  LNAEKRPRMKGRFVKR  380



>ref|XP_004299078.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Fragaria vesca 
subsp. vesca]
Length=450

 Score =   133 bits (335),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 87/130 (67%), Gaps = 11/130 (8%)
 Frame = -1

Query  721  AKKSRMLLSLNYEEVISAWASQ--GCPWTDGTRPHFDPNHCWPDFMG---GDHHHHHPYG  557
             KK ++ L L+Y+EVI+ W SQ  G P+  G RP  D + C PDFMG   G    H+PYG
Sbjct  318  CKKRKIFLRLDYDEVITKWDSQSNGSPFAFGDRPDIDYD-CLPDFMGTASGAELLHYPYG  376

Query  556  S-----AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  392
                   +    +D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  377  DLNRVIGLHPTMTDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA  436

Query  391  SLFQPPPPFP  362
            S       FP
Sbjct  437  SFAATGSTFP  446



>ref|XP_009105041.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Brassica rapa]
 ref|XP_009105042.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Brassica rapa]
Length=402

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 100/235 (43%), Positives = 134/235 (57%), Gaps = 50/235 (21%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGD---------DDVG---------------EDKATAAVKIEING  857
            +++ELA+F+ADVETLLG          +++G               E+ AT  V  +++ 
Sbjct  172  TEMELAQFSADVETLLGGGTDREFHAMEEIGFGEMLKIEKEEVKEEEEVATREV-CDLDD  230

Query  856  GDCTEALNWSFG---------EEQEVEQKVMMTMLS-GFDessssmesgsckeEVAKKSR  707
             + T     SF          EE + ++ VM  ++  G +E +  ++         K+  
Sbjct  231  ANETSPFEISFDYESSHKTAFEEDDEKEDVMKNLVDVGVNEVTGRIKEEK------KEKV  284

Query  706  MLLSLNYEEVISAWASQGCPWTDGTRPH---FDPNHCWPDFM---GGD-HHHHHPYGSAM  548
            ++L L+YE VIS W SQG PWT   +P     D   C  + M   GG+ HHH+H  G  +
Sbjct  285  LMLRLDYETVISTWGSQGTPWT-ALKPSEIDLDMLCCQTNSMCESGGEAHHHNHFPGLGL  343

Query  547  MMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
             MR + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  344  HMREAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  398



>emb|CDY44890.1| BnaA02g13920D [Brassica napus]
Length=401

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 76/110 (69%), Gaps = 4/110 (4%)
 Frame = -1

Query  703  LLSLNYEEVISAWASQGCPWTDGTRPHFDPNH--CWPDFM--GGDHHHHHPYGSAMMMRR  536
            +L L+YE VIS W  QG PWT    P  D N   C  D M   G   HHH Y   + +  
Sbjct  288  MLRLDYESVISTWGGQGTPWTARETPQIDLNMLCCPTDSMVESGGEAHHHNYVRGLGLHM  347

Query  535  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
             + GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  348  GEAGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  397



>ref|XP_006415872.1| hypothetical protein EUTSA_v10007685mg [Eutrema salsugineum]
 dbj|BAJ34058.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ34225.1| hypothetical protein EUTSA_v10007685mg [Eutrema salsugineum]
Length=433

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 80/118 (68%), Gaps = 7/118 (6%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDFM----GGDHHHHHPYGS  554
            +K+ ++L LNY+ VIS W  QG PWT G  P  D +   WP       GG+ HH   Y  
Sbjct  303  QKNVLMLRLNYDSVISTWGGQGPPWTSGDPPELDIDISGWPAISMVGNGGESHHQKQYVG  362

Query  553  AMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
              +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL
Sbjct  363  GCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASL  420



>ref|XP_007222133.1| hypothetical protein PRUPE_ppa005713mg [Prunus persica]
 gb|EMJ23332.1| hypothetical protein PRUPE_ppa005713mg [Prunus persica]
Length=447

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 81/117 (69%), Gaps = 8/117 (7%)
 Frame = -1

Query  721  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-GDHHHHHPYGS---  554
             KK  + L L+YE VI+AW   G PWT G RP F  + C PD MG      H+PYG    
Sbjct  324  GKKKEIFLRLDYEAVITAW--DGSPWTSGGRPDFS-SECLPDCMGVCGTELHYPYGDLNG  380

Query  553  -AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
              +    +D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S 
Sbjct  381  LGVHPAMADGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF  437



>ref|XP_004512860.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Cicer arietinum]
Length=405

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 100/225 (44%), Positives = 119/225 (53%), Gaps = 26/225 (12%)
 Frame = -1

Query  961  DVELAEFAADVETLLGDDDVGEDKATAAV--KIEINGGDCT--EALNWSFGEEQEVEQKV  794
            DV+LAEFAA+VE+LLG   V E+  T     K E N  D +  E L     E  ++E   
Sbjct  182  DVDLAEFAANVESLLG---VHENSTTQVFDYKQENNEMDASKNEMLKVKDEELDDLESVF  238

Query  793  MMTMLSGF----DessssmesgsckeEVAK-------KSRMLLSLNYEEVISAWASQGCP  647
             MT    F    D ++ ++     +  V         K    L LNYE+VISAW  QG P
Sbjct  239  DMTSDEVFQWNIDCNNETVAQEEKECVVGSFDAKEETKRERFLRLNYEDVISAWNIQGSP  298

Query  646  --WTDGTRPHF-DPNHCWPDFMG---GDHHHHHPYGSAMMMRRSDEGREARVSRYREKRR  485
              WT G  P F   + CW +F+G    D       G  +     D GREARVSRYREKRR
Sbjct  299  SPWTTGNPPKFISHDDCWQNFLGPSGVDEEVRSLRGQLIGNINGDGGREARVSRYREKRR  358

Query  484  TRLFSKKIRYEVRKLNAEKRPRLKGRFVKR--SSLFQPPPPFPNY  356
            TRLF+KKIRYEVRKLNAEKRPR+KGRFVKR           FP Y
Sbjct  359  TRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTTCFAGTTTTSFPTY  403



>emb|CDX81527.1| BnaC02g18310D [Brassica napus]
Length=401

 Score =   132 bits (332),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 77/110 (70%), Gaps = 4/110 (4%)
 Frame = -1

Query  703  LLSLNYEEVISAWASQGCPWTDGTRPHFDPNH-CWP-DFM--GGDHHHHHPYGSAMMMRR  536
            +L L+YE VIS W  QG PWT    P  D N  C P D M   G   HHH Y   + +  
Sbjct  288  MLRLDYESVISTWGGQGTPWTAREPPQIDLNMLCCPTDSMVESGGEAHHHNYVRGLGLHM  347

Query  535  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
             + GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  348  GEAGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  397



>gb|ACX42573.1| CONSTANS-like zinc finger protein [Glycine max]
 gb|KHN21563.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=366

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 96/224 (43%), Positives = 123/224 (55%), Gaps = 31/224 (14%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMT  785
            SD++ AEFAADVE+LL  +D   D+ +A V      G+  +       +E+E++  V   
Sbjct  152  SDMDFAEFAADVESLLDKED---DEISACVGGGEGEGEGVQGAMVKVKDEEEIDGDVACY  208

Query  784  MLSGFD--------essssmesgsckeEVA-----------KKSRMLLSLNYEEVISAWA  662
            + S FD        ES  S      +  VA            K  + L LNY+EVI+AW+
Sbjct  209  LESVFDDAFHWNNIESVLSDAREEKEGVVACDVGVGDEEGGTKRDIFLRLNYDEVITAWS  268

Query  661  SQGC-PWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR-RSDEGREARVSRYREKR  488
            SQG  PWT    P F+ ++ +   + G        G    +R   D GREARVSRYREKR
Sbjct  269  SQGSSPWTTSNPPKFNSDYDFSLGLSG------VGGEVRSLRGHLDGGREARVSRYREKR  322

Query  487  RTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNY  356
            RTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR + F     FP Y
Sbjct  323  RTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR-TCFVGANAFPAY  365



>ref|XP_009410076.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Musa acuminata 
subsp. malaccensis]
Length=423

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 99/234 (42%), Positives = 132/234 (56%), Gaps = 43/234 (18%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKATAAVKIEING--GDCTEALNWSFGE------EQE  809
            SD+E+AEFAA++E+LLG    G D +  +  +E  G      + +N+  G+      EQ 
Sbjct  197  SDMEIAEFAANMESLLGG---GLDVSDGSFSMEKLGLVNSIEDGVNYCLGDAGRLKTEQP  253

Query  808  -------VEQKVMM---TMLSGFDessssmes-----------gsckeEVAKKSRMLLSL  692
                   VE  + M   T+   F+ + SS               + +++V +K+R  LSL
Sbjct  254  DDTVGCPVELDIDMSRETLELDFNWTGSSTAEEEEFEEEKIMVATEQQQVTQKAR--LSL  311

Query  691  NYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMG----GDHHHHHPYGSAMMMRRSDE  527
            +YE VI AW+S G  PWTDG RP  + + CW D  G    G       +GS      +D 
Sbjct  312  DYEAVIIAWSSHGSSPWTDGERPQINLDSCWHDCTGMWVEGADALGVGHGSDTGGGYADV  371

Query  526  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPF  365
            GR+ARV+RYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+    P P F
Sbjct  372  GRQARVTRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRA----PGPAF  421



>ref|XP_008243227.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Prunus mume]
Length=451

 Score =   132 bits (331),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 82/117 (70%), Gaps = 8/117 (7%)
 Frame = -1

Query  721  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG-GDHHHHHPYGSAMM  545
            +KK  + L L+YE VI+AW   G PWT G RP F+ + C PD MG      H PYG    
Sbjct  328  SKKKEIFLRLDYEAVITAW--DGSPWTSGGRPDFN-SECLPDCMGVCGTELHFPYGDLNG  384

Query  544  M----RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            +      +D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+S 
Sbjct  385  LWVHPAIADGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASF  441



>emb|CDY04230.1| BnaC06g25850D [Brassica napus]
Length=230

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 111/205 (54%), Gaps = 66/205 (32%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMT  785
            + +ELA+F+ADVETLL +++V   + +  +K                   +E ++KV+M 
Sbjct  76   TQMELAQFSADVETLL-EEEVATREMSGRIK-------------------EEEKEKVLM-  114

Query  784  MLSGFDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHC  605
                                        L L+YE VISAW S   PWT       +P+  
Sbjct  115  ----------------------------LRLDYENVISAWGSHRTPWTA-----LEPSEI  141

Query  604  WPDFM----------GGD-HHHHHPYGSAMMMRRS-DEGREARVSRYREKRRTRLFSKKI  461
              D +          GG+ HHH+H  G  + MR + D GREARVSRYREKRRTRLFSKKI
Sbjct  142  DLDMLRRQTNSVCESGGEAHHHNHFRGLGLHMREAGDGGREARVSRYREKRRTRLFSKKI  201

Query  460  RYEVRKLNAEKRPRLKGRFVKRSSL  386
            RYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  202  RYEVRKLNAEKRPRMKGRFVKRSSI  226



>gb|AAG52391.1|AC011915_5 putative B-box zinc finger protein; 52092-50677 [Arabidopsis 
thaliana]
Length=405

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 97/233 (42%), Positives = 126/233 (54%), Gaps = 46/233 (20%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDD-----VGEDKATAAVKI----------------EINGGDC  848
            +D+ELA+F ADVETLLG  D     + E      +KI                + + GD 
Sbjct  175  TDMELAQFTADVETLLGGGDREFHSIEELGLGEMLKIEKEEVEEEGVVTREVHDQDEGDE  234

Query  847  TEALNWSFGEE-----------QEVEQKVMMTMLS-GFDessssmesgsckeEVAKKSRM  704
            T     SF  E           ++ ++ VM  ++  G +E S  ++         K+  +
Sbjct  235  TSPFEISFDYEYTHKTTFDEGEEDEKEDVMKNVMEMGVNEMSGGIKEEK------KEKAL  288

Query  703  LLSLNYEEVISAWASQGCPWTDGTRPHFDPNH-CWPDFMGGD-----HHHHHPYGSAMMM  542
            +L L+YE VIS W  QG PWT       D +  C+P    G+     HHH+H  G  + +
Sbjct  289  MLRLDYESVISTWGGQGIPWTARVPSEIDLDMVCFPTHTMGESGAEAHHHNHFRGLGLHL  348

Query  541  RRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
              + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  349  GDAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  401



>ref|NP_564932.1| zinc finger protein CONSTANS-LIKE 6 [Arabidopsis thaliana]
 sp|Q8LG76.2|COL6_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 6 [Arabidopsis 
thaliana]
 gb|AAK96816.1| putative B-box zinc finger protein [Arabidopsis thaliana]
 gb|AAM10103.1| putative B-box zinc finger protein [Arabidopsis thaliana]
 gb|AEE34802.1| zinc finger protein CONSTANS-LIKE 6 [Arabidopsis thaliana]
Length=406

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 97/233 (42%), Positives = 126/233 (54%), Gaps = 46/233 (20%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDD-----VGEDKATAAVKI----------------EINGGDC  848
            +D+ELA+F ADVETLLG  D     + E      +KI                + + GD 
Sbjct  176  TDMELAQFTADVETLLGGGDREFHSIEELGLGEMLKIEKEEVEEEGVVTREVHDQDEGDE  235

Query  847  TEALNWSFGEE-----------QEVEQKVMMTMLS-GFDessssmesgsckeEVAKKSRM  704
            T     SF  E           ++ ++ VM  ++  G +E S  ++         K+  +
Sbjct  236  TSPFEISFDYEYTHKTTFDEGEEDEKEDVMKNVMEMGVNEMSGGIKEEK------KEKAL  289

Query  703  LLSLNYEEVISAWASQGCPWTDGTRPHFDPNH-CWPDFMGGD-----HHHHHPYGSAMMM  542
            +L L+YE VIS W  QG PWT       D +  C+P    G+     HHH+H  G  + +
Sbjct  290  MLRLDYESVISTWGGQGIPWTARVPSEIDLDMVCFPTHTMGESGAEAHHHNHFRGLGLHL  349

Query  541  RRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
              + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  350  GDAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  402



>emb|CDY67920.1| BnaAnng25560D [Brassica napus]
Length=348

 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 102/197 (52%), Gaps = 51/197 (26%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEAL-NWSFGEEQEVEQKVMM  788
            +D+EL EFAADVE LL                 +N G C EA+ N    + +E EQK + 
Sbjct  180  TDMELEEFAADVEILLA----------------MNMGICCEAIKNADCIKVEEEEQKNV-  222

Query  787  TMLSGFDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH  608
                                       ++LSLNYE VIS W  QG PW     P  D + 
Sbjct  223  ---------------------------LMLSLNYESVISTWGGQGQPWLSREPPERDIDI  255

Query  607  -----CWPDFMGGDHHHHHPYGSAMMMRR-SDEGREARVSRYREKRRTRLFSKKIRYEVR  446
                    +  GG+ HH H  G  +      D GREARVSRYREKRRTRLFSKKIRYEVR
Sbjct  256  SDKPVVSMEINGGESHHKHYVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVR  315

Query  445  KLNAEKRPRLKGRFVKR  395
            KLNAEKRPR+KGRFVKR
Sbjct  316  KLNAEKRPRMKGRFVKR  332



>ref|XP_010667660.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Beta vulgaris 
subsp. vulgaris]
Length=429

 Score =   131 bits (329),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 78/119 (66%), Gaps = 8/119 (7%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG--GDHHHHHPYGSAMM  545
            K+ ++LL L+YE +  AWAS G PW +G RP  + + CWP  M   G    H  +G   M
Sbjct  302  KRRKILLRLDYEAISDAWASHGSPWINGQRPQINSDDCWPHCMATCGLEGRHPIFGDHQM  361

Query  544  MRRSDEG------REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
                         REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS 
Sbjct  362  GGMGGNRGIGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSF  420



>gb|EAZ36554.1| hypothetical protein OsJ_20892 [Oryza sativa Japonica Group]
Length=448

 Score =   130 bits (328),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 96/226 (42%), Positives = 117/226 (52%), Gaps = 41/226 (18%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG---DDDVGEDK--------------ATAAVKIEINGGDCTEAL  836
            +D EL EFAAD+E LLG   DD   ED                   VK+E +G D    L
Sbjct  213  TDAELREFAADMEALLGRGLDDGNDEDSFCMETLGLIEPVDDDAGRVKVEADG-DAGMTL  271

Query  835  NWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVA------------KKSRMLLSL  692
             W    + E     M+ +   FD  S    +   ++  +            ++S + LSL
Sbjct  272  AWCHELDTETSSGEMLDI--DFDCGSPQAATTPDEKVGSSGPAAADDDAQLQQSNLALSL  329

Query  691  NYEEVISAWASQGCPWTDGTRPHFDPNHCWP-DFMG-----GDHHHHHPYGSAMMMRRS-  533
            NYE +I +W +   PWTDG RPH   +  WP D+ G          H     A+  R   
Sbjct  330  NYEAIIESWGTS--PWTDGERPHVKLDDSWPRDYSGVWMAAAGVFGHGGEEQALTPRLGM  387

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  388  DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  433



>gb|EEE59794.1| hypothetical protein OsJ_12314 [Oryza sativa Japonica Group]
Length=201

 Score =   126 bits (316),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 77/109 (71%), Gaps = 5/109 (5%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMM  542
            K+  M+L L+YE VI +WA  G  PW  G RP FDP+  WPDF  G        G+A+  
Sbjct  22   KRPEMILKLDYEGVIDSWARDGASPWFHGERPRFDPSESWPDFPAGSRGG---LGAAVTA  78

Query  541  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
                E REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  79   VTGGE-REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  126



>ref|XP_002888669.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64928.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 82/117 (70%), Gaps = 6/117 (5%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH-CWPDFMGGD----HHHHHPYGS  554
            K+  ++L L+YE VIS W  QG PWTD      D +  C P    G+    HHH+H  G 
Sbjct  292  KEKALMLRLDYESVISTWNGQGIPWTDREPSEIDLDMVCCPTHSLGESGEAHHHNHFRGL  351

Query  553  AMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
             + M  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  352  GLHMGEAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  408



>ref|XP_006391130.1| hypothetical protein EUTSA_v10018663mg [Eutrema salsugineum]
 gb|ESQ28416.1| hypothetical protein EUTSA_v10018663mg [Eutrema salsugineum]
Length=399

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 93/225 (41%), Positives = 117/225 (52%), Gaps = 36/225 (16%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGD---------DDVG-----------EDKATAAVKIEINGGDCT  845
            +D+ELA+F ADVETLLG          +++G           E+ AT  V    +  D T
Sbjct  175  TDMELAQFTADVETLLGGGIEREIHDMEELGLGEMLKIEHEEEEVATREVCDLNDADDET  234

Query  844  EALNWSFGEEQEVEQKV----------MMTMLSGFDessssmesgsckeEVAKKSRMLLS  695
                 SF  E   +             ++  ++G   +  S      K    K++  +L 
Sbjct  235  SPFEISFDYEYSNKTASEEEGEEEKEDVIKNMTGVKVNEMSCTVKEEK----KENVPMLR  290

Query  694  LNYEEVISAWASQGCPWTDGTRPHFDPNH--CWPDFMGGDHHHHHPYGSAMMMRRSDEGR  521
            L+Y+ VIS W  QG PWT    P  D +   C P+     HH+H       M    D GR
Sbjct  291  LDYQAVISTWGGQGTPWTALEPPEIDLDMLCCSPNSTAHQHHNHFHGLGLRMGDAGDGGR  350

Query  520  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  351  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  395



>gb|EYU26768.1| hypothetical protein MIMGU_mgv1a006045mg [Erythranthe guttata]
Length=460

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 92/246 (37%), Positives = 121/246 (49%), Gaps = 53/246 (22%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGD-----------------DDVGE-----DKATAAVKIEINGGD  851
            S+++LAEFAADVE+LLG                  DD  E     +  +  VK+E +  +
Sbjct  205  SEMDLAEFAADVESLLGKGLEDESFDMEGLGLLDCDDEREKLKWANLVSERVKVEDDDEE  264

Query  850  CTEALNWSFGEEQ-EVEQKVMMTMLSGFDessssmesgsckeEVAKKS------------  710
            C        G E  E+       +    +E           E +A  +            
Sbjct  265  CNNGEFIDIGRETFELNFDYNSPITGEDEEEEEEDNKIENVEPIAMNNFEDSNSKMFDSK  324

Query  709  RMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMG--------GDHHHHHPYG-  557
            ++ L L+Y+ V+S+W  +  PWT G RP  D + CWPD  G        G+HHH      
Sbjct  325  KIFLRLDYDGVLSSWDERKSPWTTGERPDLDSDECWPDCSGTCGKMHVYGNHHHDMGMMM  384

Query  556  ---------SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  404
                     S  ++   D GR+ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRF
Sbjct  385  MMMGGGGTHSGAVVASVDGGRQARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRF  444

Query  403  VKRSSL  386
            VKR++ 
Sbjct  445  VKRANF  450



>gb|AAM61001.1| putative B-box zinc finger protein [Arabidopsis thaliana]
Length=405

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 95/232 (41%), Positives = 123/232 (53%), Gaps = 44/232 (19%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDD-----VGEDKATAAVKI----------------EINGGDC  848
            +D+ELA+F ADVETLLG  D     + E      +KI                + + GD 
Sbjct  175  TDMELAQFTADVETLLGGGDREFHSIEELGLGEMLKIEKEEVEEEGVVTREVHDQDEGDE  234

Query  847  TEALNWSFGEE-----------QEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRML  701
            T     SF  E           ++ ++ VM  ++          E     +E  K+  ++
Sbjct  235  TSPFEISFDYEYTHKTTFDEGEEDEKEDVMKNVME-----MGVNEMSGGIKEEKKEKALM  289

Query  700  LSLNYEEVISAWASQGCPWTDGTRPHFDPNH-CWPDFMGGD-----HHHHHPYGSAMMMR  539
            L L+YE VIS W  QG PWT       D +  C+P    G+     HHH+H  G  + + 
Sbjct  290  LRLDYESVISTWGGQGIPWTARVPSEIDLDMVCFPTHTMGESGAEAHHHNHFRGLGLHLG  349

Query  538  RS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
             + D GREARVSRYREKRRTRLFSKKIRYEVRKLNA+KRPR+KGRFVKRSS+
Sbjct  350  DAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNADKRPRMKGRFVKRSSI  401



>ref|XP_009103068.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brassica 
rapa]
Length=408

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 95/225 (42%), Positives = 119/225 (53%), Gaps = 43/225 (19%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKATAAV-----------KIE-------INGGDCTE-  842
            +D+EL E+AADVETLLG    G D  + A+           KIE       +N G C + 
Sbjct  182  TDMELEEYAADVETLLGR---GLDTESYAMEELGLSNKEMFKIEKEEETKDMNIGICDDD  238

Query  841  -------ALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRMLLSLNYE  683
                    L++ +      E++V+  +    +      E         +K+ ++L LNY+
Sbjct  239  RDATAPFELSFDYESHNTYEEEVIKNIEGSGECVKVKEEE--------QKNVLMLRLNYD  290

Query  682  EVISAWASQGCPWTDGTRPHFDPN-HCWPDF-MGGD----HHHHHPYGSAMMMRRSDEGR  521
             VIS W  Q  PWT G  P  D +   WP   MGG+       HH           D GR
Sbjct  291  SVISTWGGQCPPWTSGEPPERDIDISNWPFVSMGGNVRESQQKHHVGVCLPSSGFGDGGR  350

Query  520  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL
Sbjct  351  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASL  395



>ref|XP_010499109.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Camelina sativa]
Length=419

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 98/232 (42%), Positives = 118/232 (51%), Gaps = 49/232 (21%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGD---------DDVG-----------------EDKATAAVKIEI  863
            +D+EL EFAADVETLLG          +D+G                 E +   A+ +EI
Sbjct  179  TDMELEEFAADVETLLGRGLDTESYAMEDLGFSNTEMFKVEKDEIEEEEVEEKKAINMEI  238

Query  862  ------NGGDCTEALNWSFGEE---QEVEQKVMMTMLSGFDessssmesgsckeEVAKKS  710
                     D T     SF  E   +  E++VM  + S  +      E         +K+
Sbjct  239  FDDDDRKDVDGTVPFELSFDYESSHKTSEEEVMKNVESSGECVVKVKEE-------EEKN  291

Query  709  RMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDF----MGGDHHHHHPYGSAMM  545
             ++L LNY+ VIS W  QG PWT G  P  D +   WP       GGD  H   Y    +
Sbjct  292  VLMLRLNYDSVISTWGGQGPPWTSGEPPELDIDISSWPPVSMGEFGGDQSHQKQYVGGCL  351

Query  544  MRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
                  D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  352  PSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  403



>ref|XP_010460379.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X2 [Camelina sativa]
Length=419

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 98/232 (42%), Positives = 118/232 (51%), Gaps = 49/232 (21%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGD---------DDVG-----------------EDKATAAVKIEI  863
            +D+EL EFAADVETLLG          +D+G                 E +   A+ +EI
Sbjct  179  TDMELEEFAADVETLLGRGLDTESYAMEDLGFSNTEMFKVEKDEIEEEEVEEKKAINMEI  238

Query  862  ------NGGDCTEALNWSFGEE---QEVEQKVMMTMLSGFDessssmesgsckeEVAKKS  710
                     D T     SF  E   +  E++VM  + S  +      E         +K+
Sbjct  239  FDDDDRKDVDGTVPFELSFDYESSHKTSEEEVMKNVESSGECVVKVKEE-------EEKN  291

Query  709  RMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDF----MGGDHHHHHPYGSAMM  545
             ++L LNY+ VIS W  QG PWT G  P  D +   WP       GGD  H   Y    +
Sbjct  292  VLMLRLNYDSVISTWGGQGPPWTSGEPPKLDIDISSWPPVSMGEFGGDQSHQKQYVGGCL  351

Query  544  MRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
                  D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  352  PSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  403



>emb|CDY65591.1| BnaC05g50730D [Brassica napus]
Length=348

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 88/196 (45%), Positives = 101/196 (52%), Gaps = 49/196 (25%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMT  785
            +D+EL EFAADVE LL            A+ + I    C E      G  +E EQK ++ 
Sbjct  180  TDMELEEFAADVEILL------------AMNMGIG---CGEDRGDGDGTVKEEEQKNVL-  223

Query  784  MLSGFDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH-  608
                                       +LSLNYE VIS W  QG PW  G  P  D +  
Sbjct  224  ---------------------------MLSLNYESVISTWGGQGQPWMSGEPPERDIDIS  256

Query  607  ----CWPDFMGGDHHHHHPYGSAMMMRR-SDEGREARVSRYREKRRTRLFSKKIRYEVRK  443
                   +  GG+ HH H  G  +      D GREARVSRYREKRRTRLFSKKIRYEVRK
Sbjct  257  DKPVVSMEINGGESHHKHYVGGCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRK  316

Query  442  LNAEKRPRLKGRFVKR  395
            LNAEKRPR+KGRFVKR
Sbjct  317  LNAEKRPRMKGRFVKR  332



>ref|XP_010460378.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Camelina sativa]
Length=419

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 98/232 (42%), Positives = 118/232 (51%), Gaps = 49/232 (21%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGD---------DDVG-----------------EDKATAAVKIEI  863
            +D+EL EFAADVETLLG          +D+G                 E +   A+ +EI
Sbjct  179  TDMELEEFAADVETLLGRGLDTESYAMEDLGFSNTEMFKVEKDEIEEEEVEEKKAINMEI  238

Query  862  ------NGGDCTEALNWSFGEE---QEVEQKVMMTMLSGFDessssmesgsckeEVAKKS  710
                     D T     SF  E   +  E++VM  + S  +      E         +K+
Sbjct  239  FDDDDRKDVDGTVPFELSFDYESSHKTSEEEVMKNVESSGECVVKVKEE-------EEKN  291

Query  709  RMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDF----MGGDHHHHHPYGSAMM  545
             ++L LNY+ VIS W  QG PWT G  P  D +   WP       GGD  H   Y    +
Sbjct  292  VLMLRLNYDSVISTWGGQGRPWTSGEPPELDIDISSWPPVSMGEFGGDQSHQKQYVGGCL  351

Query  544  MRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
                  D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  352  PSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  403



>ref|XP_007160372.1| hypothetical protein PHAVU_002G316100g [Phaseolus vulgaris]
 gb|ESW32366.1| hypothetical protein PHAVU_002G316100g [Phaseolus vulgaris]
Length=369

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 97/227 (43%), Positives = 121/227 (53%), Gaps = 40/227 (18%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMT  785
            SD++ AEFAADVE LL  +D   D+ +A V     GG    A+     +E++++  V   
Sbjct  158  SDMDFAEFAADVENLLVKED---DERSACV-----GGGVQGAMA-KVKDEEDIDGDVACY  208

Query  784  MLSGFDessssmesgsckeEV----------------------AKKSRMLLSLNYEEVIS  671
            + S FD S+      +  E V                        K  + L LNY+EVIS
Sbjct  209  LESVFDMSNDDTLHWNSIESVLSDAGEEKACVVASDGGVGEEEGTKRDIFLRLNYDEVIS  268

Query  670  AWASQGC-PWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR-RSDEGREARVSRYR  497
            AW++QG  PWT    P F+  +   DF  G        G    +R   D GREARVSRYR
Sbjct  269  AWSTQGSSPWTTSNPPKFNSGY---DFCLG---LSGVDGEVRSLRGHLDGGREARVSRYR  322

Query  496  EKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNY  356
            EKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR + F     FP Y
Sbjct  323  EKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR-TCFVGVNAFPAY  368



>ref|XP_002466587.1| hypothetical protein SORBIDRAFT_01g010420 [Sorghum bicolor]
 gb|EER93585.1| hypothetical protein SORBIDRAFT_01g010420 [Sorghum bicolor]
Length=420

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 107/197 (54%), Gaps = 40/197 (20%)
 Frame = -1

Query  961  DVELAEFAADVETLL-----GDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQK  797
            D+ELA FAAD+E+LL     G DD+G        K ++N     EA+     E ++ ++ 
Sbjct  219  DMELASFAADMESLLMGVHDGFDDLG---FLDEEKPQVNADAYLEAMAAPVPEREDKKR-  274

Query  796  VMMTMLSGFDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQ-GCPWTDGTRPHF  620
                                      K+  M+L LNY+ VI++W    G PW  G RPH 
Sbjct  275  --------------------------KRPEMILKLNYDGVIASWVRDGGSPWFHGERPHL  308

Query  619  DPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKL  440
            DP   W DF  G        G A+      E REARVSRYREKRRTRLF+KKIRYEVRK+
Sbjct  309  DPYELWSDFPAGSRGL---LGGAVTAVTGGE-REARVSRYREKRRTRLFAKKIRYEVRKV  364

Query  439  NAEKRPRLKGRFVKRSS  389
            NAEKRPR+KGRFVKR++
Sbjct  365  NAEKRPRMKGRFVKRTT  381



>gb|EMS53816.1| Zinc finger protein CONSTANS-LIKE 16 [Triticum urartu]
Length=282

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 90/224 (40%), Positives = 120/224 (54%), Gaps = 40/224 (18%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG-----DDDVGEDKATAAV----KIEINGGDCTEALNW--SFGE  818
            +D EL EFAAD+E LLG     D D  E     A+     ++++GG     ++   + G 
Sbjct  51   TDAELMEFAADMEALLGRPGMDDGDEEEPFCMEALGLIEPMDVDGGRVKLEIDPMRACGL  110

Query  817  EQEVE-QKVMMTMLSGFDessssmesgsckeEVAKKSR-----MLLSLNYEEVISAWASQ  656
            EQ+ E    M  +   +D    + +  +     + +++     + L+LNYE ++  W S 
Sbjct  111  EQKPEVSGDMFDIDFDYDSPLGTPDENAASSGASAEAQFTPRSLALNLNYEAIMENWGSS  170

Query  655  GCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR---------------RSDEGR  521
              PW DG RPH   + CWP      H ++     A MM                R D GR
Sbjct  171  --PWADGERPHVKLDDCWP------HDYYSLQEGAWMMGGVVGHGGEGLGTPRLRMDGGR  222

Query  520  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  223  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  266



>ref|XP_003560836.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Brachypodium 
distachyon]
Length=436

 Score =   128 bits (321),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 95/226 (42%), Positives = 119/226 (53%), Gaps = 38/226 (17%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG---DDDVGE-----------------DKATAAVKIEINGGDCT  845
            +D EL EFAAD+E LLG   D+   E                 D A   VK+E +G    
Sbjct  205  TDAELMEFAADMEALLGRGLDEGTEEEPFCMEALGLIQPMVDVDGAGGRVKMETDGE--A  262

Query  844  EALNWSFGEEQEVEQKVMMTMLS-GFDessssmesgsckeEVA-KKSRML-----LSLNY  686
              +  + G E+E E +V   ML   FD+   S ++   +   +   +R L     L+LNY
Sbjct  263  RGMFLACGLEREPETEVSGNMLGIDFDDDYGSPQATPDENAASGSAARFLPRSLSLNLNY  322

Query  685  EEVISAWASQGCPWTDGTRPHFDPNHCWPD-------FMGGDHHHHHPYGSAMMMRRSDE  527
            E +I  W  +  PW DG RP    + CWP         MGG    H          + D 
Sbjct  323  EAIIDKW--EKSPWADGKRPDVKLDGCWPHDYSMSVWMMGGVLVGHGTEELRTPRTKMDG  380

Query  526  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            GR+ARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  381  GRDARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  426



>ref|XP_006302328.1| hypothetical protein CARUB_v10020384mg [Capsella rubella]
 gb|EOA35226.1| hypothetical protein CARUB_v10020384mg [Capsella rubella]
Length=410

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 81/120 (68%), Gaps = 9/120 (8%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH--CWPDFMGGD-----HHHHHPY  560
            K+  ++L LNYE VIS W  QG PWT       D +   C  D MG       HH++H  
Sbjct  287  KEKALMLRLNYESVISTWGGQGIPWTAQQPSEIDLDMVCCPTDSMGESGVDQAHHYNHFR  346

Query  559  GSAMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            G  + M  +  D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  347  GLGLRMGEAHGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSV  406



>ref|XP_006307606.1| hypothetical protein CARUB_v10009230mg [Capsella rubella]
 gb|EOA40504.1| hypothetical protein CARUB_v10009230mg [Capsella rubella]
Length=424

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 98/229 (43%), Positives = 119/229 (52%), Gaps = 44/229 (19%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTE------------------A  839
            +D+EL EFAADVETLL     G    T +  +E  G   TE                  A
Sbjct  184  TDMELEEFAADVETLL-----GRGLETESYAMEDLGFSNTEMFKVEKDEIEEEEVEDIKA  238

Query  838  LNWSFGEE--QEVEQKVMMTMLSGFDessssmesgsckeE------VAK------KSRML  701
            +N    ++  ++V+  V   +   ++ S  + E    K        V K      K+ ++
Sbjct  239  INMEIFDDDRKDVDGTVPFELTFDYESSHKTAEEEEIKNVESSGECVVKVKEEEGKNVLM  298

Query  700  LSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDF-MG---GDHHHHHPYGSAMMMRR  536
            L LNY+ VIS W  QG PWT G  P  D +   WP   MG   GD  H   Y S  +   
Sbjct  299  LRLNYDSVISTWGGQGQPWTSGEPPELDIDISSWPPVSMGETKGDLSHQKQYVSVCLPSS  358

Query  535  S--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
               D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  359  GFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  407



>ref|XP_004982006.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Setaria 
italica]
Length=406

 Score =   127 bits (319),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 83/189 (44%), Positives = 107/189 (57%), Gaps = 27/189 (14%)
 Frame = -1

Query  961  DVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMTM  782
            D+ELA FAAD+E+LL   D G D                   +  F +E++ +  V    
Sbjct  201  DMELASFAADMESLLMGVDEGFD-------------------DLGFLDEEKPQVNVD---  238

Query  781  LSGFDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQG-CPWTDGTRPHFDPNHC  605
            L   +  + ++ +    ++  K+  M+L LNY+ VI++WA  G  PW  G RPH DP+  
Sbjct  239  LGSMNLETMAVPAPERDDKKRKRPEMILKLNYDGVIASWARDGGSPWFHGERPHLDPHES  298

Query  604  WPDFMGGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKR  425
            W DF  G        G  +      E REARVSRYREKRRTRLF+KKIRYEVRKLNAEKR
Sbjct  299  WSDFPAGSRGL---LGGTVTAVTGGE-REARVSRYREKRRTRLFAKKIRYEVRKLNAEKR  354

Query  424  PRLKGRFVK  398
            PR+KGRFVK
Sbjct  355  PRMKGRFVK  363



>ref|XP_010477926.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Camelina 
sativa]
Length=419

 Score =   127 bits (320),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 73/111 (66%), Gaps = 7/111 (6%)
 Frame = -1

Query  706  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDF----MGGDHHHHHPYGSAMMM  542
            ++L LNY+ VIS W  QG PWT G  P  D +   WP       GGD  H   Y    + 
Sbjct  293  LMLRLNYDSVISTWGGQGRPWTSGEPPELDIDISSWPPVSMGEFGGDQSHQKQYVGGCLP  352

Query  541  RRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
                 D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  353  SSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  403



>emb|CDX77359.1| BnaC08g04040D [Brassica napus]
Length=160

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 74/112 (66%), Gaps = 1/112 (1%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDFMGGDHHHHHPYGSAMMM  542
            KK+ ++L LNY+ VIS W  QG PWT G  P  D +   WP            +      
Sbjct  36   KKNVLMLRLNYDSVISTWGGQGPPWTSGEPPERDIDISSWPFVSMRKSAEASRWWMFTFE  95

Query  541  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
               D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+SL
Sbjct  96   WVWDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRASL  147



>ref|XP_010527538.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Tarenaya 
hassleriana]
Length=443

 Score =   127 bits (320),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 102/253 (40%), Positives = 132/253 (52%), Gaps = 65/253 (26%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG---------------------------------DDDVGEDKAT  884
            +D+ELAEFAADV+TLLG                                 ++DV E++  
Sbjct  184  TDMELAEFAADVDTLLGHNLETESFATEDLGLGDGLSVCGRSSSMMLKLENEDVHEEETV  243

Query  883  A--AVKIEI----NGGDCTEALNWSFGEEQE---------VEQKVMMTMLSGFDessssm  749
            A     +E+     G D T     SF ++            E+K ++ + +G  ES  S 
Sbjct  244  AREGTPMELFYERKGMDMT-PFELSFDQDHSHRAFEEEEEDEEKNVINVNTGERESVRSG  302

Query  748  esgsckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFD-PNHCWPDFMG--GDH  578
             S +    + KK+ ++L LN+E VIS W  +G PWT G  P  D  ++ W   MG  G+ 
Sbjct  303  GSSNISHSIKKKNVLMLRLNHEAVISTWGGKGPPWTAGKPPELDLDDNSWHISMGENGNE  362

Query  577  HHHHPYG---------SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKR  425
                 YG         +AMM    D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKR
Sbjct  363  VPLDRYGGRFCGLGLQAAMM----DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKR  418

Query  424  PRLKGRFVKRSSL  386
            PR+KGRFVKR+S+
Sbjct  419  PRMKGRFVKRASI  431



>ref|XP_010460380.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X3 [Camelina sativa]
Length=427

 Score =   127 bits (319),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 73/111 (66%), Gaps = 7/111 (6%)
 Frame = -1

Query  706  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDF----MGGDHHHHHPYGSAMMM  542
            ++L LNY+ VIS W  QG PWT G  P  D +   WP       GGD  H   Y    + 
Sbjct  301  LMLRLNYDSVISTWGGQGRPWTSGEPPELDIDISSWPPVSMGEFGGDQSHQKQYVGGCLP  360

Query  541  RRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
                 D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  361  SSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  411



>gb|EMT27110.1| hypothetical protein F775_43077 [Aegilops tauschii]
Length=343

 Score =   125 bits (315),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 90/224 (40%), Positives = 119/224 (53%), Gaps = 40/224 (18%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG-----DDDVGEDKATAAV----KIEINGGDCTEALNW--SFGE  818
            +D EL EFAAD+E LLG     D D  E     A+     ++++GG     ++   + G 
Sbjct  112  TDAELMEFAADMEALLGRPGMDDGDEEEPFCMEALGLIEPMDVDGGRVKLEIDPMRACGL  171

Query  817  EQEVE-QKVMMTMLSGFDessssmesgsckeEVAKKSR-----MLLSLNYEEVISAWASQ  656
            EQ+ E    M  +   +D    + +  +     +  ++     + L+LNYE ++  W S 
Sbjct  172  EQKPEVSGDMFDIDFDYDSPLGTPDENAASSGASADAQFTPRSLALNLNYEAIMENWGSS  231

Query  655  GCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR---------------RSDEGR  521
              PW DG RPH   + CWP      H ++     A MM                R D GR
Sbjct  232  --PWADGERPHVKLDDCWP------HDYYSLQEGAWMMGGVVGHGGEGLGTPRLRMDGGR  283

Query  520  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  284  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  327



>gb|EAZ00428.1| hypothetical protein OsI_22452 [Oryza sativa Indica Group]
Length=447

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 92/225 (41%), Positives = 112/225 (50%), Gaps = 38/225 (17%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG---DDDVGEDK--------------ATAAVKIEINGGDCTEAL  836
            +D EL EFAAD+E LLG   DD   ED                   VK+E + GD    L
Sbjct  213  TDAELREFAADMEALLGRGLDDGNDEDSFCMETLGLIEPVDDDAGRVKVEAD-GDAGMTL  271

Query  835  NWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVA-----------KKSRMLLSLN  689
             W    + E     M+ +   +    ++                      ++S + LSLN
Sbjct  272  AWCHELDTETSSGEMLDIDFDYGSPQAATTPDEKVGSSGPAAAADDDAQFQQSSLALSLN  331

Query  688  YEEVISAWASQGCPWTDGTRPHFDPNHCWP-DFMG-----GDHHHHHPYGSAMMMRRS-D  530
            YE +I +W +   PWTDG RP    +  WP D+ G          H     A+  R   D
Sbjct  332  YEAIIESWGTS--PWTDGERPRVKLDDSWPRDYSGVWMAAAGVFGHGGEEQALTPRLGMD  389

Query  529  EGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
             GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  390  GGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  434



>gb|AAM13173.1| unknown protein [Arabidopsis thaliana]
Length=417

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 95/233 (41%), Positives = 117/233 (50%), Gaps = 53/233 (23%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKATAAVK-IEINGG----------------------  854
            +D+EL EFAADVETLLG    G D  + A++ +E++                        
Sbjct  181  TDMELEEFAADVETLLGR---GLDTESYAMEELELSNSEMFKIEKDEIEEEVEEIKAMSM  237

Query  853  ----------DCTEALNWSFGEE---QEVEQKVMMTMLSGFDessssmesgsckeEVAKK  713
                      D T     SF  E   +  E++VM  + S  +      E          K
Sbjct  238  DIFDDDRKDVDGTVPFELSFDYESSHKTSEEEVMKNVESSGECVVKVKEEE-------HK  290

Query  712  SRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDFM----GGDHHHHHPYGSAM  548
            + ++L LNY+ VIS W  QG PW+ G  P  D +   WP F     GG+  H   Y    
Sbjct  291  NVLMLRLNYDSVISTWGGQGPPWSSGEPPERDMDISGWPAFSMVENGGESTHQKQYVGGC  350

Query  547  MMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  351  LPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  403



>ref|XP_003559520.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6 [Brachypodium 
distachyon]
Length=423

 Score =   126 bits (316),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 87/201 (43%), Positives = 110/201 (55%), Gaps = 19/201 (9%)
 Frame = -1

Query  961  DVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMTM  782
            D+ELA FAAD+E+LL   D G D        ++   D  +      G +   +     T+
Sbjct  219  DMELASFAADMESLLMGVDSGYD--------DLGFLDDEKPQMNHLGFDDMQDDFDQSTV  270

Query  781  LSGFDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHC  605
                   +   E      +  +  +M+L L+YE VIS+W   G  PW  G RPH D +  
Sbjct  271  AP----PAPQEEEQQEDRKRKRPDQMILKLDYEGVISSWTHDGASPWFYGERPHLDSSDS  326

Query  604  WPDFMGGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKR  425
            W DF  G        G+A+      E REARVSRYREKRRTRLF+KKIRYEVRKLNAEKR
Sbjct  327  WLDFPAGSGRGFG-LGAAVTAVTGGE-REARVSRYREKRRTRLFAKKIRYEVRKLNAEKR  384

Query  424  PRLKGRFVKRSSLFQPPPPFP  362
            PR+KGRFVKR++L    PP P
Sbjct  385  PRMKGRFVKRAAL----PPLP  401



>ref|NP_173915.2| zinc finger protein CONSTANS-LIKE 16 [Arabidopsis thaliana]
 sp|Q8RWD0.2|COL16_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 16 [Arabidopsis 
thaliana]
 gb|AAU90068.1| At1g25440 [Arabidopsis thaliana]
 dbj|BAE98579.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE30625.1| zinc finger protein CONSTANS-LIKE 16 [Arabidopsis thaliana]
Length=417

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 95/230 (41%), Positives = 114/230 (50%), Gaps = 47/230 (20%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKA-------------------------TAAVKIEI-  863
            +D+EL EFAADVETLLG     E  A                           A+ ++I 
Sbjct  181  TDMELEEFAADVETLLGRGLDTESYAMEELGLSNSEMFKIEKDEIEEEVEEIKAMSMDIF  240

Query  862  ----NGGDCTEALNWSFGEE---QEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRM  704
                   D T     SF  E   +  E++VM  + S  +      E          K+ +
Sbjct  241  DDDRKDVDGTVPFELSFDYESSHKTSEEEVMKNVESSGECVVKVKEEE-------HKNVL  293

Query  703  LLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDFM----GGDHHHHHPYGSAMMMR  539
            +L LNY+ VIS W  QG PW+ G  P  D +   WP F     GG+  H   Y    +  
Sbjct  294  MLRLNYDSVISTWGGQGPPWSSGEPPERDMDISGWPAFSMVENGGESTHQKQYVGGCLPS  353

Query  538  RS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
                D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  354  SGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  403



>ref|XP_010470801.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Camelina sativa]
 ref|XP_010470802.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Camelina sativa]
Length=413

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 82/119 (69%), Gaps = 8/119 (7%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGCPWT--DGTRPHFDPNHCWPDFMGGD-----HHHHHPY  560
            K+  ++L L+YE V+S W  QG PWT  + +    D   C  D MG       HH++H  
Sbjct  291  KEKALMLRLDYESVLSTWGGQGIPWTAQEPSEIDLDMVCCPTDSMGESGADQAHHYNHFR  350

Query  559  GSAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            G  + M  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  351  GLGLHMGEAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  409



>gb|AAG50803.1|AC079281_5 zinc finger protein, putative [Arabidopsis thaliana]
Length=416

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 95/230 (41%), Positives = 114/230 (50%), Gaps = 47/230 (20%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKA-------------------------TAAVKIEI-  863
            +D+EL EFAADVETLLG     E  A                           A+ ++I 
Sbjct  180  TDMELEEFAADVETLLGRGLDTESYAMEELGLSNSEMFKIEKDEIEEEVEEIKAMSMDIF  239

Query  862  ----NGGDCTEALNWSFGEE---QEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRM  704
                   D T     SF  E   +  E++VM  + S  +      E          K+ +
Sbjct  240  DDDRKDVDGTVPFELSFDYESSHKTSEEEVMKNVESSGECVVKVKEEE-------HKNVL  292

Query  703  LLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDFM----GGDHHHHHPYGSAMMMR  539
            +L LNY+ VIS W  QG PW+ G  P  D +   WP F     GG+  H   Y    +  
Sbjct  293  MLRLNYDSVISTWGGQGPPWSSGEPPERDMDISGWPAFSMVENGGESTHQKQYVGGCLPS  352

Query  538  RS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
                D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  353  SGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  402



>gb|ABF98510.1| CCT motif family protein, expressed [Oryza sativa Japonica Group]
Length=345

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 77/109 (71%), Gaps = 5/109 (5%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMM  542
            K+  M+L L+YE VI +WA  G  PW  G RP FDP+  WPDF  G        G+A+  
Sbjct  200  KRPEMILKLDYEGVIDSWARDGASPWFHGERPRFDPSESWPDFPAGSRGG---LGAAVTA  256

Query  541  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
                E REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  257  VTGGE-REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  304



>ref|XP_010415472.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Camelina 
sativa]
Length=427

 Score =   125 bits (314),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 69/119 (58%), Positives = 82/119 (69%), Gaps = 8/119 (7%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGCPWT--DGTRPHFDPNHCWPDFMGGD-----HHHHHPY  560
            K+  ++L L+YE V+S W  QG PWT  + +    D   C  D MG       HH++H  
Sbjct  305  KEKALMLRLDYESVLSTWGGQGIPWTAQEPSEIDLDMVCCPTDSMGETGADQAHHYNHFR  364

Query  559  GSAMMMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            G  + M  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  365  GLGLHMGEAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  423



>ref|XP_009115317.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brassica 
rapa]
Length=414

 Score =   125 bits (314),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 94/219 (43%), Positives = 117/219 (53%), Gaps = 29/219 (13%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDD-DVGEDKATAAVKIE-------------INGGDCTEALNWS  827
            +D+EL EFAADVE LLG   DV E  A   + +                 G+ T+A+N  
Sbjct  180  TDMELEEFAADVEILLGRGLDVTESYAMEELGLSNTEMFKIEKDEIEEEEGEETKAMNMG  239

Query  826  F--GEEQ-EVEQKVMMTMLSGFDessssmesgsckeEVAK------KSRMLLSLNYEEVI  674
               GE++ + +  V   +    D  ++  E      +  K      K+ ++LSLNYE VI
Sbjct  240  ICCGEDRGDGDGTVAFELRFDHDSHNTYEEEAIKNADCIKVEEEEQKNVLMLSLNYESVI  299

Query  673  SAWASQGCPWTDGTRPHFDPNH-----CWPDFMGGDHHHHHPYGSAMMMRR-SDEGREAR  512
            S W  QG PW     P  D +         +  GG+ HH H  G  +      D GREAR
Sbjct  300  STWGGQGQPWLSREPPERDIDISDKPVVSMEINGGESHHKHYVGGCLPSSGFGDGGREAR  359

Query  511  VSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            VSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  360  VSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  398



>ref|XP_011648856.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Cucumis sativus]
 gb|KGN63817.1| hypothetical protein Csa_1G023050 [Cucumis sativus]
Length=360

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 89/213 (42%), Positives = 111/213 (52%), Gaps = 37/213 (17%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDV---------GEDKATAAVKIEINGGDCTEALNWSFGEEQ  812
            S+V+LAEF ADVE LLG  D          G       VK E    DC    N   G   
Sbjct  163  SEVDLAEFVADVENLLGRQDDEEQQQQDHDGNTNIIVKVKDEDLVQDCINKNNNHNG---  219

Query  811  EVEQKVMMTMLSGFDessssmesgsckeEVAKKSRML-LSLNYEEVISAWASQGCPWTDG  635
                      L  +D      E    + ++  K  ++ L LNY+ VI+AW +Q  P+T G
Sbjct  220  ---------YLMDWDFKEEIEEEEEEELKIKNKKNIISLRLNYDAVITAWDAQSSPYTTG  270

Query  634  TRPHFDPNHCWPDFMG-----------GDHHHHHPYGSAMMMRRSDEGREARVSRYREKR  488
             RP FD + CW ++ G            D        + +    S+E REARVSRYREKR
Sbjct  271  NRPQFDLDDCWEEWSGVCSKGGRNVVVDDQEWRGRNNNGI----SNEEREARVSRYREKR  326

Query  487  RTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            RTRLFSKKIRY+VRKLNAEKRPR+KGRFVKR++
Sbjct  327  RTRLFSKKIRYQVRKLNAEKRPRMKGRFVKRTT  359



>ref|XP_009381448.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Musa acuminata 
subsp. malaccensis]
Length=422

 Score =   125 bits (313),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 84/121 (69%), Gaps = 12/121 (10%)
 Frame = -1

Query  724  VAKKSRMLLSLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMGGDHHHHHP-----  563
            V KK++  L L+YE VISAW+S G  PWTDG RP  + ++ WPD+MG             
Sbjct  297  VTKKAK--LRLDYEAVISAWSSYGSSPWTDGERPQINLDYYWPDYMGVRVEVGGGGRGET  354

Query  562  ----YGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
                +GS   +   D GR+ARV+RYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  355  PGTGHGSDTGVGFVDVGRQARVTRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  414

Query  394  S  392
            +
Sbjct  415  A  415



>ref|XP_008453390.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Cucumis melo]
Length=368

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 90/218 (41%), Positives = 115/218 (53%), Gaps = 47/218 (22%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG-----DDDVGEDKATAAVKI--EINGGDCTEA--------LNW  830
            S+V+LAEF ADVE LLG     +     D  T  VK+  E    DC           ++W
Sbjct  170  SEVDLAEFVADVENLLGKEEEEEQQQQHDGNTIIVKVKDEELVQDCINKNNNHNGFWMDW  229

Query  829  SFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQGC  650
             F EE E E++    +                 +   KK+ + L LNY+ VI+AW +Q  
Sbjct  230  DFKEEIEEEEEDEEEL-----------------KIKNKKNIISLRLNYDAVITAWDAQSS  272

Query  649  PWTDGTRPHFDPNHCWPDFMG-----------GDHHHHHPYGSAMMMRRSDEGREARVSR  503
            P+T G RP FD + C  ++ G            D      Y   +    S+  REARVSR
Sbjct  273  PYTTGNRPQFDLDDCLEEWSGICSKGGRNVAVDDQEWRRNYNGII----SNGEREARVSR  328

Query  502  YREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            YREKRRTRLFSKKIRY+VRKLNAEKRPR+KGRFVKR++
Sbjct  329  YREKRRTRLFSKKIRYQVRKLNAEKRPRMKGRFVKRTT  366



>ref|NP_001048022.1| Os02g0731700 [Oryza sativa Japonica Group]
 dbj|BAD15938.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAD16131.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAF09936.1| Os02g0731700 [Oryza sativa Japonica Group]
 gb|EEE57750.1| hypothetical protein OsJ_08268 [Oryza sativa Japonica Group]
Length=323

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 93/237 (39%), Positives = 123/237 (52%), Gaps = 48/237 (20%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGD--DDVGEDK----------------ATAAVKIEINGGDCTEA  839
            +D EL EFAAD+E LLG   DD  E +                 +  VK+E++GG  + +
Sbjct  91   TDAELREFAADMEALLGQGLDDSNELQDSFYMETLGLITPPVEESGRVKMELDGGVASNS  150

Query  838  -----LNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRML-----LSLN  689
                    +  + ++VE   ++ +   F+ +S   +  S     A  S+       L LN
Sbjct  151  RVSLPSCRAHPKPEDVESADVLDI--DFNCTSPDEQKSSASNGAAADSQFFHRSLDLRLN  208

Query  688  YEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSA---------MMM--  542
            YE +I +W +   PWTDG  PH   +  WP+    DHH+   + +          MM   
Sbjct  209  YEAIIESWGNS--PWTDGRPPHGQLDDFWPN----DHHYSGLWAAGGGGHGAEVGMMTVR  262

Query  541  -RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  374
             R    GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR S    P
Sbjct  263  PRMDGPGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPSAAAAP  319



>gb|EEC73943.1| hypothetical protein OsI_08813 [Oryza sativa Indica Group]
Length=324

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 123/238 (52%), Gaps = 49/238 (21%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGD--DDVGEDK----------------ATAAVKIEINGGDCTEA  839
            +D EL EFAAD+E LLG   DD  E +                 ++ VK+E++GG  + +
Sbjct  91   TDAELREFAADMEALLGQGLDDSNELQDSFYMETLGLITPPVEESSRVKMELDGGVASSS  150

Query  838  -----LNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRML-----LSLN  689
                    +  + ++VE   ++ +   F+ +S   +  S     A  S+       L LN
Sbjct  151  RVSLPSCRAHPKPEDVESADVLDI--DFNCTSPDEQKSSASNGAAADSQFFHRSLDLRLN  208

Query  688  YEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSA----------MMM-  542
            YE +I +W +   PWTDG  PH   +  WP+    DHH+      A          MM  
Sbjct  209  YEAIIESWGNS--PWTDGRPPHGQLDDFWPN----DHHYSVRVVGAGGGGHGAEVGMMTV  262

Query  541  --RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  374
              R    GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR S    P
Sbjct  263  RPRMDGPGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPSAAAAP  320



>ref|XP_006649016.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Oryza brachyantha]
Length=331

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 75/116 (65%), Gaps = 17/116 (15%)
 Frame = -1

Query  700  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPY------------G  557
            L LNYEE+I +W S   PWTDG RPH    H   DF   DHH+   +             
Sbjct  212  LRLNYEEIIESWGS--SPWTDGRRPH---GHQLDDFWPNDHHYQGLWAAGGGGHGAEAGT  266

Query  556  SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            + M  R    GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR +
Sbjct  267  TVMRPRMDGPGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPA  322



>gb|AFK49208.1| unknown [Medicago truncatula]
Length=197

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 76/116 (66%), Gaps = 5/116 (4%)
 Frame = -1

Query  715  KSRMLLSLNYEEVISAWASQGCP--WTDGTRPHFD-PNHCWPDFMG--GDHHHHHPYGSA  551
            K    L LNYEEVI+ W+ QG P  WT    P F+  +  W + +G  G           
Sbjct  70   KRERFLRLNYEEVITEWSRQGSPSPWTTANPPKFNCDDDSWQNLLGSSGVEGEVRSLRGQ  129

Query  550  MMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  383
            +M    D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++ F
Sbjct  130  LMGSGGDGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTACF  185



>ref|XP_010428333.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like [Camelina 
sativa]
Length=403

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 86/209 (41%), Positives = 113/209 (54%), Gaps = 27/209 (13%)
 Frame = -1

Query  961  DVELAEFAADVETLLGDDD----VGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKV  794
            D++L E   DVE+LL ++     V E  ++  VK E N G   E  +      ++ E++V
Sbjct  200  DMDLGEIVMDVESLLEEEQPFLRVKELNSSGLVKEETNVG--FEFDSKDLKRVKDEEEEV  257

Query  793  MMTMLSGFDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFD-  617
            +     G D+ +   E         +K+ + L L+YE VISAW + G PW  G +P F+ 
Sbjct  258  VKCEHGGSDQEACEDED--------RKASLFLRLDYEAVISAWDNHGSPWETGIKPEFNL  309

Query  616  -------PNHCWPDFMGGDHHHHHPYGSAMMMRRSDEG-----REARVSRYREKRRTRLF  473
                    N C    MGG         S    +  D G     REARV RYREKRRTRLF
Sbjct  310  DGCLLGGNNTCPSHVMGGFEELASAVRSVTRQQGRDGGGSDVEREARVLRYREKRRTRLF  369

Query  472  SKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            +KKIRYEVRKLNAE+RPR+KGRFVKR+SL
Sbjct  370  AKKIRYEVRKLNAEQRPRIKGRFVKRTSL  398



>ref|XP_010907326.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Elaeis 
guineensis]
Length=367

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 116/208 (56%), Gaps = 39/208 (19%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDD-DVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMM  788
            SD ELAEFAA++E+LLG   D  E+ +    K E++ G                     M
Sbjct  197  SDDELAEFAANMESLLGKGLDNSENPSEHGTKAELDNG---------------------M  235

Query  787  TMLSGFDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH  608
             M +         +S    E+   + ++ L L+YE +++AW+S   PWT+G RP F+ + 
Sbjct  236  EMATS-------RQSMKKGEKAVSRKKVALRLDYEAIMAAWSSS--PWTNGARPQFNLDV  286

Query  607  C-WPDFMGGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAE  431
            C WPD MG                   + RE++V+RYREKRRTRLF+KKIRYEVR+LNAE
Sbjct  287  CSWPD-MG-----MWAGEGGEDKGGGRQERESKVTRYREKRRTRLFAKKIRYEVRRLNAE  340

Query  430  KRPRLKGRFVKRSSLFQPPPPFPNYLLN  347
            KRPR+KGRFVKR+S+  P P F   +L+
Sbjct  341  KRPRMKGRFVKRASM-APTPAFAGPVLD  367



>ref|NP_001149548.1| CCT motif family protein [Zea mays]
 gb|ACG35795.1| CCT motif family protein [Zea mays]
 gb|AFW67846.1| CCT motif family protein [Zea mays]
 gb|AIB05334.1| C2C2-CO-like transcription factor, partial [Zea mays]
Length=413

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 84/193 (44%), Positives = 109/193 (56%), Gaps = 32/193 (17%)
 Frame = -1

Query  961  DVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMTM  782
            D+ELA FAAD+E+LL             + ++ +G DC   L+         E+K  +  
Sbjct  209  DMELASFAADMESLL-------------MGVDDDGFDCLGFLD---------EEKPQVNA  246

Query  781  LSGFDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQG-CPWTDGTRPHFDPNHC  605
                D  +    +   +++  K+  M+L LNYE VI++W   G  PW  G RPH D +  
Sbjct  247  ----DLDAIVAPAPEPEDKKRKRPEMILKLNYEGVIASWVRDGGSPWFHGERPHLDCHEL  302

Query  604  WPD-FMGGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEK  428
            W D F  G        G A+      E REARVSRYREKRRTRLF+KKIRYEVRKLNAEK
Sbjct  303  WSDDFTTGSREL---LGGAVTPVTGGE-REARVSRYREKRRTRLFAKKIRYEVRKLNAEK  358

Query  427  RPRLKGRFVKRSS  389
            RPR+KGRFVKR++
Sbjct  359  RPRMKGRFVKRAT  371



>ref|XP_010511849.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1 
[Camelina sativa]
Length=415

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 78/115 (68%), Gaps = 8/115 (7%)
 Frame = -1

Query  706  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH--CWPDFMGGD-----HHHHHPYGSAM  548
            ++L L+YE V+S W  QG PWT       D +   C  D MG       HH++H  G   
Sbjct  297  LMLRLDYESVLSTWGGQGIPWTAQKPSEIDLDMVCCPTDSMGESGADQAHHYNHFRGLGF  356

Query  547  MMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
             M  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKRSS+
Sbjct  357  HMGEAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRSSI  411



>ref|NP_001057333.2| Os06g0264200 [Oryza sativa Japonica Group]
 dbj|BAD54363.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAF19247.2| Os06g0264200 [Oryza sativa Japonica Group]
Length=481

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 96/259 (37%), Positives = 119/259 (46%), Gaps = 74/259 (29%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG---DDDVGEDK--------------ATAAVKIEINGGDCTEAL  836
            +D EL EFAAD+E LLG   DD   ED                   VK+E +G D    L
Sbjct  213  TDAELREFAADMEALLGRGLDDGNDEDSFCMETLGLIEPVDDDAGRVKVEADG-DAGMTL  271

Query  835  NWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVA------------KKSRMLLSL  692
             W    + E     M+ +   FD  S    +   ++  +            ++S + LSL
Sbjct  272  AWCHELDTETSSGEMLDI--DFDCGSPQAATTPDEKVGSSGPAAADDDAQLQQSNLALSL  329

Query  691  NYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSA------------M  548
            NYE +I +W +   PWTDG RPH   +  WP           PY S+            +
Sbjct  330  NYEAIIESWGTS--PWTDGERPHVKLDDSWPRDYSVRATPCTPYASSHRILHNLAGTDDL  387

Query  547  MMRRS----------------------------DEGREARVSRYREKRRTRLFSKKIRYE  452
            + RR+                            D GREARVSRYREKRRTRLFSKKIRYE
Sbjct  388  LRRRAAVQGVWMAAAGVFGHGGEEQALTPRLGMDGGREARVSRYREKRRTRLFSKKIRYE  447

Query  451  VRKLNAEKRPRLKGRFVKR  395
            VRKLNAEKRPR+KGRFVKR
Sbjct  448  VRKLNAEKRPRMKGRFVKR  466



>ref|XP_002890690.1| hypothetical protein ARALYDRAFT_472829 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66949.1| hypothetical protein ARALYDRAFT_472829 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 76/115 (66%), Gaps = 7/115 (6%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDFM----GGDHHHHHPYGS  554
            +K+ +LL LNY+ VIS W  QG PW+ G  P  D +   WP       GG+  H   Y  
Sbjct  288  QKNVLLLRLNYDSVISTWGGQGPPWSSGVPPERDMDISGWPAVSMGENGGECTHKKQYVG  347

Query  553  AMMMRRS--DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
              +      D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  348  GCLPSSGFGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKR  402



>ref|XP_007153446.1| hypothetical protein PHAVU_003G036000g [Phaseolus vulgaris]
 gb|ESW25440.1| hypothetical protein PHAVU_003G036000g [Phaseolus vulgaris]
Length=384

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 103/239 (43%), Positives = 127/239 (53%), Gaps = 47/239 (20%)
 Frame = -1

Query  964  SDVELAEFAADVETLL-----------------GDDDVGEDKA------TAAVKIEIN--  860
            S  E+A F+ADVE+LL                 G D+V E  +         +K+E    
Sbjct  156  SAFEIA-FSADVESLLREGLESECVGMEELGLVGTDEVEEHASWECCVGGGNMKVEEEAY  214

Query  859  --GGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRMLLSLNY  686
              G DC   LN+S   E EV++KV+     G D+    ++    +    KK  +LL L+Y
Sbjct  215  ELGFDCGHELNFSLTCE-EVKEKVI-----GLDKRQEVVKEDDQR---KKKKILLLRLDY  265

Query  685  EEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGG-----DHHHHHPYGSAMMMRRSDEGR  521
            E VI+AW SQ   WT   +P       WP  M       +H     +G    M  +D GR
Sbjct  266  EAVITAWTSQRSLWTTSHKPDLGTTQFWPHCMRTCGVEFEHRSGELFGCDAAM--ADGGR  323

Query  520  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNYLLNR  344
            EARVSRYREKRR RLFSKKIRYEVRKLNAEKRPR+KGRFVKR SL   PP FP  LLN+
Sbjct  324  EARVSRYREKRRKRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPSL-ATPPIFP--LLNK  379



>dbj|BAD15937.1| zinc finger protein-like [Oryza sativa Japonica Group]
 dbj|BAD16130.1| zinc finger protein-like [Oryza sativa Japonica Group]
Length=452

 Score =   122 bits (307),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 93/237 (39%), Positives = 123/237 (52%), Gaps = 48/237 (20%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGD--DDVGEDK----------------ATAAVKIEINGGDCTEA  839
            +D EL EFAAD+E LLG   DD  E +                 +  VK+E++GG  + +
Sbjct  220  TDAELREFAADMEALLGQGLDDSNELQDSFYMETLGLITPPVEESGRVKMELDGGVASNS  279

Query  838  -----LNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRML-----LSLN  689
                    +  + ++VE   ++ +   F+ +S   +  S     A  S+       L LN
Sbjct  280  RVSLPSCRAHPKPEDVESADVLDI--DFNCTSPDEQKSSASNGAAADSQFFHRSLDLRLN  337

Query  688  YEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSA---------MMM--  542
            YE +I +W +   PWTDG  PH   +  WP+    DHH+   + +          MM   
Sbjct  338  YEAIIESWGNS--PWTDGRPPHGQLDDFWPN----DHHYSGLWAAGGGGHGAEVGMMTVR  391

Query  541  -RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPP  374
             R    GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR S    P
Sbjct  392  PRMDGPGREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRPSAAAAP  448



>ref|XP_003630849.1| CONSTANS-like zinc finger protein [Medicago truncatula]
 gb|AET05325.1| zinc finger constans-like protein [Medicago truncatula]
Length=416

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 90/226 (40%), Positives = 118/226 (52%), Gaps = 36/226 (16%)
 Frame = -1

Query  961  DVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMTM  782
            DV+LAEFAA+VE+LLG   VG  +       ++        ++ S  E  +V+ + +  +
Sbjct  182  DVDLAEFAANVESLLG---VGSSEIQENSSGQVFDYKQENEMDASKSEMLKVKDEELDDL  238

Query  781  LSGFDess-------------------------ssmesgsckeEVAK---KSRMLLSLNY  686
             S FD +S                         S+   G  +  + K   K    L LNY
Sbjct  239  ESVFDMTSDDVFHWNIDNNDVSLAQQEKEYMPLSNSSVGYSESVITKEETKRERFLRLNY  298

Query  685  EEVISAWASQGCP--WTDGTRPHFD-PNHCWPDFMG--GDHHHHHPYGSAMMMRRSDEGR  521
            EEVI+ W+ QG P  WT    P F+  +  W + +G  G           +M    D GR
Sbjct  299  EEVITEWSRQGSPSPWTTANPPKFNCDDDSWQNLLGSSGVEGEVRSLRGQLMGSGGDGGR  358

Query  520  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  383
            EARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++ F
Sbjct  359  EARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTACF  404



>dbj|BAK04456.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=410

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 88/202 (44%), Positives = 112/202 (55%), Gaps = 37/202 (18%)
 Frame = -1

Query  961  DVELAEFAADVETLL------GDDDV---GEDKATAAVKIEINGGDCTEALNWSFGEEQE  809
            D+ELA FAAD+E+LL      G DD+    E+K    +  ++   D  ++ + +   EQE
Sbjct  208  DMELASFAADMESLLMGGVEEGYDDLRFLDEEKPQLNLDFDMADFD-DQSQSAAPAPEQE  266

Query  808  VEQKVMMTMLSGFDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQG-CPWTDGT  632
            +E +      SG                      M+L L+YE VI +WA  G  PW  G 
Sbjct  267  LEDRKRKRSDSG----------------------MILKLDYERVIDSWAHDGGSPWFYGE  304

Query  631  RPHFDP-NHCWPDFMGGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRY  455
            RPH DP +  W D   G        G+A+      E REARVSRYREKRRTRLF+KKIRY
Sbjct  305  RPHIDPTDDSWLDMPAGSRGFG--LGAAVTAVTGGE-REARVSRYREKRRTRLFAKKIRY  361

Query  454  EVRKLNAEKRPRLKGRFVKRSS  389
            EVRKLNAEKRPR+KGRFVKR++
Sbjct  362  EVRKLNAEKRPRMKGRFVKRTA  383



>emb|CDY24402.1| BnaCnng04690D [Brassica napus]
Length=369

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 113/203 (56%), Gaps = 15/203 (7%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMT  785
            +++E+ +FAADVETLLG    G DK +    +E  G   TE L     E++E +   M  
Sbjct  159  TNMEVEDFAADVETLLGH---GLDKESYT--MEELGLSNTEMLKKDEIEDKETKAMNMDI  213

Query  784  MLSGFDessssmesgsckeEVAK----KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFD  617
             +   D+ +      + +   AK    K+ ++LSL+Y++VIS W  QG PWT G  P  D
Sbjct  214  EICDDDQGNRDGTMPNGECVQAKEEKKKNVLMLSLDYDQVISTWGGQGLPWTSGGPPDID  273

Query  616  PNHCWPDFM----GGDHHHHHPYGSAMMMRR--SDEGREARVSRYREKRRTRLFSKKIRY  455
             N      +     G        G   +      D GREARVSRYREK++TR F+K IRY
Sbjct  274  INISGSPVVSKRDNGRKSRKKRRGGGRLPSSVVGDGGREARVSRYREKKKTRSFTKTIRY  333

Query  454  EVRKLNAEKRPRLKGRFVKRSSL  386
            EVRKLNAE +PR+KGRFVKR+SL
Sbjct  334  EVRKLNAENKPRMKGRFVKRASL  356



>ref|XP_010416209.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like [Camelina 
sativa]
Length=401

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 78/124 (63%), Gaps = 13/124 (10%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFD--------PNHCWPDFMGGDHHHHHP  563
            +K+ + L L+YE VISAW + G PW  G +P F+         N C    MGG       
Sbjct  273  RKTTLFLRLDYEAVISAWDNHGSPWETGIKPEFNLDGCLLGGNNTCPSHVMGGFEELASA  332

Query  562  YGSAMMMRRSDEG-----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  398
             GS    +  D G     REAR+ RYREKRRTRLF+KKIRYEVRKLNAE+RPR+KGRFVK
Sbjct  333  VGSVTRQQGRDRGGSDVEREARMLRYREKRRTRLFAKKIRYEVRKLNAEQRPRIKGRFVK  392

Query  397  RSSL  386
            R+SL
Sbjct  393  RTSL  396



>ref|NP_177528.1| zinc finger protein CONSTANS-LIKE 7 [Arabidopsis thaliana]
 sp|Q9C9A9.1|COL7_ARATH RecName: Full=Zinc finger protein CONSTANS-LIKE 7 [Arabidopsis 
thaliana]
 gb|AAG52532.1|AC016662_26 hypothetical protein; 93964-92656 [Arabidopsis thaliana]
 gb|AAU84677.1| At1g73870 [Arabidopsis thaliana]
 gb|AAV43785.1| At1g73870 [Arabidopsis thaliana]
 gb|AEE35518.1| zinc finger protein CONSTANS-LIKE 7 [Arabidopsis thaliana]
Length=392

 Score =   121 bits (304),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 82/210 (39%), Positives = 106/210 (50%), Gaps = 28/210 (13%)
 Frame = -1

Query  961  DVELAEFAADVETLLGD----------DDVGEDKATAAVKIEINGGDCTEALNWSFGEEQ  812
            D++L +   DVE+LL +          +DVG  K    V  EIN  D            +
Sbjct  193  DMDLEDLTMDVESLLEEEQLCLGFKEPNDVGVIKEENKVGFEINCKDL-----------K  241

Query  811  EVEQKVMMTMLSGFDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGT  632
             V+ +      +  +   S         +  +K+ + L L+Y  VISAW + G PW  G 
Sbjct  242  RVKDEDEEEEEAKCENGGSKDSDREASNDKDRKTSLFLRLDYGAVISAWDNHGSPWKTGI  301

Query  631  RPH--FDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEG-----REARVSRYREKRRTRLF  473
            +P      N C P  +GG        GS    +  D G     REARV RY+EKRRTRLF
Sbjct  302  KPECMLGGNTCLPHVVGGYEKLMSSDGSVTRQQGRDGGGSDGEREARVLRYKEKRRTRLF  361

Query  472  SKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  383
            SKKIRYEVRKLNAE+RPR+KGRFVKR+SL 
Sbjct  362  SKKIRYEVRKLNAEQRPRIKGRFVKRTSLL  391



>ref|XP_010471465.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Camelina sativa]
Length=402

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 78/124 (63%), Gaps = 13/124 (10%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFD--------PNHCWPDFMGGDHHHHHP  563
            +K+ + L L+YE VISAW + G PW  G +P F+         N C    MGG       
Sbjct  274  RKASLFLRLDYEAVISAWDNHGSPWETGIKPEFNLDCCLLGGNNTCPSHVMGGFDELESA  333

Query  562  YGSAMMMRRSDEG-----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  398
             GS    +  D G     REARV RYR+KRRTRLF+KKIRYEVRKLNAE+RPR+KGRFVK
Sbjct  334  VGSVTRQQGRDGGGSDVEREARVLRYRDKRRTRLFAKKIRYEVRKLNAEQRPRIKGRFVK  393

Query  397  RSSL  386
            R+SL
Sbjct  394  RTSL  397



>dbj|BAK01505.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=432

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 88/226 (39%), Positives = 122/226 (54%), Gaps = 42/226 (19%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGD---DDVGEDK-----ATAAVK-IEINGGDCTEALNW--SFGE  818
            +D EL EFAAD+E LLG    DD  E++     A   ++ +++ GG     ++   + G 
Sbjct  199  TDAELMEFAADMEALLGRPGMDDGNEEEPFCMEALGLIEPMDVEGGRVKLEIDPMRACGL  258

Query  817  EQEVEQKVMMTMLS---GFDessssmesgsckeEVAKKSR-----MLLSLNYEEVISAWA  662
            EQ+ E    M  +     +D    + +  +     +  ++     + L+LNY+ ++  W 
Sbjct  259  EQKPEVSGDMFDIDFDYHYDSPQGTPDENAGSSGASADAQFTPRSLALNLNYDAIMENWG  318

Query  661  SQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR---------------RSDE  527
            S   PW DG RP+   + CWP      H ++  +  A MM                R D 
Sbjct  319  SS--PWADGERPNVKLDDCWP------HDYYSLHEGAWMMGGVVGHGGEGLGTPRPRMDG  370

Query  526  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  371  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAN  416



>ref|XP_004965182.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Setaria 
italica]
Length=445

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 95/233 (41%), Positives = 117/233 (50%), Gaps = 48/233 (21%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGD-------------------DDVGEDKATAAVKIEINGGDCTE  842
            +D EL EFAAD+E LLG                    D V +D   A VK+EI+GG   +
Sbjct  209  TDAELREFAADMEALLGRGLDDGNEDSSFYMETLGLLDPVDDDAGVARVKLEIDGGGAFD  268

Query  841  ALNW-SFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAK----------KSRMLLS  695
            A    + G + E E    M  +  FD  S                        ++ + L+
Sbjct  269  ASGTPACGVQLEAEASDEMLDID-FDYGSPQETPDDKAASSDTSAAATDAQFLQTSLSLT  327

Query  694  LNYEEVISAWASQGCPWT-DGTRPHFDPNHCWP-DFMG------GDHHHHHPYGS---AM  548
            LNYE +I +W S   PWT  G RPH   +  WP D+           H     G+    M
Sbjct  328  LNYEAIIQSWGSS--PWTGSGERPHVKLDGSWPHDYTSMWVVGGMVGHVGEELGTPRLGM  385

Query  547  MMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            M    D GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  386  M----DGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRAT  434



>ref|NP_001149457.1| zinc finger protein CONSTANS-LIKE 16 [Zea mays]
 gb|ACG35514.1| zinc finger protein CONSTANS-LIKE 16 [Zea mays]
Length=456

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 97/240 (40%), Positives = 118/240 (49%), Gaps = 57/240 (24%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG---DD-------------------DVGEDKATAAVKIEINGGD  851
            +D EL EFAAD+E LLG   DD                   +VGED +   VK+E + G 
Sbjct  215  TDAELREFAADMEALLGYGLDDGNEESSSFCMETLGLLEPVEVGEDASR--VKVETDAGS  272

Query  850  CTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKS-----------RM  704
              EA        + ++      ML   D +  S +  +  E  A  S            +
Sbjct  273  ACEASGTLACALELLDPDASDEMLD-IDFNYGSPQDTTTTENAASSSHTGTDGQFLQTSL  331

Query  703  LLSLNYEEVISAWASQGCPWTDGT-RPHFDPNHCWPDFM-------------GGDHHHHH  566
             L+LNYE +I +W S   PWT G  RPH   +  WP                GG+     
Sbjct  332  SLTLNYEAIIQSWGSS--PWTGGAERPHVKLDDSWPHDCTNMWVVGRGMVGHGGEDLLGT  389

Query  565  P-YGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            P  G  M     D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  390  PRLGQGM----DDVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAT  445



>gb|AFW87599.1| zinc finger protein CONSTANS-LIKE 16 [Zea mays]
Length=456

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 94/252 (37%), Positives = 120/252 (48%), Gaps = 81/252 (32%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG---DD-------------------DVGEDKATAAVKIEINGGD  851
            +D EL EFAAD+E LLG   DD                   +VGED +   VK+E + G 
Sbjct  215  TDAELREFAADMEALLGYGLDDGNEESSSFCMETLGLLEPVEVGEDASR--VKVETDAGS  272

Query  850  CTEA---------------------LNWSFGEEQEVE--QKVMMTMLSGFDessssmesg  740
              EA                     +++++G  Q+    +    +  +G D         
Sbjct  273  ACEASGTLACALELLDPDASDEMLDIDFNYGSPQDTTTTENAASSSHTGTDGQFL-----  327

Query  739  sckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGT-RPHFDPNHCWPDFM---------  590
                    ++ + L+LNYE +I +W S   PWT G  RPH   +  WP            
Sbjct  328  --------QTSLSLTLNYEAIIQSWGSS--PWTGGAERPHVKLDDSWPHDCTNMWVVGRG  377

Query  589  ----GGDHHHHHP-YGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKR  425
                GG+     P  G  M     D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKR
Sbjct  378  MVGHGGEDLLGTPRLGQGM----DDVGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKR  433

Query  424  PRLKGRFVKRSS  389
            PR+KGRFVKR++
Sbjct  434  PRMKGRFVKRAT  445



>gb|EPS73837.1| hypothetical protein M569_00919 [Genlisea aurea]
Length=412

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 102/191 (53%), Gaps = 15/191 (8%)
 Frame = -1

Query  961  DVELAEFAADVETLLGD--DDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMM  788
            D++LAEFAADVE LLG   DD   D     +       +   AL     E  ++++K + 
Sbjct  219  DMDLAEFAADVECLLGKGLDDSCFDMEELGIFDRPLKSEVETAL--VMNENHQIDEKSID  276

Query  787  TMLSGFDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH  608
                  D     +  G  + E        L L+ + ++SAW S+  PW  G +P      
Sbjct  277  ------DLPVPVVPCGGEEYEEDDTKTTFLKLDLDGILSAWNSRNTPWITGQKPDSKSID  330

Query  607  CWPDFMGGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEK  428
             WPDF G        + +       D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEK
Sbjct  331  FWPDFFGTTAARGDVWAAG-----GDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEK  385

Query  427  RPRLKGRFVKR  395
            RPR+KGRFVKR
Sbjct  386  RPRMKGRFVKR  396



>ref|XP_003530677.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Glycine 
max]
Length=371

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 94/227 (41%), Positives = 118/227 (52%), Gaps = 38/227 (17%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMT  785
            SD++ +EFAADVE  L  +D   D+ +A V            L    GEE E++  V   
Sbjct  158  SDMDFSEFAADVEGRLDKED---DEISAYVGGGEGV---QGVLAKVKGEE-EIDGDVACY  210

Query  784  MLSGFDessssmesgsckeEVAKKSR----------------------MLLSLNYEEVIS  671
            + S FD  S      +  E V   +R                      + L LNY+EVI+
Sbjct  211  LESVFDMISDDAFHWNNIESVVSDAREEKGCVVPCDGGVSEQGGIKRDIFLRLNYDEVIT  270

Query  670  AWASQG-CPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR-RSDEGREARVSRYR  497
            AW+SQG  PWT    P F+ ++ +   + G        G    +R   D GREARVSRYR
Sbjct  271  AWSSQGSSPWTTSNPPKFNSDYDFSLGLSG------VDGEGRSLRGHLDGGREARVSRYR  324

Query  496  EKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNY  356
            EKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR + F     FP Y
Sbjct  325  EKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR-TCFVGANAFPAY  370



>gb|AEF12200.1| CONSTANS-like zinc finger protein [Glycine max]
 gb|KHN16579.1| Zinc finger protein CONSTANS-LIKE 16 [Glycine soja]
Length=371

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 94/227 (41%), Positives = 118/227 (52%), Gaps = 38/227 (17%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMT  785
            SD++ +EFAADVE  L  +D   D+ +A V            L    GEE E++  V   
Sbjct  158  SDMDFSEFAADVEGRLDKED---DEISAYVGGGEGV---QGVLAKVKGEE-EIDGDVACY  210

Query  784  MLSGFDessssmesgsckeEVAKKSR----------------------MLLSLNYEEVIS  671
            + S FD  S      +  E V   +R                      + L LNY+EVI+
Sbjct  211  LESVFDMISDDAFHWNNIESVVSDAREEKGCVVPCDGGVSEQGGIKRDIFLRLNYDEVIT  270

Query  670  AWASQG-CPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR-RSDEGREARVSRYR  497
            AW+SQG  PWT    P F+ ++ +   + G        G    +R   D GREARVSRYR
Sbjct  271  AWSSQGSSPWTTSNPPKFNSDYDFSLGLSG------VDGEGRSLRGHLDGGREARVSRYR  324

Query  496  EKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNY  356
            EKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR + F     FP Y
Sbjct  325  EKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR-TCFVGANAFPAY  370



>gb|EYU45446.1| hypothetical protein MIMGU_mgv1a026677mg [Erythranthe guttata]
Length=394

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 77/117 (66%), Gaps = 5/117 (4%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDP-NHCWPDFMGGDHH----HHHPYGS  554
              + M L LNYE VI+AWA++GCPWT+GT P FD  +    ++ GG             +
Sbjct  264  NNNNMFLRLNYEAVIAAWATKGCPWTNGTPPQFDNLDQFMDEWSGGSSEWCGGRIGGNNN  323

Query  553  AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  383
                  +D  REARV RY+EKRRTRLFSKKIRY+VRKLNAE RPR+KGRFVKR + F
Sbjct  324  NNNNNNNDAEREARVLRYKEKRRTRLFSKKIRYQVRKLNAENRPRMKGRFVKRPTAF  380



>gb|AFK37106.1| unknown [Medicago truncatula]
Length=416

 Score =   119 bits (298),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 90/223 (40%), Positives = 117/223 (52%), Gaps = 30/223 (13%)
 Frame = -1

Query  961  DVELAEFAADVETLLG--DDDVGEDKATAAVKI-EINGGDCT--EALNWSFGEEQEVEQK  797
            DV+LAEFAA+VE+LLG    ++ E+ +       + N  D +  E L    GE  ++E  
Sbjct  182  DVDLAEFAANVESLLGVGSSEIQENSSGQVFDYKQENEMDASKSEMLKVKDGELDDLESV  241

Query  796  VMMTMLSGF----DessssmesgsckeEVAKKSRM----------------LLSLNYEEV  677
              MT    F    D +  S+     +      S +                 L LNYEEV
Sbjct  242  FDMTSDDVFHWNIDNNDVSLAQQEKEYMPLSNSSVGYSESVITKEETKRERFLRLNYEEV  301

Query  676  ISAWASQGCP--WTDGTRPHFD-PNHCWPDFMG--GDHHHHHPYGSAMMMRRSDEGREAR  512
            I+  + QG P  WT  + P F+  +  W + +G  G           +M    D GREAR
Sbjct  302  ITECSRQGSPSPWTTASPPKFNCDDDSWQNLLGSSGVEGEVRSLRGQLMGSGGDGGREAR  361

Query  511  VSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  383
            VSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR++ F
Sbjct  362  VSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRTACF  404



>ref|XP_002436824.1| hypothetical protein SORBIDRAFT_10g009480 [Sorghum bicolor]
 gb|EER88191.1| hypothetical protein SORBIDRAFT_10g009480 [Sorghum bicolor]
Length=474

 Score =   119 bits (298),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 93/232 (40%), Positives = 117/232 (50%), Gaps = 42/232 (18%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG---DDDVGEDKA-----------------TAAVKIEINGGDC-  848
            +D EL EFAAD+E LLG   DD   ED +                    VK+E +GG   
Sbjct  233  TDAELREFAADMEALLGHGLDDGNEEDSSFYMETLGLLDPVEVGDDATRVKVETDGGSAC  292

Query  847  -----TEALNWSFGEEQEVEQKVM---MTMLSGFDessssmesgsckeEVAKKSRML---  701
                 T A      +  EV  +++       S  D      ++ S     A  ++ L   
Sbjct  293  GEASGTLACALELLDPAEVSDEMLDIDFNYGSPLDTMMDDEKAASSDTGGADDAQFLQTS  352

Query  700  --LSLNYEEVISAWASQGCPWT-DGTRPHFDPNHCWPDF-MGGDHHHHHPYGSAMMMRRS  533
              L+LNYE +I +W S   PWT  G RPH   +  WP   M          G  +++  +
Sbjct  353  LSLTLNYEAIIQSWGSS--PWTAGGERPHVKLDDSWPHTNMWVVGGVAGHGGEDLLLGTA  410

Query  532  ----DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
                D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  411  RLGMDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAT  462



>ref|XP_006302335.1| hypothetical protein CARUB_v10020393mg [Capsella rubella]
 gb|EOA35233.1| hypothetical protein CARUB_v10020393mg [Capsella rubella]
Length=407

 Score =   119 bits (297),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 79/123 (64%), Gaps = 12/123 (10%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHC------WPD-FMGGDHHHHHPY  560
            +K+ + L L+YE VISAW + G PW    +P F+ + C      +P   MGG        
Sbjct  283  RKTSLFLRLDYEAVISAWDNHGSPWKTEIKPEFNLDDCLLEGNTYPSHVMGGFEEWTSAV  342

Query  559  GSAMMMRRSDEG-----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            GS    +  D G     REARV RYREKRRTRLF+KKIRYEVRKLNAE+RPR+KGRFVKR
Sbjct  343  GSVTRRQGRDGGGSDVEREARVLRYREKRRTRLFAKKIRYEVRKLNAEQRPRIKGRFVKR  402

Query  394  SSL  386
            +SL
Sbjct  403  TSL  405



>ref|NP_001140584.1| uncharacterized protein LOC100272654 [Zea mays]
 gb|ACN28503.1| unknown [Zea mays]
 gb|AFW76935.1| hypothetical protein ZEAMMB73_075677 [Zea mays]
 gb|AIB05431.1| C2C2-CO-like transcription factor, partial [Zea mays]
Length=452

 Score =   119 bits (297),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 119/232 (51%), Gaps = 46/232 (20%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG---DD-------------------DVGEDKATAAVKIEINGGD  851
            +D EL EFAAD+E LLG   DD                   +VG+D     V+ + +   
Sbjct  216  TDAELREFAADMEALLGHGLDDGNEEDSSFYMETLGLLDPMEVGDDATQVKVETDGSSAC  275

Query  850  CTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAK--------KSRMLLS  695
            C  +   + G E ++E    M  +  FD +S    +   +   +         ++ + L+
Sbjct  276  CEASGTLACGLELDLEASDEMLDID-FDYASPQDTATDERAASSDTGADAQFLQTSLSLT  334

Query  694  LNYEEVISAWASQGCPWTDG-TRPHFDPNHCWP-DFMG--------GDHHHHHPYGSAMM  545
            LNYE +I +W S   PWT G  RPH   +  WP D+          G      P    + 
Sbjct  335  LNYEAIIQSWGSS--PWTGGGERPHVKLDTRWPHDYTNMWVVGGVVGHGGEDLPGTPRLG  392

Query  544  MRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            M   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  393  M---DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAT  441



>gb|AGI62036.1| CONSTANS-like 12 [Erycina pusilla]
Length=339

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 91/228 (40%), Positives = 109/228 (48%), Gaps = 59/228 (26%)
 Frame = -1

Query  961  DVELAEFAADVETLLGD--DDVGE---------------------DKATAAVKIE-----  866
            D E  +F+AD+E+LLG   D  GE                     D A    KIE     
Sbjct  134  DTETEDFSADMESLLGREFDRGGEFCMEELGLGGAGGGAVAGVAGDPAEKKGKIEEKGEI  193

Query  865  ----INGGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRMLL  698
                I G  C E L   FGEE + E KV ++                          M L
Sbjct  194  LGIGIEGDLCRENLEIDFGEEIKEEIKVGIS------------------------KGMGL  229

Query  697  SLNYEEVISAWASQGC-PWTDGTRPHFDPNHCWPDFMG--GDHHHHHPYGSAMMMRRSDE  527
            SL+YE V  AW   G  PW  G RP       W + +G  G+           +++  D 
Sbjct  230  SLDYEAVKEAWMVTGSSPWMTGERPRMGVEDYWHECLGKFGETGGEFIGSGTGIIQFMDL  289

Query  526  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  383
            GREARV+RYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR+ +F
Sbjct  290  GREARVTRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRTDVF  337



>ref|XP_004953821.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X2 [Setaria italica]
Length=441

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 112/215 (52%), Gaps = 33/215 (15%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVM--  791
            +D EL EFAAD+E LLG      ++   +  +E  G   T   +     + E +  V+  
Sbjct  217  TDAELREFAADMEALLGQGLDDGNQLDESFYMESLGLMTTPTEDGGRVLKMEPDSIVVSH  276

Query  790  --MTML----SGFDessssmesgsckeEVAKKSRML-----LSLNYEEVISAWASQGCPW  644
              M  L    +      S+ ++ +    VA  ++ L     L LNYE VI +W S   PW
Sbjct  277  GDMGALGRSPAEVKPEESAEKASAASNGVAADAQFLKRSLDLRLNYEAVIESWGSS--PW  334

Query  643  TDGTRPHFDPNHCWPDFMGGDHHHHHPY----------GSAMMMR--RSDEGREARVSRY  500
            TDG RP    +  WP      HH HH            G A+  R      GREARVSRY
Sbjct  335  TDGQRPDVQLDDFWP------HHAHHSGVWMAGGGRLGGEALTPRLGMGGGGREARVSRY  388

Query  499  REKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            REKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  389  REKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  423



>gb|AFX97569.1| K, partial [Hordeum vulgare subsp. vulgare]
Length=182

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 77/116 (66%), Gaps = 13/116 (11%)
 Frame = -1

Query  715  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYG-------  557
            K  + L LNYE VI++WAS   PWTDG RP   P     D +  DH      G       
Sbjct  64   KRSLDLRLNYEAVIASWAS--SPWTDGRRP---PGQQLDDLLLNDHAGMWTAGGGGRQGE  118

Query  556  SAMMMR-RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  392
            +A   R R+D  REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  119  AAWPARPRTDGWREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT  174



>ref|XP_004953820.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X1 [Setaria italica]
Length=465

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 93/240 (39%), Positives = 115/240 (48%), Gaps = 59/240 (25%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGD------------------------DDVGEDKATAAVKIEING  857
            +D EL EFAAD+E LLG                         +D G         I ++ 
Sbjct  217  TDAELREFAADMEALLGQGLDDGNQLDESFYMESLGLMTTPTEDGGRVLKMEPDSIVVSH  276

Query  856  GDCTEALNWSFGEEQEVEQKVMM---------TMLSGFDessssmesgsckeEVAKKSRM  704
            GD   AL  S  E +  E   ++         T++   ++     ++ +    VA  ++ 
Sbjct  277  GD-MGALGRSPAEVKPEESAEVLDIDFNCSSPTVIDNDEDYCFEQKASAASNGVAADAQF  335

Query  703  L-----LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPY-------  560
            L     L LNYE VI +W S   PWTDG RP    +  WP      HH HH         
Sbjct  336  LKRSLDLRLNYEAVIESWGSS--PWTDGQRPDVQLDDFWP------HHAHHSGVWMAGGG  387

Query  559  ---GSAMMMR--RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
               G A+  R      GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  388  RLGGEALTPRLGMGGGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  447



>ref|XP_009109881.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brassica 
rapa]
Length=395

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 84/230 (37%), Positives = 112/230 (49%), Gaps = 46/230 (20%)
 Frame = -1

Query  964  SDVELAEFAADVETLLG---------------------DDDVGEDKATAAVKIEINGGD-  851
            +++E+ +FAADVETLLG                       D  EDK T A+ ++I  GD 
Sbjct  162  TNMEVEDFAADVETLLGHGLDKESYTMEELGLSNTEMFKKDEIEDKETKAMNMDIEIGDD  221

Query  850  ------CTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRMLLSLN  689
                   T   + ++ +    E  +     SG              +E  KK+ ++LSL+
Sbjct  222  DQGNRDGTLPFDLNYPQNAYEEDAIKNVESSG---------ECVQAKEEKKKNVLMLSLD  272

Query  688  YEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR---------R  536
            Y++VISAW  QG PWT G  P  D N      +       +   S    R          
Sbjct  273  YDQVISAWGGQGLPWTSGGPPELDINISGSPVVSKVSKRDNGRKSRKKRRVGGCLPSSVV  332

Query  535  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
             D GREA VSRYREK++TR F+K IRYEVRKLNAE +PR+KGRFVKR+ L
Sbjct  333  GDGGREASVSRYREKKKTRSFTKTIRYEVRKLNAENKPRMKGRFVKRTPL  382



>ref|XP_002887511.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63770.1| zinc finger (B-box type) family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=391

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 76/119 (64%), Gaps = 7/119 (6%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPH--FDPNHCWPDFMGGDHHHHHPYGSAMM  545
            +K+ + LSL+YE VI+AW + G PW  G +       N C    +GG        GS   
Sbjct  272  RKTSLFLSLDYEAVITAWDNHGSPWKTGIKSECLLGGNTCPSHAVGGFDELVSTVGSVTR  331

Query  544  MRRSDEG-----REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  383
             +  D G     REARV RY+EKRRTRLFSKKIRYEVRKLNAE+RPR+KGRFVKR+SL 
Sbjct  332  QQVKDGGGSDGEREARVLRYKEKRRTRLFSKKIRYEVRKLNAEQRPRIKGRFVKRTSLL  390



>ref|XP_004953822.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform 
X3 [Setaria italica]
Length=440

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 91/226 (40%), Positives = 106/226 (47%), Gaps = 56/226 (25%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGD------------------------DDVGEDKATAAVKIEING  857
            +D EL EFAAD+E LLG                         +D G         I ++ 
Sbjct  217  TDAELREFAADMEALLGQGLDDGNQLDESFYMESLGLMTTPTEDGGRVLKMEPDSIVVSH  276

Query  856  GDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRMLLSLNYEEV  677
            GD   AL  S  E +  E        +G    +  +           K  + L LNYE V
Sbjct  277  GD-MGALGRSPAEVKPEESAEASAASNGVAADAQFL-----------KRSLDLRLNYEAV  324

Query  676  ISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPY----------GSAMMMR--RS  533
            I +W S   PWTDG RP    +  WP      HH HH            G A+  R    
Sbjct  325  IESWGSS--PWTDGQRPDVQLDDFWP------HHAHHSGVWMAGGGRLGGEALTPRLGMG  376

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
              GREARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  377  GGGREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  422



>gb|AFX97570.1| K, partial [Hordeum vulgare subsp. vulgare]
Length=182

 Score =   112 bits (280),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 76/116 (66%), Gaps = 13/116 (11%)
 Frame = -1

Query  715  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYG-------  557
            K  + L LNYE VI +WAS   PWTDG RP   P     D +  DH      G       
Sbjct  64   KRSLDLRLNYEAVIESWASS--PWTDGRRP---PGQQLDDLLLNDHAGMWTAGGGGRQGE  118

Query  556  SAMMMR-RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  392
            +A   R R+D  REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  119  AAWPARPRTDGWREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT  174



>ref|XP_008801158.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16 [Phoenix dactylifera]
Length=381

 Score =   116 bits (290),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 112/207 (54%), Gaps = 32/207 (15%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDVGEDKATAAVKIEINGGDCTEALNWSFGEEQEVEQKVMMT  785
            SD ELAEFA  +E+LLG    G D          N  + +E      G + E++  + M 
Sbjct  196  SDDELAEFATKMESLLGR---GLD----------NSKNSSE-----HGTKPELDNDMKMA  237

Query  784  M------LSGFDessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQGCPWTDGTRPH  623
                   LS   +S    E     E+     ++ L L+YE ++ AW+S   PWT+G RP 
Sbjct  238  TSRERPDLSFSCQSMKKGEEAEEGEKAGSSKKVALRLDYEAIMEAWSSS--PWTNGERPQ  295

Query  622  FDPNHC-WPDFMGGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVR  446
            F+ N C WP    GD       G         +GREA+V+RYREKRRTR+F+KKIRYEVR
Sbjct  296  FNLNVCRWP----GDMGMWVGEGGEEDKGGGRQGREAKVTRYREKRRTRMFAKKIRYEVR  351

Query  445  KLNAEKRPRLKGRFVKRSSLFQPPPPF  365
            +LNAE+RPR+KGRFVKR +   P P F
Sbjct  352  RLNAEQRPRMKGRFVKR-AFVTPTPAF  377



>gb|EYU29978.1| hypothetical protein MIMGU_mgv1a007591mg [Erythranthe guttata]
Length=402

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 77/123 (63%), Gaps = 17/123 (14%)
 Frame = -1

Query  709  RMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHC-WPDFMG-----------GDHHHHH  566
            + LL L+Y  V+SAW     PWT G RP    + C WP+F G           G  + + 
Sbjct  278  KTLLKLDYGGVMSAWDKHKSPWTTGERPPEPISGCHWPEFSGACGTMGVNGETGKINENI  337

Query  565  PYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
            P  +       D GREARVSRYREKRR RLFSKKIRYEVRKLNAEKRPR+KGRFVKR++L
Sbjct  338  PAAAT-----GDGGREARVSRYREKRRKRLFSKKIRYEVRKLNAEKRPRMKGRFVKRANL  392

Query  385  FQP  377
              P
Sbjct  393  EAP  395



>dbj|BAJ87752.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=498

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 93/223 (42%), Positives = 118/223 (53%), Gaps = 37/223 (17%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGD--DDVGEDKAT----------------AAVKIEINGGDCTEA  839
            +D +L EFAAD+E LLG   DD  E + +                  VK+E +GG  + +
Sbjct  273  TDADLREFAADMEALLGQGLDDGNELEDSFYMEALGLISPPAEHGGRVKVEADGGLVSRS  332

Query  838  LN-WSFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRML-----LSLNYEEV  677
                + G + + E       L   D+S     S +   +    ++ L     L LNYE V
Sbjct  333  NGVLAAGHDLKREFSGSPPTLVDDDDSFEHKTSSASNGDAVDGAQFLKRSLDLRLNYEAV  392

Query  676  ISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYG-------SAMMMR-RSDEGR  521
            I++WAS   PWTDG RP   P     D +  DH      G       +A   R R+D  R
Sbjct  393  IASWASS--PWTDGRRP---PGQQLDDLLLNDHAGMWTAGGGGRQGEAAWPARPRTDGWR  447

Query  520  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  392
            EARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  448  EARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT  490



>ref|XP_009381104.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Musa acuminata 
subsp. malaccensis]
Length=419

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 100/244 (41%), Positives = 126/244 (52%), Gaps = 54/244 (22%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGD---------DDVG------EDKATAAVKIEINGGDCTEALNW  830
            SD+EL +FA+D+E LLG          D +G      ED +   VK+E++      + N 
Sbjct  193  SDLELEQFASDMEVLLGSGLDNDSFCIDGLGWMNGTVEDDSDGQVKVEVDLDVARTSSN-  251

Query  829  SFGEEQEVEQKVMMTMLSGFDes-------------sssmesgsckeEVAKKSRMLLSLN  689
             F  E ++ +     +  GFD                +   S + + E A K +M+L L+
Sbjct  252  -FRMEMDLPK---WKLDLGFDSQMMAVEVDEHKPLQQAETASDNYRAEAAAKRKMILRLD  307

Query  688  YEEVISAWASQGCP-WTDGTRPHFDPNHCWPDF--------MGGDHHHHHPYGSAMMMRR  536
            YE VI+A +S     W DG RP FDPN  WPD            + H+      A     
Sbjct  308  YEAVIAACSSNVLSLWIDGVRPDFDPNDSWPDVPAMAGGAAAMKEMHYQQEVAHA-----  362

Query  535  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQPPPPFPNY  356
            +DEGREARVSRYREKRR RLFSKKIRYEVRKLNAEKRPR+KGRFVKR       P FP  
Sbjct  363  ADEGREARVSRYREKRRRRLFSKKIRYEVRKLNAEKRPRMKGRFVKR-------PAFPAA  415

Query  355  LLNR  344
            L  R
Sbjct  416  LACR  419



>gb|ACL53155.1| unknown [Zea mays]
Length=157

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 77/119 (65%), Gaps = 15/119 (13%)
 Frame = -1

Query  715  KSRMLLSLNYEEVISAWASQGCPWTDGT-RPHFDPNHCWP-DFMG--------GDHHHHH  566
            ++ + L+LNYE +I +W S   PWT G  RPH   +  WP D+          G      
Sbjct  33   QTSLSLTLNYEAIIQSWGS--SPWTGGGERPHVKLDTRWPHDYTNMWVVGGVVGHGGEDL  90

Query  565  PYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            P    + M   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  91   PGTPRLGM---DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAT  146



>gb|ACF84125.1| unknown [Zea mays]
Length=226

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 77/119 (65%), Gaps = 15/119 (13%)
 Frame = -1

Query  715  KSRMLLSLNYEEVISAWASQGCPWTDGT-RPHFDPNHCWP-DFMG--------GDHHHHH  566
            ++ + L+LNYE +I +W S   PWT G  RPH   +  WP D+          G      
Sbjct  102  QTSLSLTLNYEAIIQSWGSS--PWTGGGERPHVKLDTRWPHDYTNMWVVGGVVGHGGEDL  159

Query  565  PYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            P    + M   D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  160  PGTPRLGM---DGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRAT  215



>ref|XP_002452605.1| hypothetical protein SORBIDRAFT_04g028920 [Sorghum bicolor]
 gb|EES05581.1| hypothetical protein SORBIDRAFT_04g028920 [Sorghum bicolor]
Length=488

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 72/112 (64%), Gaps = 7/112 (6%)
 Frame = -1

Query  715  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWP-----DFMGGDHHHHHPYGSA  551
            K  + LSLNYE +I +W S   PWTDG RP+   +  WP      +M G         + 
Sbjct  361  KRSLDLSLNYEAIIESWGSS--PWTDGQRPNVQLDDFWPHAHLTGWMAGGGRLGGEAAAV  418

Query  550  MMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
                    GREARV+RYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  419  SPRLGMVGGREARVTRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  470



>ref|XP_003573014.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brachypodium 
distachyon]
 ref|XP_010236028.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Brachypodium 
distachyon]
Length=448

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 89/231 (39%), Positives = 112/231 (48%), Gaps = 51/231 (22%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGDDDV-------------------------GEDKATAA---VKI  869
            +D EL EFAAD+E LLG  D                          G+ K   A   VK+
Sbjct  229  TDAELREFAADMEALLGGQDALGGNEQLMAEDSFYMEALGLVSPLSGDHKGVDAGRPVKV  288

Query  868  EINGGDCTEALNWSFGEEQEVEQKVMMTMLSGFDessssmesgsckeEVAKKSRMLLSLN  689
            E +GG             +     ++      F+  +++   G   +    K  + L LN
Sbjct  289  ETDGG-----------ARRSSPPTLVDDDDGSFEHKAATASYGEAADAGFLKRSLDLRLN  337

Query  688  YEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPY-----GSAMMMRRSDEG  524
            YE VI  W S   PWTDG RPH        D +  DH++   +     G       +D+G
Sbjct  338  YEAVIEGWGSS--PWTDGRRPH---GGQLDDLLLHDHYYSGMWTAAAGGGRAARPAADDG  392

Query  523  --REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQP  377
              REARVSRYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR +   P
Sbjct  393  GWREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRPAGAAP  443



>ref|XP_008646195.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Zea mays]
 gb|AFW73247.1| hypothetical protein ZEAMMB73_807545 [Zea mays]
 gb|AIB05540.1| C2C2-CO-like transcription factor, partial [Zea mays]
Length=496

 Score =   111 bits (278),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 74/114 (65%), Gaps = 12/114 (11%)
 Frame = -1

Query  715  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWP-----DFMGGDHHHHHPYGSA  551
            K  + LSLNYE +I +W S   PWTDG RP    +  WP      +M G        G A
Sbjct  334  KRSLDLSLNYEAIIESWGSS--PWTDGQRPSVQLDDFWPHAHLTGWMAGGGRLG---GEA  388

Query  550  MMMRR--SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
             +  R     GREARV+RYREKRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR
Sbjct  389  AVTPRLGMGGGREARVTRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR  442



>ref|XP_010511850.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2 
[Camelina sativa]
Length=411

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 70/107 (65%), Gaps = 8/107 (7%)
 Frame = -1

Query  706  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNH--CWPDFMGGD-----HHHHHPYGSAM  548
            ++L L+YE V+S W  QG PWT       D +   C  D MG       HH++H  G   
Sbjct  297  LMLRLDYESVLSTWGGQGIPWTAQKPSEIDLDMVCCPTDSMGESGADQAHHYNHFRGLGF  356

Query  547  MMRRS-DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKG  410
             M  + D GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPR+KG
Sbjct  357  HMGEAGDGGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKG  403



>ref|XP_002961709.1| hypothetical protein SELMODRAFT_438000 [Selaginella moellendorffii]
 gb|EFJ36969.1| hypothetical protein SELMODRAFT_438000 [Selaginella moellendorffii]
Length=448

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 79/125 (63%), Gaps = 19/125 (15%)
 Frame = -1

Query  709  RMLLSLNYEEVISAWASQGCPWTDGTRPH-------FDPNHCW-----PDFMGGDHHHHH  566
            ++ L L+YE+V++AW+ +G  WT+G RP        FDP         PDF   +     
Sbjct  320  KITLKLDYEDVLNAWSDRGPFWTEGPRPQTVPDDSLFDPASTLDYGLVPDFCM-ESTEVE  378

Query  565  PYGSAMMMRRSDE------GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  404
              G   ++   ++      GREARV RYREKRRTRLFSKKIRYEVRKLNAE+RPRLKGRF
Sbjct  379  AVGQVPVVNFGEDRLTPQGGREARVMRYREKRRTRLFSKKIRYEVRKLNAERRPRLKGRF  438

Query  403  VKRSS  389
            VKR++
Sbjct  439  VKRTN  443



>gb|EMT01944.1| hypothetical protein F775_21198 [Aegilops tauschii]
Length=340

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 90/226 (40%), Positives = 116/226 (51%), Gaps = 42/226 (19%)
 Frame = -1

Query  964  SDVELAEFAADVETLLGD--DDVGEDKAT----------------AAVKIEINGGDCTEA  839
            +D +L EFAAD+E LLG   DD  E + +                  VK+E +GG  + +
Sbjct  110  TDADLREFAADMEALLGQGLDDGNEMEDSFYMEALGLISPPGEHDGRVKVEADGGLVSRS  169

Query  838  LNWSFGEEQEVEQKVM---MTMLSGFDessssmesgsckeEVAK----KSRMLLSLNYEE  680
             N       +++++      T++   D       S S  + V      K  + L LNYE 
Sbjct  170  -NGVLASGHDLKREFSGSPPTLVDDDDSFEHKTSSASNGDAVDDAQFLKRSLDLRLNYEA  228

Query  679  VISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR----------RSD  530
            V+ +W S   PWTDG RP   P     D +  DH      G     R          R+D
Sbjct  229  VMESWGSS--PWTDGRRP---PGQL-DDLLLHDHAGMWTAGGGGGGRHGEAAWPPRPRTD  282

Query  529  EGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  392
            E REARVSRYR+KRRTRLF+KKIRYEVRKLNAEKRPR+KGRFVKR+
Sbjct  283  EWREARVSRYRKKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRT  328



>ref|XP_002964778.1| hypothetical protein SELMODRAFT_266834 [Selaginella moellendorffii]
 gb|EFJ33616.1| hypothetical protein SELMODRAFT_266834 [Selaginella moellendorffii]
Length=448

 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 79/125 (63%), Gaps = 19/125 (15%)
 Frame = -1

Query  709  RMLLSLNYEEVISAWASQGCPWTDGTRPH-------FDPNHCW-----PDFMGGDHHHHH  566
            ++ L L+YE+V++AW+ +G  WT+G RP        FDP         PDF   +     
Sbjct  320  KITLKLDYEDVLNAWSDRGPFWTEGPRPQTVPDDSLFDPASTLDYGLVPDFCM-ESTEVE  378

Query  565  PYGSAMMMRRSDE------GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  404
              G   ++   ++      GREARV RYREKRRTRLFSKKIRYEVRKLNAE+RPRLKGRF
Sbjct  379  AVGQVPVVNFGEDRLTPRGGREARVMRYREKRRTRLFSKKIRYEVRKLNAERRPRLKGRF  438

Query  403  VKRSS  389
            VKR++
Sbjct  439  VKRTN  443



>ref|XP_001769011.1| predicted protein [Physcomitrella patens]
 gb|EDQ66209.1| predicted protein [Physcomitrella patens]
Length=495

 Score =   108 bits (269),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 72/116 (62%), Gaps = 19/116 (16%)
 Frame = -1

Query  703  LLSLNYEEVISAWASQGCPWTDGTRPHFDPNHC-----------WPDFMGGDHHHHHPYG  557
            LL LN+++V+SAW+ +   WTDG RP   P+              PD   G        G
Sbjct  385  LLRLNFDDVLSAWSDRSL-WTDGKRPQTVPDDSSEAVGGLDLGLVPDLSKGCAQGQPGTG  443

Query  556  SAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
                    D GREARV RYREKRRTRLFSKKIRYEVRKLNAE+RPR+KGRFVKR++
Sbjct  444  G-------DRGREARVLRYREKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVKRTT  492



>ref|XP_001771896.1| predicted protein [Physcomitrella patens]
 gb|EDQ63325.1| predicted protein [Physcomitrella patens]
Length=475

 Score =   107 bits (268),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 72/108 (67%), Gaps = 5/108 (5%)
 Frame = -1

Query  703  LLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGD----HHHHHPYGSAMMMRR  536
            LL LN+++V+SAW+ +   WTDG RP   P+       G D       +  Y     +  
Sbjct  365  LLRLNFDDVLSAWSDRSL-WTDGRRPQTVPDDSSEAVGGTDVGLVPDINTQYAQGATLAA  423

Query  535  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  392
             D+GRE RV RY+EKRRTRLFSKKIRYEVRKLNAE+RPR+KGRFVK++
Sbjct  424  GDKGREFRVMRYKEKRRTRLFSKKIRYEVRKLNAERRPRMKGRFVKQT  471



>ref|XP_007206389.1| hypothetical protein PRUPE_ppa018053mg [Prunus persica]
 gb|EMJ07588.1| hypothetical protein PRUPE_ppa018053mg [Prunus persica]
Length=241

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 71/165 (43%), Positives = 90/165 (55%), Gaps = 29/165 (18%)
 Frame = -1

Query  838  LNWSF--------GEE-QEVEQKVMMTM-LSGFDessssmesgsckeEVA-------KKS  710
            LNW F        GEE +E+EQKV  T     F++ S         E VA       K+ 
Sbjct  86   LNWDFMDWDEFPKGEEGEEIEQKVFQTADRCFFEDESYYERKVVKSESVAFWDEDDEKRV  145

Query  709  RMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSD  530
             + L+LNY+EV+ AW+ +G  W D          C    M  + ++    G   +M    
Sbjct  146  HLNLNLNYQEVLDAWSDRGPLWADD---------CSRSSMASNGNY---MGEVPIMEEDR  193

Query  529  EGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
              REA V RYREKR++RLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  194  TRREASVLRYREKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVKR  238



>ref|XP_008354841.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X2 
[Malus domestica]
Length=234

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 70/108 (65%), Gaps = 12/108 (11%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  539
            KK ++ L+LNY+EV+ AW+ +G  W D          C    M  + ++    G   +M 
Sbjct  138  KKVQLNLNLNYQEVMDAWSDRGTLWADD---------CSLSSMASNGNY---IGEVPVME  185

Query  538  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
                 REARV RY+EKR++RLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  186  EEKARREARVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVKR  233



>ref|XP_008665284.1| PREDICTED: zinc finger protein CONSTANS-LIKE 16-like [Zea mays]
 tpg|DAA50967.1| TPA: hypothetical protein ZEAMMB73_914054 [Zea mays]
 gb|AIB05335.1| C2C2-CO-like transcription factor, partial [Zea mays]
Length=454

 Score =   101 bits (252),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 87/207 (42%), Positives = 114/207 (55%), Gaps = 19/207 (9%)
 Frame = -1

Query  961  DVELAEFAADVETLL-GDDDVGEDKA-TAAVKIEINGGDCTEALNWSFGEEQEVEQKVMM  788
            D++LA FAAD+E+LL G DD  +D       K ++N     EA+     E ++ ++K   
Sbjct  208  DMDLASFAADMESLLMGVDDGFDDLGFLDEQKPQVNADVDLEAMAAPEPEREDKKRKRDG  267

Query  787  TMLSGF------------DessssmesgsckeEVAKKSRMLLSLNYEEVISAWASQG-CP  647
                GF            D  +        +++  K++ M+L LNYE VI++W   G  P
Sbjct  268  FDYLGFLDEEKPQVNADVDLEAMVAPEPEREDKKRKRTDMILKLNYEGVIASWVRDGGSP  327

Query  646  WTDGTRPHFD-PNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGREARVSRYREKRRTRLFS  470
            W  G RPH D P   W +F          +G  M      E REARVSRYREKRR RLF+
Sbjct  328  WYHGERPHLDDPYELWLEFPATGSRGL--FGGTMTAVTGGE-REARVSRYREKRRRRLFA  384

Query  469  KKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            KKIRYEVRKLNAEKRPR+KGRFVKR++
Sbjct  385  KKIRYEVRKLNAEKRPRMKGRFVKRTT  411



>ref|XP_010685899.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Beta vulgaris 
subsp. vulgaris]
Length=231

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 67/109 (61%), Gaps = 12/109 (11%)
 Frame = -1

Query  715  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRR  536
            K+ + L+LNYEEV+ AW+++G  W     P           M  +H+     G    +  
Sbjct  126  KTSLNLNLNYEEVLEAWSNRGSLWAHNHHPSLS--------MSSNHY----MGEVPNLEE  173

Query  535  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
                RE  V RY+EKRR+RLFSKKIRYEVRKLNA+KRPRLKGRFVKR S
Sbjct  174  ERTRRETSVLRYKEKRRSRLFSKKIRYEVRKLNADKRPRLKGRFVKRIS  222



>emb|CBI15893.3| unnamed protein product [Vitis vinifera]
Length=101

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 63/102 (62%), Gaps = 14/102 (14%)
 Frame = -1

Query  700  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  521
            L+LNY+EV+ AW+ +G  W D          C   F    +    P     +M      R
Sbjct  6    LNLNYQEVLEAWSDRGSLWADD---------CSLSFKNTSYMGEVP-----VMEEEKTRR  51

Query  520  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            EA V RY+EKR+TRLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  52   EASVLRYKEKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKR  93



>ref|XP_009354295.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X2 
[Pyrus x bretschneideri]
 ref|XP_009341688.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X2 
[Pyrus x bretschneideri]
Length=234

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 69/108 (64%), Gaps = 12/108 (11%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  539
            KK R+ L+LNY+EV+ AW+ +G  W D          C    M  + ++    G   +M 
Sbjct  138  KKVRLNLNLNYQEVMDAWSDRGTLWADD---------CSLSSMASNGNY---IGEVPVME  185

Query  538  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
                 REARV RY+EKR++RLFSKKIRY+VRKLNA+KRPR KGRFVKR
Sbjct  186  DEKARREARVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRFKGRFVKR  233



>ref|XP_008233500.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Prunus mume]
Length=241

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 91/165 (55%), Gaps = 29/165 (18%)
 Frame = -1

Query  838  LNWSF--------GEE-QEVEQKVMMTMLSGF--DessssmesgsckeEV------AKKS  710
            LNW F        GEE +E+EQKV  T    F  DES    +    +  V       K+ 
Sbjct  86   LNWDFMDWDEFPKGEEGEEIEQKVFQTADRCFFEDESYYERKVVKSESVVFWDEDDEKRV  145

Query  709  RMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSD  530
            ++ L+LNY+EV+ AW+ +G  W D          C    M  + ++    G   +M    
Sbjct  146  QLNLNLNYQEVLDAWSDRGPLWADD---------CSRSSMASNGNY---MGEVPIMEEER  193

Query  529  EGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
              REA V RYREKR++RLFSKKIRY+VRKLNA+KRPRLKGRFV+R
Sbjct  194  TRREASVLRYREKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVRR  238



>ref|XP_010519197.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 isoform X2 [Tarenaya 
hassleriana]
Length=448

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 94/227 (41%), Positives = 115/227 (51%), Gaps = 36/227 (16%)
 Frame = -1

Query  961  DVELAEFAADVETLLGDDDVGEDKATAA----------------VKIEINGGDCTEALNW  830
            D++LAE   DVE+LLG++     K   A                VK E       E   W
Sbjct  221  DMDLAELTMDVESLLGEESCMGIKEPGALEFKEDEEKIGLTLRTVKDEEEEEGLGETCRW  280

Query  829  SF--------GEEQEVEQKVMMTMLSGFDe-ssssmesgsckeEVAKKSRMLLSLNYEEV  677
            +         G+ +EVE       L   D       E   C +E AKK  + L L+YE V
Sbjct  281  NLDNGSSVSGGKREEVEDVNGKKGLRSEDNYEEEGEEEERCADEKAKKQSLFLRLDYEAV  340

Query  676  ISAWASQGCPWTDGTRPHFDPNHCWPDFMG----GDHHHHHPYGSAMMMRR-----SDEG  524
            + AW S+  PWT G  P F P++ W D +G    G        GS  M RR     SD  
Sbjct  341  MIAWDSECSPWTTGRCPDFRPSNFWLDCLGFVIDGSEEATPAVGS--MPRRQGRGGSDGE  398

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  383
            REARV RYREKRR RLF+KKIRYEVRKLNAEKRPR+KGRFV+R+S +
Sbjct  399  REARVLRYREKRRRRLFAKKIRYEVRKLNAEKRPRIKGRFVRRTSSY  445



>ref|XP_006488582.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Citrus sinensis]
Length=246

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 70/109 (64%), Gaps = 12/109 (11%)
 Frame = -1

Query  721  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMM  542
            A   ++ L+LNY++V+ AW+ +G  WTD       P+H +  +MG             +M
Sbjct  149  ASSLKLNLNLNYQQVLDAWSDRGPLWTDDFSLSSVPSHSY--YMG----------EVPVM  196

Query  541  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
                  REA V RYREKR++RLFSK+IRY+VRKLNA+KRPRLKGRFVKR
Sbjct  197  EEDKTRREASVLRYREKRQSRLFSKRIRYQVRKLNADKRPRLKGRFVKR  245



>ref|XP_006425148.1| hypothetical protein CICLE_v10029146mg [Citrus clementina]
 gb|ESR38388.1| hypothetical protein CICLE_v10029146mg [Citrus clementina]
 gb|KDO67018.1| hypothetical protein CISIN_1g025320mg [Citrus sinensis]
Length=244

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 70/108 (65%), Gaps = 12/108 (11%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  539
            + S + L+LNY++V+ AW+ +G  WTD       P+H +  +MG             +M 
Sbjct  148  RASSLNLNLNYQQVLDAWSDRGPLWTDDFSLSSVPSHGY--YMG----------EVPVME  195

Query  538  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
                 REA V RYREKR++RLFSK+IRY+VRKLNA+KRPRLKGRFVKR
Sbjct  196  EDKTRREASVLRYREKRQSRLFSKRIRYQVRKLNADKRPRLKGRFVKR  243



>ref|XP_004294775.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Fragaria vesca 
subsp. vesca]
Length=236

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 69/110 (63%), Gaps = 9/110 (8%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  539
            KK ++ L+LNY+EV+ AW+ +G  W +    H        ++MG            +M  
Sbjct  136  KKVQLNLNLNYQEVLDAWSDRGSLWAEDCSSHSSMAASNGNYMGE---------VPVMEE  186

Query  538  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
                 REA V RYREKR++RLFSKKIRY+VRKLNA+KRPRLKGRFVKR S
Sbjct  187  EKSIRREASVLRYREKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVKRVS  236



>ref|XP_008384739.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like [Malus 
domestica]
Length=234

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 69/108 (64%), Gaps = 12/108 (11%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  539
            KK ++ L+LNY+EV+ AW+ +G  W D          C    M  + ++    G   +M 
Sbjct  138  KKVQLNLNLNYQEVLDAWSDRGSLWADD---------CSLSSMASNGNY---MGEVPVME  185

Query  538  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
                 REA V RY+EKR++RLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  186  EDKTRREASVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVKR  233



>ref|XP_012078538.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2 [Jatropha curcas]
 gb|KDP45740.1| hypothetical protein JCGZ_17347 [Jatropha curcas]
Length=238

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 65/104 (63%), Gaps = 12/104 (12%)
 Frame = -1

Query  700  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  521
            L+LNY+EV+ AW+ +G  W          N C       + ++    G   +M      R
Sbjct  147  LNLNYQEVLDAWSDRGSLWA---------NDCSASMATSNTYYM---GEVPVMEEEKTRR  194

Query  520  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
            EA V RY+EKR+TRLFSKKIRY+VRKLNA+KRPRLKGRFVKR S
Sbjct  195  EASVMRYKEKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKRVS  238



>ref|XP_009369559.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2 [Pyrus x bretschneideri]
Length=234

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 69/108 (64%), Gaps = 12/108 (11%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  539
            KK ++ L+LNY+EV+ AW+ +G  W D          C    M  + ++    G   +M 
Sbjct  138  KKVQLNLNLNYQEVLDAWSDRGSLWADD---------CSLSSMASNGNYM---GEVPVME  185

Query  538  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
                 REA V RY+EKR++RLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  186  EDKTRREASVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRLKGRFVKR  233



>ref|XP_011003377.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Populus euphratica]
Length=207

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 69/110 (63%), Gaps = 13/110 (12%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  539
            K+  + L+LNY+EV+ AW+ +G    D           +   MG + ++    G   +M 
Sbjct  111  KRVSLNLNLNYQEVLDAWSDRGSLLADD----------YSLSMGSNCYYK---GEVPVME  157

Query  538  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
                 REA V RYREKR+TRLFSKKIRY+VRKLNA+KRPRLKGRFVKR S
Sbjct  158  EDRTRREASVLRYREKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKRVS  207



>ref|XP_007016977.1| CCT motif family protein isoform 2, partial [Theobroma cacao]
 gb|EOY34596.1| CCT motif family protein isoform 2, partial [Theobroma cacao]
Length=240

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 68/110 (62%), Gaps = 13/110 (12%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  539
            K+  + L+LNY++V+ AW+ +G  W D             D+      + +  G   +M 
Sbjct  144  KRVSLNLNLNYQDVLDAWSDRGSLWAD-------------DYSISKASNGYYMGEVPVME  190

Query  538  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
                 REA V RY+EKR+TRLFSKKIRY+VRKLNA+KRPRLKGRFVKR S
Sbjct  191  EERARREASVLRYKEKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKRVS  240



>ref|XP_002274679.2| PREDICTED: zinc finger protein CONSTANS-LIKE 7 [Vitis vinifera]
Length=218

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 63/102 (62%), Gaps = 14/102 (14%)
 Frame = -1

Query  700  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  521
            L+LNY+EV+ AW+ +G  W D          C   F    +    P     +M      R
Sbjct  123  LNLNYQEVLEAWSDRGSLWAD---------DCSLSFKNTSYMGEVP-----VMEEEKTRR  168

Query  520  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            EA V RY+EKR+TRLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  169  EASVLRYKEKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKR  210



>ref|XP_008797174.1| PREDICTED: uncharacterized protein LOC103712429 [Phoenix dactylifera]
Length=232

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 70/115 (61%), Gaps = 17/115 (15%)
 Frame = -1

Query  706  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPY-----GSAMMM  542
            + L L+YE+V++AW+ +G  + DG  P   P           HH   P       +   +
Sbjct  126  LSLKLDYEDVLTAWSDRGSLYIDGDGPQVVPEL---------HHTASPVMVEVGSTGWRV  176

Query  541  RRSDE---GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
              SD     REARV RY+EKRR+RLFSK++RYEVRKLNAE+RPRLKGRFVKR  +
Sbjct  177  PESDREAGNREARVMRYKEKRRSRLFSKRVRYEVRKLNAERRPRLKGRFVKRKDV  231



>ref|XP_010519196.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7 isoform X1 [Tarenaya 
hassleriana]
Length=450

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 91/227 (40%), Positives = 114/227 (50%), Gaps = 34/227 (15%)
 Frame = -1

Query  961  DVELAEFAADVETLLGDDDVGEDKATAA----------------VKIEINGGDCTEALNW  830
            D++LAE   DVE+LLG++     K   A                VK E       E   W
Sbjct  221  DMDLAELTMDVESLLGEESCMGIKEPGALEFKEDEEKIGLTLRTVKDEEEEEGLGETCRW  280

Query  829  SF--------GEEQEVEQKVMMTMLSGFDe-ssssmesgsckeEVAKKSRMLLSLNYEEV  677
            +         G+ +EVE       L   D       E   C +E AKK  + L L+YE V
Sbjct  281  NLDNGSSVSGGKREEVEDVNGKKGLRSEDNYEEEGEEEERCADEKAKKQSLFLRLDYEAV  340

Query  676  ISAWASQGCPWTDGTRPHFDPNHCWPD-----FMGGDHHHHHPYGSAMMMRR----SDEG  524
            + AW S+  PWT G  P F P++ W D     F+        P   +M  R+    SD  
Sbjct  341  MIAWDSECSPWTTGRCPDFRPSNFWLDCLLQGFVIDGSEEATPAVGSMPRRQGRGGSDGE  400

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLF  383
            REARV RYREKRR RLF+KKIRYEVRKLNAEKRPR+KGRFV+R+S +
Sbjct  401  REARVLRYREKRRRRLFAKKIRYEVRKLNAEKRPRIKGRFVRRTSSY  447



>ref|XP_008354834.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X1 
[Malus domestica]
Length=235

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 70/109 (64%), Gaps = 13/109 (12%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  539
            KK ++ L+LNY+EV+ AW+ +G  W D          C    M  + ++    G   +M 
Sbjct  138  KKVQLNLNLNYQEVMDAWSDRGTLWADD---------CSLSSMASNGNY---IGEVPVME  185

Query  538  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLK-GRFVKR  395
                 REARV RY+EKR++RLFSKKIRY+VRKLNA+KRPRLK GRFVKR
Sbjct  186  EEKARREARVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRLKQGRFVKR  234



>gb|KHN40106.1| Protein CHLOROPLAST IMPORT APPARATUS 2 [Glycine soja]
Length=220

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 65/102 (64%), Gaps = 12/102 (12%)
 Frame = -1

Query  700  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  521
            L+LNY+EV+ AW+ +G  W D     F  N+ +  +MG             ++      R
Sbjct  130  LNLNYQEVLDAWSDRGSLWADDCSLSFPTNNAY--YMG----------EVPVLEEERARR  177

Query  520  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            EA V RY+EKR+ RLFSKKIRY+VRKLNA+KRPR+KGRFVKR
Sbjct  178  EASVLRYKEKRQNRLFSKKIRYQVRKLNADKRPRIKGRFVKR  219



>ref|XP_001769217.1| predicted protein [Physcomitrella patens]
 gb|EDQ65929.1| predicted protein [Physcomitrella patens]
Length=646

 Score = 98.2 bits (243),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 70/116 (60%), Gaps = 20/116 (17%)
 Frame = -1

Query  721  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHC----------WPDFMGGDHHH  572
             K +  LL LNYE+++SAW+ +   WTDG RP   P+             PDF  G+   
Sbjct  381  VKPAPSLLRLNYEDIMSAWSDRSL-WTDGKRPQTVPDDSNSESTVDLGMVPDF--GNGCQ  437

Query  571  HHPYGSAMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRF  404
              P GS       D GR AR+ RYREKRRTRLFSKKIRYEVRKLNAE+RPR+K + 
Sbjct  438  TVPGGS-------DGGRGARIMRYREKRRTRLFSKKIRYEVRKLNAERRPRMKSQL  486



>ref|XP_003544900.2| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
X1 [Glycine max]
Length=240

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 65/102 (64%), Gaps = 12/102 (12%)
 Frame = -1

Query  700  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  521
            L+LNY+EV+ AW+ +G  W D     F  N+ +  +MG             ++      R
Sbjct  150  LNLNYQEVLDAWSDRGSLWADDCSLSFPTNNAY--YMG----------EVPVLEEERARR  197

Query  520  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            EA V RY+EKR+ RLFSKKIRY+VRKLNA+KRPR+KGRFVKR
Sbjct  198  EASVLRYKEKRQNRLFSKKIRYQVRKLNADKRPRIKGRFVKR  239



>ref|XP_009354286.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009341687.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like isoform X1 
[Pyrus x bretschneideri]
Length=235

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 69/109 (63%), Gaps = 13/109 (12%)
 Frame = -1

Query  718  KKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR  539
            KK R+ L+LNY+EV+ AW+ +G  W D          C    M  + ++    G   +M 
Sbjct  138  KKVRLNLNLNYQEVMDAWSDRGTLWADD---------CSLSSMASNGNY---IGEVPVME  185

Query  538  RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLK-GRFVKR  395
                 REARV RY+EKR++RLFSKKIRY+VRKLNA+KRPR K GRFVKR
Sbjct  186  DEKARREARVLRYKEKRQSRLFSKKIRYQVRKLNADKRPRFKQGRFVKR  234



>ref|XP_006574444.1| PREDICTED: uncharacterized protein LOC100803772 isoform X1 [Glycine 
max]
Length=217

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 65/102 (64%), Gaps = 12/102 (12%)
 Frame = -1

Query  700  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  521
            L+LNY+EV+ AW+ +G  W D     F  N+ +  +MG             ++      R
Sbjct  127  LNLNYQEVLDAWSDRGSLWADDCSLSFATNNAY--YMG----------EVPVLEEERARR  174

Query  520  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            EA V RY+EKR+ RLFSKKIRY+VRKLNA+KRPR+KGRFVKR
Sbjct  175  EACVLRYKEKRQNRLFSKKIRYQVRKLNADKRPRIKGRFVKR  216



>ref|XP_002298500.1| CONSTANS-like family protein [Populus trichocarpa]
 gb|EEE83305.1| CONSTANS-like family protein [Populus trichocarpa]
Length=207

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 63/102 (62%), Gaps = 13/102 (13%)
 Frame = -1

Query  700  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  521
            L+LNY+EV+ AW+ +G        P    +H       G     H  G   +M      R
Sbjct  117  LNLNYQEVLEAWSDRG--------PLLADDHSLSTASNG-----HYMGEVPVMEEDRTRR  163

Query  520  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            EA V RY+EKR+TRLFSKKIRY+VRKLNA+KRPRLKGRFVKR
Sbjct  164  EASVLRYKEKRQTRLFSKKIRYQVRKLNADKRPRLKGRFVKR  205



>ref|XP_008799931.1| PREDICTED: uncharacterized protein LOC103714457 [Phoenix dactylifera]
Length=268

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 67/106 (63%), Gaps = 3/106 (3%)
 Frame = -1

Query  703  LLSLNYEEVISAWASQGCPWTDGTRPHFDPN---HCWPDFMGGDHHHHHPYGSAMMMRRS  533
            LL L+YEEV++AW+ +G  + DG  P   P       P F+           S  M  + 
Sbjct  160  LLKLDYEEVLTAWSDRGSLYIDGEGPQIVPELHRTASPVFVEVGCTGWRVPESDRMEGKE  219

Query  532  DEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
               REARV RY+EKRR+R FSK+IRYEVRKLNAEKRPRLKGRFV+R
Sbjct  220  VGNREARVMRYKEKRRSRHFSKQIRYEVRKLNAEKRPRLKGRFVRR  265



>ref|XP_010938521.1| PREDICTED: uncharacterized protein LOC105057575 [Elaeis guineensis]
Length=233

 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 69/115 (60%), Gaps = 17/115 (15%)
 Frame = -1

Query  706  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPY----GSAMMMR  539
            + L L+YEEV++AW+ +G  + DG  P   P+          +H   P     GS     
Sbjct  127  LSLKLDYEEVLTAWSDRGSLYIDGDGPQVVPDL---------YHTTSPVLVEVGSTGWTV  177

Query  538  RSDE----GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
               E     REARV RY+EKRR+RLFSK+IRYEVRKLNAEKRPR KGRFV+R  +
Sbjct  178  PESELEVGNREARVMRYKEKRRSRLFSKRIRYEVRKLNAEKRPRSKGRFVRRKDV  232



>ref|XP_009125969.1| PREDICTED: zinc finger protein CONSTANS-LIKE 7-like [Brassica 
rapa]
Length=156

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 69/114 (61%), Gaps = 4/114 (4%)
 Frame = -1

Query  715  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDFMGGDHHHHHPYGSAMMMR  539
            ++ + L L+YEE++ AW  +G  + DG  P   P+ H   D + G       +    M  
Sbjct  43   RTSLALKLDYEEIMEAWPDKGTLYVDGEPPQTVPDLHASTDVVTGGGEAGSLWTVPEMET  102

Query  538  RSD---EGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
                    REA + RY+EKR++RLFSK+IRY+VRKLNAEKRPR+KGRFVKR  L
Sbjct  103  TETLWRGHREASLLRYKEKRQSRLFSKRIRYQVRKLNAEKRPRVKGRFVKRDDL  156



>ref|XP_003615824.1| Zinc finger protein CONSTANS-like protein [Medicago truncatula]
 gb|ACJ84105.1| unknown [Medicago truncatula]
 gb|AES98782.1| CCT motif protein [Medicago truncatula]
 gb|AFK39776.1| unknown [Medicago truncatula]
Length=217

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 65/102 (64%), Gaps = 11/102 (11%)
 Frame = -1

Query  700  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEGR  521
            L+LNY+EV+ AW+++G  W          N C   F   ++  +   G   ++      R
Sbjct  126  LNLNYQEVLDAWSNRGSLWA---------NDCSLSFSSSNNGSYM--GEVPILEEERARR  174

Query  520  EARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            EA V RY+EKR+ RLFSKKIRY+VRKLNA+KRPR+KGRFVKR
Sbjct  175  EASVLRYKEKRQNRLFSKKIRYQVRKLNADKRPRIKGRFVKR  216



>ref|XP_010927568.1| PREDICTED: uncharacterized protein LOC105049568 [Elaeis guineensis]
Length=231

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 69/118 (58%), Gaps = 23/118 (19%)
 Frame = -1

Query  706  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDE  527
            + L L+YEEV++AW+ +G  + DG  P   P+             HH     ++  RS  
Sbjct  125  LSLKLDYEEVLTAWSGRGSFYIDGDGPQVVPDL------------HHTTSPVLVEVRSTG  172

Query  526  -----------GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
                        REARV RY+EKRR+RLFSK+IRYEVRKL+AEKRPR KGRFVKR  +
Sbjct  173  WRVPESEREVGNREARVMRYKEKRRSRLFSKRIRYEVRKLDAEKRPRSKGRFVKRKDV  230



>ref|XP_001765504.1| predicted protein [Physcomitrella patens]
 gb|EDQ69765.1| predicted protein [Physcomitrella patens]
Length=495

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 70/111 (63%), Gaps = 24/111 (22%)
 Frame = -1

Query  700  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEG-  524
            L LNYE+VI+AW+ +G PW       F P+ C  D             + ++   + EG 
Sbjct  380  LRLNYEDVITAWSDRGEPW-------FYPHDCTSD----------ATDAGLVPDMAQEGA  422

Query  523  ------REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSS  389
                  REA V R++EKRR+RLFSK+IRYEVRKLNAEKRPR+KGRFVK++S
Sbjct  423  DDCQGSREASVMRFKEKRRSRLFSKRIRYEVRKLNAEKRPRMKGRFVKKNS  473



>ref|XP_009383142.1| PREDICTED: zinc finger protein CONSTANS-LIKE 6-like [Musa acuminata 
subsp. malaccensis]
Length=324

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 69/122 (57%), Gaps = 29/122 (24%)
 Frame = -1

Query  706  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMR----  539
            + L L+YEE+++ W+ +G  + DG  P   P               HP  SAM++     
Sbjct  208  LALKLDYEEILAVWSDRGPLYMDGEGPQVVP------------QLQHPCDSAMLVEVGCR  255

Query  538  -------------RSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVK  398
                         RS   REARV RY+EKRR RLF+K+IRYEVRK NAEKRPR+KGRFV+
Sbjct  256  SWKVPEQPAEGKERSGMSREARVMRYKEKRRNRLFAKRIRYEVRKFNAEKRPRVKGRFVR  315

Query  397  RS  392
            R+
Sbjct  316  RN  317



>ref|XP_011010948.1| PREDICTED: uncharacterized protein LOC105115687 [Populus euphratica]
Length=310

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 69/111 (62%), Gaps = 8/111 (7%)
 Frame = -1

Query  700  LSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDEG-  524
            L L+Y+E+++AW+ +G  + +G  P   P+ C       D   H      +   ++ EG 
Sbjct  197  LKLDYQEILNAWSDKGPLYIEGESPQTVPDICDGSNQLMDEWGHVWRVPDLCGSKTKEGK  256

Query  523  -------REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  392
                   REA V RY+EKR+ RLF+K+IRYEVRKLNAEKRPRLKGRFVKRS
Sbjct  257  EIWKSGLREASVLRYKEKRQNRLFAKRIRYEVRKLNAEKRPRLKGRFVKRS  307



>ref|XP_007142158.1| hypothetical protein PHAVU_008G257300g [Phaseolus vulgaris]
 gb|ESW14152.1| hypothetical protein PHAVU_008G257300g [Phaseolus vulgaris]
Length=217

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 64/103 (62%), Gaps = 14/103 (14%)
 Frame = -1

Query  700  LSLNYEEVISAWASQGCPWTDGTRPHFDPNH-CWPDFMGGDHHHHHPYGSAMMMRRSDEG  524
            L+LNY+EV+ AW+++G  W D        N+ C+              G   ++      
Sbjct  127  LNLNYQEVLDAWSNRGSLWADECSLSLATNNSCYN-------------GEVPVLEEERAR  173

Query  523  REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            REA V RY+EKR+ RLFSKKIRY+VRKLNA+KRPR+KGRFVKR
Sbjct  174  REASVLRYKEKRQNRLFSKKIRYQVRKLNADKRPRIKGRFVKR  216



>ref|XP_008799492.1| PREDICTED: LOW QUALITY PROTEIN: protein CHLOROPLAST IMPORT APPARATUS 
2-like [Phoenix dactylifera]
Length=411

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 65/112 (58%), Gaps = 8/112 (7%)
 Frame = -1

Query  715  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRR  536
            KS + L LN+EEV+ AW+  G  + DG                 D       G  +    
Sbjct  300  KSGLGLKLNHEEVLKAWSGHGSVFADGPDSPHSSAEALAKLADIDLFPEAGGGGGV----  355

Query  535  SDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSLFQ  380
                REA V RY+EKRRTRLFSKKIRY+VRK+NA++RPR+KGRFVKR SL Q
Sbjct  356  ----REASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVKRPSLLQ  403



>ref|XP_006393307.1| hypothetical protein EUTSA_v10011633mg [Eutrema salsugineum]
 gb|ESQ30593.1| hypothetical protein EUTSA_v10011633mg [Eutrema salsugineum]
Length=326

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 66/114 (58%), Gaps = 16/114 (14%)
 Frame = -1

Query  721  AKKSRMLLSLNYEEVISAWASQ----GCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGS  554
            AK+  MLL LNYE VI+AW  Q    G P  +             +F         P G+
Sbjct  220  AKQMNMLLRLNYENVIAAWDKQESPRGAPINET------------EFNNISTFQLVPPGT  267

Query  553  AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  392
                  S   REARV RYR+KR+ RLF KKIRYEVRK+NA+KRPR+KGRFV+RS
Sbjct  268  EEKKMSSKSEREARVWRYRDKRKNRLFEKKIRYEVRKVNADKRPRMKGRFVRRS  321



>ref|XP_006453246.1| hypothetical protein CICLE_v10008308mg [Citrus clementina]
 ref|XP_006474272.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
X1 [Citrus sinensis]
 gb|ESR66486.1| hypothetical protein CICLE_v10008308mg [Citrus clementina]
Length=442

 Score = 94.4 bits (233),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 70/110 (64%), Gaps = 13/110 (12%)
 Frame = -1

Query  721  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMM  542
            A    +LL L Y++V++AW+ +G P+ D +          PD  G D         A + 
Sbjct  325  ANSGELLLKLQYDDVLNAWSGKGSPFLDES--------LAPDGQGNDVSARL----AQID  372

Query  541  RRSDEG-REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
              SD G REA V RY+EKRRTRLFSKKIRY+VRK+NA++RPR+KGRFV+R
Sbjct  373  LFSDGGLREASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRR  422



>ref|XP_004490653.1| PREDICTED: protein CHLOROPLAST IMPORT APPARATUS 2-like isoform 
X2 [Cicer arietinum]
Length=198

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 65/104 (63%), Gaps = 12/104 (12%)
 Frame = -1

Query  706  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDE  527
            + L+LNY+EV+ AW+ +G  W DG       N+    +MG             ++     
Sbjct  106  LKLNLNYQEVLDAWSDRGSLWADGCSSLSTNNYA--SYMG----------EVPILEEERR  153

Query  526  GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
             REA V RY+EKR+ RLFSKKIRY+VRKLNA+KRPR+KGRFVKR
Sbjct  154  RREASVLRYKEKRQNRLFSKKIRYQVRKLNADKRPRIKGRFVKR  197



>ref|XP_009144991.1| PREDICTED: zinc finger protein CONSTANS-LIKE 8 [Brassica rapa]
 emb|CDY66242.1| BnaA05g36570D [Brassica napus]
Length=314

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 68/110 (62%), Gaps = 8/110 (7%)
 Frame = -1

Query  721  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMM  542
            AK+  +LL LNYE VI+AW  Q  P    T   ++ N    +F    +    P G     
Sbjct  208  AKQRNLLLRLNYENVIAAWDKQESP----TTATWNQN----EFSNTSNFQLVPPGIEEEK  259

Query  541  RRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  392
              +   REARV RYR+KR+ RLF KKIRYEVRK+NA+KRPR+KGRFV+RS
Sbjct  260  VSNRSEREARVWRYRDKRKNRLFEKKIRYEVRKVNADKRPRIKGRFVRRS  309



>emb|CDX70561.1| BnaC03g06450D [Brassica napus]
Length=151

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 70/113 (62%), Gaps = 4/113 (4%)
 Frame = -1

Query  715  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDFM--GGDHHHHHPYGSAMM  545
            +S + L L+YE+++ AW  +G  + DG  P   P+ H   D    GG+     P    M 
Sbjct  40   RSSLALKLDYEQIMEAWLDKGTLYVDGEPPQTVPDLHASADVFTSGGEALWAVPEMETME  99

Query  544  MRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
             R     REA + RY+EKR++ LFSK+IRY+VRKLNAEKRPR+KGRFVKR  L
Sbjct  100  -RLWRVHREASLLRYKEKRQSLLFSKRIRYQVRKLNAEKRPRIKGRFVKRDDL  151



>ref|XP_006393308.1| hypothetical protein EUTSA_v10011633mg [Eutrema salsugineum]
 dbj|BAJ34092.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ30594.1| hypothetical protein EUTSA_v10011633mg [Eutrema salsugineum]
Length=339

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 66/114 (58%), Gaps = 16/114 (14%)
 Frame = -1

Query  721  AKKSRMLLSLNYEEVISAWASQ----GCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGS  554
            AK+  MLL LNYE VI+AW  Q    G P  +             +F         P G+
Sbjct  233  AKQMNMLLRLNYENVIAAWDKQESPRGAPINET------------EFNNISTFQLVPPGT  280

Query  553  AMMMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  392
                  S   REARV RYR+KR+ RLF KKIRYEVRK+NA+KRPR+KGRFV+RS
Sbjct  281  EEKKMSSKSEREARVWRYRDKRKNRLFEKKIRYEVRKVNADKRPRMKGRFVRRS  334



>gb|KFK36040.1| hypothetical protein AALP_AA4G070200 [Arabis alpina]
Length=330

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 68/112 (61%), Gaps = 16/112 (14%)
 Frame = -1

Query  721  AKKSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYG--SAM  548
            AK+  MLL LNYE V++AW  Q  P                 F    +    P+G     
Sbjct  228  AKQRNMLLRLNYENVMAAWDKQESPRNQTK------------FTNTSNFQLVPHGIMEKD  275

Query  547  MMRRSDEGREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRS  392
            + R+SD  REARV RYR+KR+ RLF KKIRYEVRK+NA+KRPR+KGRFV+RS
Sbjct  276  VSRKSD--REARVWRYRDKRKNRLFEKKIRYEVRKVNADKRPRMKGRFVRRS  325



>ref|XP_010111554.1| Protein CHLOROPLAST IMPORT APPARATUS 2 [Morus notabilis]
 gb|EXC31212.1| Protein CHLOROPLAST IMPORT APPARATUS 2 [Morus notabilis]
Length=440

 Score = 94.0 bits (232),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 68/106 (64%), Gaps = 17/106 (16%)
 Frame = -1

Query  706  MLLSLNYEEVISAWASQGCPWTDGTRPHFDPNHCWPDFMGGDHHHHHPYGSAMMMRRSDE  527
            +LL LNY+ V+SAW+ +G P++D             D  G D         A +   SD 
Sbjct  339  LLLKLNYDGVLSAWSDKGSPFSDEA-----------DVPGNDVAARL----AQIDLFSDT  383

Query  526  G--REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKR  395
            G  REA V RY+EKRRTRLFSKKIRY+VRK+NA++RPR+KGRFV+R
Sbjct  384  GGVREASVLRYKEKRRTRLFSKKIRYQVRKVNADRRPRMKGRFVRR  429



>gb|KFK25676.1| hypothetical protein AALP_AA8G144900 [Arabis alpina]
Length=329

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 71/115 (62%), Gaps = 6/115 (5%)
 Frame = -1

Query  715  KSRMLLSLNYEEVISAWASQGCPWTDGTRPHFDPN-HCWPDFMGGDHHHHHPYGSAMMMR  539
            ++ + L L+YE+++ AW+ +G  + DG  P   P+ H  PD    D        +   M 
Sbjct  216  RTSLALKLDYEQIMEAWSDKGTLYVDGEPPQTVPDLHASPDGFA-DAGEAGSLWTVPEME  274

Query  538  RSDE----GREARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRLKGRFVKRSSL  386
             ++      REA + RY+EKR+ RLFSK+IRY+VRKLNAEKRPR+KGRFVKR  L
Sbjct  275  TTERLWRGHREASLLRYKEKRQNRLFSKRIRYQVRKLNAEKRPRIKGRFVKRDDL  329



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2350593015464