BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13599

Length=1406
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011086200.1|  PREDICTED: calcium permeable stress-gated ca...    388   8e-123   Sesamum indicum [beniseed]
ref|XP_007141612.1|  hypothetical protein PHAVU_008G210700g             385   5e-122   Phaseolus vulgaris [French bean]
ref|XP_002317144.2|  early-responsive to dehydration family protein     385   8e-122   
ref|XP_008459005.1|  PREDICTED: uncharacterized membrane protein ...    385   1e-121   Cucumis melo [Oriental melon]
ref|XP_011463550.1|  PREDICTED: calcium permeable stress-gated ca...    381   8e-121   Fragaria vesca subsp. vesca
ref|XP_006283166.1|  hypothetical protein CARUB_v10004197mg             382   1e-120   Capsella rubella
ref|XP_004289181.1|  PREDICTED: calcium permeable stress-gated ca...    382   2e-120   Fragaria vesca subsp. vesca
ref|XP_006396700.1|  hypothetical protein EUTSA_v10028449mg             381   3e-120   
ref|XP_010252492.1|  PREDICTED: calcium permeable stress-gated ca...    381   3e-120   Nelumbo nucifera [Indian lotus]
ref|XP_011016279.1|  PREDICTED: CSC1-like protein At3g21620             380   8e-120   Populus euphratica
gb|KHN38468.1|  Putative membrane protein C2G11.09                      380   9e-120   Glycine soja [wild soybean]
ref|XP_003519463.1|  PREDICTED: uncharacterized membrane protein ...    380   1e-119   Glycine max [soybeans]
dbj|BAF98597.1|  CM0545.360.nc                                          379   1e-119   Lotus japonicus
gb|ABK96436.1|  unknown                                                 362   2e-119   Populus trichocarpa x Populus deltoides
ref|XP_002518432.1|  conserved hypothetical protein                     379   2e-119   
ref|XP_009772361.1|  PREDICTED: CSC1-like protein At3g21620             379   2e-119   Nicotiana sylvestris
ref|XP_008363487.1|  PREDICTED: uncharacterized protein RSN1-like       373   2e-119   
ref|XP_009592755.1|  PREDICTED: CSC1-like protein At3g21620             379   3e-119   Nicotiana tomentosiformis
ref|XP_006469645.1|  PREDICTED: uncharacterized membrane protein ...    372   9e-119   
ref|XP_011047222.1|  PREDICTED: CSC1-like protein At3g21620             377   2e-118   Populus euphratica
ref|XP_010099166.1|  Uncharacterized membrane protein                   377   2e-118   Morus notabilis
ref|XP_009357481.1|  PREDICTED: calcium permeable stress-gated ca...    376   4e-118   Pyrus x bretschneideri [bai li]
ref|XP_011002577.1|  PREDICTED: calcium permeable stress-gated ca...    376   4e-118   Populus euphratica
emb|CAA18115.1|  putative protein                                       372   1e-117   Arabidopsis thaliana [mouse-ear cress]
gb|KDP20707.1|  hypothetical protein JCGZ_21178                         372   1e-117   Jatropha curcas
ref|XP_002321139.1|  early-responsive to dehydration family protein     374   2e-117   Populus trichocarpa [western balsam poplar]
ref|XP_004145433.1|  PREDICTED: calcium permeable stress-gated ca...    374   2e-117   Cucumis sativus [cucumbers]
ref|XP_010439363.1|  PREDICTED: calcium permeable stress-gated ca...    374   3e-117   
ref|XP_010434078.1|  PREDICTED: calcium permeable stress-gated ca...    374   3e-117   Camelina sativa [gold-of-pleasure]
ref|XP_006417282.1|  hypothetical protein EUTSA_v10006870mg             374   3e-117   Eutrema salsugineum [saltwater cress]
ref|XP_006413690.1|  hypothetical protein EUTSA_v10024476mg             373   4e-117   Eutrema salsugineum [saltwater cress]
emb|CDX82907.1|  BnaC01g13570D                                          373   4e-117   
ref|XP_006287117.1|  hypothetical protein CARUB_v10000278mg             373   4e-117   Capsella rubella
ref|NP_172660.5|  putative ERD4 protein                                 373   4e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008455928.1|  PREDICTED: uncharacterized membrane protein ...    369   5e-117   Cucumis melo [Oriental melon]
ref|XP_002867790.1|  hypothetical protein ARALYDRAFT_492658             373   5e-117   
gb|AAC17615.1|  Similar to hypothetical protein HYP1 gb|Z97338 fr...    373   6e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008229991.1|  PREDICTED: uncharacterized membrane protein ...    373   6e-117   
ref|XP_008455926.1|  PREDICTED: uncharacterized membrane protein ...    369   6e-117   
ref|XP_004243535.1|  PREDICTED: CSC1-like protein At3g21620             372   6e-117   Solanum lycopersicum
ref|XP_008384098.1|  PREDICTED: uncharacterized protein RSN1            372   7e-117   
ref|XP_009135587.1|  PREDICTED: calcium permeable stress-gated ca...    372   7e-117   Brassica rapa
ref|XP_004151944.1|  PREDICTED: calcium permeable stress-gated ca...    372   7e-117   Cucumis sativus [cucumbers]
ref|XP_002264502.1|  PREDICTED: calcium permeable stress-gated ca...    372   8e-117   
ref|XP_002301612.2|  early-responsive to dehydration family protein     372   8e-117   
ref|NP_193943.2|  early-responsive to dehydration stress-related ...    372   9e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006447609.1|  hypothetical protein CICLE_v10014378mg             372   1e-116   Citrus clementina [clementine]
emb|CDY21297.1|  BnaC03g29810D                                          372   1e-116   Brassica napus [oilseed rape]
ref|XP_002892667.1|  hypothetical protein ARALYDRAFT_312226             372   1e-116   
ref|NP_192343.1|  early-responsive to dehydration stress-related ...    372   2e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010448929.1|  PREDICTED: calcium permeable stress-gated ca...    372   2e-116   
ref|XP_011007190.1|  PREDICTED: CSC1-like protein At3g21620             371   2e-116   Populus euphratica
ref|XP_009108550.1|  PREDICTED: calcium permeable stress-gated ca...    371   2e-116   Brassica rapa
ref|XP_006363038.1|  PREDICTED: uncharacterized protein RSN1-like...    371   2e-116   Solanum tuberosum [potatoes]
ref|NP_001291223.1|  calcium permeable stress-gated cation channel 1    371   3e-116   Populus euphratica
ref|XP_006348154.1|  PREDICTED: uncharacterized protein RSN1-like...    369   3e-116   Solanum tuberosum [potatoes]
ref|XP_009772257.1|  PREDICTED: calcium permeable stress-gated ca...    370   7e-116   Nicotiana sylvestris
gb|AAL07154.1|  unknown protein                                         370   8e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011046982.1|  PREDICTED: calcium permeable stress-gated ca...    367   9e-116   Populus euphratica
dbj|BAD93792.1|  hypothetical protein                                   369   1e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010493595.1|  PREDICTED: LOW QUALITY PROTEIN: CSC1-like pr...    369   1e-115   
ref|XP_008455922.1|  PREDICTED: uncharacterized protein RSN1 isof...    369   2e-115   Cucumis melo [Oriental melon]
ref|XP_009613689.1|  PREDICTED: calcium permeable stress-gated ca...    369   2e-115   Nicotiana tomentosiformis
ref|XP_009148626.1|  PREDICTED: CSC1-like protein At1g11960             369   2e-115   Brassica rapa
ref|XP_007211353.1|  hypothetical protein PRUPE_ppa001728mg             369   2e-115   Prunus persica
emb|CDX98089.1|  BnaA06g08400D                                          369   2e-115   
ref|XP_006348153.1|  PREDICTED: uncharacterized protein RSN1-like...    369   2e-115   Solanum tuberosum [potatoes]
ref|XP_006306821.1|  hypothetical protein CARUB_v10008363mg             368   3e-115   Capsella rubella
ref|XP_010539247.1|  PREDICTED: calcium permeable stress-gated ca...    368   3e-115   Tarenaya hassleriana [spider flower]
ref|XP_010476146.1|  PREDICTED: CSC1-like protein At1g11960             368   3e-115   Camelina sativa [gold-of-pleasure]
ref|XP_010035539.1|  PREDICTED: CSC1-like protein At3g21620             368   4e-115   Eucalyptus grandis [rose gum]
emb|CDP04437.1|  unnamed protein product                                368   4e-115   Coffea canephora [robusta coffee]
ref|XP_006467388.1|  PREDICTED: uncharacterized membrane protein ...    368   5e-115   Citrus sinensis [apfelsine]
ref|XP_012080615.1|  PREDICTED: CSC1-like protein At3g21620             368   5e-115   Jatropha curcas
ref|XP_010458617.1|  PREDICTED: CSC1-like protein At1g11960             368   5e-115   Camelina sativa [gold-of-pleasure]
ref|XP_004491137.1|  PREDICTED: uncharacterized protein RSN1-like       367   6e-115   Cicer arietinum [garbanzo]
gb|KJB57786.1|  hypothetical protein B456_009G181100                    367   7e-115   Gossypium raimondii
ref|XP_008224710.1|  PREDICTED: uncharacterized membrane protein ...    367   8e-115   Prunus mume [ume]
ref|XP_004232686.1|  PREDICTED: calcium permeable stress-gated ca...    367   1e-114   Solanum lycopersicum
emb|CDY30043.1|  BnaC05g09770D                                          367   1e-114   Brassica napus [oilseed rape]
ref|XP_002872689.1|  hypothetical protein ARALYDRAFT_911697             367   1e-114   Arabidopsis lyrata subsp. lyrata
emb|CDY27443.1|  BnaC03g64830D                                          367   1e-114   Brassica napus [oilseed rape]
ref|XP_011046979.1|  PREDICTED: calcium permeable stress-gated ca...    366   2e-114   Populus euphratica
ref|XP_003616997.1|  Transmembrane protein                              366   2e-114   Medicago truncatula
gb|EMS56194.1|  Uncharacterized membrane protein C2G11.09               361   3e-114   Triticum urartu
ref|XP_009134294.1|  PREDICTED: CSC1-like protein At4g04340             365   3e-114   Brassica rapa
emb|CDX90856.1|  BnaA03g25360D                                          365   3e-114   
ref|XP_009357605.1|  PREDICTED: calcium permeable stress-gated ca...    365   4e-114   Pyrus x bretschneideri [bai li]
ref|XP_007026161.1|  ERD (early-responsive to dehydration stress)...    365   7e-114   
emb|CDY19541.1|  BnaC09g13620D                                          365   9e-114   Brassica napus [oilseed rape]
ref|XP_004507664.1|  PREDICTED: uncharacterized membrane protein ...    364   1e-113   Cicer arietinum [garbanzo]
ref|XP_002457968.1|  hypothetical protein SORBIDRAFT_03g023990          364   1e-113   Sorghum bicolor [broomcorn]
gb|KHG22816.1|  putative membrane C2G11.09                              360   1e-113   Gossypium arboreum [tree cotton]
ref|XP_010089460.1|  Uncharacterized membrane protein                   364   1e-113   
ref|XP_009418442.1|  PREDICTED: calcium permeable stress-gated ca...    363   2e-113   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010546606.1|  PREDICTED: CSC1-like protein At1g11960             363   3e-113   Tarenaya hassleriana [spider flower]
ref|XP_007049121.1|  ERD (early-responsive to dehydration stress)...    363   3e-113   
gb|KJB69238.1|  hypothetical protein B456_011G012200                    358   4e-113   Gossypium raimondii
ref|XP_003549667.1|  PREDICTED: uncharacterized membrane protein ...    363   4e-113   Glycine max [soybeans]
ref|XP_006383870.1|  early-responsive to dehydration family protein     363   4e-113   
ref|XP_003569164.1|  PREDICTED: calcium permeable stress-gated ca...    363   4e-113   Brachypodium distachyon [annual false brome]
ref|NP_001056508.1|  Os05g0594700                                       362   5e-113   
ref|XP_006387597.1|  hypothetical protein POPTR_0796s00210g             360   6e-113   
ref|XP_010548889.1|  PREDICTED: CSC1-like protein At3g21620             362   6e-113   Tarenaya hassleriana [spider flower]
ref|XP_010496174.1|  PREDICTED: protein OSCA1-like                      362   7e-113   Camelina sativa [gold-of-pleasure]
ref|XP_010422263.1|  PREDICTED: LOW QUALITY PROTEIN: protein OSCA...    362   8e-113   
ref|XP_006644293.1|  PREDICTED: uncharacterized membrane protein ...    362   1e-112   Oryza brachyantha
ref|XP_006447608.1|  hypothetical protein CICLE_v10014696mg             356   1e-112   
ref|XP_010686787.1|  PREDICTED: calcium permeable stress-gated ca...    361   1e-112   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB10672.1|  hypothetical protein B456_001G215500                    356   2e-112   Gossypium raimondii
ref|XP_007217157.1|  hypothetical protein PRUPE_ppa001757mg             361   2e-112   Prunus persica
ref|XP_006350470.1|  PREDICTED: uncharacterized membrane protein ...    360   2e-112   Solanum tuberosum [potatoes]
gb|KDO39720.1|  hypothetical protein CISIN_1g048588mg                   356   3e-112   Citrus sinensis [apfelsine]
ref|XP_010657219.1|  PREDICTED: CSC1-like protein At3g21620             360   3e-112   Vitis vinifera
dbj|BAK03311.1|  predicted protein                                      360   3e-112   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007153987.1|  hypothetical protein PHAVU_003G081500g             360   5e-112   Phaseolus vulgaris [French bean]
ref|XP_010231849.1|  PREDICTED: calcium permeable stress-gated ca...    358   5e-112   
gb|EEE64912.1|  hypothetical protein OsJ_19772                          362   7e-112   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011095994.1|  PREDICTED: calcium permeable stress-gated ca...    359   9e-112   Sesamum indicum [beniseed]
gb|EMT27455.1|  Putative membrane protein                               360   1e-111   
ref|XP_002440380.1|  hypothetical protein SORBIDRAFT_09g030770          358   1e-111   Sorghum bicolor [broomcorn]
gb|KHG30770.1|  putative membrane C2G11.09                              358   2e-111   Gossypium arboreum [tree cotton]
ref|XP_003569103.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    358   2e-111   Brachypodium distachyon [annual false brome]
ref|XP_004231619.1|  PREDICTED: calcium permeable stress-gated ca...    358   2e-111   
ref|XP_008363043.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    355   2e-111   
gb|KJB69239.1|  hypothetical protein B456_011G012200                    358   3e-111   Gossypium raimondii
gb|KJB69243.1|  hypothetical protein B456_011G012200                    358   3e-111   Gossypium raimondii
gb|EPS60017.1|  hypothetical protein M569_14787                         358   3e-111   Genlisea aurea
gb|KJB69236.1|  hypothetical protein B456_011G012200                    358   3e-111   Gossypium raimondii
ref|XP_012092360.1|  PREDICTED: uncharacterized protein LOC105650086    371   4e-111   
ref|XP_009803475.1|  PREDICTED: calcium permeable stress-gated ca...    357   5e-111   Nicotiana sylvestris
ref|NP_001043256.1|  Os01g0534900                                       357   5e-111   
ref|XP_003529649.1|  PREDICTED: uncharacterized membrane protein ...    357   6e-111   Glycine max [soybeans]
emb|CDP11354.1|  unnamed protein product                                357   7e-111   Coffea canephora [robusta coffee]
ref|XP_009619499.1|  PREDICTED: calcium permeable stress-gated ca...    357   8e-111   Nicotiana tomentosiformis
gb|KHG01808.1|  putative membrane C2G11.09                              357   8e-111   Gossypium arboreum [tree cotton]
gb|KJB10674.1|  hypothetical protein B456_001G215500                    355   1e-110   Gossypium raimondii
gb|KJB10673.1|  hypothetical protein B456_001G215500                    356   2e-110   Gossypium raimondii
ref|XP_010473449.1|  PREDICTED: CSC1-like protein At1g62320             356   2e-110   Camelina sativa [gold-of-pleasure]
ref|NP_001147493.1|  LOC100281102                                       355   3e-110   Zea mays [maize]
gb|AFW81357.1|  HYP1 isoform 1                                          355   3e-110   
ref|XP_006654880.1|  PREDICTED: uncharacterized membrane protein ...    355   3e-110   Oryza brachyantha
sp|F4HYR3.2|CSCL6_ARATH  RecName: Full=CSC1-like protein At1g62320      355   4e-110   Arabidopsis thaliana [mouse-ear cress]
emb|CDY32438.1|  BnaC03g42220D                                          354   5e-110   Brassica napus [oilseed rape]
ref|XP_009135761.1|  PREDICTED: CSC1-like protein At3g21620             354   7e-110   Brassica rapa
emb|CDY48898.1|  BnaA03g36370D                                          354   7e-110   Brassica napus [oilseed rape]
ref|XP_003610472.1|  Membrane protein, putative                         354   8e-110   Medicago truncatula
emb|CDY12941.1|  BnaA09g13330D                                          354   8e-110   Brassica napus [oilseed rape]
gb|EYU27725.1|  hypothetical protein MIMGU_mgv1a001730mg                354   9e-110   Erythranthe guttata [common monkey flower]
ref|XP_009113086.1|  PREDICTED: CSC1-like protein At1g62320             353   2e-109   Brassica rapa
gb|EPS71959.1|  hypothetical protein M569_02795                         353   2e-109   Genlisea aurea
ref|XP_010430277.1|  PREDICTED: CSC1-like protein At1g62320             353   2e-109   Camelina sativa [gold-of-pleasure]
ref|XP_010418218.1|  PREDICTED: CSC1-like protein At1g62320             353   2e-109   Camelina sativa [gold-of-pleasure]
ref|XP_006300401.1|  hypothetical protein CARUB_v10019839mg             353   3e-109   Capsella rubella
ref|XP_004293317.1|  PREDICTED: calcium permeable stress-gated ca...    352   4e-109   Fragaria vesca subsp. vesca
emb|CDP03600.1|  unnamed protein product                                351   9e-109   Coffea canephora [robusta coffee]
ref|XP_011046975.1|  PREDICTED: calcium permeable stress-gated ca...    351   1e-108   Populus euphratica
gb|KCW77011.1|  hypothetical protein EUGRSUZ_D01358                     348   1e-108   Eucalyptus grandis [rose gum]
ref|XP_011014901.1|  PREDICTED: calcium permeable stress-gated ca...    351   1e-108   Populus euphratica
ref|XP_003555683.1|  PREDICTED: uncharacterized membrane protein ...    351   2e-108   Glycine max [soybeans]
gb|KHN28986.1|  Putative membrane protein C2G11.09                      351   2e-108   Glycine soja [wild soybean]
ref|XP_010921296.1|  PREDICTED: calcium permeable stress-gated ca...    350   2e-108   Elaeis guineensis
ref|XP_007145950.1|  hypothetical protein PHAVU_006G000300g             350   2e-108   Phaseolus vulgaris [French bean]
ref|XP_008675529.1|  PREDICTED: calcium permeable stress-gated ca...    350   3e-108   
ref|XP_011046977.1|  PREDICTED: calcium permeable stress-gated ca...    350   3e-108   Populus euphratica
ref|XP_006843810.1|  PREDICTED: calcium permeable stress-gated ca...    349   4e-108   Amborella trichopoda
ref|XP_010924083.1|  PREDICTED: protein OSCA1-like isoform X6           347   5e-108   
gb|EYU33878.1|  hypothetical protein MIMGU_mgv1a018274mg                349   5e-108   Erythranthe guttata [common monkey flower]
ref|XP_008799225.1|  PREDICTED: calcium permeable stress-gated ca...    349   5e-108   Phoenix dactylifera
ref|XP_008673458.1|  PREDICTED: calcium permeable stress-gated ca...    349   7e-108   
ref|XP_008371060.1|  PREDICTED: transmembrane protein 63B-like          349   8e-108   
emb|CDY32032.1|  BnaA03g60360D                                          349   1e-107   Brassica napus [oilseed rape]
ref|XP_010924080.1|  PREDICTED: calcium permeable stress-gated ca...    347   1e-107   
ref|XP_011625695.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    348   1e-107   
ref|XP_009123383.1|  PREDICTED: CSC1-like protein At1g62320             348   1e-107   Brassica rapa
ref|XP_010924079.1|  PREDICTED: calcium permeable stress-gated ca...    347   2e-107   
ref|XP_010924081.1|  PREDICTED: calcium permeable stress-gated ca...    347   2e-107   Elaeis guineensis
ref|XP_003542161.1|  PREDICTED: uncharacterized membrane protein ...    348   2e-107   Glycine max [soybeans]
ref|XP_006850790.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    348   2e-107   Amborella trichopoda
ref|XP_010052882.1|  PREDICTED: calcium permeable stress-gated ca...    347   3e-107   Eucalyptus grandis [rose gum]
ref|XP_010924075.1|  PREDICTED: calcium permeable stress-gated ca...    347   3e-107   Elaeis guineensis
ref|XP_004295293.1|  PREDICTED: calcium permeable stress-gated ca...    347   5e-107   Fragaria vesca subsp. vesca
ref|XP_010466416.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    343   1e-106   Camelina sativa [gold-of-pleasure]
ref|XP_010488177.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    343   1e-106   
gb|KJB42870.1|  hypothetical protein B456_007G171500                    344   4e-106   Gossypium raimondii
gb|KJB42871.1|  hypothetical protein B456_007G171500                    345   4e-106   Gossypium raimondii
ref|NP_188799.1|  early-responsive to dehydration stress-related ...    344   4e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008803557.1|  PREDICTED: LOW QUALITY PROTEIN: calcium perm...    344   5e-106   Phoenix dactylifera
ref|XP_006406250.1|  hypothetical protein EUTSA_v10020132mg             344   5e-106   Eutrema salsugineum [saltwater cress]
dbj|BAD94445.1|  hypothetical protein                                   343   6e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466415.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    343   7e-106   
ref|XP_010488175.1|  PREDICTED: CSC1-like protein At3g21620 isofo...    343   8e-106   Camelina sativa [gold-of-pleasure]
ref|XP_010510410.1|  PREDICTED: CSC1-like protein At3g21620             343   1e-105   Camelina sativa [gold-of-pleasure]
ref|XP_004960982.1|  PREDICTED: uncharacterized membrane protein ...    343   1e-105   Setaria italica
ref|XP_002885454.1|  hypothetical protein ARALYDRAFT_342312             342   2e-105   Arabidopsis lyrata subsp. lyrata
ref|XP_011046985.1|  PREDICTED: calcium permeable stress-gated ca...    351   2e-105   Populus euphratica
ref|XP_006299035.1|  hypothetical protein CARUB_v10015172mg             342   3e-105   Capsella rubella
gb|EMS50375.1|  Transmembrane protein 63B                               341   5e-105   Triticum urartu
ref|XP_002271834.1|  PREDICTED: CSC1-like protein At4g02900             341   7e-105   Vitis vinifera
emb|CBI32349.3|  unnamed protein product                                341   8e-105   Vitis vinifera
ref|XP_011079804.1|  PREDICTED: CSC1-like protein At4g02900             341   9e-105   Sesamum indicum [beniseed]
ref|XP_004968885.1|  PREDICTED: uncharacterized membrane protein ...    340   1e-104   Setaria italica
ref|XP_006391905.1|  hypothetical protein EUTSA_v10023297mg             340   1e-104   
ref|XP_010255871.1|  PREDICTED: CSC1-like protein At4g02900             340   2e-104   Nelumbo nucifera [Indian lotus]
ref|XP_010038117.1|  PREDICTED: CSC1-like protein At4g02900             340   2e-104   Eucalyptus grandis [rose gum]
gb|KEH23730.1|  ERD (early-responsive to dehydration stress) fami...    339   4e-104   Medicago truncatula
ref|XP_006285697.1|  hypothetical protein CARUB_v10007167mg             338   8e-104   Capsella rubella
ref|XP_006352784.1|  PREDICTED: uncharacterized membrane protein ...    338   8e-104   Solanum tuberosum [potatoes]
ref|XP_011046984.1|  PREDICTED: uncharacterized protein LOC105141...    351   8e-104   Populus euphratica
ref|XP_006383869.1|  hypothetical protein POPTR_0004s00750g             338   1e-103   
ref|XP_009396325.1|  PREDICTED: calcium permeable stress-gated ca...    337   2e-103   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY97938.1|  hypothetical protein OsI_19855                          338   2e-103   Oryza sativa Indica Group [Indian rice]
ref|NP_001055457.1|  Os05g0393800                                       337   2e-103   
ref|XP_009601393.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    332   8e-103   Nicotiana tomentosiformis
ref|XP_006654360.1|  PREDICTED: uncharacterized protein C354.08c-...    334   3e-102   Oryza brachyantha
ref|XP_002870239.1|  hypothetical protein ARALYDRAFT_493346             334   3e-102   
ref|NP_176422.1|  ERD (early-responsive to dehydration stress) fa...    334   4e-102   
gb|EMT18085.1|  Putative membrane protein                               333   5e-102   
ref|XP_004493651.1|  PREDICTED: uncharacterized protein RSN1-like...    333   6e-102   Cicer arietinum [garbanzo]
ref|XP_009601331.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    333   8e-102   Nicotiana tomentosiformis
ref|XP_004242328.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    333   1e-101   Solanum lycopersicum
ref|XP_002886475.1|  F24O1.4                                            333   2e-101   Arabidopsis lyrata subsp. lyrata
ref|XP_003568506.1|  PREDICTED: CSC1-like protein At4g02900             332   2e-101   Brachypodium distachyon [annual false brome]
ref|XP_010110412.1|  Uncharacterized protein RSN1                       320   3e-101   
ref|XP_007050676.1|  ERD (early-responsive to dehydration stress)...    331   4e-101   
ref|XP_008808245.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    330   1e-100   Phoenix dactylifera
ref|XP_006479762.1|  PREDICTED: uncharacterized membrane protein ...    329   2e-100   
ref|XP_006444131.1|  hypothetical protein CICLE_v10024532mg             329   3e-100   Citrus clementina [clementine]
gb|EMT23208.1|  Putative membrane protein                               331   3e-100   
ref|XP_009147362.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    329   3e-100   Brassica rapa
ref|XP_009147329.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    329   3e-100   Brassica rapa
gb|EMS65241.1|  Uncharacterized membrane protein C2G11.09               330   4e-100   Triticum urartu
gb|KHN19872.1|  Putative membrane protein C2G11.09                      327   4e-100   Glycine soja [wild soybean]
ref|XP_006604421.1|  PREDICTED: uncharacterized protein RSN1-like...    328   4e-100   
ref|XP_003553451.1|  PREDICTED: uncharacterized protein RSN1-like...    328   4e-100   
gb|AAC79116.1|  hypothetical protein                                    326   6e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003520558.1|  PREDICTED: uncharacterized membrane protein ...    327   1e-99    Glycine max [soybeans]
gb|KFK30891.1|  hypothetical protein AALP_AA6G039600                    325   2e-99    Arabis alpina [alpine rockcress]
gb|KFK30892.1|  hypothetical protein AALP_AA6G039600                    325   2e-99    Arabis alpina [alpine rockcress]
ref|XP_010326353.1|  PREDICTED: CSC1-like protein At4g02900             325   5e-99    Solanum lycopersicum
ref|XP_009625807.1|  PREDICTED: CSC1-like protein At4g02900             325   6e-99    Nicotiana tomentosiformis
ref|XP_011625696.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    325   8e-99    
ref|NP_192199.1|  ERD (early-responsive to dehydration stress) fa...    325   1e-98    Arabidopsis thaliana [mouse-ear cress]
gb|EYU46618.1|  hypothetical protein MIMGU_mgv1a001779mg                325   1e-98    Erythranthe guttata [common monkey flower]
ref|XP_008234907.1|  PREDICTED: uncharacterized protein RSN1 isof...    324   1e-98    Prunus mume [ume]
ref|XP_006854105.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    324   1e-98    Amborella trichopoda
ref|XP_011626938.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    324   1e-98    
ref|XP_002441130.1|  hypothetical protein SORBIDRAFT_09g021010          324   2e-98    Sorghum bicolor [broomcorn]
dbj|BAJ96091.1|  predicted protein                                      324   2e-98    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010434984.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    324   3e-98    Camelina sativa [gold-of-pleasure]
dbj|BAK05559.1|  predicted protein                                      324   3e-98    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007162399.1|  hypothetical protein PHAVU_001G148800g             323   3e-98    Phaseolus vulgaris [French bean]
ref|XP_002874888.1|  hypothetical protein ARALYDRAFT_352535             323   4e-98    
ref|XP_010449938.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    323   4e-98    Camelina sativa [gold-of-pleasure]
ref|XP_009393118.1|  PREDICTED: CSC1-like protein At4g02900             323   4e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010440309.1|  PREDICTED: CSC1-like protein At4g15430             323   6e-98    Camelina sativa [gold-of-pleasure]
ref|XP_004962175.1|  PREDICTED: uncharacterized protein RSN1-like       323   6e-98    Setaria italica
ref|XP_010090368.1|  Uncharacterized membrane protein                   325   7e-98    
ref|XP_006396516.1|  hypothetical protein EUTSA_v10029277mg             322   9e-98    
ref|XP_006355875.1|  PREDICTED: uncharacterized protein C354.08c-...    322   1e-97    Solanum tuberosum [potatoes]
emb|CDY22920.1|  BnaA01g18580D                                          322   2e-97    Brassica napus [oilseed rape]
ref|XP_009404947.1|  PREDICTED: calcium permeable stress-gated ca...    320   2e-97    
gb|AFW78070.1|  hypothetical protein ZEAMMB73_829601                    321   2e-97    
ref|XP_009404922.1|  PREDICTED: calcium permeable stress-gated ca...    321   3e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007200309.1|  hypothetical protein PRUPE_ppa001848mg             320   4e-97    Prunus persica
ref|XP_008649660.1|  PREDICTED: LOW QUALITY PROTEIN: calcium perm...    321   4e-97    
emb|CDY49293.1|  BnaC01g22480D                                          320   5e-97    Brassica napus [oilseed rape]
ref|XP_010522697.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    321   5e-97    Tarenaya hassleriana [spider flower]
ref|XP_010522696.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    321   7e-97    Tarenaya hassleriana [spider flower]
ref|XP_010664612.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    316   9e-97    Vitis vinifera
ref|XP_009395092.1|  PREDICTED: calcium permeable stress-gated ca...    320   1e-96    
ref|XP_010684236.1|  PREDICTED: CSC1-like protein At4g02900             319   1e-96    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010434983.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    319   1e-96    Camelina sativa [gold-of-pleasure]
emb|CDY17981.1|  BnaC03g30530D                                          319   1e-96    Brassica napus [oilseed rape]
ref|XP_010522695.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    320   1e-96    Tarenaya hassleriana [spider flower]
emb|CDX90914.1|  BnaA03g25940D                                          319   1e-96    
ref|XP_009134388.1|  PREDICTED: CSC1-like protein At4g02900             319   2e-96    Brassica rapa
ref|XP_010422520.1|  PREDICTED: CSC1-like protein At4g02900             319   2e-96    
ref|XP_010430503.1|  PREDICTED: CSC1-like protein At4g02900             319   2e-96    
ref|XP_010449936.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    318   2e-96    
ref|XP_009356857.1|  PREDICTED: CSC1-like protein At4g02900             318   3e-96    
ref|XP_008386531.1|  PREDICTED: uncharacterized protein RSN1            318   5e-96    
ref|XP_009147369.1|  PREDICTED: CSC1-like protein At4g15430 isofo...    317   6e-96    
ref|XP_004136187.1|  PREDICTED: CSC1-like protein At4g02900             317   7e-96    
ref|XP_008451390.1|  PREDICTED: uncharacterized membrane protein ...    317   1e-95    
ref|XP_010261636.1|  PREDICTED: CSC1-like protein At1g32090             317   1e-95    
ref|XP_008451392.1|  PREDICTED: uncharacterized membrane protein ...    317   1e-95    
ref|NP_001154237.1|  ERD (early-responsive to dehydration stress)...    316   2e-95    
ref|XP_008451393.1|  PREDICTED: uncharacterized membrane protein ...    316   2e-95    
gb|KJB51550.1|  hypothetical protein B456_008G222200                    315   2e-95    
ref|XP_002273732.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    316   2e-95    
gb|KJB42062.1|  hypothetical protein B456_007G134700                    313   7e-95    
ref|XP_004292602.1|  PREDICTED: CSC1-like protein At4g02900             314   8e-95    
gb|KJB42060.1|  hypothetical protein B456_007G134700                    313   1e-94    
gb|EMS63788.1|  Uncharacterized membrane protein C2G11.09               315   1e-94    
ref|XP_004293316.1|  PREDICTED: calcium permeable stress-gated ca...    313   2e-94    
gb|KJB51549.1|  hypothetical protein B456_008G222200                    315   2e-94    
gb|KJB42059.1|  hypothetical protein B456_007G134700                    313   2e-94    
ref|XP_010455942.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    313   2e-94    
ref|XP_010455941.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    313   5e-94    
gb|KHG10946.1|  putative membrane C2G11.09                              312   5e-94    
ref|XP_010276749.1|  PREDICTED: CSC1-like protein At1g32090             311   8e-94    
ref|NP_193278.4|  ERD (early-responsive to dehydration stress) fa...    311   1e-93    
ref|XP_009347716.1|  PREDICTED: CSC1-like protein At4g02900             298   1e-93    
ref|XP_008808246.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    311   1e-93    
ref|XP_012066469.1|  PREDICTED: CSC1-like protein At1g32090             311   2e-93    
ref|XP_006604422.1|  PREDICTED: uncharacterized protein RSN1-like...    310   2e-93    
ref|XP_008238126.1|  PREDICTED: uncharacterized protein RSN1            311   3e-93    
gb|KHG26829.1|  putative membrane C2G11.09                              311   4e-93    
ref|XP_007210357.1|  hypothetical protein PRUPE_ppa001580mg             310   9e-93    
ref|XP_012092490.1|  PREDICTED: CSC1-like protein At4g02900             308   1e-92    
ref|XP_009107840.1|  PREDICTED: CSC1-like protein At4g15430             308   1e-92    
emb|CDY09064.1|  BnaC08g10180D                                          308   1e-92    
ref|XP_004300169.1|  PREDICTED: CSC1-like protein At1g32090             310   2e-92    
gb|EYU38139.1|  hypothetical protein MIMGU_mgv1a022024mg                308   2e-92    
ref|XP_004245915.1|  PREDICTED: CSC1-like protein At1g32090             308   4e-92    
ref|XP_006352918.1|  PREDICTED: uncharacterized protein RSN1-like       308   5e-92    
gb|EPS71707.1|  hypothetical protein M569_03051                         306   6e-92    
ref|XP_009373514.1|  PREDICTED: CSC1-like protein At1g32090             308   7e-92    
gb|EMT11783.1|  Putative membrane protein                               307   8e-92    
ref|XP_002533077.1|  conserved hypothetical protein                     306   9e-92    
ref|XP_010278586.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    306   1e-91    
ref|XP_002519965.1|  Extensin-3 precursor, putative                     307   2e-91    
ref|XP_008373502.1|  PREDICTED: uncharacterized protein RSN1            306   2e-91    
ref|XP_007040776.1|  Early-responsive to dehydration stress prote...    306   2e-91    
ref|XP_002973564.1|  hypothetical protein SELMODRAFT_442177             305   2e-91    
ref|XP_008234908.1|  PREDICTED: uncharacterized protein RSN1 isof...    305   3e-91    
gb|EMT13890.1|  Putative membrane protein                               306   4e-91    
ref|XP_007040777.1|  Early-responsive to dehydration stress prote...    305   4e-91    
gb|EMS66710.1|  Uncharacterized membrane protein C2G11.09               304   5e-91    
ref|XP_002975592.1|  hypothetical protein SELMODRAFT_150725             304   8e-91    
ref|XP_009784323.1|  PREDICTED: CSC1-like protein At1g32090             305   9e-91    
gb|EMS63833.1|  Uncharacterized membrane protein C2G11.09               304   1e-90    
ref|XP_009603996.1|  PREDICTED: CSC1-like protein At1g32090             304   1e-90    
gb|EMT22148.1|  Putative membrane protein                               303   2e-90    
ref|XP_003612662.1|  Membrane protein, putative                         302   7e-90    
ref|XP_011082546.1|  PREDICTED: CSC1-like protein At4g02900             301   8e-90    
gb|KJB22581.1|  hypothetical protein B456_004G055300                    296   1e-89    
ref|XP_010920040.1|  PREDICTED: LOW QUALITY PROTEIN: CSC1-like pr...    300   3e-89    
gb|AFW81356.1|  hypothetical protein ZEAMMB73_379943                    299   3e-89    
emb|CDP11732.1|  unnamed protein product                                300   4e-89    
ref|XP_011626939.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    299   4e-89    
ref|XP_007158205.1|  hypothetical protein PHAVU_002G133000g             301   4e-89    
gb|AFI41197.1|  dehydration stress protein                              300   6e-89    
gb|EPS74192.1|  hypothetical protein M569_00556                         298   9e-89    
gb|KHG17938.1|  putative membrane C2G11.09                              298   1e-88    
ref|XP_011074804.1|  PREDICTED: CSC1-like protein At1g32090             296   9e-88    
ref|XP_010056204.1|  PREDICTED: CSC1-like protein At1g32090             295   2e-87    
ref|XP_010455943.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    295   3e-87    
ref|XP_011028084.1|  PREDICTED: CSC1-like protein At1g32090             295   3e-87    
emb|CDX76386.1|  BnaA08g10140D                                          292   5e-87    
ref|XP_008788615.1|  PREDICTED: CSC1-like protein At1g32090             293   6e-87    
ref|XP_002529341.1|  conserved hypothetical protein                     292   1e-86    
ref|XP_002304365.2|  hypothetical protein POPTR_0003s09900g             293   3e-86    
emb|CDX79125.1|  BnaA01g11920D                                          289   8e-86    
ref|XP_002464863.1|  hypothetical protein SORBIDRAFT_01g027810          291   1e-85    
ref|XP_010235059.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    288   2e-85    
ref|XP_011018446.1|  PREDICTED: CSC1-like protein At1g32090             291   2e-85    
ref|XP_008448614.1|  PREDICTED: uncharacterized protein RSN1            290   3e-85    
emb|CDP11733.1|  unnamed protein product                                291   5e-85    
ref|XP_006432649.1|  hypothetical protein CICLE_v10000312mg             290   5e-85    
ref|XP_006368323.1|  early-responsive to dehydration family protein     289   5e-85    
ref|XP_004146108.1|  PREDICTED: CSC1-like protein At1g32090             289   5e-85    
ref|XP_008658829.1|  PREDICTED: uncharacterized protein RSN1            289   8e-85    
ref|XP_003574401.1|  PREDICTED: CSC1-like protein At1g32090 isofo...    288   8e-85    
gb|KDO58806.1|  hypothetical protein CISIN_1g040696mg                   288   1e-84    
gb|KHN40403.1|  Putative membrane protein C2G11.09                      287   3e-84    
ref|XP_004512449.1|  PREDICTED: uncharacterized membrane protein ...    287   4e-84    
ref|XP_003516847.1|  PREDICTED: uncharacterized protein RSN1-like       287   4e-84    
emb|CDM81261.1|  unnamed protein product                                287   5e-84    
ref|XP_008360740.1|  PREDICTED: uncharacterized protein RSN1-like       273   8e-84    
ref|XP_004983522.1|  PREDICTED: uncharacterized membrane protein ...    286   8e-84    
ref|XP_006662108.1|  PREDICTED: uncharacterized membrane protein ...    285   2e-83    
ref|NP_001065504.1|  Os10g0579100                                       285   3e-83    
gb|EAY79648.1|  hypothetical protein OsI_34792                          284   5e-83    
ref|XP_010054102.1|  PREDICTED: CSC1-like protein At1g32090             282   7e-83    
emb|CAB10322.1|  hypothetical protein                                   280   1e-82    
ref|XP_011082330.1|  PREDICTED: CSC1-like protein At1g32090             282   2e-82    
ref|XP_003533453.1|  PREDICTED: uncharacterized protein RSN1-like       282   3e-82    
gb|EYU23284.1|  hypothetical protein MIMGU_mgv1a001448mg                281   6e-82    
ref|XP_006415254.1|  hypothetical protein EUTSA_v10006831mg             281   6e-82    
ref|XP_010461028.1|  PREDICTED: CSC1-like protein At1g32090             280   1e-81    
ref|XP_010499754.1|  PREDICTED: CSC1-like protein At1g32090             280   1e-81    
ref|XP_010478627.1|  PREDICTED: CSC1-like protein At1g32090             280   1e-81    
ref|XP_009409814.1|  PREDICTED: CSC1-like protein At1g32090             278   3e-81    
ref|XP_009145210.1|  PREDICTED: CSC1-like protein At1g32090             279   4e-81    
emb|CDY29933.1|  BnaC05g29030D                                          279   4e-81    
emb|CDY35541.1|  BnaA05g16450D                                          279   4e-81    
ref|XP_006304000.1|  hypothetical protein CARUB_v10011444mg             278   7e-81    
gb|KFK44972.1|  hypothetical protein AALP_AA1G327200                    278   1e-80    
ref|NP_174489.1|  early-responsive to dehydration stress protein ...    278   1e-80    
ref|XP_002893699.1|  hypothetical protein ARALYDRAFT_473392             276   4e-80    
gb|EYU29074.1|  hypothetical protein MIMGU_mgv1a021500mg                274   7e-80    
ref|XP_010323041.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    273   1e-79    
ref|XP_010518924.1|  PREDICTED: CSC1-like protein At1g32090             274   2e-79    
gb|KHG01781.1|  putative membrane C2G11.09                              270   6e-79    
ref|XP_006414510.1|  hypothetical protein EUTSA_v10024504mg             269   7e-79    
ref|XP_010323040.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    270   2e-78    
ref|XP_002969287.1|  hypothetical protein SELMODRAFT_91711              270   3e-78    
ref|XP_006414511.1|  hypothetical protein EUTSA_v10024504mg             269   7e-78    
gb|EPS61105.1|  hypothetical protein M569_13694                         264   9e-78    
ref|XP_002317143.2|  hypothetical protein POPTR_0011s01450g             259   1e-77    
ref|XP_010677412.1|  PREDICTED: CSC1-like protein At1g32090             265   4e-76    
ref|XP_006287199.1|  hypothetical protein CARUB_v10000374mg             258   4e-74    
ref|XP_001782141.1|  predicted protein                                  253   4e-72    
ref|XP_001754358.1|  predicted protein                                  249   2e-70    
gb|EPS60193.1|  hypothetical protein M569_14609                         248   2e-70    
gb|KJB22580.1|  hypothetical protein B456_004G055300                    242   9e-70    
ref|XP_010278603.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    244   9e-69    
ref|XP_002986828.1|  hypothetical protein SELMODRAFT_425683             232   9e-65    
ref|XP_010450765.1|  PREDICTED: protein OSCA1-like                      216   7e-64    
ref|XP_001759032.1|  predicted protein                                  228   2e-62    
ref|XP_006387596.1|  hypothetical protein POPTR_0796s00200g             209   2e-61    
ref|XP_006449787.1|  hypothetical protein CICLE_v10014589mg             215   9e-59    
ref|XP_001770572.1|  predicted protein                                  214   8e-58    
ref|XP_001757556.1|  predicted protein                                  213   2e-57    
gb|ERN14627.1|  hypothetical protein AMTR_s00038p00185310               187   9e-50    
gb|KDO68804.1|  hypothetical protein CISIN_1g0209791mg                  171   7e-47    
gb|KJB25199.1|  hypothetical protein B456_004G180800                    172   5e-44    
ref|XP_007026162.1|  ERD (early-responsive to dehydration stress)...    172   2e-43    
ref|XP_006396699.1|  hypothetical protein EUTSA_v10028449mg             172   2e-43    
gb|KDO68803.1|  hypothetical protein CISIN_1g0209792mg                  161   3e-43    
gb|KJB69237.1|  hypothetical protein B456_011G012200                    171   6e-43    
ref|XP_006449786.1|  hypothetical protein CICLE_v10014589mg             169   2e-42    
ref|XP_010921304.1|  PREDICTED: calcium permeable stress-gated ca...    169   4e-42    
gb|KDO78339.1|  hypothetical protein CISIN_1g004125mg                   168   4e-42    
ref|XP_010924082.1|  PREDICTED: calcium permeable stress-gated ca...    167   1e-41    
ref|XP_009771290.1|  PREDICTED: CSC1-like protein At4g02900             166   3e-41    
ref|XP_010490005.1|  PREDICTED: CSC1-like protein At3g21620             152   3e-40    
ref|XP_010905258.1|  PREDICTED: protein OSCA1-like                      162   8e-40    
ref|XP_010278611.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    150   3e-36    
ref|XP_001764420.1|  predicted protein                                  151   4e-36    
emb|CAA56145.1|  HYP1                                                   143   4e-34    
gb|AAF26164.1|AC008261_21  unknown protein                              143   5e-34    
ref|NP_186759.2|  uncharacterized protein                               143   2e-33    
dbj|BAD94293.1|  hypothetical protein                                   143   2e-33    
ref|XP_009147396.1|  PREDICTED: CSC1-like protein HYP1                  143   2e-33    
emb|CDY37544.1|  BnaA05g34090D                                          144   3e-33    
emb|CDY43268.1|  BnaC05g48610D                                          142   5e-33    
ref|XP_009765631.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    140   6e-33    
ref|XP_009765629.1|  PREDICTED: CSC1-like protein At4g02900 isofo...    140   1e-32    
ref|XP_001761096.1|  predicted protein                                  140   2e-32    
ref|XP_002882200.1|  hypothetical protein ARALYDRAFT_477418             140   3e-32    
ref|XP_006408462.1|  hypothetical protein EUTSA_v10020163mg             139   5e-32    
ref|XP_006299849.1|  hypothetical protein CARUB_v10016052mg             139   6e-32    
ref|XP_009134634.1|  PREDICTED: CSC1-like protein HYP1                  139   7e-32    
emb|CDX74284.1|  BnaA03g27630D                                          139   8e-32    
ref|XP_011098667.1|  PREDICTED: CSC1-like protein HYP1 isoform X1       137   2e-31    
gb|KJB80261.1|  hypothetical protein B456_013G089300                    137   2e-31    
ref|XP_010485425.1|  PREDICTED: CSC1-like protein HYP1                  137   2e-31    
ref|XP_010525100.1|  PREDICTED: CSC1-like protein HYP1                  137   3e-31    
gb|KJB80259.1|  hypothetical protein B456_013G089300                    137   4e-31    
ref|XP_002984025.1|  hypothetical protein SELMODRAFT_156268             137   4e-31    
ref|XP_010943516.1|  PREDICTED: CSC1-like protein RXW8 isoform X1       137   5e-31    
gb|EEC76105.1|  hypothetical protein OsI_13363                          136   6e-31    
gb|KHN36998.1|  Putative membrane protein                               135   7e-31    
ref|XP_009789228.1|  PREDICTED: CSC1-like protein HYP1 isoform X2       135   7e-31    
gb|ABR16200.1|  unknown                                                 135   9e-31    
ref|XP_010109429.1|  putative membrane protein                          136   9e-31    
ref|XP_003556958.1|  PREDICTED: uncharacterized membrane protein ...    135   9e-31    
ref|XP_006483099.1|  PREDICTED: uncharacterized membrane protein ...    135   1e-30    
emb|CDX91963.1|  BnaC03g32650D                                          137   1e-30    
ref|NP_001051134.1|  Os03g0726300                                       135   1e-30    
ref|XP_011010302.1|  PREDICTED: CSC1-like protein HYP1                  135   1e-30    
ref|XP_006483098.1|  PREDICTED: uncharacterized membrane protein ...    135   1e-30    
gb|KHG30396.1|  putative membrane C2G11.09                              135   1e-30    
ref|XP_010670228.1|  PREDICTED: CSC1-like protein HYP1 isoform X1       135   1e-30    
ref|XP_009625276.1|  PREDICTED: CSC1-like protein HYP1 isoform X2       134   1e-30    
ref|XP_006855764.1|  PREDICTED: CSC1-like protein RXW8                  135   1e-30    
ref|XP_006574920.1|  PREDICTED: uncharacterized membrane protein ...    134   1e-30    
ref|XP_010670229.1|  PREDICTED: CSC1-like protein HYP1 isoform X2       135   2e-30    
gb|EEE59847.1|  hypothetical protein OsJ_12422                          135   2e-30    
ref|XP_010430647.1|  PREDICTED: LOW QUALITY PROTEIN: CSC1-like pr...    135   2e-30    
ref|XP_012084749.1|  PREDICTED: CSC1-like protein HYP1 isoform X2       135   2e-30    
ref|XP_010088119.1|  Uncharacterized membrane protein                   135   2e-30    
ref|XP_009789223.1|  PREDICTED: CSC1-like protein HYP1 isoform X1       135   2e-30    
ref|XP_007045993.1|  Early-responsive to dehydration stress prote...    135   2e-30    
ref|XP_012084747.1|  PREDICTED: CSC1-like protein HYP1 isoform X1       134   2e-30    
ref|XP_007032618.1|  Early-responsive to dehydration stress prote...    133   2e-30    
gb|EYU44140.1|  hypothetical protein MIMGU_mgv1a002119mg                134   2e-30    
gb|KHN17195.1|  Putative membrane protein                               134   2e-30    
ref|XP_004304272.1|  PREDICTED: CSC1-like protein HYP1                  134   2e-30    
ref|XP_006574918.1|  PREDICTED: uncharacterized membrane protein ...    133   3e-30    
ref|XP_003545361.2|  PREDICTED: uncharacterized membrane protein ...    134   3e-30    
ref|XP_009625272.1|  PREDICTED: CSC1-like protein HYP1 isoform X1       134   3e-30    
ref|XP_010247468.1|  PREDICTED: CSC1-like protein RXW8 isoform X3       131   3e-30    
ref|XP_008221566.1|  PREDICTED: uncharacterized membrane protein ...    134   3e-30    
ref|XP_002269926.1|  PREDICTED: CSC1-like protein HYP1                  134   4e-30    
ref|XP_006574916.1|  PREDICTED: uncharacterized membrane protein ...    134   4e-30    
ref|XP_007032617.1|  Early-responsive to dehydration stress prote...    133   6e-30    
ref|XP_006664233.1|  PREDICTED: uncharacterized protein RSN1-like       133   6e-30    
ref|XP_010247466.1|  PREDICTED: CSC1-like protein RXW8 isoform X1       131   6e-30    
ref|XP_009397320.1|  PREDICTED: CSC1-like protein RXW8                  133   6e-30    
emb|CBI38238.3|  unnamed protein product                                134   7e-30    
ref|XP_004498938.1|  PREDICTED: uncharacterized membrane protein ...    133   7e-30    
ref|XP_010247467.1|  PREDICTED: CSC1-like protein RXW8 isoform X2       130   8e-30    
ref|XP_002463956.1|  hypothetical protein SORBIDRAFT_01g009540          132   9e-30    
ref|XP_007157718.1|  hypothetical protein PHAVU_002G092500g             132   1e-29    
ref|XP_002510037.1|  conserved hypothetical protein                     132   1e-29    
ref|XP_008798903.1|  PREDICTED: CSC1-like protein RXW8 isoform X2       132   2e-29    



>ref|XP_011086200.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
 ref|XP_011086201.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
 ref|XP_011086202.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
Length=775

 Score =   388 bits (997),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 192/257 (75%), Positives = 212/257 (82%), Gaps = 12/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITY+MVDGW G+AGE+LRLK LI+FHLKN FLVKTEK
Sbjct  505   IGVAIPM-----------KATFFITYVMVDGWAGVAGEILRLKPLIIFHLKNFFLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EP+IQLYFLLGLVYA VTP+ LPFILVFFA AYVVFRHQIINVY
Sbjct  554   DREEAMDPGSIGFNTGEPQIQLYFLLGLVYAVVTPVFLPFILVFFALAYVVFRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRII AL+FSQ+  +GL+STK AAQS PFLI LPVLTI FH +CK
Sbjct  614   NQEYESAAAFWPDVHGRIISALVFSQLVLMGLMSTKGAAQSTPFLIALPVLTIWFHRFCK  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AF ++PLQEA MKDTLE+AREPN NLK YL+ AYIHPVFK +ED    D ISEK 
Sbjct  674   GRYEPAFIRYPLQEAMMKDTLERAREPNLNLKSYLRYAYIHPVFKNDEDGEHDDDISEKL  733

Query  673   DEENVLVQTKRQSRKNT  623
             D E VLV TKRQSRKNT
Sbjct  734   D-ETVLVPTKRQSRKNT  749



>ref|XP_007141612.1| hypothetical protein PHAVU_008G210700g [Phaseolus vulgaris]
 gb|ESW13606.1| hypothetical protein PHAVU_008G210700g [Phaseolus vulgaris]
Length=755

 Score =   385 bits (990),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 188/253 (74%), Positives = 214/253 (85%), Gaps = 5/253 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P+ +G+S     MKATFFITYIMVDGW G AGE+LRLK LI +HLK  FLVKTEKDRE+A
Sbjct  500   PITVGVSIP---MKATFFITYIMVDGWAGCAGEILRLKPLIFYHLKIFFLVKTEKDREEA  556

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG+  FN  EP+IQLYFLLGLVYA VTP LLP+I+VFF FAYVV+RHQIINVYNQEYE
Sbjct  557   MDPGTFGFNTGEPQIQLYFLLGLVYAVVTPFLLPYIIVFFGFAYVVYRHQIINVYNQEYE  616

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRIIFAL+ SQ+  +GLLSTK AA S P LI LPVLTI+FHLYCKGRY+ 
Sbjct  617   SAAAFWPDVHGRIIFALVISQLLLMGLLSTKEAANSTPLLITLPVLTISFHLYCKGRYQP  676

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADE-EN  662
             AF KHPLQEA MKDTLE+AREPNFNLK +LQ AYIHPVFKG++D  D + +SEK +E E 
Sbjct  677   AFIKHPLQEAMMKDTLERAREPNFNLKEFLQSAYIHPVFKGDDDS-DSEVMSEKWEEQEP  735

Query  661   VLVQTKRQSRKNT  623
             V+VQTKRQSR+NT
Sbjct  736   VVVQTKRQSRRNT  748



>ref|XP_002317144.2| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE97756.2| early-responsive to dehydration family protein [Populus trichocarpa]
Length=744

 Score =   385 bits (988),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 193/257 (75%), Positives = 218/257 (85%), Gaps = 12/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A P+           KATFFITYIMVDGW GIAGEVL LK LIL+HLKN FLVKTEK
Sbjct  477   IGVAVPL-----------KATFFITYIMVDGWAGIAGEVLMLKPLILYHLKNFFLVKTEK  525

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGSL FN  EPRIQLYFLLGLVYA VTP+LLPFI++FFAFAYVVFRHQIINVY
Sbjct  526   DREEAMDPGSLGFNTGEPRIQLYFLLGLVYATVTPVLLPFIIIFFAFAYVVFRHQIINVY  585

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYES AAFWPDVHGR+I AL+ SQ++ LGL+STK AAQSAPFLI LPVLTI FH +C 
Sbjct  586   NQEYESGAAFWPDVHGRVITALVISQLALLGLMSTKEAAQSAPFLIALPVLTIWFHGFCN  645

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GR++SAF K+PLQEA MKDTLE+AR+PNFNLK YLQDAYIHPVFKG +D+ D D +S+K 
Sbjct  646   GRHKSAFVKYPLQEAMMKDTLERARDPNFNLKAYLQDAYIHPVFKGGDDDEDDD-LSKKL  704

Query  673   DEENVLVQTKRQSRKNT  623
             + E+VLV TKRQSRKNT
Sbjct  705   ETESVLVPTKRQSRKNT  721



>ref|XP_008459005.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
melo]
 ref|XP_008459006.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Cucumis 
melo]
Length=773

 Score =   385 bits (989),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 189/257 (74%), Positives = 213/257 (83%), Gaps = 12/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW GIAGE+L LK LI+FHLKN FLVKTEK
Sbjct  505   IGVAIPM-----------KATFFITYIMVDGWAGIAGEILMLKPLIMFHLKNFFLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGSL FN  EPRIQLYFLLGLVYA VTP+LLPFI+VFFA  +VVFRHQIINVY
Sbjct  554   DREEAMDPGSLGFNTGEPRIQLYFLLGLVYATVTPLLLPFIIVFFALGFVVFRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRII+ALIFSQV  +GLLSTK AAQS PFLI LPV+TI+FHLYCK
Sbjct  614   NQEYESAAAFWPDVHGRIIYALIFSQVVLMGLLSTKKAAQSTPFLIALPVITISFHLYCK  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AF ++P+QEA MKDTLE+AREPN NLK YL  AY HPVFK +ED+ + +  +E  
Sbjct  674   GRYEPAFIRYPIQEAMMKDTLERAREPNLNLKGYLHAAYAHPVFKESEDDDEVES-NEAF  732

Query  673   DEENVLVQTKRQSRKNT  623
             + E+VLV TKRQSR+NT
Sbjct  733   ETESVLVATKRQSRRNT  749



>ref|XP_011463550.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=718

 Score =   381 bits (979),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 182/252 (72%), Positives = 212/252 (84%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P+ +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI++HLKN+FLVKTEKDRE+A
Sbjct  448   PITIGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIMYHLKNTFLVKTEKDREEA  504

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG+L FN  EP+IQLYFLLGLVYA V+PILLPFI+VFFA AYVV+RHQIINVYNQEYE
Sbjct  505   MDPGTLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAYVVYRHQIINVYNQEYE  564

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRII AL+ SQ+  +GLLSTK AAQS P LI LPVLTI+FH +CKGRYE 
Sbjct  565   SAAAFWPDVHGRIITALVVSQLLLMGLLSTKEAAQSTPLLITLPVLTISFHRFCKGRYEP  624

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF K+PLQEA  KDTLE  REPN NLK +LQ AY+HPVFKG +D  D DG +E+ + E  
Sbjct  625   AFKKNPLQEAMRKDTLEHVREPNLNLKGFLQSAYVHPVFKGADDS-DSDGAAEELEVEPA  683

Query  658   LVQTKRQSRKNT  623
             +V+TKRQSR+NT
Sbjct  684   VVRTKRQSRRNT  695



>ref|XP_006283166.1| hypothetical protein CARUB_v10004197mg [Capsella rubella]
 gb|EOA16064.1| hypothetical protein CARUB_v10004197mg [Capsella rubella]
Length=771

 Score =   382 bits (981),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 184/257 (72%), Positives = 212/257 (82%), Gaps = 11/257 (4%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW G+AGE+L LK LI+FHLKN+FLVKTEK
Sbjct  505   IGVAIPM-----------KATFFITYIMVDGWAGVAGEILMLKPLIMFHLKNAFLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EPRIQLYFLLGLVYA VTP+LLPFILVFFA AY+V+RHQIINVY
Sbjct  554   DREEAMDPGSIGFNTGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGR+I AL+ SQ+  +GLL TKHAA +APFLI LPVLTI FH +CK
Sbjct  614   NQEYESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHHFCK  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AF ++PLQEA MKDTLE AREPN NLK YLQ+AYIHPVFKG+ED  + +    K 
Sbjct  674   GRYEPAFIRYPLQEAMMKDTLENAREPNLNLKGYLQNAYIHPVFKGDEDGDNINDKLGKF  733

Query  673   DEENVLVQTKRQSRKNT  623
             ++E ++V TKRQSR+NT
Sbjct  734   EDEAIIVPTKRQSRRNT  750



>ref|XP_004289181.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=767

 Score =   382 bits (980),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 182/252 (72%), Positives = 212/252 (84%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P+ +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI++HLKN+FLVKTEKDRE+A
Sbjct  497   PITIGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIMYHLKNTFLVKTEKDREEA  553

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG+L FN  EP+IQLYFLLGLVYA V+PILLPFI+VFFA AYVV+RHQIINVYNQEYE
Sbjct  554   MDPGTLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAYVVYRHQIINVYNQEYE  613

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRII AL+ SQ+  +GLLSTK AAQS P LI LPVLTI+FH +CKGRYE 
Sbjct  614   SAAAFWPDVHGRIITALVVSQLLLMGLLSTKEAAQSTPLLITLPVLTISFHRFCKGRYEP  673

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF K+PLQEA  KDTLE  REPN NLK +LQ AY+HPVFKG +D  D DG +E+ + E  
Sbjct  674   AFKKNPLQEAMRKDTLEHVREPNLNLKGFLQSAYVHPVFKGADDS-DSDGAAEELEVEPA  732

Query  658   LVQTKRQSRKNT  623
             +V+TKRQSR+NT
Sbjct  733   VVRTKRQSRRNT  744



>ref|XP_006396700.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
 ref|XP_006396701.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
 gb|ESQ38153.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
 gb|ESQ38154.1| hypothetical protein EUTSA_v10028449mg [Eutrema salsugineum]
Length=770

 Score =   381 bits (979),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 184/257 (72%), Positives = 212/257 (82%), Gaps = 12/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW G+AGE+L LK LI++HLKN+FLVKTEK
Sbjct  504   IGVAIPM-----------KATFFITYIMVDGWAGVAGEILMLKPLIIYHLKNAFLVKTEK  552

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE AM+PGS+ FN  EP+IQLYFLLGLVYA VTP+LLPFILVFF  AY+V+RHQIINVY
Sbjct  553   DREAAMDPGSIGFNTGEPQIQLYFLLGLVYAPVTPMLLPFILVFFGLAYIVYRHQIINVY  612

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYES AAFWPDVHGR+I ALI SQ+  +GLL TKHAA +APFLIVLPVLTI FH +CK
Sbjct  613   NQEYESGAAFWPDVHGRVISALIISQLLLMGLLGTKHAASAAPFLIVLPVLTIGFHRFCK  672

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AF ++PLQEA MKDTLE+A+EPN NLK YLQDAYIHPVFKG +D+ + D +  K 
Sbjct  673   GRYEPAFVRYPLQEAMMKDTLERAKEPNLNLKGYLQDAYIHPVFKGGDDDDESDMLG-KL  731

Query  673   DEENVLVQTKRQSRKNT  623
             +EE V+V TKRQSR+NT
Sbjct  732   EEEVVIVPTKRQSRRNT  748



>ref|XP_010252492.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Nelumbo 
nucifera]
Length=770

 Score =   381 bits (979),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 189/257 (74%), Positives = 212/257 (82%), Gaps = 13/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW GIAGE+LR+K LI++HLKN FLVKTEK
Sbjct  505   IGVAIPM-----------KATFFITYIMVDGWAGIAGEILRVKPLIIYHLKNFFLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGSL FN  EP+IQLYFLLGLVYA VTPILLPFI+VFF  AY+VFRHQIINVY
Sbjct  554   DREEAMDPGSLGFNTGEPQIQLYFLLGLVYAVVTPILLPFIVVFFGLAYLVFRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRII ALI SQ+  +GLLSTK AAQS P LI LPVLTI FH +CK
Sbjct  614   NQEYESAAAFWPDVHGRIITALIISQLLLMGLLSTKRAAQSTPLLIALPVLTIWFHRFCK  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
              RYE AF ++PLQEA MKDTLE+AREPN NLK YLQ+AY+HPVFKG EDE D D  +E+ 
Sbjct  674   SRYEPAFIRYPLQEAMMKDTLERAREPNLNLKGYLQNAYVHPVFKG-EDE-DSDAFTEEL  731

Query  673   DEENVLVQTKRQSRKNT  623
              +E+VLV TKRQSR+NT
Sbjct  732   QKESVLVPTKRQSRRNT  748



>ref|XP_011016279.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011016280.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011016281.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=768

 Score =   380 bits (976),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 185/252 (73%), Positives = 213/252 (85%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI++HLKN FLVKTEKDRE+A
Sbjct  498   PKTVGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG+L FN  EP+IQLYFLLGLVYA V+PILLPFI+VFFA A+VV+RHQIINVYNQEYE
Sbjct  555   MDPGTLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAFVVYRHQIINVYNQEYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRII A+I SQ+  +GLLSTK AAQS P LI LPVLTI FHL+CKGRYE 
Sbjct  615   SAAAFWPDVHGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLITLPVLTIWFHLFCKGRYEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQEA MKDTLE+AREPN NLK +LQ+AY HPVFKG ED+ D DG  E+ ++E  
Sbjct  675   AFVRYPLQEAMMKDTLERAREPNLNLKSFLQNAYSHPVFKG-EDDSDSDGAPEEFEKEPD  733

Query  658   LVQTKRQSRKNT  623
             LV TKRQSR+NT
Sbjct  734   LVPTKRQSRRNT  745



>gb|KHN38468.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=758

 Score =   380 bits (975),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 185/252 (73%), Positives = 208/252 (83%), Gaps = 3/252 (1%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G AGE+LRLK LI +HLKN FLVKTEKDRE+A
Sbjct  498   PKTIGVSIP---MKATFFITYIMVDGWAGCAGEILRLKPLIFYHLKNFFLVKTEKDREEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG+  FN  EP+IQLYFLLGLVYA VTP LLP+I+VFF  AYVV+RHQIINVYNQEYE
Sbjct  555   MDPGTFGFNTGEPQIQLYFLLGLVYAVVTPFLLPYIIVFFGLAYVVYRHQIINVYNQEYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRIIFAL+ SQ+  +GLLSTK AA S P LI LP+LTI+FHLYCKGRYE 
Sbjct  615   SAAAFWPDVHGRIIFALVISQLLLMGLLSTKEAANSTPLLITLPILTISFHLYCKGRYEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF KHPLQEA MKDTLE+AREPNFNLK +LQ+AYIHPVFKG++D           ++E V
Sbjct  675   AFVKHPLQEAMMKDTLERAREPNFNLKEFLQNAYIHPVFKGDDDSDSDVMSENWEEQEPV  734

Query  658   LVQTKRQSRKNT  623
             LVQTKRQSRKNT
Sbjct  735   LVQTKRQSRKNT  746



>ref|XP_003519463.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Glycine 
max]
Length=760

 Score =   380 bits (975),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 185/252 (73%), Positives = 208/252 (83%), Gaps = 3/252 (1%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G AGE+LRLK LI +HLKN FLVKTEKDRE+A
Sbjct  500   PKTIGVSIP---MKATFFITYIMVDGWAGCAGEILRLKPLIFYHLKNFFLVKTEKDREEA  556

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG+  FN  EP+IQLYFLLGLVYA VTP LLP+I+VFF  AYVV+RHQIINVYNQEYE
Sbjct  557   MDPGTFGFNTGEPQIQLYFLLGLVYAVVTPFLLPYIIVFFGLAYVVYRHQIINVYNQEYE  616

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRIIFAL+ SQ+  +GLLSTK AA S P LI LP+LTI+FHLYCKGRYE 
Sbjct  617   SAAAFWPDVHGRIIFALVISQLLLMGLLSTKEAANSTPLLITLPILTISFHLYCKGRYEP  676

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF KHPLQEA MKDTLE+AREPNFNLK +LQ+AYIHPVFKG++D           ++E V
Sbjct  677   AFVKHPLQEAMMKDTLERAREPNFNLKEFLQNAYIHPVFKGDDDSDSDVMSENWEEQEPV  736

Query  658   LVQTKRQSRKNT  623
             LVQTKRQSRKNT
Sbjct  737   LVQTKRQSRKNT  748



>dbj|BAF98597.1| CM0545.360.nc [Lotus japonicus]
Length=755

 Score =   379 bits (974),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 181/252 (72%), Positives = 211/252 (84%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G AGE+LRLK LI +HLKN FLVKTEKDRE+A
Sbjct  498   PKTIGVSIP---MKATFFITYIMVDGWAGCAGEILRLKPLIFYHLKNFFLVKTEKDREEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG++ FN  EP+IQLYFLLGLVYA +TP LLP+I+VFF  AYVV+RHQIINVYNQEYE
Sbjct  555   MDPGTIGFNTGEPQIQLYFLLGLVYAVITPFLLPYIIVFFGLAYVVYRHQIINVYNQEYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPD+HGRIIFAL+ SQ+  +GLLSTK AA S P LI+LPVLTI FHL+CKGRYE 
Sbjct  615   SAAAFWPDIHGRIIFALVISQLLLMGLLSTKEAANSTPLLIILPVLTIWFHLFCKGRYEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF +HPLQEA MKDTLE+AREP  N K +LQ+AYIHPVFK +ED  D D +S++ ++E +
Sbjct  675   AFVQHPLQEAMMKDTLERAREPQLNYKEFLQNAYIHPVFKSDEDS-DSDVMSQEFEDEPM  733

Query  658   LVQTKRQSRKNT  623
             LVQTKRQSRKNT
Sbjct  734   LVQTKRQSRKNT  745



>gb|ABK96436.1| unknown [Populus trichocarpa x Populus deltoides]
Length=252

 Score =   362 bits (929),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 178/230 (77%), Positives = 200/230 (87%), Gaps = 1/230 (0%)
 Frame = -2

Query  1312  MVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNEPRIQLYFLLG  1133
             MVDGW GIAGEVL LK LIL+HLKN FLVKTEKDRE+AM+PGSL FN  EPRIQLYFLLG
Sbjct  1     MVDGWAGIAGEVLMLKPLILYHLKNFFLVKTEKDREEAMDPGSLGFNTGEPRIQLYFLLG  60

Query  1132  LVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGRIIFALIFSQV  953
             LVYA VTP+LLPFI++FFAFAYVVFRHQIINVYNQEYES AAFWPDVHGR+I AL+ SQ+
Sbjct  61    LVYATVTPVLLPFIIIFFAFAYVVFRHQIINVYNQEYESGAAFWPDVHGRVITALVISQL  120

Query  952   STLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKMKDTLEQAREP  773
             + LGL+STK AAQSAPFLI LPVLTI FH +C GR++SAF K+PLQEA MKDTLE+AR+P
Sbjct  121   ALLGLMSTKEAAQSAPFLIALPVLTIWFHRFCNGRHKSAFVKYPLQEAMMKDTLERARDP  180

Query  772   NFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  623
             NFNLK YLQDAYIHPVFK   D  + D +S+K + E+VLV TKRQSRKNT
Sbjct  181   NFNLKAYLQDAYIHPVFK-GGDGDEDDDLSKKLETESVLVPTKRQSRKNT  229



>ref|XP_002518432.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43819.1| conserved hypothetical protein [Ricinus communis]
Length=773

 Score =   379 bits (974),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 194/259 (75%), Positives = 213/259 (82%), Gaps = 13/259 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW GIAGEVL LK LI+FHLKN FLVKTEK
Sbjct  503   IGVAIPM-----------KATFFITYIMVDGWAGIAGEVLMLKPLIIFHLKNFFLVKTEK  551

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGSL FN  EPRIQ YFLLGLVYA VTP LLPFI+VFFAFAYVVFRHQIINVY
Sbjct  552   DREEAMHPGSLGFNTGEPRIQFYFLLGLVYATVTPTLLPFIIVFFAFAYVVFRHQIINVY  611

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             +QEYES AAFWPDVHGR+I ALI SQV  +GLLSTK AAQS PFLIVLPVLTI FH +CK
Sbjct  612   DQEYESGAAFWPDVHGRVITALIISQVLMIGLLSTKRAAQSTPFLIVLPVLTIWFHRFCK  671

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFK--GNEDEYDYDGISE  680
             GRYE AF K+PLQEA MKDTLE+AREPN NLKP+LQ+AY HPVFK    +D+ + D ISE
Sbjct  672   GRYEPAFVKYPLQEAMMKDTLERAREPNLNLKPFLQNAYRHPVFKNDDGDDDDENDDISE  731

Query  679   KADEENVLVQTKRQSRKNT  623
             K + E+VLV TKRQSR+NT
Sbjct  732   KLETESVLVPTKRQSRRNT  750



>ref|XP_009772361.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772362.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772364.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
 ref|XP_009772365.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana sylvestris]
Length=768

 Score =   379 bits (974),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 188/252 (75%), Positives = 206/252 (82%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI FHLKN FLVKTEKDRE+A
Sbjct  498   PKTVGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIFFHLKNFFLVKTEKDREEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGSL FN  EP+IQLYFLLGLVYA V+PILLPFI+VFF  AYVV+RHQIINVYNQEYE
Sbjct  555   MDPGSLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIIVFFGLAYVVYRHQIINVYNQEYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRII ALI SQ+  +GLLSTK A+ S P LI LPVLTI FHL+CKGRYE 
Sbjct  615   SAAAFWPDVHGRIITALIVSQLLLMGLLSTKGASHSTPLLITLPVLTIWFHLFCKGRYEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQEA MKDTLE+ REPNFNLK YLQDAYIHPVFKG ED  + D  SE    E  
Sbjct  675   AFIRYPLQEAVMKDTLERTREPNFNLKEYLQDAYIHPVFKGEED-IESDAASEDGKLEPS  733

Query  658   LVQTKRQSRKNT  623
             LV TKRQSR NT
Sbjct  734   LVPTKRQSRFNT  745



>ref|XP_008363487.1| PREDICTED: uncharacterized protein RSN1-like [Malus domestica]
Length=567

 Score =   373 bits (958),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 181/252 (72%), Positives = 210/252 (83%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW GIAGE+LRLK LI++HLKN FLVKTEKDRE+A
Sbjct  295   PKTIGVSIP---MKATFFITYIMVDGWAGIAGEILRLKPLIIYHLKNFFLVKTEKDREEA  351

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG+L FN  EP+IQLYFLLGLVYA V+PILLPFI+VFFA AYVV+RHQIINVYNQEYE
Sbjct  352   MDPGTLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAYVVYRHQIINVYNQEYE  411

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRII ALI SQ+  +GLLSTK AAQS P LI LPVLTI FH +CKGRYE 
Sbjct  412   SAAAFWPDVHGRIITALIVSQLLLMGLLSTKEAAQSTPLLITLPVLTIWFHXFCKGRYEP  471

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF +HPLQEA MKDTLE+ REPN N+K +LQ+AYIHPVFKG ED+ +    +++ ++E  
Sbjct  472   AFIRHPLQEAMMKDTLERTREPNLNMKGFLQNAYIHPVFKG-EDDSENXAPAQEFEKEPX  530

Query  658   LVQTKRQSRKNT  623
             +V TKR SR+NT
Sbjct  531   VVLTKRSSRRNT  542



>ref|XP_009592755.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana tomentosiformis]
 ref|XP_009592756.1| PREDICTED: CSC1-like protein At3g21620 [Nicotiana tomentosiformis]
Length=768

 Score =   379 bits (972),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 187/252 (74%), Positives = 207/252 (82%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI FHLKN FLVKTEKDRE+A
Sbjct  498   PKTVGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIFFHLKNFFLVKTEKDREEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGSL FN  EP+IQLYFLLGLVYA V+PILLPFI+VFF  AYVV+RHQIINVYNQEYE
Sbjct  555   MDPGSLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIIVFFGLAYVVYRHQIINVYNQEYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRII ALI SQ+  +GLLSTK A+ S P LI LPVLTI FHL+CKGRYE 
Sbjct  615   SAAAFWPDVHGRIITALIVSQLLLMGLLSTKGASHSTPLLITLPVLTIWFHLFCKGRYEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQEA MKDTLE+ REPNFNLK YLQDAYIHPVFKG ED  + D  S+  + E  
Sbjct  675   AFVRYPLQEAVMKDTLERTREPNFNLKEYLQDAYIHPVFKGEED-IESDAASKDGELEPS  733

Query  658   LVQTKRQSRKNT  623
             LV TKRQSR NT
Sbjct  734   LVPTKRQSRFNT  745



>ref|XP_006469645.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X3 [Citrus sinensis]
Length=599

 Score =   372 bits (956),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 182/252 (72%), Positives = 209/252 (83%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G S     MKATFFITYIMVDGW G+AGE+LRLK LI++HLKN FLVKTEKDRE+A
Sbjct  338   PKTIGTSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREEA  394

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG++ FN  EP+IQLYFLLGLVYA VTP LLPFI+VFFA A+VV+RHQIINVYNQEYE
Sbjct  395   MDPGTVGFNTGEPQIQLYFLLGLVYAVVTPFLLPFIIVFFALAFVVYRHQIINVYNQEYE  454

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRII AL+ SQ+  +GLLSTK AAQS P LI LP+LTI FH +CKGRYE 
Sbjct  455   SAAAFWPDVHGRIITALVVSQLLLMGLLSTKEAAQSTPLLITLPILTIWFHRFCKGRYEP  514

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQEA MKDTLE+AREPN NLK +LQ AYIHPVFK  E E + D  SE++D+E V
Sbjct  515   AFVRYPLQEAMMKDTLERAREPNLNLKSFLQIAYIHPVFKEVE-ECESDPASEESDQEPV  573

Query  658   LVQTKRQSRKNT  623
             L+ TKRQSR NT
Sbjct  574   LIPTKRQSRMNT  585



>ref|XP_011047222.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047223.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047224.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011047225.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=768

 Score =   377 bits (967),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 183/252 (73%), Positives = 212/252 (84%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI++HLKN FLVKTEKDRE+A
Sbjct  498   PKTVGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG+L FN  EP+IQLYFLLGLVYA V+PILLPFI+VFFA A+VV+RHQIINVYNQEYE
Sbjct  555   MDPGTLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAFVVYRHQIINVYNQEYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRII A+I SQ+  +GLLSTK AAQS P LI LP+LTI FHL+CKGRYE 
Sbjct  615   SAAAFWPDVHGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLITLPILTIWFHLFCKGRYEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQEA MKDTLE+AREPN NLK +LQ+AY HPVFKG ED+ D D   E+ ++E  
Sbjct  675   AFVRYPLQEAMMKDTLERAREPNLNLKSFLQNAYSHPVFKG-EDDSDSDEAPEEFEKEPD  733

Query  658   LVQTKRQSRKNT  623
             LV TKRQSR+NT
Sbjct  734   LVPTKRQSRRNT  745



>ref|XP_010099166.1| Uncharacterized membrane protein [Morus notabilis]
 gb|EXB77038.1| Uncharacterized membrane protein [Morus notabilis]
Length=779

 Score =   377 bits (967),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 188/257 (73%), Positives = 210/257 (82%), Gaps = 12/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A P+           KATFFITYIMVDGW GIAGE+L LK LI++HLKN FLVKTEK
Sbjct  505   IGVAVPL-----------KATFFITYIMVDGWAGIAGEILMLKPLIIYHLKNFFLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGSL FN  EPRIQLYFLLGLVYAA+ P++LPFI+VFF FAY+VFRHQIINVY
Sbjct  554   DREEAMDPGSLGFNTGEPRIQLYFLLGLVYAAMNPVILPFIIVFFGFAYLVFRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYES AAFWPDVH RII ALI SQV+ LGLL TK  AQS P LIVLPVLTI F  +CK
Sbjct  614   NQEYESGAAFWPDVHLRIIIALITSQVALLGLLGTKENAQSTPVLIVLPVLTIWFFRFCK  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYESAF K+PLQEA MKDTLE+AREP+ NLK YLQ AYIHP+FK +EDE D D +SEK 
Sbjct  674   GRYESAFVKYPLQEAMMKDTLERAREPHLNLKGYLQVAYIHPIFKESEDE-DDDVVSEKW  732

Query  673   DEENVLVQTKRQSRKNT  623
             D E+ LV TKRQSR+NT
Sbjct  733   DTESTLVPTKRQSRRNT  749



>ref|XP_009357481.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Pyrus x bretschneideri]
Length=772

 Score =   376 bits (965),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 185/257 (72%), Positives = 206/257 (80%), Gaps = 12/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW GIA E+L LK LI++HLKN FLVKT+K
Sbjct  505   IGVAIPM-----------KATFFITYIMVDGWAGIAAEILMLKPLIIYHLKNFFLVKTDK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AMNPGS+ FN  EPRIQLY LLGLVYA VTP LLPFI++FF  AYVVFRHQIINVY
Sbjct  554   DREEAMNPGSIGFNTGEPRIQLYLLLGLVYATVTPTLLPFIIIFFGLAYVVFRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRII ALI SQ+   GLLSTK AAQS PFLI LPVLT+ FH YCK
Sbjct  614   NQEYESAAAFWPDVHGRIITALIISQLLLFGLLSTKKAAQSTPFLIALPVLTLWFHRYCK  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GR+E AF ++PLQEA MKDTLEQAREPN NLK YLQ AYIHPVFK  +DE D++   EK 
Sbjct  674   GRFEPAFKRYPLQEAMMKDTLEQAREPNLNLKGYLQSAYIHPVFKECDDEEDHESF-EKG  732

Query  673   DEENVLVQTKRQSRKNT  623
             + E+V+V TKR SR+NT
Sbjct  733   ETESVIVATKRHSRRNT  749



>ref|XP_011002577.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Populus 
euphratica]
Length=772

 Score =   376 bits (965),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 189/257 (74%), Positives = 213/257 (83%), Gaps = 12/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A P+           KATFFITYIMVDGW GIAGEVL LK LIL+HLKN FLVKTEK
Sbjct  505   IGVAVPL-----------KATFFITYIMVDGWAGIAGEVLMLKPLILYHLKNFFLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGSL FN  EPRIQLYFLLGLVYA VTP+LLPFIL+FFAFAYVVFRHQIINVY
Sbjct  554   DREEAMDPGSLGFNTGEPRIQLYFLLGLVYATVTPVLLPFILIFFAFAYVVFRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYES AAFWPDVHGR+I AL+ SQ++ LGL+STK AAQSAPFLI LPVLTI FH +  
Sbjct  614   NQEYESGAAFWPDVHGRVITALVISQLALLGLMSTKEAAQSAPFLIALPVLTIWFHSFSN  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GR++SAF K+PLQEA MKDTLE+AR+PNFNLK YLQDAYIHPVFK    + + D +S+  
Sbjct  674   GRHKSAFVKYPLQEAMMKDTLERARDPNFNLKAYLQDAYIHPVFK-GGGDDEDDDLSKIL  732

Query  673   DEENVLVQTKRQSRKNT  623
             + E+VLV TKRQSRKNT
Sbjct  733   ETESVLVPTKRQSRKNT  749



>emb|CAA18115.1| putative protein [Arabidopsis thaliana]
 emb|CAB79167.1| putative protein [Arabidopsis thaliana]
Length=697

 Score =   372 bits (956),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 185/257 (72%), Positives = 214/257 (83%), Gaps = 11/257 (4%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW G+AGE+L LK LI+FHLKN+FLVKT+K
Sbjct  431   IGVAIPM-----------KATFFITYIMVDGWAGVAGEILMLKPLIMFHLKNAFLVKTDK  479

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EPRIQLYFLLGLVYA VTP+LLPFILVFFA AY+V+RHQIINVY
Sbjct  480   DREEAMDPGSIGFNTGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVY  539

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGR+I AL+ SQ+  +GLL TKHAA +APFLI LPVLTI FH +CK
Sbjct  540   NQEYESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHHFCK  599

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AF ++PLQEA MKDTLE AREPN NLK YLQ+AY+HPVFKG+ED+YD D    K 
Sbjct  600   GRYEPAFIRYPLQEAMMKDTLETAREPNLNLKGYLQNAYVHPVFKGDEDDYDIDDKLGKF  659

Query  673   DEENVLVQTKRQSRKNT  623
             ++E ++V TKRQSR+NT
Sbjct  660   EDEAIIVPTKRQSRRNT  676



>gb|KDP20707.1| hypothetical protein JCGZ_21178 [Jatropha curcas]
Length=694

 Score =   372 bits (956),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 188/259 (73%), Positives = 209/259 (81%), Gaps = 13/259 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW GIAGEVL LK LILFHLKN FLVKTEK
Sbjct  423   IGVAIPM-----------KATFFITYIMVDGWAGIAGEVLMLKPLILFHLKNFFLVKTEK  471

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGSL FN  EPRIQ YFLLGLVYA VTP LLPFI+VFF FAYVVFRHQIINVY
Sbjct  472   DREEAMDPGSLGFNTGEPRIQFYFLLGLVYATVTPALLPFIIVFFGFAYVVFRHQIINVY  531

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAA+WPDVHGR++ ALI SQV  +GLLSTK AA S PFLI LP+LTI FH +CK
Sbjct  532   NQEYESAAAYWPDVHGRVVTALIISQVLMIGLLSTKRAALSTPFLIALPILTIWFHRFCK  591

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDG--ISE  680
             GRYE AF K+PLQEA M+DTLE+AREPN NLK YLQ+AY HPVFK  +D  + +   +SE
Sbjct  592   GRYEPAFVKYPLQEAMMRDTLERAREPNLNLKGYLQNAYAHPVFKEADDGDEDEDEILSE  651

Query  679   KADEENVLVQTKRQSRKNT  623
             K + E+VLV TKRQSR+NT
Sbjct  652   KLESESVLVPTKRQSRRNT  670



>ref|XP_002321139.1| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE99454.1| early-responsive to dehydration family protein [Populus trichocarpa]
Length=768

 Score =   374 bits (961),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 181/252 (72%), Positives = 212/252 (84%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI++HLKN FLVKTEKD+++A
Sbjct  498   PKTVGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDKKEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG+L FN  EP+IQLYFLLGLVYA V+PILLPFI+VFFA A+VV+RHQIINVYNQEYE
Sbjct  555   MDPGTLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAFVVYRHQIINVYNQEYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRII A+I SQ+  +GLLSTK AAQS P LI LP+LTI FHL+CKGRYE 
Sbjct  615   SAAAFWPDVHGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLITLPILTIWFHLFCKGRYEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQEA MKDTLE+AREPN NLK +LQ+AY HPVFKG ED+ D D   E+ ++E  
Sbjct  675   AFVRYPLQEAMMKDTLERAREPNLNLKSFLQNAYSHPVFKG-EDDSDSDEAPEEFEKEPD  733

Query  658   LVQTKRQSRKNT  623
             LV TKRQSR+NT
Sbjct  734   LVPTKRQSRRNT  745



>ref|XP_004145433.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Cucumis sativus]
 ref|XP_011660305.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Cucumis sativus]
 gb|KGN66856.1| hypothetical protein Csa_1G701320 [Cucumis sativus]
Length=773

 Score =   374 bits (960),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 187/257 (73%), Positives = 209/257 (81%), Gaps = 12/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW GIAGE+L LK L++FHLKN FLVKTEK
Sbjct  505   IGVAIPM-----------KATFFITYIMVDGWAGIAGEILMLKPLVMFHLKNFFLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AMNPGSL FN  EPRIQLYFLLGLVYA VTP+LLPFI+VFFA  +VVFRHQIINVY
Sbjct  554   DREEAMNPGSLGFNTGEPRIQLYFLLGLVYATVTPLLLPFIIVFFALGFVVFRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRII+ALIFSQV  +GLLSTK AAQS PFL+ LPV+TI+FHLYCK
Sbjct  614   NQEYESAAAFWPDVHGRIIYALIFSQVILMGLLSTKKAAQSTPFLLALPVITISFHLYCK  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AF ++P+QEA MKDTLE+AREPN NLK YL  AY HPV K   +E D    +E  
Sbjct  674   GRYEPAFIRYPIQEAMMKDTLERAREPNLNLKGYLHAAYAHPVIK-ESEEDDEVESNEAF  732

Query  673   DEENVLVQTKRQSRKNT  623
             + E+VLV TKRQSR+NT
Sbjct  733   ETESVLVATKRQSRRNT  749



>ref|XP_010439363.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Camelina 
sativa]
 ref|XP_010439364.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Camelina 
sativa]
 ref|XP_010439365.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Camelina 
sativa]
Length=771

 Score =   374 bits (959),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 186/257 (72%), Positives = 213/257 (83%), Gaps = 11/257 (4%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW G+AGE+L LK LI+FHLKN+FLVKTEK
Sbjct  505   IGVAIPM-----------KATFFITYIMVDGWAGVAGEILMLKPLIMFHLKNAFLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EPRIQLYFLLGLVYA VTP+LLPFILVFFA AY+V+RHQIINVY
Sbjct  554   DREEAMDPGSIGFNTGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGR+I AL+ SQ+  +GLL TKHAA +APFLI LPVLTI FH +CK
Sbjct  614   NQEYESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHHFCK  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AF ++PLQEA MKDTLE AREPN NLK YLQ+AYIHPVFKG+ED+ D D    K 
Sbjct  674   GRYEPAFIRYPLQEAMMKDTLETAREPNLNLKGYLQNAYIHPVFKGDEDDDDIDDKLGKF  733

Query  673   DEENVLVQTKRQSRKNT  623
             ++E ++V TKRQSR+NT
Sbjct  734   EDEAIIVPTKRQSRRNT  750



>ref|XP_010434078.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010434079.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010434080.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010434081.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
Length=771

 Score =   374 bits (959),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 186/257 (72%), Positives = 213/257 (83%), Gaps = 11/257 (4%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW G+AGE+L LK LI+FHLKN+FLVKTEK
Sbjct  505   IGVAIPM-----------KATFFITYIMVDGWAGVAGEILMLKPLIMFHLKNAFLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EPRIQLYFLLGLVYA VTP+LLPFILVFFA AY+V+RHQIINVY
Sbjct  554   DREEAMDPGSIGFNTGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGR+I AL+ SQ+  +GLL TKHAA +APFLI LPVLTI FH +CK
Sbjct  614   NQEYESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHHFCK  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AF ++PLQEA MKDTLE AREPN NLK YLQ+AYIHPVFKG+ED+ D D    K 
Sbjct  674   GRYEPAFIRYPLQEAMMKDTLETAREPNLNLKGYLQNAYIHPVFKGDEDDDDIDDKLGKF  733

Query  673   DEENVLVQTKRQSRKNT  623
             ++E ++V TKRQSR+NT
Sbjct  734   EDEAIIVPTKRQSRRNT  750



>ref|XP_006417282.1| hypothetical protein EUTSA_v10006870mg [Eutrema salsugineum]
 gb|ESQ35635.1| hypothetical protein EUTSA_v10006870mg [Eutrema salsugineum]
Length=770

 Score =   374 bits (959),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 184/261 (70%), Positives = 208/261 (80%), Gaps = 15/261 (6%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             +G+A P+           KATFFITYIMVDGW G+AGE+LRLK LI FH+KN FLVKTEK
Sbjct  504   VGVAIPI-----------KATFFITYIMVDGWAGVAGEILRLKPLIFFHVKNFFLVKTEK  552

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AMNPG + F+  EPRIQLYFLLGLVYA VTP+LLPFI++FFA AY+VFRHQIINVY
Sbjct  553   DREEAMNPGQINFHATEPRIQLYFLLGLVYAPVTPVLLPFIIIFFALAYLVFRHQIINVY  612

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRI  ALI SQ+  +GL+STK AAQS PFLI LPVLT  FH +CK
Sbjct  613   NQEYESAAAFWPDVHGRITSALIISQILLMGLMSTKGAAQSTPFLIALPVLTFFFHRFCK  672

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGIS---  683
             GRYE AF +HPLQEA +KDTLE+AREP+FNLKPYLQ AYIHPVFK ++ E     IS   
Sbjct  673   GRYEPAFLRHPLQEAMIKDTLERAREPSFNLKPYLQKAYIHPVFKDDDYEDSRSEISGYC  732

Query  682   -EKADEENVLVQTKRQSRKNT  623
              E +DEE V V TKRQSRK T
Sbjct  733   FEDSDEECVTVPTKRQSRKTT  753



>ref|XP_006413690.1| hypothetical protein EUTSA_v10024476mg [Eutrema salsugineum]
 gb|ESQ55143.1| hypothetical protein EUTSA_v10024476mg [Eutrema salsugineum]
Length=771

 Score =   373 bits (958),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 185/257 (72%), Positives = 212/257 (82%), Gaps = 11/257 (4%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW G+AGE+L LK LI+FHLKN+FLVKTEK
Sbjct  505   IGVAIPM-----------KATFFITYIMVDGWAGVAGEILMLKPLIMFHLKNAFLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EPRIQLYFLLGLVYA VTP+LLPFILVFFA AY+V+RHQIINVY
Sbjct  554   DREEAMDPGSIGFNTGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGR+I ALI SQ+  +GLL TKHAA +APFLI LPVLTI FH +CK
Sbjct  614   NQEYESAAAFWPDVHGRVITALIISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHRFCK  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AF ++PLQEA MKDTLE AREPN NLK YLQ AY+HPVF+G+ED+ D D    K 
Sbjct  674   GRYEPAFIRYPLQEAMMKDTLESAREPNLNLKGYLQSAYVHPVFRGDEDDDDIDDKLGKF  733

Query  673   DEENVLVQTKRQSRKNT  623
             ++E ++V TKRQSR+NT
Sbjct  734   EDEAIIVPTKRQSRRNT  750



>emb|CDX82907.1| BnaC01g13570D [Brassica napus]
Length=768

 Score =   373 bits (958),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 188/258 (73%), Positives = 214/258 (83%), Gaps = 12/258 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW G+AGE+L LK LI+FHLKN+FLVKTEK
Sbjct  505   IGVAIPM-----------KATFFITYIMVDGWAGVAGEILMLKPLIMFHLKNTFLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EPRIQLYFLLGLVYA VTP+LLPFILVFFA AY+V+RHQIINVY
Sbjct  554   DREEAMDPGSIGFNTGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGR+I ALI SQ+  +GLL TKHAA +APFLI LPVLTI FH +CK
Sbjct  614   NQEYESAAAFWPDVHGRVIAALIISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHHFCK  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGIS-EK  677
             GRYE AF ++PLQEAKMKDTLE AREPN NL+ YLQ AY+HPVF+G+EDE DYD     K
Sbjct  674   GRYEPAFVRYPLQEAKMKDTLESAREPNLNLRGYLQSAYVHPVFRGDEDEDDYDDDKLGK  733

Query  676   ADEENVLVQTKRQSRKNT  623
              +EE ++V TKRQSR+NT
Sbjct  734   FEEEAIIVPTKRQSRRNT  751



>ref|XP_006287117.1| hypothetical protein CARUB_v10000278mg [Capsella rubella]
 gb|EOA20015.1| hypothetical protein CARUB_v10000278mg [Capsella rubella]
Length=772

 Score =   373 bits (958),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 179/240 (75%), Positives = 209/240 (87%), Gaps = 1/240 (0%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             MKATFFITYIM+DGW G+AGE+L LK LI+FHLKN+FLVKTEKDRE+AM+PGS+ FN  E
Sbjct  512   MKATFFITYIMIDGWAGVAGEILMLKPLIIFHLKNAFLVKTEKDREEAMDPGSIGFNTGE  571

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             P+IQLYFLLGLVYA VTP+LLPFILVFF  AY+V+RHQIINVYNQEYESAAAFWPDVHGR
Sbjct  572   PQIQLYFLLGLVYAPVTPLLLPFILVFFGLAYIVYRHQIINVYNQEYESAAAFWPDVHGR  631

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             II ALI SQ+  +GLL TKHAA +APFLI LPV+TI FH +CKGRYE AF ++PLQEA M
Sbjct  632   IITALIISQLLLMGLLGTKHAASAAPFLIALPVITIGFHRFCKGRYEPAFIRYPLQEAMM  691

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  623
             KDTLE+AREPN NLK YLQDAY+HPVFKG++D+ D D +  K ++E ++V TKRQSR+NT
Sbjct  692   KDTLERAREPNLNLKGYLQDAYVHPVFKGDDDDDDSDMVG-KLEDEVIIVPTKRQSRRNT  750



>ref|NP_172660.5| putative ERD4 protein [Arabidopsis thaliana]
 sp|B5TYT3.1|CSCL7_ARATH RecName: Full=CSC1-like protein At1g11960 [Arabidopsis thaliana]
 gb|ACI01072.1| putative membrane protein [Arabidopsis thaliana]
 gb|AEE28821.1| putative ERD4 protein [Arabidopsis thaliana]
 gb|AIU34615.1| hyperosmolality-gated Ca2+ permeable channel 1.3 [Arabidopsis 
thaliana]
Length=771

 Score =   373 bits (958),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 183/262 (70%), Positives = 211/262 (81%), Gaps = 16/262 (6%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             +G+A P+           KATFFITYIMVDGW GIAGE+LRLK LI FH+KNS LVKTEK
Sbjct  504   VGVAIPI-----------KATFFITYIMVDGWAGIAGEILRLKPLIFFHIKNSLLVKTEK  552

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AMNPG + ++  EPRIQLYFLLGLVYA VTP+LLPFI++FFA AY+VFRHQIINVY
Sbjct  553   DREEAMNPGQINYHATEPRIQLYFLLGLVYAPVTPVLLPFIIIFFALAYLVFRHQIINVY  612

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAA FWPDVHGRII ALI +Q+  +GLLSTK AAQS PFL+ LP++T  FH YCK
Sbjct  613   NQEYESAARFWPDVHGRIISALIIAQILLMGLLSTKGAAQSTPFLLFLPIITFFFHRYCK  672

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNE-DEYDYDGIS--  683
             GRYE AF +HPL+EA +KDTLE+AREPNFNLKPYLQ AYIHPVFK N+ ++  +D IS  
Sbjct  673   GRYEPAFLRHPLKEAMVKDTLERAREPNFNLKPYLQKAYIHPVFKDNDYEDSRFDEISGY  732

Query  682   --EKADEENVLVQTKRQSRKNT  623
               E +DEE V V TKRQSR NT
Sbjct  733   CIEDSDEECVTVPTKRQSRINT  754



>ref|XP_008455928.1| PREDICTED: uncharacterized membrane protein YLR241W isoform X3 
[Cucumis melo]
Length=629

 Score =   369 bits (947),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 175/252 (69%), Positives = 208/252 (83%), Gaps = 3/252 (1%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFIT+IMVDGW GIA E+LRL+ LI++HL+N FLVKTEKDRE+A
Sbjct  359   PKTIGVSIP---MKATFFITFIMVDGWAGIAAEILRLRPLIIYHLRNFFLVKTEKDREEA  415

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG+L FN  EPRIQLYFLLGLVYA VTP+LLPFI+ FF  AY+V+RHQIINVYNQEYE
Sbjct  416   MDPGTLEFNTGEPRIQLYFLLGLVYAVVTPLLLPFIVTFFGLAYIVYRHQIINVYNQEYE  475

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRII AL+ SQ+  +GLLSTK AAQS P LI LP+LTI F+ +CKGRYE 
Sbjct  476   SAAAFWPDVHGRIIAALVVSQLLLMGLLSTKEAAQSTPLLIALPILTIWFNRFCKGRYEP  535

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQEA MKDTLE+AREPN NLK +LQ+AY+HPVFK +ED+ + +  SE   +E  
Sbjct  536   AFVQYPLQEAMMKDTLERAREPNLNLKGFLQNAYVHPVFKHDEDDVEIETDSEDRQQEPA  595

Query  658   LVQTKRQSRKNT  623
             LV TKRQSR+NT
Sbjct  596   LVPTKRQSRRNT  607



>ref|XP_002867790.1| hypothetical protein ARALYDRAFT_492658 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44049.1| hypothetical protein ARALYDRAFT_492658 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score =   373 bits (958),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 185/257 (72%), Positives = 213/257 (83%), Gaps = 11/257 (4%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW G+AGE+L LK LI+FHLKN+FLVKT+K
Sbjct  507   IGVAIPM-----------KATFFITYIMVDGWAGVAGEILMLKPLIMFHLKNAFLVKTDK  555

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EPRIQLYFLLGLVYA VTP+LLPFILVFFA AY+V+RHQIINVY
Sbjct  556   DREEAMDPGSIGFNTGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVY  615

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGR+I AL+ SQ+  +GLL TKHAA +APFLI LPVLTI FH +CK
Sbjct  616   NQEYESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHHFCK  675

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AF ++PLQEA MKDTLE AREPN NLK YLQ+AYIHPVFKG+ED+ D D    K 
Sbjct  676   GRYEPAFIRYPLQEAMMKDTLESAREPNLNLKGYLQNAYIHPVFKGDEDDDDIDDKLGKF  735

Query  673   DEENVLVQTKRQSRKNT  623
             ++E ++V TKRQSR+NT
Sbjct  736   EDEAIIVPTKRQSRRNT  752



>gb|AAC17615.1| Similar to hypothetical protein HYP1 gb|Z97338 from A. thaliana 
[Arabidopsis thaliana]
Length=783

 Score =   373 bits (958),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 183/262 (70%), Positives = 211/262 (81%), Gaps = 16/262 (6%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             +G+A P+           KATFFITYIMVDGW GIAGE+LRLK LI FH+KNS LVKTEK
Sbjct  516   VGVAIPI-----------KATFFITYIMVDGWAGIAGEILRLKPLIFFHIKNSLLVKTEK  564

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AMNPG + ++  EPRIQLYFLLGLVYA VTP+LLPFI++FFA AY+VFRHQIINVY
Sbjct  565   DREEAMNPGQINYHATEPRIQLYFLLGLVYAPVTPVLLPFIIIFFALAYLVFRHQIINVY  624

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAA FWPDVHGRII ALI +Q+  +GLLSTK AAQS PFL+ LP++T  FH YCK
Sbjct  625   NQEYESAARFWPDVHGRIISALIIAQILLMGLLSTKGAAQSTPFLLFLPIITFFFHRYCK  684

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNE-DEYDYDGIS--  683
             GRYE AF +HPL+EA +KDTLE+AREPNFNLKPYLQ AYIHPVFK N+ ++  +D IS  
Sbjct  685   GRYEPAFLRHPLKEAMVKDTLERAREPNFNLKPYLQKAYIHPVFKDNDYEDSRFDEISGY  744

Query  682   --EKADEENVLVQTKRQSRKNT  623
               E +DEE V V TKRQSR NT
Sbjct  745   CIEDSDEECVTVPTKRQSRINT  766



>ref|XP_008229991.1| PREDICTED: uncharacterized membrane protein C2G11.09 [Prunus 
mume]
Length=769

 Score =   373 bits (957),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 181/252 (72%), Positives = 210/252 (83%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI++HLKN FLVKTEKDREDA
Sbjct  498   PKTIGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREDA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG+L FN  EP+IQLYFLLGLVYA V+PILLPFI+VFF  AYVV+RHQIINVYNQEYE
Sbjct  555   MDPGTLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIIVFFGLAYVVYRHQIINVYNQEYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRII ALI SQ+  +GLLSTK AAQS P LI LPVLTI FH +CKG YE 
Sbjct  615   SAAAFWPDVHGRIITALIISQLLLMGLLSTKEAAQSTPLLITLPVLTIWFHRFCKGCYEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQEA MKDTLE+A EPN NLK +LQ+AYIHPVFKG ED+ + +  +E+ ++E  
Sbjct  675   AFIRYPLQEAMMKDTLERATEPNLNLKSFLQNAYIHPVFKG-EDDGENETAAEECEKEPA  733

Query  658   LVQTKRQSRKNT  623
             +V TKRQSR+NT
Sbjct  734   VVPTKRQSRRNT  745



>ref|XP_008455926.1| PREDICTED: uncharacterized membrane protein YLR241W isoform X2 
[Cucumis melo]
 ref|XP_008455927.1| PREDICTED: uncharacterized membrane protein YLR241W isoform X2 
[Cucumis melo]
Length=649

 Score =   369 bits (948),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 175/252 (69%), Positives = 208/252 (83%), Gaps = 3/252 (1%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFIT+IMVDGW GIA E+LRL+ LI++HL+N FLVKTEKDRE+A
Sbjct  379   PKTIGVSIP---MKATFFITFIMVDGWAGIAAEILRLRPLIIYHLRNFFLVKTEKDREEA  435

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG+L FN  EPRIQLYFLLGLVYA VTP+LLPFI+ FF  AY+V+RHQIINVYNQEYE
Sbjct  436   MDPGTLEFNTGEPRIQLYFLLGLVYAVVTPLLLPFIVTFFGLAYIVYRHQIINVYNQEYE  495

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRII AL+ SQ+  +GLLSTK AAQS P LI LP+LTI F+ +CKGRYE 
Sbjct  496   SAAAFWPDVHGRIIAALVVSQLLLMGLLSTKEAAQSTPLLIALPILTIWFNRFCKGRYEP  555

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQEA MKDTLE+AREPN NLK +LQ+AY+HPVFK +ED+ + +  SE   +E  
Sbjct  556   AFVQYPLQEAMMKDTLERAREPNLNLKGFLQNAYVHPVFKHDEDDVEIETDSEDRQQEPA  615

Query  658   LVQTKRQSRKNT  623
             LV TKRQSR+NT
Sbjct  616   LVPTKRQSRRNT  627



>ref|XP_004243535.1| PREDICTED: CSC1-like protein At3g21620 [Solanum lycopersicum]
 ref|XP_010323863.1| PREDICTED: CSC1-like protein At3g21620 [Solanum lycopersicum]
Length=767

 Score =   372 bits (956),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 182/252 (72%), Positives = 207/252 (82%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI FHLKN FLVKTEKDRE+A
Sbjct  498   PKTIGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIFFHLKNFFLVKTEKDREEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGSL FN  EP+IQLYFLLGLVYA V+PILLPFI+VFFA AYVV+RHQIINVYNQEYE
Sbjct  555   MDPGSLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAYVVYRHQIINVYNQEYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRII ALI SQ+  +GLLSTK A++S P LI LP+LTI FH++CKGR+E 
Sbjct  615   SAAAFWPDVHGRIITALIVSQLLLMGLLSTKEASKSTPLLITLPILTIWFHIFCKGRFEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQE   KDTLE+ +EPNFNLK +LQ+AYIHPVFKG  D  + D  SE  D E  
Sbjct  675   AFVRYPLQETVRKDTLERTKEPNFNLKEFLQNAYIHPVFKGEVDS-EIDAASEDGDLEPS  733

Query  658   LVQTKRQSRKNT  623
             LVQTKRQSR NT
Sbjct  734   LVQTKRQSRFNT  745



>ref|XP_008384098.1| PREDICTED: uncharacterized protein RSN1 [Malus domestica]
Length=771

 Score =   372 bits (956),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 183/257 (71%), Positives = 205/257 (80%), Gaps = 12/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW GIA E+L LK LI++HLKNSFLVKT+K
Sbjct  505   IGVAIPM-----------KATFFITYIMVDGWAGIAAEILMLKPLIIYHLKNSFLVKTDK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EPRIQLY LLGLVYA VTP LLPFI++FF  AYVVFRHQIINVY
Sbjct  554   DREEAMDPGSIGFNTGEPRIQLYVLLGLVYATVTPTLLPFIIIFFGLAYVVFRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
              QEYESAAAFWPDVHGRII ALI SQ+   GLLSTK AAQS PFLI LPVLT+ FH YCK
Sbjct  614   KQEYESAAAFWPDVHGRIITALIISQLLLFGLLSTKKAAQSTPFLIALPVLTLXFHRYCK  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GR+E AF   PLQEA MKDTLEQAR+PN NLK YLQ AYIHPVFK   DE D + + +K+
Sbjct  674   GRFEPAFKTFPLQEAMMKDTLEQARDPNLNLKGYLQSAYIHPVFKECGDEXDNESL-ZKS  732

Query  673   DEENVLVQTKRQSRKNT  623
             + E+V+V TKRQSR+NT
Sbjct  733   ETESVIVATKRQSRRNT  749



>ref|XP_009135587.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Brassica 
rapa]
Length=768

 Score =   372 bits (956),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 186/258 (72%), Positives = 214/258 (83%), Gaps = 12/258 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW G+AGE+L LK L++FHLKN+FLVKTEK
Sbjct  505   IGVAIPM-----------KATFFITYIMVDGWAGVAGEILMLKPLVMFHLKNTFLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EPRIQLYFLLGLVYA VTP+LLPFILVFFA AY+V+RHQIINVY
Sbjct  554   DREEAMDPGSIGFNTGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGR+I ALI SQ+  +GLL TKHAA +APFLI LPVLTI FH +CK
Sbjct  614   NQEYESAAAFWPDVHGRVISALIISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHHFCK  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGIS-EK  677
             GRYE AF ++PLQEAKMKDTLE AREPN NL+ YLQ AY+HPVF+G+ED+ DYD     K
Sbjct  674   GRYEPAFVRYPLQEAKMKDTLENAREPNLNLRGYLQSAYVHPVFRGDEDDDDYDDDKLGK  733

Query  676   ADEENVLVQTKRQSRKNT  623
              +EE ++V TKRQSR+NT
Sbjct  734   FEEEAIIVPTKRQSRRNT  751



>ref|XP_004151944.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Cucumis 
sativus]
 ref|XP_011649986.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Cucumis 
sativus]
 gb|KGN63220.1| hypothetical protein Csa_2G416110 [Cucumis sativus]
Length=768

 Score =   372 bits (956),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 176/252 (70%), Positives = 208/252 (83%), Gaps = 3/252 (1%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFIT+IMVDGW GIA E+LRL+ LI++HL+N FLVKTEKDRE+A
Sbjct  498   PKTIGVSIP---MKATFFITFIMVDGWAGIAAEILRLRPLIIYHLRNFFLVKTEKDREEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG+L FN  EPRIQLYFLLGLVYA VTP+LLPFI+ FF  AY+V+RHQIINVYNQEYE
Sbjct  555   MDPGTLEFNTGEPRIQLYFLLGLVYAVVTPLLLPFIVTFFGLAYIVYRHQIINVYNQEYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRII AL+ SQ+  +GLLSTK AAQS P LI LP+LTI FH +CKGRYE 
Sbjct  615   SAAAFWPDVHGRIIAALVVSQLLLMGLLSTKEAAQSTPLLIALPILTIWFHRFCKGRYEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQEA MKDTLE+AREPN NLK +LQ+AY+HPVFK +ED+ + +  SE   +E  
Sbjct  675   AFVRYPLQEAMMKDTLERAREPNLNLKGFLQNAYVHPVFKHDEDDVEIEADSEDWQQEPA  734

Query  658   LVQTKRQSRKNT  623
             LV TKRQSR+NT
Sbjct  735   LVPTKRQSRRNT  746



>ref|XP_002264502.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655368.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655369.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 ref|XP_010655370.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Vitis 
vinifera]
 emb|CBI23200.3| unnamed protein product [Vitis vinifera]
Length=771

 Score =   372 bits (956),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 184/257 (72%), Positives = 208/257 (81%), Gaps = 12/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFI+YIMVDGW GIA E+L LK LI+FHLKN FLVKTEK
Sbjct  503   IGVAIPM-----------KATFFISYIMVDGWAGIAAEILMLKPLIIFHLKNFFLVKTEK  551

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EPRIQLYFLLGLVYA VTP+LLPFI+VFF  AYVVFRHQIINVY
Sbjct  552   DREEAMDPGSIGFNTGEPRIQLYFLLGLVYAVVTPVLLPFIIVFFCLAYVVFRHQIINVY  611

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYES AAFWPDVHGRII ALI SQ+  +GLLSTK AAQS PFLI LP+LTI+FH YCK
Sbjct  612   NQEYESGAAFWPDVHGRIIGALIISQLLLMGLLSTKQAAQSTPFLIALPILTISFHYYCK  671

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GR+E AF ++PLQEAKMKDTLE+AREP+ NLK YLQ AYIHPVFK  ED+ + + I  K 
Sbjct  672   GRFEPAFIRYPLQEAKMKDTLERAREPHLNLKGYLQTAYIHPVFKSAEDD-EEEEIHGKW  730

Query  673   DEENVLVQTKRQSRKNT  623
             + +  LV TKRQSR+NT
Sbjct  731   EHDAELVPTKRQSRRNT  747



>ref|XP_002301612.2| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|EEE80885.2| early-responsive to dehydration family protein [Populus trichocarpa]
Length=763

 Score =   372 bits (955),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 181/252 (72%), Positives = 211/252 (84%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI++HLK  F+VKTEKD E+A
Sbjct  494   PKTIGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKMFFMVKTEKDMEEA  550

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG+L FN  EP+IQLYFLLGLVYA V+PILLPFI+VFFA A+VV+RHQIINVYNQEYE
Sbjct  551   MDPGTLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAFVVYRHQIINVYNQEYE  610

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRII A+I SQ+  +GLLSTK AAQS P LI LPVLTI FHL+CKGRYE 
Sbjct  611   SAAAFWPDVHGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLITLPVLTIWFHLFCKGRYEP  670

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQEA MKDTLE+A+EPN NLK +LQ+AYIHPVFKG ED+ D D   E+ ++E  
Sbjct  671   AFVRYPLQEAMMKDTLERAKEPNLNLKSFLQNAYIHPVFKG-EDDSDSDEAPEEFEKEPD  729

Query  658   LVQTKRQSRKNT  623
             LV TKRQSR+NT
Sbjct  730   LVPTKRQSRRNT  741



>ref|NP_193943.2| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001078425.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001119027.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001119028.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001119029.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_001190796.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 sp|Q5XEZ5.1|CSC1_ARATH RecName: Full=Calcium permeable stress-gated cation channel 1; 
Short=AtCSC1 [Arabidopsis thaliana]
 gb|AAU94384.1| At4g22120 [Arabidopsis thaliana]
 gb|AAW50707.1| At4g22120 [Arabidopsis thaliana]
 gb|AEE84554.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84555.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84556.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84557.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84558.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE84559.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AIU34614.1| hyperosmolality-gated Ca2+ permeable channel 1.2 [Arabidopsis 
thaliana]
Length=771

 Score =   372 bits (956),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 185/257 (72%), Positives = 214/257 (83%), Gaps = 11/257 (4%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW G+AGE+L LK LI+FHLKN+FLVKT+K
Sbjct  505   IGVAIPM-----------KATFFITYIMVDGWAGVAGEILMLKPLIMFHLKNAFLVKTDK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EPRIQLYFLLGLVYA VTP+LLPFILVFFA AY+V+RHQIINVY
Sbjct  554   DREEAMDPGSIGFNTGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGR+I AL+ SQ+  +GLL TKHAA +APFLI LPVLTI FH +CK
Sbjct  614   NQEYESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHHFCK  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AF ++PLQEA MKDTLE AREPN NLK YLQ+AY+HPVFKG+ED+YD D    K 
Sbjct  674   GRYEPAFIRYPLQEAMMKDTLETAREPNLNLKGYLQNAYVHPVFKGDEDDYDIDDKLGKF  733

Query  673   DEENVLVQTKRQSRKNT  623
             ++E ++V TKRQSR+NT
Sbjct  734   EDEAIIVPTKRQSRRNT  750



>ref|XP_006447609.1| hypothetical protein CICLE_v10014378mg [Citrus clementina]
 ref|XP_006469643.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469644.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Citrus sinensis]
 gb|ESR60849.1| hypothetical protein CICLE_v10014378mg [Citrus clementina]
Length=759

 Score =   372 bits (954),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 182/252 (72%), Positives = 209/252 (83%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G S     MKATFFITYIMVDGW G+AGE+LRLK LI++HLKN FLVKTEKDRE+A
Sbjct  498   PKTIGTSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG++ FN  EP+IQLYFLLGLVYA VTP LLPFI+VFFA A+VV+RHQIINVYNQEYE
Sbjct  555   MDPGTVGFNTGEPQIQLYFLLGLVYAVVTPFLLPFIIVFFALAFVVYRHQIINVYNQEYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRII AL+ SQ+  +GLLSTK AAQS P LI LP+LTI FH +CKGRYE 
Sbjct  615   SAAAFWPDVHGRIITALVVSQLLLMGLLSTKEAAQSTPLLITLPILTIWFHRFCKGRYEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQEA MKDTLE+AREPN NLK +LQ AYIHPVFK  E E + D  SE++D+E V
Sbjct  675   AFVRYPLQEAMMKDTLERAREPNLNLKSFLQIAYIHPVFKEVE-ECESDPASEESDQEPV  733

Query  658   LVQTKRQSRKNT  623
             L+ TKRQSR NT
Sbjct  734   LIPTKRQSRMNT  745



>emb|CDY21297.1| BnaC03g29810D [Brassica napus]
Length=768

 Score =   372 bits (954),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 182/257 (71%), Positives = 212/257 (82%), Gaps = 11/257 (4%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW G+AGE+L LK LI++HLKN+FLVKTEK
Sbjct  501   IGVAIPM-----------KATFFITYIMVDGWAGVAGEILMLKPLIIYHLKNAFLVKTEK  549

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EP+IQLYFLLGLVYA VTP+LLPFILVFFA AYVV+RHQIINVY
Sbjct  550   DREEAMDPGSIGFNTGEPQIQLYFLLGLVYAPVTPMLLPFILVFFALAYVVYRHQIINVY  609

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRII ALI SQ+  +GLL TK AA +APF+I LPV+TI FH +CK
Sbjct  610   NQEYESAAAFWPDVHGRIITALIISQLLLMGLLVTKRAALAAPFIIALPVITIGFHRFCK  669

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AF ++PLQEA MKDTLE+A+EPN NLK YLQDAYIHPVFKG +++ D D +  K 
Sbjct  670   GRYEPAFVRYPLQEAMMKDTLERAKEPNLNLKGYLQDAYIHPVFKGGDNDDDDDSVLGKL  729

Query  673   DEENVLVQTKRQSRKNT  623
             + E ++V TKRQSR+NT
Sbjct  730   EGEVIIVPTKRQSRRNT  746



>ref|XP_002892667.1| hypothetical protein ARALYDRAFT_312226 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68926.1| hypothetical protein ARALYDRAFT_312226 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score =   372 bits (955),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 183/262 (70%), Positives = 211/262 (81%), Gaps = 16/262 (6%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             +G+A P+           KATFFITYIMVDGW GIAGE+LRLK LI FH+KN  LVKTEK
Sbjct  506   VGVAIPI-----------KATFFITYIMVDGWAGIAGEILRLKPLIFFHIKNFLLVKTEK  554

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AMNPG + ++  EPRIQLYFLLGLVYA VTP+LLPFI++FFA AY+VFRHQIINVY
Sbjct  555   DREEAMNPGQINYHATEPRIQLYFLLGLVYAPVTPVLLPFIIIFFALAYLVFRHQIINVY  614

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAA FWPDVHGRII ALI SQ+  +GLLSTK AAQS PFL+VLP+LT  FH +CK
Sbjct  615   NQEYESAARFWPDVHGRIISALIISQILLMGLLSTKGAAQSTPFLLVLPILTFFFHRFCK  674

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNE-DEYDYDGIS--  683
             GRYE AF +HPL+EA +KDTLE+AREPNFNLKPYLQ AYIHPVFK N+ ++  +D IS  
Sbjct  675   GRYEPAFLRHPLKEAMVKDTLERAREPNFNLKPYLQKAYIHPVFKDNDYEDSRFDEISGY  734

Query  682   --EKADEENVLVQTKRQSRKNT  623
               E +D+E V V TKRQSR NT
Sbjct  735   CIEDSDDECVTVPTKRQSRINT  756



>ref|NP_192343.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_849296.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 ref|NP_849297.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 sp|Q9XEA1.1|CSCL5_ARATH RecName: Full=Protein OSCA1; AltName: Full=CSC1-like protein 
At4g04340; AltName: Full=Protein reduced hyperosmolality-induced 
[Ca(2+)]i increase 1 [Arabidopsis thaliana]
 gb|AAD36947.1|AF069441_7 predicted protein of unknown function [Arabidopsis thaliana]
 emb|CAB77902.1| predicted protein of unknown function [Arabidopsis thaliana]
 gb|AAM13208.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82380.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE82381.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AEE82382.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AIU34613.1| hyperosmolality-gated Ca2+ permeable channel 1.1 [Arabidopsis 
thaliana]
Length=772

 Score =   372 bits (954),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 185/257 (72%), Positives = 213/257 (83%), Gaps = 12/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW G+AGE+L LK LI++HLKN+FLVKTEK
Sbjct  506   IGMAIPM-----------KATFFITYIMVDGWAGVAGEILMLKPLIIYHLKNAFLVKTEK  554

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AMNPGS+ FN  EP+IQLYFLLGLVYA VTP+LLPFILVFFA AYVV+RHQIINVY
Sbjct  555   DREEAMNPGSIGFNTGEPQIQLYFLLGLVYAPVTPMLLPFILVFFALAYVVYRHQIINVY  614

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGR+I ALI SQ+  +GLL TKHAA +APFLI LPV+TI FH +CK
Sbjct  615   NQEYESAAAFWPDVHGRVITALIISQLLLMGLLGTKHAASAAPFLIALPVITIGFHRFCK  674

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GR+E AF ++PLQEA MKDTLE+AREPN NLK YLQDAYIHPVFKG +++ D D I  K 
Sbjct  675   GRFEPAFVRYPLQEAMMKDTLERAREPNLNLKGYLQDAYIHPVFKGGDNDDDGDMIG-KL  733

Query  673   DEENVLVQTKRQSRKNT  623
             + E ++V TKRQSR+NT
Sbjct  734   ENEVIIVPTKRQSRRNT  750



>ref|XP_010448929.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448930.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448931.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448932.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448933.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
 ref|XP_010448934.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Camelina sativa]
Length=771

 Score =   372 bits (954),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 184/257 (72%), Positives = 212/257 (82%), Gaps = 11/257 (4%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW G+AGE+L LK LI+FHLKN+FLVKTEK
Sbjct  505   IGVAIPM-----------KATFFITYIMVDGWAGVAGEILMLKPLIMFHLKNAFLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EPRIQLYFLLGLVYA VTP+LLPFILVFFA AY+V+RHQIINVY
Sbjct  554   DREEAMDPGSIGFNTGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGR+I AL+ SQ+  +GLL TKHAA +APFLI LPVLTI FH +CK
Sbjct  614   NQEYESAAAFWPDVHGRVIAALVISQLLLMGLLGTKHAALAAPFLIALPVLTIGFHHFCK  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AF ++PLQEA MKDTLE AREPN NLK YLQ +YIHPVFKG+E++ D D    K 
Sbjct  674   GRYEPAFIRYPLQEAMMKDTLETAREPNLNLKGYLQTSYIHPVFKGDEEDDDIDDKLGKF  733

Query  673   DEENVLVQTKRQSRKNT  623
             ++E ++V TKRQSR+NT
Sbjct  734   EDEAIIVPTKRQSRRNT  750



>ref|XP_011007190.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011007191.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
 ref|XP_011007193.1| PREDICTED: CSC1-like protein At3g21620 [Populus euphratica]
Length=767

 Score =   371 bits (953),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 181/252 (72%), Positives = 210/252 (83%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI++HLK  F+VKTEKD E+A
Sbjct  498   PKTIGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKMFFMVKTEKDMEEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG+L FN  EP+IQLYFLLGLVYA V+PILLPFI+VFFA A+VV+RHQIINVYNQEYE
Sbjct  555   MDPGTLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAFVVYRHQIINVYNQEYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRII A+I SQ+  +GLLSTK AAQS P LI LPVLTI FHL+CKGRYE 
Sbjct  615   SAAAFWPDVHGRIIVAVIVSQLLLMGLLSTKEAAQSTPLLIALPVLTIWFHLFCKGRYEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQEA MKDTLE+AREP  NLK +LQ+AYIHPVFKG ED+ D D   E+ ++E  
Sbjct  675   AFVRYPLQEAMMKDTLERAREPKLNLKSFLQNAYIHPVFKG-EDDSDSDEAPEEFEKEPD  733

Query  658   LVQTKRQSRKNT  623
             LV TKRQSR+NT
Sbjct  734   LVPTKRQSRRNT  745



>ref|XP_009108550.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Brassica rapa]
 ref|XP_009108551.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Brassica rapa]
Length=774

 Score =   371 bits (953),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 186/260 (72%), Positives = 213/260 (82%), Gaps = 14/260 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW G+AGE+L LK LI+FHLKN+FLVKTEK
Sbjct  505   IGVAIPM-----------KATFFITYIMVDGWAGVAGEILMLKPLIMFHLKNTFLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EPRIQLYFLLGLVYA VTP+LLPFIL+FFA AY+V+RHQIINVY
Sbjct  554   DREEAMDPGSIGFNTGEPRIQLYFLLGLVYAPVTPMLLPFILIFFALAYIVYRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGR+I ALI SQV  +GLL TKHAA +APFLI LPVLTI FH +CK
Sbjct  614   NQEYESAAAFWPDVHGRVIAALIISQVLLMGLLGTKHAALAAPFLIALPVLTIGFHRFCK  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AF ++PLQEAKMKDTLE AREPN NLK YLQ AY+HPVFKG ED+ D +   +K 
Sbjct  674   GRYEPAFVRYPLQEAKMKDTLESAREPNLNLKGYLQSAYVHPVFKGGEDDDDDEYGDDKL  733

Query  673   ---DEENVLVQTKRQSRKNT  623
                ++E ++V TKRQSR+NT
Sbjct  734   GKFEDEAIIVPTKRQSRRNT  753



>ref|XP_006363038.1| PREDICTED: uncharacterized protein RSN1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006363039.1| PREDICTED: uncharacterized protein RSN1-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006363040.1| PREDICTED: uncharacterized protein RSN1-like isoform X3 [Solanum 
tuberosum]
Length=768

 Score =   371 bits (953),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 181/252 (72%), Positives = 208/252 (83%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI FHLKN FLVKTEKDRE+A
Sbjct  498   PKTIGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIFFHLKNFFLVKTEKDREEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGSL FN  EP+IQLYFLLGLVYAAV+PILLPFI+VFFA AYVV+RHQIINVYNQEYE
Sbjct  555   MDPGSLGFNTGEPQIQLYFLLGLVYAAVSPILLPFIIVFFALAYVVYRHQIINVYNQEYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRII ALI SQ+  +GLLSTK A++S P LI LP+LTI FH++CKGRYE 
Sbjct  615   SAAAFWPDVHGRIITALIVSQLLLMGLLSTKEASKSTPLLITLPILTIWFHIFCKGRYEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQE   KDTL++ +EPNF+LK +LQ+AYIHPVFKG  D  + D  SE  + E  
Sbjct  675   AFVRYPLQETVRKDTLDRTKEPNFDLKEFLQNAYIHPVFKGEVDS-EIDAASEDGELEPS  733

Query  658   LVQTKRQSRKNT  623
             LVQTKRQSR NT
Sbjct  734   LVQTKRQSRFNT  745



>ref|NP_001291223.1| calcium permeable stress-gated cation channel 1 [Populus euphratica]
 gb|AEL95439.1| early-responsive to dehydration-related protein [Populus euphratica]
Length=772

 Score =   371 bits (952),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 187/257 (73%), Positives = 212/257 (82%), Gaps = 12/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A P+           KATFFITYIMVDGW GIAGEVL LK LIL+HLKN FLVKTEK
Sbjct  505   IGVAVPL-----------KATFFITYIMVDGWAGIAGEVLMLKPLILYHLKNFFLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+ GSL FN  EPRIQLYFLLGLVYA VTP+LLPFI++FFAFAYVVFRHQIINVY
Sbjct  554   DREEAMDAGSLGFNTGEPRIQLYFLLGLVYATVTPVLLPFIIIFFAFAYVVFRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYES AAFWPDVHGR+I AL+ SQ++ LGL+STK AAQSAPFLI LPVLTI FH +  
Sbjct  614   NQEYESGAAFWPDVHGRVITALVISQLALLGLMSTKEAAQSAPFLIALPVLTIWFHSFSN  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GR++SAF K+PLQEA MKDTLE+AR+PNFNLK YLQDAYIHPVFK    + + D +S+  
Sbjct  674   GRHKSAFVKYPLQEAMMKDTLERARDPNFNLKAYLQDAYIHPVFK-GGGDDEDDDLSKIL  732

Query  673   DEENVLVQTKRQSRKNT  623
             + E+VLV TKRQSRKNT
Sbjct  733   ETESVLVPTKRQSRKNT  749



>ref|XP_006348154.1| PREDICTED: uncharacterized protein RSN1-like isoform X2 [Solanum 
tuberosum]
Length=703

 Score =   369 bits (947),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 205/279 (73%), Positives = 231/279 (83%), Gaps = 12/279 (4%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KA+FFITYIMVDGW GIAGE+LRLK LI +HLKN FLVKTEK
Sbjct  437   IGVAVPM-----------KASFFITYIMVDGWAGIAGEILRLKPLIFYHLKNFFLVKTEK  485

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EP+IQLYFLLGLVYA VTP LLPFILVFF  AYVV+RHQIINVY
Sbjct  486   DREEAMDPGSVGFNTGEPQIQLYFLLGLVYAVVTPFLLPFILVFFGLAYVVYRHQIINVY  545

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRIIFAL FSQ+S LGLL TKHA QSAPFLI LPVLTI+FHLYCK
Sbjct  546   NQEYESAAAFWPDVHGRIIFALCFSQLSLLGLLGTKHATQSAPFLIALPVLTISFHLYCK  605

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AFTK+P+QEA+M+DTLEQAREPN NLK YLQ+AY+HPVFK ++++ D D +  K 
Sbjct  606   GRYEPAFTKYPIQEARMRDTLEQAREPNLNLKGYLQNAYVHPVFKDDDEDEDEDFMM-KL  664

Query  673   DEENVLVQTKRQSRKNTpapskgsggsspSFRVEVIHEK  557
             + ++VLV TKRQSR NTP PSK S GSSPS    VIHE+
Sbjct  665   ETDSVLVPTKRQSRMNTPVPSKVSAGSSPSLPDVVIHEQ  703



>ref|XP_009772257.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana sylvestris]
Length=767

 Score =   370 bits (949),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 206/278 (74%), Positives = 234/278 (84%), Gaps = 12/278 (4%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KA+FFITYIMVDGW GIAGE+LRLK LI +HLKN FLVKTEK
Sbjct  501   IGVAVPM-----------KASFFITYIMVDGWAGIAGEILRLKPLIFYHLKNFFLVKTEK  549

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EP+IQLYFLLGLVYA VTP LLPFILVFF  AYVV+RHQIINVY
Sbjct  550   DREEAMDPGSVGFNTGEPQIQLYFLLGLVYAVVTPFLLPFILVFFGLAYVVYRHQIINVY  609

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRIIFAL FSQ+S LGLLSTKHAAQSAPFLI LPVLTI+FHL+CK
Sbjct  610   NQEYESAAAFWPDVHGRIIFALCFSQLSLLGLLSTKHAAQSAPFLIALPVLTISFHLFCK  669

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AFTK+P+QEA+M+DTLEQAREPNFNLK YLQ+AY+HPVFKG++++ D D ++ K 
Sbjct  670   GRYEPAFTKYPIQEARMRDTLEQAREPNFNLKGYLQNAYVHPVFKGDDEDEDEDFMN-KL  728

Query  673   DEENVLVQTKRQSRKNTpapskgsggsspSFRVEVIHE  560
             + ++V+V TKR SR NTP PSK S GSSPS    VIHE
Sbjct  729   ETDSVIVPTKRHSRLNTPVPSKVSAGSSPSLPDAVIHE  766



>gb|AAL07154.1| unknown protein [Arabidopsis thaliana]
Length=772

 Score =   370 bits (949),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 184/257 (72%), Positives = 212/257 (82%), Gaps = 12/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW G+AGE+L LK LI++HLKN+FLVKTEK
Sbjct  506   IGMAIPM-----------KATFFITYIMVDGWAGVAGEILMLKPLIIYHLKNAFLVKTEK  554

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AMNPGS+ FN  EP+IQLYFLLGLVYA VTP+LLPFILVFFA AYVV+RHQIINVY
Sbjct  555   DREEAMNPGSIGFNTGEPQIQLYFLLGLVYAPVTPMLLPFILVFFALAYVVYRHQIINVY  614

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGR+I ALI SQ+  +GLL TKHAA +APFLI LPV+T  FH +CK
Sbjct  615   NQEYESAAAFWPDVHGRVITALIISQLLLMGLLGTKHAASAAPFLIALPVITTGFHRFCK  674

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GR+E AF ++PLQEA MKDTLE+AREPN NLK YLQDAYIHPVFKG +++ D D I  K 
Sbjct  675   GRFEPAFVRYPLQEAMMKDTLERAREPNLNLKGYLQDAYIHPVFKGGDNDDDGDMIG-KL  733

Query  673   DEENVLVQTKRQSRKNT  623
             + E ++V TKRQSR+NT
Sbjct  734   ENEVIIVPTKRQSRRNT  750



>ref|XP_011046982.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Populus euphratica]
Length=672

 Score =   367 bits (941),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 177/260 (68%), Positives = 210/260 (81%), Gaps = 14/260 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW GIAGEVL LK LI++HLKN FLVKTEK
Sbjct  402   IGVAIPM-----------KATFFITYIMVDGWAGIAGEVLMLKPLIIYHLKNFFLVKTEK  450

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DR++AM+ GSL FN  EPRIQLYFLLGLVYA VTPILLPFI++FF FAYVV+RHQIINVY
Sbjct  451   DRKEAMDAGSLGFNTGEPRIQLYFLLGLVYAPVTPILLPFIVMFFGFAYVVYRHQIINVY  510

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYES AAFWP VHGR+I AL+ +Q+  +GLLSTK A+ S PFLI LPVLTI FH++C 
Sbjct  511   NQEYESGAAFWPAVHGRVITALVIAQLLMMGLLSTKQASSSTPFLIALPVLTIWFHVFCN  570

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD---GIS  683
             GRY+SAF K+PLQEA MKD+LE+A  PNFN K YL+ AY+HPVFKGN ++ DY+     +
Sbjct  571   GRYKSAFVKYPLQEAMMKDSLERASSPNFNFKSYLEKAYVHPVFKGNGNDDDYEQYLSEN  630

Query  682   EKADEENVLVQTKRQSRKNT  623
             ++AD ENVLV T+RQS++N+
Sbjct  631   QEADAENVLVPTRRQSQRNS  650



>dbj|BAD93792.1| hypothetical protein [Arabidopsis thaliana]
Length=771

 Score =   369 bits (948),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 184/257 (72%), Positives = 213/257 (83%), Gaps = 11/257 (4%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVD W G+AGE+L LK LI+FHLKN+FLVKT+K
Sbjct  505   IGVAIPM-----------KATFFITYIMVDSWAGVAGEILMLKPLIMFHLKNAFLVKTDK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EPRIQLYFLLGLVYA VTP+LLPFILVFFA AY+V+RHQIINVY
Sbjct  554   DREEAMDPGSIGFNTGEPRIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGR+I AL+ SQ+  +GLL TKHAA +APFLI LPVLTI FH +CK
Sbjct  614   NQEYESAAAFWPDVHGRVIAALVISQLFLMGLLGTKHAALAAPFLIALPVLTIGFHHFCK  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AF ++PLQEA MKDTLE AREPN NLK YLQ+AY+HPVFKG+ED+YD D    K 
Sbjct  674   GRYEPAFIRYPLQEAMMKDTLETAREPNLNLKGYLQNAYVHPVFKGDEDDYDIDDKLGKF  733

Query  673   DEENVLVQTKRQSRKNT  623
             ++E ++V TKRQSR+NT
Sbjct  734   EDEAIIVPTKRQSRRNT  750



>ref|XP_010493595.1| PREDICTED: LOW QUALITY PROTEIN: CSC1-like protein At1g11960 [Camelina 
sativa]
Length=779

 Score =   369 bits (948),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 182/262 (69%), Positives = 210/262 (80%), Gaps = 16/262 (6%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             +G+A P+           KATFFITYIMVDGW G+AGE+LRLK LI FH+KN FLVKTEK
Sbjct  514   VGVAIPI-----------KATFFITYIMVDGWAGVAGEILRLKPLIFFHIKNFFLVKTEK  562

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AMNPG + ++  EPRIQLYFLLGLVYA VTP+LLPFI+VFFA AY+VFRHQIINVY
Sbjct  563   DREEAMNPGQINYHATEPRIQLYFLLGLVYAPVTPVLLPFIIVFFALAYLVFRHQIINVY  622

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYES A FWPDVHGRII ALI SQV  +GLLSTK AAQS PFL+VLP+LT  FH +CK
Sbjct  623   NQEYESGARFWPDVHGRIIAALIISQVLLMGLLSTKGAAQSTPFLLVLPILTFFFHRFCK  682

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNE-DEYDYDGIS--  683
             GRYE AF +HPL+EA +KDTLE+AREPNFNLKPYLQ AYIHPVFK +  ++  +D +S  
Sbjct  683   GRYEPAFLRHPLKEAMVKDTLEKAREPNFNLKPYLQKAYIHPVFKDDHYEDSRFDDMSSY  742

Query  682   --EKADEENVLVQTKRQSRKNT  623
               E +D+E V V TKRQSR NT
Sbjct  743   CGEDSDDECVTVPTKRQSRLNT  764



>ref|XP_008455922.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
 ref|XP_008455924.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
 ref|XP_008455925.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Cucumis melo]
Length=768

 Score =   369 bits (947),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 175/252 (69%), Positives = 208/252 (83%), Gaps = 3/252 (1%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFIT+IMVDGW GIA E+LRL+ LI++HL+N FLVKTEKDRE+A
Sbjct  498   PKTIGVSIP---MKATFFITFIMVDGWAGIAAEILRLRPLIIYHLRNFFLVKTEKDREEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG+L FN  EPRIQLYFLLGLVYA VTP+LLPFI+ FF  AY+V+RHQIINVYNQEYE
Sbjct  555   MDPGTLEFNTGEPRIQLYFLLGLVYAVVTPLLLPFIVTFFGLAYIVYRHQIINVYNQEYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRII AL+ SQ+  +GLLSTK AAQS P LI LP+LTI F+ +CKGRYE 
Sbjct  615   SAAAFWPDVHGRIIAALVVSQLLLMGLLSTKEAAQSTPLLIALPILTIWFNRFCKGRYEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQEA MKDTLE+AREPN NLK +LQ+AY+HPVFK +ED+ + +  SE   +E  
Sbjct  675   AFVQYPLQEAMMKDTLERAREPNLNLKGFLQNAYVHPVFKHDEDDVEIETDSEDRQQEPA  734

Query  658   LVQTKRQSRKNT  623
             LV TKRQSR+NT
Sbjct  735   LVPTKRQSRRNT  746



>ref|XP_009613689.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana tomentosiformis]
Length=767

 Score =   369 bits (947),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 191/257 (74%), Positives = 221/257 (86%), Gaps = 12/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KA+FFIT+IMVDGW GIAGE+LRLK LI +HLKN FLVKTEK
Sbjct  501   IGVAVPM-----------KASFFITFIMVDGWAGIAGEILRLKPLIFYHLKNFFLVKTEK  549

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EP+IQLYFLLGLVYA VTP LLPFILVFF  AYVV+RHQIINVY
Sbjct  550   DREEAMDPGSVGFNTGEPQIQLYFLLGLVYAVVTPFLLPFILVFFGLAYVVYRHQIINVY  609

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRI+FAL FSQ+S LGLLSTKHAAQSAPFLI LPVLTI+FHL+CK
Sbjct  610   NQEYESAAAFWPDVHGRIVFALCFSQLSLLGLLSTKHAAQSAPFLIALPVLTISFHLFCK  669

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AFTK+P+QEA+M+DTLEQAREPNFNLK YLQ+AY+HPVFKG++++ D D ++ K 
Sbjct  670   GRYEPAFTKYPIQEARMRDTLEQAREPNFNLKGYLQNAYVHPVFKGDDEDEDEDFLN-KL  728

Query  673   DEENVLVQTKRQSRKNT  623
             + ++V+V TKRQSR NT
Sbjct  729   ENDSVIVPTKRQSRLNT  745



>ref|XP_009148626.1| PREDICTED: CSC1-like protein At1g11960 [Brassica rapa]
Length=768

 Score =   369 bits (946),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 187/264 (71%), Positives = 207/264 (78%), Gaps = 21/264 (8%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             +G+A P+           KATFFITYIMVDGW G+AGE+LRLK LI FH+KN FLVKTEK
Sbjct  504   VGVAIPI-----------KATFFITYIMVDGWAGVAGEILRLKPLIFFHVKNFFLVKTEK  552

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AMNPG + F+  EPRIQLYFLLGLVYA VTP+LLPFI++FFA AY+VFRHQIINVY
Sbjct  553   DREEAMNPGQINFHATEPRIQLYFLLGLVYAPVTPVLLPFIIIFFALAYLVFRHQIINVY  612

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESA  FWPDVHGRII ALI SQV  LGL+STK AAQS PFLI LPVLT  FH +CK
Sbjct  613   NQEYESAGRFWPDVHGRIISALIISQVLLLGLMSTKGAAQSTPFLIALPVLTFFFHRFCK  672

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISE--  680
             GRYE AF +HPLQEA +KDTLEQAREPNFNLKPYL+ AYIHPVFK  +DEY+ D  SE  
Sbjct  673   GRYEPAFLRHPLQEAMIKDTLEQAREPNFNLKPYLKKAYIHPVFK--DDEYE-DVRSEVS  729

Query  679   -----KADEENVLVQTKRQSRKNT  623
                    DEE V V TKRQSR  T
Sbjct  730   GYYLGDTDEECVTVPTKRQSRITT  753



>ref|XP_007211353.1| hypothetical protein PRUPE_ppa001728mg [Prunus persica]
 gb|EMJ12552.1| hypothetical protein PRUPE_ppa001728mg [Prunus persica]
Length=773

 Score =   369 bits (946),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 180/257 (70%), Positives = 206/257 (80%), Gaps = 12/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW GIA E+L LK LI+FHLKN FLVKTEK
Sbjct  505   IGVAIPM-----------KATFFITYIMVDGWAGIAAEILMLKPLIIFHLKNFFLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EPRIQLYFLLGLVYA VTP LLPFI++FF  AYVVFRHQIINVY
Sbjct  554   DREEAMDPGSIGFNTGEPRIQLYFLLGLVYATVTPALLPFIIIFFGLAYVVFRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGR++ ALI SQ+   GLLSTK AAQS PFLI LPVLTI F+ YCK
Sbjct  614   NQEYESAAAFWPDVHGRVVSALIISQLLLFGLLSTKRAAQSTPFLIALPVLTIWFYRYCK  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GR+E AF  +PLQEA MKDTLE+A+EPN NLK YLQ AY+HPVF+  +D+ D + I +K 
Sbjct  674   GRFEPAFVTYPLQEAMMKDTLERAKEPNLNLKGYLQSAYVHPVFRDCDDDEDNESI-DKG  732

Query  673   DEENVLVQTKRQSRKNT  623
             + E+V+V TKR SR+NT
Sbjct  733   ENESVIVPTKRHSRRNT  749



>emb|CDX98089.1| BnaA06g08400D [Brassica napus]
Length=768

 Score =   369 bits (946),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 187/264 (71%), Positives = 207/264 (78%), Gaps = 21/264 (8%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             +G+A P+           KATFFITYIMVDGW G+AGE+LRLK LI FH+KN FLVKTEK
Sbjct  504   VGVAIPI-----------KATFFITYIMVDGWAGVAGEILRLKPLIFFHVKNFFLVKTEK  552

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AMNPG + F+  EPRIQLYFLLGLVYA VTP+LLPFI++FFA AY+VFRHQIINVY
Sbjct  553   DREEAMNPGQINFHATEPRIQLYFLLGLVYAPVTPVLLPFIIIFFALAYLVFRHQIINVY  612

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESA  FWPDVHGRII ALI SQV  LGL+STK AAQS PFLI LPVLT  FH +CK
Sbjct  613   NQEYESAGRFWPDVHGRIISALIISQVLLLGLMSTKGAAQSTPFLIALPVLTFFFHRFCK  672

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISE--  680
             GRYE AF +HPLQEA +KDTLEQAREPNFNLKPYL+ AYIHPVFK  +DEY+ D  SE  
Sbjct  673   GRYEPAFLRHPLQEAMIKDTLEQAREPNFNLKPYLKKAYIHPVFK--DDEYE-DVRSEVS  729

Query  679   -----KADEENVLVQTKRQSRKNT  623
                    DEE V V TKRQSR  T
Sbjct  730   GYYLGDTDEECVTVPTKRQSRITT  753



>ref|XP_006348153.1| PREDICTED: uncharacterized protein RSN1-like isoform X1 [Solanum 
tuberosum]
Length=767

 Score =   369 bits (946),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 205/279 (73%), Positives = 231/279 (83%), Gaps = 12/279 (4%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KA+FFITYIMVDGW GIAGE+LRLK LI +HLKN FLVKTEK
Sbjct  501   IGVAVPM-----------KASFFITYIMVDGWAGIAGEILRLKPLIFYHLKNFFLVKTEK  549

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EP+IQLYFLLGLVYA VTP LLPFILVFF  AYVV+RHQIINVY
Sbjct  550   DREEAMDPGSVGFNTGEPQIQLYFLLGLVYAVVTPFLLPFILVFFGLAYVVYRHQIINVY  609

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRIIFAL FSQ+S LGLL TKHA QSAPFLI LPVLTI+FHLYCK
Sbjct  610   NQEYESAAAFWPDVHGRIIFALCFSQLSLLGLLGTKHATQSAPFLIALPVLTISFHLYCK  669

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AFTK+P+QEA+M+DTLEQAREPN NLK YLQ+AY+HPVFK ++++ D D +  K 
Sbjct  670   GRYEPAFTKYPIQEARMRDTLEQAREPNLNLKGYLQNAYVHPVFKDDDEDEDEDFMM-KL  728

Query  673   DEENVLVQTKRQSRKNTpapskgsggsspSFRVEVIHEK  557
             + ++VLV TKRQSR NTP PSK S GSSPS    VIHE+
Sbjct  729   ETDSVLVPTKRQSRMNTPVPSKVSAGSSPSLPDVVIHEQ  767



>ref|XP_006306821.1| hypothetical protein CARUB_v10008363mg [Capsella rubella]
 gb|EOA39719.1| hypothetical protein CARUB_v10008363mg [Capsella rubella]
Length=771

 Score =   368 bits (945),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 180/262 (69%), Positives = 210/262 (80%), Gaps = 16/262 (6%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             +G+A P+           KATFFITYIMVDGW GIAGE+LRLK LI FH+KN FLVKTEK
Sbjct  504   VGVAIPI-----------KATFFITYIMVDGWAGIAGEILRLKPLIFFHIKNFFLVKTEK  552

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DREDAMNPG + ++  EPRIQLYFLLGLVYA VTP+LLPFI++FFA AY+VFRHQIINVY
Sbjct  553   DREDAMNPGQINYHATEPRIQLYFLLGLVYAPVTPVLLPFIIIFFALAYLVFRHQIINVY  612

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYES A FWPDVHGRII AL+ SQV  +GL+STK AAQS PFL+VLP+LT  FH +CK
Sbjct  613   NQEYESGARFWPDVHGRIISALMISQVLLMGLMSTKGAAQSTPFLLVLPILTFFFHRFCK  672

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNE-DEYDYDGIS--  683
             GRYE AF +HPL+EA +KDTLE+AR+P FNLKPYLQ AYIHPVF+ +  ++  +D IS  
Sbjct  673   GRYEPAFLRHPLKEAMVKDTLEKARDPYFNLKPYLQKAYIHPVFRDDHFEDSRFDEISSY  732

Query  682   --EKADEENVLVQTKRQSRKNT  623
               E +DE+ V V TKRQSRKNT
Sbjct  733   RAEDSDEDCVTVPTKRQSRKNT  754



>ref|XP_010539247.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Tarenaya 
hassleriana]
 ref|XP_010539248.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Tarenaya 
hassleriana]
Length=771

 Score =   368 bits (945),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 189/257 (74%), Positives = 213/257 (83%), Gaps = 11/257 (4%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW GIAGE+L LK LI+FHLKN+FLVKTEK
Sbjct  505   IGVAIPM-----------KATFFITYIMVDGWAGIAGEILMLKPLIIFHLKNTFLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EPRIQLYFLLGLVYA+VTP+LLPFIL+FF  AYVV+RHQIINVY
Sbjct  554   DREEAMDPGSIGFNTGEPRIQLYFLLGLVYASVTPMLLPFILIFFGLAYVVYRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYES AAFWPDVHGRII ALI SQ+  LGLL TKHAA SAPFLI LPVLT+ FH +CK
Sbjct  614   NQEYESGAAFWPDVHGRIIAALIISQLLLLGLLGTKHAAMSAPFLIALPVLTLGFHRFCK  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GR+E AF K+PLQEA MKDTLE+AREPN NLK YLQ+AYIHPVFKG+ED+ D D +  K 
Sbjct  674   GRFEPAFVKYPLQEAMMKDTLERAREPNLNLKGYLQNAYIHPVFKGDEDDDDIDDMFGKL  733

Query  673   DEENVLVQTKRQSRKNT  623
             ++E V V TKRQSR+NT
Sbjct  734   EDEAVTVPTKRQSRRNT  750



>ref|XP_010476146.1| PREDICTED: CSC1-like protein At1g11960 [Camelina sativa]
Length=772

 Score =   368 bits (945),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 181/262 (69%), Positives = 210/262 (80%), Gaps = 16/262 (6%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             +G+A P+           KATFFITYIMVDGW G+AGE+LRLK LI FH+KN FLVKTEK
Sbjct  504   VGVAIPI-----------KATFFITYIMVDGWAGVAGEILRLKPLIFFHIKNFFLVKTEK  552

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AMNPG + ++  EPRIQLYFLLGLVYA VTP+LLPFI+VFFA AY+VFRHQIINVY
Sbjct  553   DREEAMNPGQINYHATEPRIQLYFLLGLVYAPVTPVLLPFIIVFFALAYLVFRHQIINVY  612

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYES A FWPDVHGRII ALI SQV  +GLLSTK AAQS PFL+VLP+LT  FH +CK
Sbjct  613   NQEYESGARFWPDVHGRIIAALIISQVLLMGLLSTKGAAQSTPFLLVLPILTFFFHRFCK  672

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNE-DEYDYDGIS--  683
             GRYE AF +HPL++A +KDTLE+AREPNFNLKPYLQ AYIHPVF+ +  ++  +D IS  
Sbjct  673   GRYEPAFLRHPLKDAMVKDTLEKAREPNFNLKPYLQKAYIHPVFRDDHYEDSRFDDISSY  732

Query  682   --EKADEENVLVQTKRQSRKNT  623
               E +D+E V V TKRQSR NT
Sbjct  733   CVEDSDDECVTVPTKRQSRLNT  754



>ref|XP_010035539.1| PREDICTED: CSC1-like protein At3g21620 [Eucalyptus grandis]
 ref|XP_010035541.1| PREDICTED: CSC1-like protein At3g21620 [Eucalyptus grandis]
 gb|KCW46963.1| hypothetical protein EUGRSUZ_K00773 [Eucalyptus grandis]
Length=756

 Score =   368 bits (944),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 182/252 (72%), Positives = 204/252 (81%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+A E+LRLK  I++HLKNSFLVKTEKDRE+A
Sbjct  498   PKTIGVSIP---MKATFFITYIMVDGWAGVAAEILRLKPFIIYHLKNSFLVKTEKDREEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG+L FN  EP+IQLYFLLGLVYA VTPILLPFILVFF  AYVV+RHQIINVYNQEYE
Sbjct  555   MDPGTLGFNTGEPQIQLYFLLGLVYAVVTPILLPFILVFFGLAYVVYRHQIINVYNQEYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRIIFA+I SQ+  +GLLSTK AAQS P LI LPVLTI FHL+CKGRYE 
Sbjct  615   SAAAFWPDVHGRIIFAMIISQLLLMGLLSTKEAAQSTPLLITLPVLTIGFHLFCKGRYEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQEA MKDTLE+ REPN NLK +LQ AYIHPVFK  +D        E   EE V
Sbjct  675   AFRRYPLQEAMMKDTLEKVREPNLNLKGFLQTAYIHPVFKEGDDSDSDSATDEIV-EEPV  733

Query  658   LVQTKRQSRKNT  623
             LV TKR SR++T
Sbjct  734   LVPTKRHSRRST  745



>emb|CDP04437.1| unnamed protein product [Coffea canephora]
Length=768

 Score =   368 bits (944),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 185/257 (72%), Positives = 212/257 (82%), Gaps = 12/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW GIA E+LR++ LI+FHLKN F+VKTEK
Sbjct  501   IGVAIPM-----------KATFFITYIMVDGWAGIAAEILRVRPLIIFHLKNFFMVKTEK  549

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DR++AM+PGSL F+  EP+IQ YFLLGLVYA VTPILLPFILVFF  AYVVFRHQIINVY
Sbjct  550   DRDEAMDPGSLGFDTGEPQIQFYFLLGLVYAVVTPILLPFILVFFGLAYVVFRHQIINVY  609

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRII A++ SQ+  +GL+STKHAA S PFL+ LP+LTI+FHLYCK
Sbjct  610   NQEYESAAAFWPDVHGRIISAMVISQLLLMGLMSTKHAALSTPFLLALPILTISFHLYCK  669

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AF ++PLQEA MKDTLE+A+EPN NLK YLQ+AYIHPVFKG +D+ D D I EK 
Sbjct  670   GRYEPAFRRYPLQEAMMKDTLERAKEPNLNLKAYLQNAYIHPVFKGGDDDEDEDEIIEKL  729

Query  673   DEENVLVQTKRQSRKNT  623
              E  VLV TKRQSR+NT
Sbjct  730   -EATVLVPTKRQSRRNT  745



>ref|XP_006467388.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Citrus 
sinensis]
 gb|KDO78338.1| hypothetical protein CISIN_1g004125mg [Citrus sinensis]
Length=772

 Score =   368 bits (944),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 185/252 (73%), Positives = 204/252 (81%), Gaps = 5/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +GI+      KATFFITYIMVDGW GIAGE+L LK LI+FHLKN FLVKTEKDR +A
Sbjct  502   PKTIGIAIPK---KATFFITYIMVDGWAGIAGEILMLKPLIIFHLKNFFLVKTEKDRVEA  558

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGSL FN  EPRIQ YFLLGLVYA VTP+LLPFI+VFFA AYVVFRHQIINVYNQ YE
Sbjct  559   MDPGSLGFNSGEPRIQFYFLLGLVYATVTPLLLPFIIVFFALAYVVFRHQIINVYNQRYE  618

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVH RII ALI SQ+  +GLLSTK AA S PFLI LPVLTI FH + K RYES
Sbjct  619   SAAAFWPDVHRRIIAALIISQLLLMGLLSTKKAALSTPFLIALPVLTIWFHYFSKDRYES  678

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF K+PLQEA MKDTLE+AREPN NLK YL++AYIHPVFKG +D  D D +    + ENV
Sbjct  679   AFVKYPLQEAMMKDTLERAREPNLNLKGYLRNAYIHPVFKGEDD--DDDALFNNEENENV  736

Query  658   LVQTKRQSRKNT  623
             LV TKRQSR+NT
Sbjct  737   LVLTKRQSRRNT  748



>ref|XP_012080615.1| PREDICTED: CSC1-like protein At3g21620 [Jatropha curcas]
 gb|KDP30779.1| hypothetical protein JCGZ_13722 [Jatropha curcas]
Length=770

 Score =   368 bits (944),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 174/240 (73%), Positives = 208/240 (87%), Gaps = 1/240 (0%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             MKATFFITYIMVDGW G+AGE+LRLK LI++HLKN FLVKTEKDRE+AM+PG++ FN  E
Sbjct  507   MKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREEAMDPGTISFNTGE  566

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             P+IQLYFLLGLVYA V+PILLPFI++FF  AYVV+RHQIINVYNQ YESAAA+WPDVHGR
Sbjct  567   PQIQLYFLLGLVYAVVSPILLPFIIIFFGLAYVVYRHQIINVYNQAYESAAAYWPDVHGR  626

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             II AL+ SQ+  +GLLSTKHAAQS P L+ LPVLTI FHL+CKGRYE AF ++PLQEA M
Sbjct  627   IIVALVVSQLLLMGLLSTKHAAQSTPLLVTLPVLTIWFHLFCKGRYEPAFVRYPLQEAMM  686

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  623
             KDTLE+AREPN NLK + Q+AYIHPVF G +D  D++ ++E+ ++E VLV T+RQSR+NT
Sbjct  687   KDTLERAREPNLNLKSFFQNAYIHPVFNGGDDS-DHEEVTEELEKEPVLVPTRRQSRRNT  745



>ref|XP_010458617.1| PREDICTED: CSC1-like protein At1g11960 [Camelina sativa]
Length=772

 Score =   368 bits (944),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 180/262 (69%), Positives = 210/262 (80%), Gaps = 16/262 (6%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             +G+A P+           KATFFITYIMVDGW G+AGE+LRLK LI FH+KN FLVKTEK
Sbjct  504   VGVAIPI-----------KATFFITYIMVDGWAGVAGEILRLKPLIFFHIKNFFLVKTEK  552

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AMNPG + ++  EPRIQLYFLLGLVYA VTP+LLPFI+VFFA AY+VFRHQIINVY
Sbjct  553   DREEAMNPGQINYHATEPRIQLYFLLGLVYAPVTPVLLPFIIVFFALAYLVFRHQIINVY  612

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYES A FWPDVHGRII ALI SQV  +GLLSTK AAQS PFL+VLP+LT  FH +CK
Sbjct  613   NQEYESGARFWPDVHGRIISALIISQVLLMGLLSTKGAAQSTPFLLVLPILTFFFHRFCK  672

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNE-DEYDYDGIS--  683
             GRYE AF +HPL++A +KDTLE+AREPNFNLKPYLQ AYIHPVF+ +  ++  +D +S  
Sbjct  673   GRYEPAFLRHPLKDAMVKDTLEKAREPNFNLKPYLQKAYIHPVFRDDHYEDSRFDDMSSY  732

Query  682   --EKADEENVLVQTKRQSRKNT  623
               E +D+E V V TKRQSR NT
Sbjct  733   CVEDSDDECVTVPTKRQSRLNT  754



>ref|XP_004491137.1| PREDICTED: uncharacterized protein RSN1-like [Cicer arietinum]
Length=766

 Score =   367 bits (943),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 176/252 (70%), Positives = 205/252 (81%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G AGE+LRLK LI +HLKN  LVKTEKDRE+A
Sbjct  498   PKTIGVSIP---MKATFFITYIMVDGWAGCAGEILRLKPLIFYHLKNFLLVKTEKDREEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG+  FN  EP+IQLYFLLGLVYA VTP LLP+I+VFF  AYVV+RHQIINVYNQEYE
Sbjct  555   MDPGTFGFNTGEPQIQLYFLLGLVYAVVTPFLLPYIVVFFGLAYVVYRHQIINVYNQEYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SA AFWPDVHGRI+FAL+ SQ+  +GLLSTK AA S P LI LP+LTI FH +CKG YE 
Sbjct  615   SAGAFWPDVHGRIVFALVISQLLLMGLLSTKKAANSTPLLITLPILTIWFHRFCKGSYEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF  HPLQEA +KDTLE+ +EPNFNLK +LQ+AYIHPVF G+ED  D D +S++ ++E V
Sbjct  675   AFITHPLQEAMVKDTLERTKEPNFNLKEFLQNAYIHPVFNGDEDT-DSDVMSKEWEQEPV  733

Query  658   LVQTKRQSRKNT  623
              VQTKRQSR+NT
Sbjct  734   TVQTKRQSRRNT  745



>gb|KJB57786.1| hypothetical protein B456_009G181100 [Gossypium raimondii]
 gb|KJB57787.1| hypothetical protein B456_009G181100 [Gossypium raimondii]
Length=770

 Score =   367 bits (943),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 182/257 (71%), Positives = 210/257 (82%), Gaps = 13/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           +ATFFITYIMVDGW GIA E+L LK LI++HLKN+FLVKTEK
Sbjct  503   IGVAVPM-----------RATFFITYIMVDGWAGIAAEILMLKPLIIYHLKNTFLVKTEK  551

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AMNPGSL FN  EPRIQLYFLLG+VYA VTP+LLPFILVFF  AYVVFRHQIINVY
Sbjct  552   DREEAMNPGSLSFNVGEPRIQLYFLLGMVYATVTPVLLPFILVFFGLAYVVFRHQIINVY  611

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRII AL+ S V+ +GLLSTKH AQ+AP LI L V+TI F+ +CK
Sbjct  612   NQEYESAAAFWPDVHGRIIIALLVSHVALIGLLSTKHLAQAAPLLITLAVVTIWFYRFCK  671

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
              RYE AF ++PLQEA MKDTLE+AR+ NFNLKPYLQ+AYIHPVFK  ED+ + + +  K 
Sbjct  672   ARYEPAFVRYPLQEAVMKDTLERARDSNFNLKPYLQNAYIHPVFKEEEDDEEEEVV--KL  729

Query  673   DEENVLVQTKRQSRKNT  623
             + E+VLV TKRQSR+NT
Sbjct  730   ENESVLVPTKRQSRRNT  746



>ref|XP_008224710.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Prunus 
mume]
Length=773

 Score =   367 bits (943),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 178/257 (69%), Positives = 206/257 (80%), Gaps = 12/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFF+TYIMVDGW GIA E+L LK LI+FHLKN FLVKT+K
Sbjct  505   IGVAIPM-----------KATFFVTYIMVDGWAGIAAEILMLKPLIIFHLKNFFLVKTDK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EPRIQLYFLLGLVYA VTP LLPFI++FF  AYVVFRHQIINVY
Sbjct  554   DREEAMDPGSIGFNTGEPRIQLYFLLGLVYATVTPALLPFIIIFFGLAYVVFRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGR++ ALI SQ+   GLLSTK AAQS PFLI LPVLTI F+ YCK
Sbjct  614   NQEYESAAAFWPDVHGRVVSALIISQLLLFGLLSTKEAAQSTPFLIALPVLTIWFYRYCK  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GR+E AF  +PLQEA MKDTLE+A+EPN NLK YLQ AY+HPVF+  +D+ D + I +K 
Sbjct  674   GRFEPAFVTYPLQEAMMKDTLERAKEPNLNLKGYLQSAYVHPVFRDCDDDEDNESI-DKG  732

Query  673   DEENVLVQTKRQSRKNT  623
             + E+V+V TKR SR+NT
Sbjct  733   ENESVIVPTKRHSRRNT  749



>ref|XP_004232686.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
 ref|XP_010316569.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
 ref|XP_010316570.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
Length=767

 Score =   367 bits (941),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 192/257 (75%), Positives = 217/257 (84%), Gaps = 12/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KA+FFITYIMVDGW GIAGE+LRLK LI +HLKN FLVKTEK
Sbjct  501   IGVAVPM-----------KASFFITYIMVDGWAGIAGEILRLKPLIFYHLKNFFLVKTEK  549

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EP+IQLYFLLGLVYA VTP LLPFILVFF  AYVV+RHQIINVY
Sbjct  550   DREEAMDPGSVGFNTGEPQIQLYFLLGLVYAVVTPFLLPFILVFFGLAYVVYRHQIINVY  609

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRIIFAL FSQ+S LGLLSTKHA QSAPFLI LPVLTI+FHLYCK
Sbjct  610   NQEYESAAAFWPDVHGRIIFALCFSQLSLLGLLSTKHATQSAPFLIALPVLTISFHLYCK  669

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AFTK+P+QEA+M+DTLEQAREPN NLK YLQ+AY+HPVFK ++++ D D +  K 
Sbjct  670   GRYEPAFTKYPIQEARMRDTLEQAREPNLNLKGYLQNAYVHPVFKDDDEDEDEDFMM-KL  728

Query  673   DEENVLVQTKRQSRKNT  623
             + ++VLV TKRQSR NT
Sbjct  729   ENDSVLVPTKRQSRMNT  745



>emb|CDY30043.1| BnaC05g09770D [Brassica napus]
Length=768

 Score =   367 bits (941),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 185/264 (70%), Positives = 207/264 (78%), Gaps = 21/264 (8%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             +G+A P+           KATFFITYIMVDGW G+AGE+LRLK LI FH+KN FLVKTEK
Sbjct  504   VGVAIPI-----------KATFFITYIMVDGWAGVAGEILRLKPLIFFHVKNFFLVKTEK  552

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AMNPG + F+  EPRIQLYFLLGLVYA VTP+LLPFI++FFA AY+VFRHQIINVY
Sbjct  553   DREEAMNPGQINFHATEPRIQLYFLLGLVYAPVTPVLLPFIIIFFALAYLVFRHQIINVY  612

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESA  FWPDVHGRII ALI SQV  LGL+STK AAQS PFL+ LPVLT  FH +CK
Sbjct  613   NQEYESAGRFWPDVHGRIISALIISQVLLLGLMSTKGAAQSTPFLVALPVLTFFFHRFCK  672

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISE--  680
             GRYE AF +HPLQEA +KDTLEQAREPNFNLKPYL+ AYIHPVFK  +DEY+ D  SE  
Sbjct  673   GRYEPAFLRHPLQEAMIKDTLEQAREPNFNLKPYLKKAYIHPVFK--DDEYE-DVRSEVS  729

Query  679   -----KADEENVLVQTKRQSRKNT  623
                    D+E V V TKRQSR  T
Sbjct  730   GYYLGDTDDECVTVPTKRQSRITT  753



>ref|XP_002872689.1| hypothetical protein ARALYDRAFT_911697 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48948.1| hypothetical protein ARALYDRAFT_911697 [Arabidopsis lyrata subsp. 
lyrata]
Length=771

 Score =   367 bits (941),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 181/257 (70%), Positives = 208/257 (81%), Gaps = 13/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW G+AGE+L LK LI++HLKN+ LVKTEK
Sbjct  506   IGMAIPM-----------KATFFITYIMVDGWAGVAGEILMLKPLIIYHLKNALLVKTEK  554

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AMNPGS+ FN  EP+IQLYFLLGLVYA VTP+LLPFIL+FFA AYVV+RHQIINVY
Sbjct  555   DREEAMNPGSIGFNTGEPQIQLYFLLGLVYAPVTPMLLPFILIFFALAYVVYRHQIINVY  614

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGR+I ALI SQ+  +GLL TKHAA +APFLI LPV+TI FH +CK
Sbjct  615   NQEYESAAAFWPDVHGRVITALIISQLLLMGLLGTKHAAFAAPFLIALPVITIGFHRFCK  674

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AF ++PLQEA MKDTLE+AREPN NLK YLQDAYIHPVFK    + D   +  K 
Sbjct  675   GRYEPAFIRYPLQEAMMKDTLERAREPNLNLKGYLQDAYIHPVFK--GGDDDDGDMIGKL  732

Query  673   DEENVLVQTKRQSRKNT  623
             + E ++V TKRQSR+NT
Sbjct  733   ENEVIIVPTKRQSRRNT  749



>emb|CDY27443.1| BnaC03g64830D [Brassica napus]
Length=775

 Score =   367 bits (942),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 185/261 (71%), Positives = 212/261 (81%), Gaps = 15/261 (6%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW G+A E+L LK LI+FHLKN+FLVKTEK
Sbjct  505   IGVAIPM-----------KATFFITYIMVDGWAGVAAEILMLKPLIMFHLKNTFLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EPRIQLYFLLGLVYA VTP+LLPFIL+FFA AY+V+RHQIINVY
Sbjct  554   DREEAMDPGSIGFNTGEPRIQLYFLLGLVYAPVTPMLLPFILIFFALAYIVYRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGR+I AL+ SQV  +GLL TKHAA +APFLI LPVLTI FH +CK
Sbjct  614   NQEYESAAAFWPDVHGRVIAALMISQVLLMGLLGTKHAALAAPFLIALPVLTIGFHRFCK  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISE--  680
             GRYE AF ++PLQEAKMKDTLE AREPN NLK YLQ AY+HPVFKG ED+ D D   +  
Sbjct  674   GRYEPAFVRYPLQEAKMKDTLESAREPNLNLKGYLQSAYVHPVFKGGEDDDDDDDYGDDK  733

Query  679   --KADEENVLVQTKRQSRKNT  623
               K ++E ++V TKRQSR+NT
Sbjct  734   LGKFEDEAIIVPTKRQSRRNT  754



>ref|XP_011046979.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Populus euphratica]
 ref|XP_011046980.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Populus euphratica]
 ref|XP_011046981.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Populus euphratica]
Length=775

 Score =   366 bits (940),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 177/260 (68%), Positives = 210/260 (81%), Gaps = 14/260 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW GIAGEVL LK LI++HLKN FLVKTEK
Sbjct  505   IGVAIPM-----------KATFFITYIMVDGWAGIAGEVLMLKPLIIYHLKNFFLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DR++AM+ GSL FN  EPRIQLYFLLGLVYA VTPILLPFI++FF FAYVV+RHQIINVY
Sbjct  554   DRKEAMDAGSLGFNTGEPRIQLYFLLGLVYAPVTPILLPFIVMFFGFAYVVYRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYES AAFWP VHGR+I AL+ +Q+  +GLLSTK A+ S PFLI LPVLTI FH++C 
Sbjct  614   NQEYESGAAFWPAVHGRVITALVIAQLLMMGLLSTKQASSSTPFLIALPVLTIWFHVFCN  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD---GIS  683
             GRY+SAF K+PLQEA MKD+LE+A  PNFN K YL+ AY+HPVFKGN ++ DY+     +
Sbjct  674   GRYKSAFVKYPLQEAMMKDSLERASSPNFNFKSYLEKAYVHPVFKGNGNDDDYEQYLSEN  733

Query  682   EKADEENVLVQTKRQSRKNT  623
             ++AD ENVLV T+RQS++N+
Sbjct  734   QEADAENVLVPTRRQSQRNS  753



>ref|XP_003616997.1| Transmembrane protein [Medicago truncatula]
 gb|AES99955.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=766

 Score =   366 bits (940),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 176/252 (70%), Positives = 204/252 (81%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G AGE+LRLK LI +HLKN  LVKTEKDRE+A
Sbjct  498   PKTIGVSIP---MKATFFITYIMVDGWAGCAGEILRLKPLIFYHLKNFLLVKTEKDREEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG++ FN  EP+IQLYFLLGLVY+ VTP LLP+I+VFF  AY+V+RHQIINVYNQEYE
Sbjct  555   MDPGTIGFNTGEPQIQLYFLLGLVYSVVTPFLLPYIIVFFGLAYLVYRHQIINVYNQEYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SA AFWPDVHGRI+FAL+ SQ+  +GLLSTK AA S P LI LPVLTI FH +CKG YE 
Sbjct  615   SAGAFWPDVHGRIVFALVVSQLLLMGLLSTKEAANSTPLLIALPVLTIWFHRFCKGSYEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AFT HPLQEA +KDTLE+ +EPNFNLK +L DAYIHPVF  + D  D D +S++  EE V
Sbjct  675   AFTTHPLQEAMVKDTLERTKEPNFNLKDFLHDAYIHPVFNDDGDT-DSDVMSQEWKEEPV  733

Query  658   LVQTKRQSRKNT  623
             +VQTKRQSRKNT
Sbjct  734   IVQTKRQSRKNT  745



>gb|EMS56194.1| Uncharacterized membrane protein C2G11.09 [Triticum urartu]
Length=612

 Score =   361 bits (927),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 177/257 (69%), Positives = 206/257 (80%), Gaps = 12/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITY+MVDGW G+AGE+LRLK L++FHLKN FLVKTEK
Sbjct  345   IGVAIPM-----------KATFFITYVMVDGWAGVAGEILRLKPLVIFHLKNFFLVKTEK  393

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DR++AM+PGS+ F+ NEP+IQLYFLLGLVYA VTP LLPFILVF+  AYVV+RHQIINVY
Sbjct  394   DRDEAMDPGSIGFDSNEPQIQLYFLLGLVYAVVTPFLLPFILVFYVLAYVVYRHQIINVY  453

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWP VHGRII ALI SQ+  LGLLSTK A QS P L+VLPV+T  FH YCK
Sbjct  454   NQEYESAAAFWPSVHGRIITALIVSQLLFLGLLSTKGAGQSTPVLLVLPVVTFYFHKYCK  513

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
              RYE AF ++PLQEA  KDTLE+AREP F+LK YL  AYIHPVFKG++D+  +  + E A
Sbjct  514   NRYEPAFVEYPLQEAMRKDTLERAREPGFDLKTYLASAYIHPVFKGDDDDEKFSMMDE-A  572

Query  673   DEENVLVQTKRQSRKNT  623
             + + VLV TKRQSR+NT
Sbjct  573   EADQVLVATKRQSRRNT  589



>ref|XP_009134294.1| PREDICTED: CSC1-like protein At4g04340 [Brassica rapa]
 ref|XP_009134295.1| PREDICTED: CSC1-like protein At4g04340 [Brassica rapa]
 ref|XP_009134297.1| PREDICTED: CSC1-like protein At4g04340 [Brassica rapa]
Length=768

 Score =   365 bits (938),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 180/257 (70%), Positives = 211/257 (82%), Gaps = 11/257 (4%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW GIAGE+L LK LI++HLKN+FLVKTEK
Sbjct  501   IGVAIPM-----------KATFFITYIMVDGWAGIAGEILMLKPLIIYHLKNAFLVKTEK  549

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EP+IQLYFLLGLVYA VTP+LLPFILVFFA AY+V+RHQIINVY
Sbjct  550   DREEAMDPGSIGFNTGEPQIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVY  609

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRII AL+ SQ+  +GLL TK AA +APF+I LPV+TI FH +CK
Sbjct  610   NQEYESAAAFWPDVHGRIITALVISQLLLMGLLVTKRAALAAPFIIALPVITIGFHRFCK  669

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AF ++PLQEA MKDTLE+A+EPN NLK YLQ+AYIHPVFKG + + D D +  K 
Sbjct  670   GRYEPAFVRYPLQEAMMKDTLERAKEPNLNLKGYLQEAYIHPVFKGGDGDDDDDSVLGKL  729

Query  673   DEENVLVQTKRQSRKNT  623
             + E ++V TKRQSR+NT
Sbjct  730   EGEVIIVPTKRQSRRNT  746



>emb|CDX90856.1| BnaA03g25360D [Brassica napus]
Length=768

 Score =   365 bits (938),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 180/257 (70%), Positives = 211/257 (82%), Gaps = 11/257 (4%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW GIAGE+L LK LI++HLKN+FLVKTEK
Sbjct  501   IGVAIPM-----------KATFFITYIMVDGWAGIAGEILMLKPLIIYHLKNAFLVKTEK  549

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EP+IQLYFLLGLVYA VTP+LLPFILVFFA AY+V+RHQIINVY
Sbjct  550   DREEAMDPGSIGFNTGEPQIQLYFLLGLVYAPVTPMLLPFILVFFALAYIVYRHQIINVY  609

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRII AL+ SQ+  +GLL TK AA +APF+I LPV+TI FH +CK
Sbjct  610   NQEYESAAAFWPDVHGRIITALVISQLLLMGLLVTKRAALAAPFIIALPVITIGFHRFCK  669

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AF ++PLQEA MKDTLE+A+EPN NLK YLQ+AYIHPVFKG + + D D +  K 
Sbjct  670   GRYEPAFVRYPLQEAMMKDTLERAKEPNLNLKGYLQEAYIHPVFKGGDGDDDDDSVLGKL  729

Query  673   DEENVLVQTKRQSRKNT  623
             + E ++V TKRQSR+NT
Sbjct  730   EGEVIIVPTKRQSRRNT  746



>ref|XP_009357605.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Pyrus 
x bretschneideri]
Length=771

 Score =   365 bits (938),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 181/257 (70%), Positives = 206/257 (80%), Gaps = 13/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW GIA E+L LK LI++HLKN FLVKT+K
Sbjct  505   IGVAIPM-----------KATFFITYIMVDGWAGIAAEILMLKPLIIYHLKNFFLVKTDK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EP+IQLYFLLGLVYA VTP LLPFI++FF  AYVVFRHQIINVY
Sbjct  554   DREEAMDPGSIGFNTGEPQIQLYFLLGLVYATVTPTLLPFIIIFFGLAYVVFRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRII ALI SQ+   GLLSTK AA S PFLI LPVLT+ F  YCK
Sbjct  614   NQEYESAAAFWPDVHGRIITALIISQLLLFGLLSTKKAASSTPFLIALPVLTLWFRSYCK  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GR+E AFT +PLQEA MKDTLE+AREPN NLK YLQ AYIHPVF+  ++E D++   EK 
Sbjct  674   GRFEPAFTTYPLQEAMMKDTLERAREPNLNLKGYLQSAYIHPVFQECDEEEDHE--FEKD  731

Query  673   DEENVLVQTKRQSRKNT  623
             + E+V+V TKRQSR+NT
Sbjct  732   ESESVIVPTKRQSRRNT  748



>ref|XP_007026161.1| ERD (early-responsive to dehydration stress) family protein isoform 
1 [Theobroma cacao]
 gb|EOY28783.1| ERD (early-responsive to dehydration stress) family protein isoform 
1 [Theobroma cacao]
Length=771

 Score =   365 bits (936),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 181/257 (70%), Positives = 208/257 (81%), Gaps = 12/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           +ATFFITYIMVDGW GIA E+L LK LI++HLKN FLVKTEK
Sbjct  503   IGVAVPM-----------RATFFITYIMVDGWAGIAAEILMLKPLIIYHLKNFFLVKTEK  551

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGSL FN  EPRIQLYFLLG+VYA +TP+LLPFI+VFF  AYVVFRHQIINVY
Sbjct  552   DREEAMDPGSLGFNTGEPRIQLYFLLGMVYATITPVLLPFIIVFFGLAYVVFRHQIINVY  611

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRII AL+ SQ++ +GLLST  AAQS PFLI L VLTI F+ +CK
Sbjct  612   NQEYESAAAFWPDVHGRIIIALLISQITLIGLLSTMQAAQSTPFLIALAVLTIWFYRFCK  671

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
              RYE AF ++PLQEA MKDTLE+AREPN NLKPYL +AY+HPVFK  ED+ D D    K+
Sbjct  672   ARYEPAFVRYPLQEAMMKDTLERAREPNLNLKPYLHNAYVHPVFK-EEDDDDGDDFMFKS  730

Query  673   DEENVLVQTKRQSRKNT  623
             + E+VLV TKRQSR+NT
Sbjct  731   ENESVLVPTKRQSRRNT  747



>emb|CDY19541.1| BnaC09g13620D [Brassica napus]
Length=779

 Score =   365 bits (936),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 176/259 (68%), Positives = 211/259 (81%), Gaps = 13/259 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             +G+A P+           KATFFITYIMVDGW G+AGE+LRLK  ++FHLKN FLVKTEK
Sbjct  504   VGVAIPI-----------KATFFITYIMVDGWAGVAGEILRLKPFVIFHLKNFFLVKTEK  552

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PG + F   EPRIQLYFLLGLVYA VTP+LLPFI+ FF FAY++FRHQIINVY
Sbjct  553   DREEAMDPGQIDFYATEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYLIFRHQIINVY  612

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAA+WPDVHGRII ALI SQ+  +GL+STK  AQS PFL++LP+LTI FH +CK
Sbjct  613   NQEYESAAAYWPDVHGRIISALIISQILLIGLMSTKGKAQSTPFLVILPILTIGFHRFCK  672

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYD-YDGISEK  677
             GRYESAF  +PLQE+ +KDTLE+AREPN NLK +LQ+AYIHPVFK  E E D Y+ ++E 
Sbjct  673   GRYESAFVVNPLQESMIKDTLERAREPNLNLKGFLQNAYIHPVFKDEECEDDQYEELNED  732

Query  676   ADEEN-VLVQTKRQSRKNT  623
             +D+EN V+V TKRQSR+ T
Sbjct  733   SDDENCVVVPTKRQSRRTT  751



>ref|XP_004507664.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Cicer 
arietinum]
Length=773

 Score =   364 bits (935),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 172/241 (71%), Positives = 203/241 (84%), Gaps = 1/241 (0%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             +KA+FFITYIMVDGW+GIA EVL LK LI++HLKN FLVKTEKDRE+AM+PGS+ FN  E
Sbjct  509   LKASFFITYIMVDGWSGIAAEVLMLKPLIIYHLKNFFLVKTEKDREEAMDPGSIGFNTGE  568

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             PRIQLYFLLGLVYAAVTP +LPFI++FF  AYVVFRHQ+INVYNQ+YESAAAFWPDVH R
Sbjct  569   PRIQLYFLLGLVYAAVTPTVLPFIIIFFGLAYVVFRHQMINVYNQQYESAAAFWPDVHVR  628

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             ++ ALI SQ+  +GLL+TK AA S PFLIVLP+LTI FH YCKGR+ESAF K+PLQEA M
Sbjct  629   VVIALIVSQLVLMGLLTTKKAASSTPFLIVLPILTIWFHRYCKGRFESAFVKYPLQEAMM  688

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYD-YDGISEKADEENVLVQTKRQSRKN  626
             KDTLE+A +PN N+K YLQ AY+HPVFK ++D+ D  D IS K + E+  V TKR SR+N
Sbjct  689   KDTLEKATDPNLNIKGYLQHAYVHPVFKASQDDVDEEDAISLKWETESATVPTKRHSRRN  748

Query  625   T  623
             T
Sbjct  749   T  749



>ref|XP_002457968.1| hypothetical protein SORBIDRAFT_03g023990 [Sorghum bicolor]
 gb|EES03088.1| hypothetical protein SORBIDRAFT_03g023990 [Sorghum bicolor]
Length=768

 Score =   364 bits (934),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 175/240 (73%), Positives = 201/240 (84%), Gaps = 1/240 (0%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             MKATFFITY MVDGW G+AGE+LRLK L++FHLKN FLVKTEKDRE+AM+PGS+ F+ +E
Sbjct  507   MKATFFITYTMVDGWAGVAGEILRLKPLVIFHLKNFFLVKTEKDREEAMDPGSIGFDSSE  566

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             P+IQLYFLLGLVYAAVTP LLPF+L+FF FAYVV+RHQIINVYNQEYESAAAFWP VHGR
Sbjct  567   PQIQLYFLLGLVYAAVTPFLLPFVLIFFGFAYVVYRHQIINVYNQEYESAAAFWPSVHGR  626

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             II ALI SQ   LGLLSTK A QS P L+VLPV+T  FH YCK RYE  F K PLQEA  
Sbjct  627   IITALIVSQFLLLGLLSTKGAGQSTPVLLVLPVVTFYFHKYCKNRYEPTFVKCPLQEAMK  686

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  623
             KDTLE+AREP F+LK YL +AYIHPVFKG+ED+  +  I+++ + E VLV TKRQSR+NT
Sbjct  687   KDTLERAREPGFDLKGYLMNAYIHPVFKGDEDDEKF-SIADEPETEQVLVATKRQSRRNT  745



>gb|KHG22816.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=649

 Score =   360 bits (925),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 173/240 (72%), Positives = 202/240 (84%), Gaps = 1/240 (0%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             MKATFFITYIMVDGW G+A E+LRLK LI++HLKN FLVKTEKDRE+AM+PG++ FN  E
Sbjct  388   MKATFFITYIMVDGWAGVAAEILRLKPLIIYHLKNFFLVKTEKDREEAMDPGTIGFNTGE  447

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             P+IQLYFLLGLVYA VTPILLPFI+VFFA A+VVFRHQIINVYNQEYESAAA+WPDVH R
Sbjct  448   PQIQLYFLLGLVYAIVTPILLPFIIVFFALAFVVFRHQIINVYNQEYESAAAYWPDVHLR  507

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             II ALI SQ+  +GLLSTK AA S P LI LPVLTI FH +CKGRYE AF ++PLQEA M
Sbjct  508   IIVALIVSQLLLMGLLSTKEAASSTPLLITLPVLTIWFHRFCKGRYEPAFVRNPLQEAMM  567

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  623
             KDTLE+AREPN NLK +LQ+AYIHPVFK  +D+   D + E+ +EE  L+ TKR S+++T
Sbjct  568   KDTLERAREPNLNLKGFLQNAYIHPVFKSADDD-KIDVVMEEWEEEPSLIATKRTSKRST  626



>ref|XP_010089460.1| Uncharacterized membrane protein [Morus notabilis]
 gb|EXB37853.1| Uncharacterized membrane protein [Morus notabilis]
Length=779

 Score =   364 bits (934),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 181/265 (68%), Positives = 206/265 (78%), Gaps = 17/265 (6%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITY MVDGW G+AGE+LRLK LI++H KN FLVKTEKDRE+A
Sbjct  498   PETIGVSIP---MKATFFITYTMVDGWAGVAGEILRLKPLIIYHFKNFFLVKTEKDREEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGSL FN  EP+IQLYFLLGLVYA VTP+LLPFI+VFFA AYVV+RHQIINVYNQEYE
Sbjct  555   MDPGSLGFNTGEPQIQLYFLLGLVYAVVTPVLLPFIIVFFALAYVVYRHQIINVYNQEYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVH RII AL+ SQ+  +GLLSTK A QS P LI LPVLTI FH +CKGRYE 
Sbjct  615   SAAAFWPDVHRRIITALVVSQLLLMGLLSTKEATQSTPLLITLPVLTIWFHFFCKGRYEP  674

Query  838   AFTKHPL-------------QEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYD  698
             AF  +PL             QEA MKDTLE+AREPN NLK +LQ+AY+HPVFKG ED+ D
Sbjct  675   AFVTYPLQLFLLFVSSSAGSQEAMMKDTLERAREPNLNLKGFLQNAYVHPVFKG-EDDSD  733

Query  697   YDGISEKADEENVLVQTKRQSRKNT  623
              D  +E   EE  +V TKRQSR+NT
Sbjct  734   SDAATEDLKEEPAIVPTKRQSRRNT  758



>ref|XP_009418442.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
Length=768

 Score =   363 bits (933),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 182/252 (72%), Positives = 207/252 (82%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFF+TYIMVDGW GIAGE+LRLK LI++HLKN FLVKTEKDRE+A
Sbjct  499   PEKIGVSIP---MKATFFVTYIMVDGWAGIAGEILRLKPLIIYHLKNFFLVKTEKDREEA  555

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGS+ F  +EP+IQLYFLLGLVYA VTP LLPFIL+FF  AYVVFRHQIINVYNQEYE
Sbjct  556   MDPGSIEFATSEPQIQLYFLLGLVYATVTPFLLPFILIFFGLAYVVFRHQIINVYNQEYE  615

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRII AL+ SQ+  LGLLSTK AA S PFLI LP+LTI FH +CK RYES
Sbjct  616   SAAAFWPDVHGRIISALVISQLLLLGLLSTKKAADSTPFLIALPILTIWFHRFCKNRYES  675

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF K+P+QEA MKDTLE+AREPN +LK YL +AY+HPVFK  EDE D     E+ + ENV
Sbjct  676   AFVKYPIQEAMMKDTLERAREPNLDLKAYLSNAYVHPVFKDGEDE-DSVATDEEKEVENV  734

Query  658   LVQTKRQSRKNT  623
             LV TKR SR+NT
Sbjct  735   LVPTKRASRRNT  746



>ref|XP_010546606.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
 ref|XP_010546613.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
 ref|XP_010546622.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
 ref|XP_010546631.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana]
Length=776

 Score =   363 bits (933),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 174/258 (67%), Positives = 208/258 (81%), Gaps = 13/258 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             +G+A P+           KATFFITYIMVDGW G+AGE+LRLK LI++HLKN FLVKTEK
Sbjct  504   VGVAIPI-----------KATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEK  552

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AMNPG + F  +EPRIQLYFLLGLVYA VTP LLPFI++FF  A++VFRHQIINVY
Sbjct  553   DREEAMNPGQIDFYSSEPRIQLYFLLGLVYATVTPALLPFIIIFFGLAFLVFRHQIINVY  612

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYES AA+WPDVHGRII ALI SQ+  +GL+STK AAQS PFLI LP+LT+ FH +CK
Sbjct  613   NQEYESGAAYWPDVHGRIITALIISQILLMGLMSTKKAAQSTPFLIALPILTLGFHRFCK  672

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKG-NEDEYDYDGISEK  677
             GRYE AF ++PLQEA +KDTLE+AREPN +LKPYLQ AYIHPVFK   ED +D D + + 
Sbjct  673   GRYEPAFIRYPLQEAMIKDTLERAREPNLDLKPYLQKAYIHPVFKDEGEDRFD-DMLEKS  731

Query  676   ADEENVLVQTKRQSRKNT  623
              D++ ++V TKRQSR+ T
Sbjct  732   EDDKCLIVPTKRQSRRTT  749



>ref|XP_007049121.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
 gb|EOX93278.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
Length=768

 Score =   363 bits (932),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 176/252 (70%), Positives = 204/252 (81%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI++HLKN FLVKTEKDRE+A
Sbjct  498   PKTIGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG++ FN  EP+IQLYFLLGLVYA VTPILLPFI+VFF  AYVV+RHQIINVYNQEYE
Sbjct  555   MDPGTIGFNTGEPQIQLYFLLGLVYAVVTPILLPFIIVFFGLAYVVYRHQIINVYNQEYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S AAFWPDVH RII ALI SQ+  +GLLSTK AAQS P LI LPVLTI FH +CKGRYE 
Sbjct  615   SGAAFWPDVHARIIVALIVSQLLLMGLLSTKEAAQSTPLLITLPVLTIWFHRFCKGRYEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQEA MKDTLE+AREPN NLK +LQ AY HPVFK  +D  + D   E++++E  
Sbjct  675   AFVRYPLQEAMMKDTLERAREPNLNLKGFLQSAYTHPVFKSADDS-ESDITMEESEQEPA  733

Query  658   LVQTKRQSRKNT  623
             L+ TKR SR+ T
Sbjct  734   LIPTKRTSRRCT  745



>gb|KJB69238.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
 gb|KJB69240.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=610

 Score =   358 bits (919),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 182/257 (71%), Positives = 211/257 (82%), Gaps = 14/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A P+           +ATFFITYIMVDGW GIAGE+L LK LI++HLKN FLVKTEK
Sbjct  341   IGVAVPL-----------RATFFITYIMVDGWAGIAGEILMLKPLIIYHLKNFFLVKTEK  389

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGSL FN  EP+IQLYFLLGLVYAAVTP LLPFI++FF  AYVVFRHQIINVY
Sbjct  390   DREEAMDPGSLGFNTGEPQIQLYFLLGLVYAAVTPALLPFIVIFFGLAYVVFRHQIINVY  449

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRII AL+ SQV+ +GLL++K AAQS PFLI L VLTI F+ +CK
Sbjct  450   NQEYESAAAFWPDVHGRIIIALLISQVALIGLLTSKKAAQSTPFLIALVVLTIWFYTFCK  509

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
              RYE AF ++PLQEA MKDTLE+AREPN NLKPYLQ+AYIHPVFK  ++E ++D  SE  
Sbjct  510   ARYEPAFVRYPLQEAMMKDTLERAREPNLNLKPYLQNAYIHPVFKEEDEEDEFDFKSEN-  568

Query  673   DEENVLVQTKRQSRKNT  623
               E+VLV TKRQSR++T
Sbjct  569   --ESVLVPTKRQSRRST  583



>ref|XP_003549667.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X1 [Glycine max]
 ref|XP_006600300.1| PREDICTED: uncharacterized membrane protein C2G11.09 isoform 
X2 [Glycine max]
 gb|KHN03500.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=775

 Score =   363 bits (932),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 176/243 (72%), Positives = 205/243 (84%), Gaps = 4/243 (2%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             +KA+FFITYIMVDGW GIA EVL LK LI++HLKN FLVKTEKDRE+AM+PGS+ FN  E
Sbjct  509   LKASFFITYIMVDGWAGIAAEVLMLKPLIIYHLKNFFLVKTEKDREEAMDPGSIGFNTGE  568

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             PRIQLYFLLGLVYA+VTP +LPFI+VFF  AYVVFRHQIINVYNQEYES AAFWPDVH R
Sbjct  569   PRIQLYFLLGLVYASVTPTVLPFIIVFFGLAYVVFRHQIINVYNQEYESGAAFWPDVHFR  628

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             +I ALI SQ+  +GLL+TK AA S PFLIVLPVLTI FH+YCKGR+E AF ++PLQEA M
Sbjct  629   VIIALIVSQIVLMGLLTTKKAASSTPFLIVLPVLTIWFHIYCKGRFEPAFVRYPLQEAMM  688

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKG---NEDEYDYDGISEKADEENVLVQTKRQSR  632
             KDTLE+A +PNFNLK YLQ+AY+HPVFK    +EDE D + +S K + E++ V TKRQSR
Sbjct  689   KDTLERATDPNFNLKAYLQNAYVHPVFKASLFDEDE-DEEVMSLKLETESLTVPTKRQSR  747

Query  631   KNT  623
             +NT
Sbjct  748   RNT  750



>ref|XP_006383870.1| early-responsive to dehydration family protein [Populus trichocarpa]
 gb|ERP61667.1| early-responsive to dehydration family protein [Populus trichocarpa]
Length=775

 Score =   363 bits (931),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 176/260 (68%), Positives = 210/260 (81%), Gaps = 14/260 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW GIAGEVL LK LI++HLKN FLVKTEK
Sbjct  505   IGVAIPM-----------KATFFITYIMVDGWAGIAGEVLMLKPLIIYHLKNFFLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DR++AM+ GSL FN  EPRIQLYFLLGLVYA VTPILLPFI++FF FAYVV+RHQIINVY
Sbjct  554   DRKEAMDAGSLGFNTGEPRIQLYFLLGLVYAPVTPILLPFIVMFFGFAYVVYRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYES AAFWP VHGR+I AL+ +Q+  +GLLSTK A+ + PFLI LPVLTI FH++C 
Sbjct  614   NQEYESGAAFWPAVHGRVITALVIAQLLMMGLLSTKQASSTTPFLIALPVLTIWFHVFCN  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFK--GNEDEYD-YDGIS  683
             GRY+SAF K+PLQEA MKD+LE+A  PNFN + YL+ AY+HPVFK  GN+D+Y+ Y   +
Sbjct  674   GRYKSAFVKYPLQEAMMKDSLERASSPNFNFRSYLEKAYVHPVFKGDGNDDDYEQYLSEN  733

Query  682   EKADEENVLVQTKRQSRKNT  623
             ++AD ENVLV T+R SR+N+
Sbjct  734   QEADAENVLVPTRRHSRRNS  753



>ref|XP_003569164.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Brachypodium 
distachyon]
 ref|XP_010231890.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Brachypodium 
distachyon]
Length=768

 Score =   363 bits (931),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 176/257 (68%), Positives = 207/257 (81%), Gaps = 12/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITY+MVDGW G+AGE+LRLK L++FHLKN FLVKTEK
Sbjct  501   IGVAIPM-----------KATFFITYVMVDGWAGVAGEILRLKPLVIFHLKNFFLVKTEK  549

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ F+ NEP+IQLYFLLGLVYA VTP LLPFIL+FF  AYVV+RHQIINVY
Sbjct  550   DREEAMDPGSIGFDSNEPQIQLYFLLGLVYAVVTPFLLPFILIFFGLAYVVYRHQIINVY  609

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWP VHGRII ALI SQ+  LGLLSTK A QS P L+VLPV+T  FH YCK
Sbjct  610   NQEYESAAAFWPSVHGRIITALIISQLLFLGLLSTKGAGQSTPVLLVLPVVTFYFHKYCK  669

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
              RYE AF ++PLQEA  KDTLE+AREP F+LK YL  AYIHPVFKG++D+  +  ++++ 
Sbjct  670   NRYEPAFVEYPLQEAMRKDTLERAREPGFDLKTYLASAYIHPVFKGDDDDEKF-SMADEV  728

Query  673   DEENVLVQTKRQSRKNT  623
             + + VLV TKRQSR+NT
Sbjct  729   EADQVLVATKRQSRRNT  745



>ref|NP_001056508.1| Os05g0594700 [Oryza sativa Japonica Group]
 gb|AAV59379.1| putative early-responsive to dehydration stress protein (ERD4) 
[Oryza sativa Japonica Group]
 dbj|BAF18422.1| Os05g0594700 [Oryza sativa Japonica Group]
 gb|EAY99267.1| hypothetical protein OsI_21231 [Oryza sativa Indica Group]
 dbj|BAG93571.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AIU34629.1| hyperosmolality-gated Ca2+ permeable channel 1.2 [Oryza sativa]
Length=766

 Score =   362 bits (930),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 175/257 (68%), Positives = 206/257 (80%), Gaps = 12/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           +ATFFITY+MVDGWTG+AGE+LRL+ALI+FHLKN FLVKTEK
Sbjct  501   IGVAIPM-----------RATFFITYVMVDGWTGVAGEILRLRALIIFHLKNFFLVKTEK  549

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+CF++ EPRIQLYFLLGLVYA VTP+LLPFILVFF  AYVV+RHQIINVY
Sbjct  550   DREEAMDPGSICFDWCEPRIQLYFLLGLVYAVVTPLLLPFILVFFGLAYVVYRHQIINVY  609

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQ+YES A FWP VHGRII ALI SQ+  +GLLSTK   ++ P L+VLPVLT  F+ YCK
Sbjct  610   NQQYESGAQFWPSVHGRIIIALIVSQLLLIGLLSTKGFEETTPVLVVLPVLTFWFYKYCK  669

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
              R+E AF ++PLQEA  KDTLE+AREP F+LK YL +AY+HPVFKG E+E D   ISE  
Sbjct  670   NRFEPAFVRNPLQEAMRKDTLERAREPTFDLKAYLANAYLHPVFKGREEE-DNMSISEDV  728

Query  673   DEENVLVQTKRQSRKNT  623
               E V+V TKRQSR+NT
Sbjct  729   GMEEVIVPTKRQSRRNT  745



>ref|XP_006387597.1| hypothetical protein POPTR_0796s00210g [Populus trichocarpa]
 gb|ERP46511.1| hypothetical protein POPTR_0796s00210g [Populus trichocarpa]
Length=696

 Score =   360 bits (924),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 179/257 (70%), Positives = 209/257 (81%), Gaps = 13/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW GIAGEVL LK LI +HLKN  LVKTEK
Sbjct  430   IGVAVPM-----------KATFFITYIMVDGWAGIAGEVLMLKPLIFYHLKNFLLVKTEK  478

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGSL F+  EPRIQLYFLLGLVYA VTP+LLPFI++FFAFAY+VFRHQIINVY
Sbjct  479   DREEAMDPGSLGFHTGEPRIQLYFLLGLVYATVTPVLLPFIVIFFAFAYLVFRHQIINVY  538

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             N EYES AAFWPDVHGRII  L+ SQ++ +GLLSTK AAQS PFLI LPVLTI FH +C 
Sbjct  539   NHEYESGAAFWPDVHGRIITGLVISQLALMGLLSTKEAAQSTPFLIALPVLTIWFHRFCN  598

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GR++SAF K+PLQEA MKDTLE+AR+PNFNLK  L  AY+HP+FKG++D+ D   +S + 
Sbjct  599   GRHKSAFVKYPLQEAMMKDTLERARDPNFNLKACLHSAYVHPIFKGDDDDEDD--LSVEM  656

Query  673   DEENVLVQTKRQSRKNT  623
             + E+VLV TKRQS++NT
Sbjct  657   ETESVLVPTKRQSQRNT  673



>ref|XP_010548889.1| PREDICTED: CSC1-like protein At3g21620 [Tarenaya hassleriana]
Length=764

 Score =   362 bits (929),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 175/253 (69%), Positives = 204/253 (81%), Gaps = 4/253 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI++HLKN FLVKTEKDRE+A
Sbjct  501   PKTIGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREEA  557

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG++ FN  EP+IQLYFLLGLVYA V+PILLPFILVFF+ AYVV+RHQ+INVYNQEYE
Sbjct  558   MDPGTIGFNTGEPQIQLYFLLGLVYAVVSPILLPFILVFFSLAYVVYRHQVINVYNQEYE  617

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SA AFWPDVHGRII AL+ SQ+  +GLLSTK AAQS P LI LPVLTI FH++C+GRYE 
Sbjct  618   SAGAFWPDVHGRIIAALVVSQLLLMGLLSTKQAAQSTPLLITLPVLTIWFHVFCRGRYEP  677

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF K+PLQEA +KDTLE+ REPN NLK +L +AY HPVFK  E+E +  G+ E   E   
Sbjct  678   AFVKYPLQEAMIKDTLEKTREPNLNLKAFLGNAYAHPVFKAAENEREETGLEETRPERTP  737

Query  658   -LVQTKRQSRKNT  623
              LV TKR SR NT
Sbjct  738   ELVPTKRGSRMNT  750



>ref|XP_010496174.1| PREDICTED: protein OSCA1-like [Camelina sativa]
Length=772

 Score =   362 bits (929),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 174/240 (73%), Positives = 205/240 (85%), Gaps = 1/240 (0%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             MKATFFITYIM+DGW G+AGE+L LK LI+FHLKN+FLVKTEKDRE+AM+PGS+ FN  E
Sbjct  512   MKATFFITYIMIDGWAGVAGEILMLKPLIIFHLKNAFLVKTEKDREEAMDPGSIGFNTGE  571

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             P+IQLYFLLGLVYA VTP+LLP+ILVFF  AY+V+RHQIINVYNQEYESAAAFWPDVHGR
Sbjct  572   PQIQLYFLLGLVYAPVTPMLLPYILVFFGLAYIVYRHQIINVYNQEYESAAAFWPDVHGR  631

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             +I ALI SQ+  +GLL+TK AA +APFLI LPV+TI FH +CKGRYE AF ++PL+EA M
Sbjct  632   VISALIISQLLLMGLLATKRAALAAPFLIALPVITIGFHRFCKGRYEPAFIRYPLEEAMM  691

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  623
             KDTLE+AREPN NLK YLQDAYIHPVFK   D+ D   +  K ++E ++V TKRQSR+NT
Sbjct  692   KDTLERAREPNLNLKGYLQDAYIHPVFK-GGDDDDDSDVVGKLEDEVIIVPTKRQSRRNT  750



>ref|XP_010422263.1| PREDICTED: LOW QUALITY PROTEIN: protein OSCA1-like [Camelina 
sativa]
Length=772

 Score =   362 bits (929),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 174/240 (73%), Positives = 204/240 (85%), Gaps = 1/240 (0%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             MKATFFITYIM+DGW G+AGE+L LK LI+FHLKN+FLVKTEKDRE+AM+PGS+ FN  E
Sbjct  512   MKATFFITYIMIDGWAGVAGEILMLKPLIIFHLKNAFLVKTEKDREEAMDPGSIGFNTGE  571

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             P IQLYFLLGLVYA VTP+LLP+ILVFF  AY+V+RHQIINVYNQEYESAAAFWPDVHGR
Sbjct  572   PXIQLYFLLGLVYAPVTPMLLPYILVFFGLAYIVYRHQIINVYNQEYESAAAFWPDVHGR  631

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             +I ALI SQ+  +GLL+TK AA +APFLI LPV+TI FH +CKGRYE AF ++PL+EA M
Sbjct  632   VISALIISQLLLMGLLATKRAALAAPFLIALPVITIGFHRFCKGRYEPAFIRYPLEEAMM  691

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  623
             KDTLE+AREPN NLK YLQDAYIHPVFK   D+ D   +  K ++E ++V TKRQSR+NT
Sbjct  692   KDTLERAREPNLNLKGYLQDAYIHPVFK-GGDDDDDSDVVGKLEDEVIIVPTKRQSRRNT  750



>ref|XP_006644293.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X1 [Oryza brachyantha]
 ref|XP_006644294.1| PREDICTED: uncharacterized membrane protein YLR241W-like isoform 
X2 [Oryza brachyantha]
Length=769

 Score =   362 bits (928),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 178/257 (69%), Positives = 205/257 (80%), Gaps = 11/257 (4%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW G+AGE+LRLK LI+FHLKN FLVKTEK
Sbjct  501   IGVAIPM-----------KATFFITYIMVDGWAGVAGEILRLKPLIIFHLKNFFLVKTEK  549

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ F+ NEP+IQLYFLLGLVYA VTP LLPFILVFF FAYVV+RHQIINVY
Sbjct  550   DREEAMDPGSIGFDSNEPQIQLYFLLGLVYAVVTPFLLPFILVFFGFAYVVYRHQIINVY  609

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWP V+GRII ALI SQ   LGLLSTK A QS P L+VLPV+T  F+ YCK
Sbjct  610   NQEYESAAAFWPSVNGRIIVALIVSQFLLLGLLSTKGAGQSTPVLLVLPVVTFYFYKYCK  669

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
              RYE AF ++PLQEA  KDTLE+AREP  +LK YL +AY+HPVFKG  D+ +   +S++ 
Sbjct  670   NRYEPAFVEYPLQEAMRKDTLERAREPGLDLKAYLMNAYVHPVFKGGGDDDERFSMSDEP  729

Query  673   DEENVLVQTKRQSRKNT  623
             + E VLV TKRQSR+NT
Sbjct  730   EAEQVLVATKRQSRRNT  746



>ref|XP_006447608.1| hypothetical protein CICLE_v10014696mg [Citrus clementina]
 gb|ESR60848.1| hypothetical protein CICLE_v10014696mg [Citrus clementina]
Length=590

 Score =   356 bits (914),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 176/252 (70%), Positives = 204/252 (81%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +GIS     MKA FFITYIMVDGW G+AGE+LRLK LI++HLK  FLVKT  DRE+A
Sbjct  329   PKTIGISIP---MKAMFFITYIMVDGWAGVAGEILRLKPLIVYHLKIFFLVKTVNDREEA  385

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG++ FN  EP+IQLYFLLGLVYA V P LLPFI+VFFA A+VV+ HQ+INVYNQEYE
Sbjct  386   MDPGAIGFNTGEPQIQLYFLLGLVYAVVAPFLLPFIIVFFALAFVVYIHQVINVYNQEYE  445

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRII ALI SQ+  +GLLSTK AAQS P LI LP+LTI FH +CKGRYE 
Sbjct  446   SAAAFWPDVHGRIITALIVSQLLLMGLLSTKEAAQSTPLLITLPILTIWFHRFCKGRYEP  505

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQEA MKDTLE+AREPN NLK +LQ AYIHPVFK  + E + D  SE++D+E V
Sbjct  506   AFVRYPLQEAMMKDTLERAREPNLNLKSFLQIAYIHPVFKEVQ-ESESDPASEESDQEPV  564

Query  658   LVQTKRQSRKNT  623
             L+ TKRQSR NT
Sbjct  565   LIPTKRQSRMNT  576



>ref|XP_010686787.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010686788.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Beta 
vulgaris subsp. vulgaris]
Length=764

 Score =   361 bits (927),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 172/240 (72%), Positives = 201/240 (84%), Gaps = 3/240 (1%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             MKATFFITYIMVDGW G+AGE+LRLK LI++HLKN FLVKTEKDRE AM+ GS+ F+  E
Sbjct  507   MKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNWFLVKTEKDREAAMDAGSIGFDTGE  566

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             P+IQLY LLGLVYA VTPILLPFILVFF F+Y+V+RHQIINVYNQEYESAAAFWP VHGR
Sbjct  567   PQIQLYILLGLVYAVVTPILLPFILVFFGFSYLVYRHQIINVYNQEYESAAAFWPSVHGR  626

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             II A++FSQ+  +GL+ TK AA S+PFLI LP+LTI FH +CKGR+E AF  +PLQEA M
Sbjct  627   IISAMVFSQLLLMGLIGTKKAASSSPFLIALPILTIWFHRFCKGRFEPAFKTYPLQEAMM  686

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  623
             KDTLE+AR+PNFNLK YLQ+AYIHPVFK  +D+   D I  K + E  LV T+RQSR+NT
Sbjct  687   KDTLERARDPNFNLKGYLQNAYIHPVFKSEDDD---DIIQNKLEMETELVPTRRQSRRNT  743



>gb|KJB10672.1| hypothetical protein B456_001G215500 [Gossypium raimondii]
Length=608

 Score =   356 bits (914),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 174/252 (69%), Positives = 204/252 (81%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G S     MKATFFITYIMVDGW G+A E+LRLK LI++HLKN FLVKTEKDRE+A
Sbjct  338   PKTIGASIP---MKATFFITYIMVDGWAGVAAEILRLKPLIIYHLKNFFLVKTEKDREEA  394

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG++ FN  EP+IQLYFLLGLVYA VTPILLPF++VFFA AYVVFRHQIINVYNQEYE
Sbjct  395   MDPGTIGFNTGEPQIQLYFLLGLVYAIVTPILLPFVIVFFALAYVVFRHQIINVYNQEYE  454

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAA+WPDVH RII ALI SQ+  +GLLSTK AA S P LI LP+LTI FH +CKGRYE 
Sbjct  455   SAAAYWPDVHLRIIVALIVSQLLLMGLLSTKEAASSTPLLITLPILTIWFHRFCKGRYEP  514

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQEA MKDTLE+AREPN NLK +LQ+AYIHPVFK  + +   D   E+ +EE  
Sbjct  515   AFVRNPLQEAMMKDTLERAREPNLNLKGFLQNAYIHPVFKSADGD-KIDVAMEEWEEEPS  573

Query  658   LVQTKRQSRKNT  623
             L+ TKR S+++T
Sbjct  574   LIATKRTSKRST  585



>ref|XP_007217157.1| hypothetical protein PRUPE_ppa001757mg [Prunus persica]
 gb|EMJ18356.1| hypothetical protein PRUPE_ppa001757mg [Prunus persica]
Length=769

 Score =   361 bits (926),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 180/252 (71%), Positives = 210/252 (83%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI++HLKN  LVKTEKDRE+A
Sbjct  498   PKTIGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFLLVKTEKDREEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG+L FN  EP+IQLYFLLGLVYA V+PILLPFI+VFF  AYVV+RHQIINVYNQEYE
Sbjct  555   MDPGTLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIIVFFGLAYVVYRHQIINVYNQEYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRII ALI SQ+  +GLLSTK AAQS P LI LPVLTI FH +CKG YE 
Sbjct  615   SAAAFWPDVHGRIITALIVSQLLLMGLLSTKEAAQSTPLLITLPVLTIWFHRFCKGCYEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQEA MKDTLE+AREPN NLK +LQ+AYIHPVFKG ED+ + +  +E+ ++E  
Sbjct  675   AFIRYPLQEAMMKDTLERAREPNLNLKGFLQNAYIHPVFKG-EDDSENEAAAEECEKEPA  733

Query  658   LVQTKRQSRKNT  623
             +V TKRQSR+NT
Sbjct  734   VVPTKRQSRRNT  745



>ref|XP_006350470.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Solanum 
tuberosum]
Length=767

 Score =   360 bits (925),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 180/258 (70%), Positives = 212/258 (82%), Gaps = 12/258 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITY MVDGW GIAGE+LRLK LI+FHLKN FLVKTE+
Sbjct  501   IGVAIPM-----------KATFFITYTMVDGWAGIAGEILRLKPLIIFHLKNFFLVKTER  549

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE AM+ GSL FN  EP+IQLYFLLGLVYA VTP LLPFILVFFA AY VFRHQIINVY
Sbjct  550   DREKAMDAGSLDFNTGEPQIQLYFLLGLVYAIVTPFLLPFILVFFALAYFVFRHQIINVY  609

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             +Q+YES AAFWPDVHGRIIFAL+FSQ+S LGLLSTK AAQSAPFLI LPVLT++FH +CK
Sbjct  610   HQKYESGAAFWPDVHGRIIFALVFSQISLLGLLSTKRAAQSAPFLIALPVLTLSFHYFCK  669

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AFT++PLQEAK KDT+EQA+E   NLK YLQ+AY+HPVF+G++++ + + +++K 
Sbjct  670   GRYEPAFTRYPLQEAKRKDTIEQAKESKLNLKYYLQNAYLHPVFRGDDEDDNEEELNDKL  729

Query  673   DEEN-VLVQTKRQSRKNT  623
             +  + VL+  KRQSR NT
Sbjct  730   ESNDIVLIPMKRQSRGNT  747



>gb|KDO39720.1| hypothetical protein CISIN_1g048588mg [Citrus sinensis]
Length=615

 Score =   356 bits (914),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 176/252 (70%), Positives = 204/252 (81%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +GIS     MKA FFITYIMVDGW G+AGE+LRLK LI++HLK  FLVKT  DRE+A
Sbjct  322   PKTIGISIP---MKAMFFITYIMVDGWAGVAGEILRLKPLIVYHLKIFFLVKTVNDREEA  378

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG++ FN  EP+IQLYFLLGLVYA V P LLPFI+VFFA A+VV+ HQ+INVYNQEYE
Sbjct  379   MDPGAIGFNTGEPQIQLYFLLGLVYAVVAPFLLPFIIVFFALAFVVYIHQVINVYNQEYE  438

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRII ALI SQ+  +GLLSTK AAQS P LI LP+LTI FH +CKGRYE 
Sbjct  439   SAAAFWPDVHGRIITALIVSQLLLMGLLSTKEAAQSTPLLITLPILTIWFHRFCKGRYEP  498

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQEA MKDTLE+AREPN NLK +LQ AYIHPVFK  + E + D  SE++D+E V
Sbjct  499   AFVRYPLQEAMMKDTLERAREPNLNLKSFLQIAYIHPVFKEVQ-ESESDPASEESDQEPV  557

Query  658   LVQTKRQSRKNT  623
             L+ TKRQSR NT
Sbjct  558   LIPTKRQSRMNT  569



>ref|XP_010657219.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657220.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657221.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657222.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657223.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 ref|XP_010657224.1| PREDICTED: CSC1-like protein At3g21620 [Vitis vinifera]
 emb|CBI28840.3| unnamed protein product [Vitis vinifera]
Length=766

 Score =   360 bits (924),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 174/253 (69%), Positives = 205/253 (81%), Gaps = 4/253 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P ++G S     MKATFFITYIMVDGW G++GE+LRLK +I++HLKN F VKTEKDRE+A
Sbjct  498   PKIIGTSIP---MKATFFITYIMVDGWAGVSGEILRLKPMIIYHLKNFFTVKTEKDREEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGSL FN  EP+IQLYFLLGLVYA VTPILLPFI+VFF  AYVVFRHQIINVYNQEYE
Sbjct  555   MDPGSLSFNTGEPQIQLYFLLGLVYAVVTPILLPFIIVFFGLAYVVFRHQIINVYNQEYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVH RII AL+ SQ+  +GLLSTK AAQS P LI LPVLTI FH +CKGRYE 
Sbjct  615   SAAAFWPDVHMRIIVALVVSQLLLMGLLSTKQAAQSTPLLIALPVLTIWFHFFCKGRYEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISE-KADEEN  662
             AF ++PLQEA MKDTLE+ REPN NLK YL++AY HP+FK  +D+ + D  +E +  ++ 
Sbjct  675   AFVRYPLQEAMMKDTLERVREPNLNLKGYLREAYFHPIFKAGDDDSEMDEANEVEMVQKP  734

Query  661   VLVQTKRQSRKNT  623
              LV TKR SR++T
Sbjct  735   ELVPTKRHSRRHT  747



>dbj|BAK03311.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=767

 Score =   360 bits (924),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 178/257 (69%), Positives = 204/257 (79%), Gaps = 13/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITY+MVDGW G+AGE+LRLK L++FHLKN FLVKTEK
Sbjct  501   IGVAIPM-----------KATFFITYVMVDGWAGVAGEILRLKPLVIFHLKNFFLVKTEK  549

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ F+ NEP+IQLYFLLGLVYA VTP LLPFILVFF  AYVV+RHQIINVY
Sbjct  550   DREEAMDPGSIGFDSNEPQIQLYFLLGLVYAVVTPFLLPFILVFFVLAYVVYRHQIINVY  609

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWP VHGRII ALI SQ+  LGLLSTK A QS P L+VLPV+T  FH YCK
Sbjct  610   NQEYESAAAFWPSVHGRIITALIVSQLLFLGLLSTKGAGQSTPVLLVLPVVTFYFHKYCK  669

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
              RYE AF ++PLQEA  KDTLE+AREP F+LK YL  AYIHPVFKG +DE     + ++ 
Sbjct  670   NRYEPAFVEYPLQEAMRKDTLERAREPGFDLKTYLASAYIHPVFKGEDDE--KFSMMDEG  727

Query  673   DEENVLVQTKRQSRKNT  623
             + + VLV TKRQSR+NT
Sbjct  728   EADQVLVATKRQSRRNT  744



>ref|XP_007153987.1| hypothetical protein PHAVU_003G081500g [Phaseolus vulgaris]
 gb|ESW25981.1| hypothetical protein PHAVU_003G081500g [Phaseolus vulgaris]
Length=774

 Score =   360 bits (924),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 180/243 (74%), Positives = 205/243 (84%), Gaps = 4/243 (2%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             +KA+FFITYIMVDGW+GIA EVL LK LI++HLKN FLVKTEKDRE+AM+PGS+ FN  E
Sbjct  509   LKASFFITYIMVDGWSGIAAEVLMLKPLIIYHLKNFFLVKTEKDREEAMDPGSIGFNTGE  568

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             PRIQLYFLLGLVYAAVTP +LPFI+VFF  AYVVFRHQIINVYNQEYES AAFWPDVH R
Sbjct  569   PRIQLYFLLGLVYAAVTPTVLPFIIVFFGLAYVVFRHQIINVYNQEYESGAAFWPDVHFR  628

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             II ALI SQ+  +GLL+TK AA S PFLIVLP+LTI FH YCKGR+ESAF K+PLQEA M
Sbjct  629   IILALIVSQIVLMGLLTTKKAASSTPFLIVLPILTIWFHRYCKGRFESAFVKYPLQEAMM  688

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFK---GNEDEYDYDGISEKADEENVLVQTKRQSR  632
             KDTLE+A EPN NLK YLQ+AY+HPVFK   G +D+ D + IS K + E++ V TKRQSR
Sbjct  689   KDTLERATEPNLNLKAYLQNAYVHPVFKASLGEDDDEDEEAISLKWETESI-VPTKRQSR  747

Query  631   KNT  623
             KNT
Sbjct  748   KNT  750



>ref|XP_010231849.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Brachypodium distachyon]
Length=703

 Score =   358 bits (919),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 177/252 (70%), Positives = 205/252 (81%), Gaps = 3/252 (1%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P ++G+S     MKATFFITY+MVDGWTG+AGE+LRLKALI+FHLKNSFLVKTEKDRE+A
Sbjct  432   PRIIGVSIP---MKATFFITYVMVDGWTGVAGEILRLKALIMFHLKNSFLVKTEKDREEA  488

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGS+CF ++EPRIQLYFLLGLVYA VTP+LLPFILVFFA AYVV+RHQIINVYNQ YE
Sbjct  489   MDPGSICFYWSEPRIQLYFLLGLVYACVTPLLLPFILVFFALAYVVYRHQIINVYNQRYE  548

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S A FWP VH RII ALI SQ+  LGLLSTK   +S P LIVLP+LT  FH YCK RYE 
Sbjct  549   SGAQFWPSVHLRIIVALIVSQLLLLGLLSTKDFEESTPALIVLPILTFWFHRYCKNRYEP  608

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQEA  KDTLE+AREPNF+LK YL DAY+HPVFK + D  D   +++    E V
Sbjct  609   AFVRNPLQEAMRKDTLERAREPNFDLKAYLADAYLHPVFKSDLDGVDKFYVADDPGAEEV  668

Query  658   LVQTKRQSRKNT  623
             +V TKRQSR+ T
Sbjct  669   IVATKRQSRRTT  680



>gb|EEE64912.1| hypothetical protein OsJ_19772 [Oryza sativa Japonica Group]
Length=893

 Score =   362 bits (930),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 175/257 (68%), Positives = 206/257 (80%), Gaps = 12/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           +ATFFITY+MVDGWTG+AGE+LRL+ALI+FHLKN FLVKTEK
Sbjct  501   IGVAIPM-----------RATFFITYVMVDGWTGVAGEILRLRALIIFHLKNFFLVKTEK  549

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+CF++ EPRIQLYFLLGLVYA VTP+LLPFILVFF  AYVV+RHQIINVY
Sbjct  550   DREEAMDPGSICFDWCEPRIQLYFLLGLVYAVVTPLLLPFILVFFGLAYVVYRHQIINVY  609

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQ+YES A FWP VHGRII ALI SQ+  +GLLSTK   ++ P L+VLPVLT  F+ YCK
Sbjct  610   NQQYESGAQFWPSVHGRIIIALIVSQLLLIGLLSTKGFEETTPVLVVLPVLTFWFYKYCK  669

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
              R+E AF ++PLQEA  KDTLE+AREP F+LK YL +AY+HPVFKG E+E D   ISE  
Sbjct  670   NRFEPAFVRNPLQEAMRKDTLERAREPTFDLKAYLANAYLHPVFKGREEE-DNMSISEDV  728

Query  673   DEENVLVQTKRQSRKNT  623
               E V+V TKRQSR+NT
Sbjct  729   GMEEVIVPTKRQSRRNT  745


 Score =   135 bits (340),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 81/108 (75%), Gaps = 1/108 (1%)
 Frame = -2

Query  946  LGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKMKDTLEQAREPNF  767
            +GLLSTK   ++ P L+VLPVLT  F+ YCK R+E AF ++PLQEA  KDTLE+AREP F
Sbjct  766  IGLLSTKGFEETTPVLVVLPVLTFWFYKYCKNRFEPAFVRNPLQEAMRKDTLERAREPTF  825

Query  766  NLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  623
            +LK YL +AY+HPVFKG E+E D   ISE    E V+V TKRQSR+NT
Sbjct  826  DLKAYLANAYLHPVFKGREEE-DNMSISEDVGMEEVIVPTKRQSRRNT  872



>ref|XP_011095994.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Sesamum indicum]
Length=769

 Score =   359 bits (922),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 179/257 (70%), Positives = 206/257 (80%), Gaps = 12/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW G+AGE+LRLK LI+FHLKN FLVKTEK
Sbjct  505   IGVAIPM-----------KATFFITYIMVDGWAGVAGEILRLKPLIIFHLKNFFLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE AM+PGS+ F+  EP+IQLYFLLGLVYA VTP+ LPFILVFF  AYVVFRHQIINVY
Sbjct  554   DREAAMDPGSIGFDTGEPQIQLYFLLGLVYAVVTPVFLPFILVFFVLAYVVFRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESA AFWPDVHGRIIFAL+FSQ+  +GL+STK AA S PFLI LPVLT  FH +CK
Sbjct  614   NQEYESAGAFWPDVHGRIIFALVFSQLVLMGLMSTKGAAASTPFLIALPVLTFFFHRFCK  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AF K+PLQEA +KDTLE+AREP  NLK YLQ AY+HPVFK N+++ + D +  K 
Sbjct  674   GRYEPAFVKYPLQEAMIKDTLERAREPGLNLKGYLQYAYVHPVFK-NDEDDEDDDLHGKI  732

Query  673   DEENVLVQTKRQSRKNT  623
             +E   ++ TKRQSR+NT
Sbjct  733   EESITIIPTKRQSRRNT  749



>gb|EMT27455.1| Putative membrane protein [Aegilops tauschii]
Length=816

 Score =   360 bits (924),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 177/257 (69%), Positives = 205/257 (80%), Gaps = 12/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITY+MVDGW G+AGE+LRLK L++FHLKN FLVKTEK
Sbjct  549   IGVAIPM-----------KATFFITYVMVDGWAGVAGEILRLKPLVIFHLKNFFLVKTEK  597

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DR++AM+PGS+ F+ NEP+IQLYFLLGLVYA VTP LLPFILVF+  AYVV+RHQIINVY
Sbjct  598   DRDEAMDPGSIGFDSNEPQIQLYFLLGLVYAVVTPFLLPFILVFYVLAYVVYRHQIINVY  657

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWP VHGRII ALI SQ+  LGLLSTK A QS P L+VLPV+T  FH YCK
Sbjct  658   NQEYESAAAFWPSVHGRIITALIVSQLLFLGLLSTKGAGQSTPVLLVLPVVTFYFHKYCK  717

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
              RYE AF ++PLQEA  KDTLE+AREP F+LK YL  AYIHPVFKG +D+  +  + E A
Sbjct  718   NRYEPAFVEYPLQEAMRKDTLERAREPGFDLKTYLASAYIHPVFKGGDDDEKFSMMDE-A  776

Query  673   DEENVLVQTKRQSRKNT  623
             + + VLV TKRQSR+NT
Sbjct  777   EADQVLVATKRQSRRNT  793



>ref|XP_002440380.1| hypothetical protein SORBIDRAFT_09g030770 [Sorghum bicolor]
 gb|EES18810.1| hypothetical protein SORBIDRAFT_09g030770 [Sorghum bicolor]
Length=766

 Score =   358 bits (920),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 176/253 (70%), Positives = 204/253 (81%), Gaps = 4/253 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P ++G S     MKATFFITY+MVDGWTGIAGE+LRLK LI FHLKN FLVKTEKDRE+A
Sbjct  498   PRIIGDSIP---MKATFFITYVMVDGWTGIAGEILRLKPLIFFHLKNLFLVKTEKDREEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGS+CF+  EPRIQLYFLLGLVYAAVTP LLPFILVFF FAYVVFRHQIINVYNQ+YE
Sbjct  555   MDPGSICFDSTEPRIQLYFLLGLVYAAVTPFLLPFILVFFGFAYVVFRHQIINVYNQQYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAA FWP VHGRII ALI SQ+  LGL+ST    QS P L+VLPVLT  F+ YCK R+E 
Sbjct  615   SAAQFWPSVHGRIITALIVSQLLLLGLMSTNDFEQSTPVLLVLPVLTFWFYKYCKNRFEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA-DEEN  662
             AF ++PLQEA  KDTLE+AREPNF+LK YL ++Y+HPVFKG+E +  Y  + ++   EE 
Sbjct  675   AFVRNPLQEAMKKDTLERAREPNFDLKAYLANSYLHPVFKGDEGDDRYSVVDDEGWMEEE  734

Query  661   VLVQTKRQSRKNT  623
             V+V TKR SR+ T
Sbjct  735   VIVPTKRHSRRTT  747



>gb|KHG30770.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=770

 Score =   358 bits (920),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 181/257 (70%), Positives = 208/257 (81%), Gaps = 13/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           +ATFFITYIMVDGW GIA E+L LK LI++HLKN+FLVKTEK
Sbjct  503   IGVAVPM-----------RATFFITYIMVDGWAGIAAEILMLKPLIIYHLKNTFLVKTEK  551

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AMNPGSL FN  EPRIQLYFLLG+VYA VTP+LLPFI+VFF  AYVVFRHQIINVY
Sbjct  552   DREEAMNPGSLSFNVGEPRIQLYFLLGMVYATVTPVLLPFIVVFFGLAYVVFRHQIINVY  611

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRII AL+ S V+ +GLLSTKH AQ+AP LI L VLTI F+ +CK
Sbjct  612   NQEYESAAAFWPDVHGRIIIALLVSHVALIGLLSTKHLAQAAPLLITLAVLTIWFYRFCK  671

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
              RYE AF ++PLQEA MKDTLE+AR+ NFNLKPYLQ+AYIHPVFK  ++E +      K 
Sbjct  672   ARYEPAFVRYPLQEAVMKDTLERARDSNFNLKPYLQNAYIHPVFKEEDEEEEE--EVVKL  729

Query  673   DEENVLVQTKRQSRKNT  623
             + E+VLV TKRQSR+NT
Sbjct  730   ENESVLVPTKRQSRRNT  746



>ref|XP_003569103.1| PREDICTED: CSC1-like protein At3g21620 isoform X1 [Brachypodium 
distachyon]
Length=768

 Score =   358 bits (920),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 177/252 (70%), Positives = 205/252 (81%), Gaps = 3/252 (1%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P ++G+S     MKATFFITY+MVDGWTG+AGE+LRLKALI+FHLKNSFLVKTEKDRE+A
Sbjct  497   PRIIGVSIP---MKATFFITYVMVDGWTGVAGEILRLKALIMFHLKNSFLVKTEKDREEA  553

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGS+CF ++EPRIQLYFLLGLVYA VTP+LLPFILVFFA AYVV+RHQIINVYNQ YE
Sbjct  554   MDPGSICFYWSEPRIQLYFLLGLVYACVTPLLLPFILVFFALAYVVYRHQIINVYNQRYE  613

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S A FWP VH RII ALI SQ+  LGLLSTK   +S P LIVLP+LT  FH YCK RYE 
Sbjct  614   SGAQFWPSVHLRIIVALIVSQLLLLGLLSTKDFEESTPALIVLPILTFWFHRYCKNRYEP  673

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQEA  KDTLE+AREPNF+LK YL DAY+HPVFK + D  D   +++    E V
Sbjct  674   AFVRNPLQEAMRKDTLERAREPNFDLKAYLADAYLHPVFKSDLDGVDKFYVADDPGAEEV  733

Query  658   LVQTKRQSRKNT  623
             +V TKRQSR+ T
Sbjct  734   IVATKRQSRRTT  745



>ref|XP_004231619.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
 ref|XP_010315702.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Solanum lycopersicum]
Length=765

 Score =   358 bits (919),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 179/257 (70%), Positives = 204/257 (79%), Gaps = 11/257 (4%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITY MVDGW GIAGE+LRLK LILFHLKN FLVKTE+
Sbjct  500   IGVAIPM-----------KATFFITYTMVDGWAGIAGEILRLKPLILFHLKNFFLVKTER  548

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE AM+ GSL FN  EP+IQLYFLLGLVYA VTP LLPFILVFFA AY VFRHQIINVY
Sbjct  549   DREKAMDAGSLNFNTGEPQIQLYFLLGLVYAIVTPFLLPFILVFFALAYFVFRHQIINVY  608

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             +QEYES AAFWPDVHGRIIFAL+FSQ+S LGLLSTK AAQSAPFLI LPVLT++FH +CK
Sbjct  609   HQEYESGAAFWPDVHGRIIFALVFSQISLLGLLSTKRAAQSAPFLIALPVLTLSFHYFCK  668

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AFT++PLQEAK KDT+EQA+E   NLK YLQ AY+HPVF+G++ + + D   +  
Sbjct  669   GRYEPAFTRYPLQEAKRKDTIEQAKESKLNLKYYLQKAYLHPVFRGDDVDDNEDVNDKLE  728

Query  673   DEENVLVQTKRQSRKNT  623
               +  L+  KR SR +T
Sbjct  729   SNDVELIPMKRHSRGST  745



>ref|XP_008363043.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized membrane protein 
C2G11.09-like [Malus domestica]
Length=660

 Score =   355 bits (911),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 175/252 (69%), Positives = 204/252 (81%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MK TFFITYIMVDGW GI+G +LRLK LI++HLKN FLVKTEKDRE+A
Sbjct  391   PKTIGVSIP---MKTTFFITYIMVDGWAGISGGILRLKPLIIYHLKNFFLVKTEKDREEA  447

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG+L FN  EP+IQLYFLLGLVYA V+PILLPFI+VFFA AYVV+R QIINVYNQEYE
Sbjct  448   MDPGTLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIIVFFALAYVVYRRQIINVYNQEYE  507

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRII ALI SQ+  +GLLSTK AA S P LI LPVLTI FH +CKGRY+ 
Sbjct  508   SAAAFWPDVHGRIITALIVSQLLLMGLLSTKEAAXSTPLLITLPVLTIWFHRFCKGRYKP  567

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF +HPLQEA MKDTLE  REPN NLK +LQ+AYIHPVFK +ED+   D  +++ ++E  
Sbjct  568   AFIRHPLQEAMMKDTLECTREPNLNLKXFLQNAYIHPVFK-SEDDSKNDAPAQEFEKEPA  626

Query  658   LVQTKRQSRKNT  623
             +V TK  SR+NT
Sbjct  627   VVLTKCSSRRNT  638



>gb|KJB69239.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=772

 Score =   358 bits (919),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 182/257 (71%), Positives = 211/257 (82%), Gaps = 14/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A P+           +ATFFITYIMVDGW GIAGE+L LK LI++HLKN FLVKTEK
Sbjct  503   IGVAVPL-----------RATFFITYIMVDGWAGIAGEILMLKPLIIYHLKNFFLVKTEK  551

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGSL FN  EP+IQLYFLLGLVYAAVTP LLPFI++FF  AYVVFRHQIINVY
Sbjct  552   DREEAMDPGSLGFNTGEPQIQLYFLLGLVYAAVTPALLPFIVIFFGLAYVVFRHQIINVY  611

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRII AL+ SQV+ +GLL++K AAQS PFLI L VLTI F+ +CK
Sbjct  612   NQEYESAAAFWPDVHGRIIIALLISQVALIGLLTSKKAAQSTPFLIALVVLTIWFYTFCK  671

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
              RYE AF ++PLQEA MKDTLE+AREPN NLKPYLQ+AYIHPVFK  ++E ++D  SE  
Sbjct  672   ARYEPAFVRYPLQEAMMKDTLERAREPNLNLKPYLQNAYIHPVFKEEDEEDEFDFKSE--  729

Query  673   DEENVLVQTKRQSRKNT  623
               E+VLV TKRQSR++T
Sbjct  730   -NESVLVPTKRQSRRST  745



>gb|KJB69243.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=764

 Score =   358 bits (918),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 182/257 (71%), Positives = 211/257 (82%), Gaps = 14/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A P+           +ATFFITYIMVDGW GIAGE+L LK LI++HLKN FLVKTEK
Sbjct  495   IGVAVPL-----------RATFFITYIMVDGWAGIAGEILMLKPLIIYHLKNFFLVKTEK  543

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGSL FN  EP+IQLYFLLGLVYAAVTP LLPFI++FF  AYVVFRHQIINVY
Sbjct  544   DREEAMDPGSLGFNTGEPQIQLYFLLGLVYAAVTPALLPFIVIFFGLAYVVFRHQIINVY  603

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRII AL+ SQV+ +GLL++K AAQS PFLI L VLTI F+ +CK
Sbjct  604   NQEYESAAAFWPDVHGRIIIALLISQVALIGLLTSKKAAQSTPFLIALVVLTIWFYTFCK  663

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
              RYE AF ++PLQEA MKDTLE+AREPN NLKPYLQ+AYIHPVFK  ++E ++D  SE  
Sbjct  664   ARYEPAFVRYPLQEAMMKDTLERAREPNLNLKPYLQNAYIHPVFKEEDEEDEFDFKSE--  721

Query  673   DEENVLVQTKRQSRKNT  623
               E+VLV TKRQSR++T
Sbjct  722   -NESVLVPTKRQSRRST  737



>gb|EPS60017.1| hypothetical protein M569_14787, partial [Genlisea aurea]
Length=762

 Score =   358 bits (918),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 178/262 (68%), Positives = 215/262 (82%), Gaps = 16/262 (6%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITY+MVDGW G+AGE+LRLK LI+FHLKN FLVKTEK
Sbjct  505   IGVAIPM-----------KATFFITYVMVDGWAGVAGEILRLKPLIIFHLKNFFLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DR++AM+PGS+ F+  EP+IQLYFLLGLVYA VTPI LPFILVFFAFAY+V+RHQIINVY
Sbjct  554   DRDEAMDPGSIGFDTGEPQIQLYFLLGLVYAVVTPIFLPFILVFFAFAYMVYRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAA FWPDVHGRII A+IFSQ+  +GL+STK AA S PFL+VLPV+TI FH +CK
Sbjct  614   NQEYESAAEFWPDVHGRIISAMIFSQLVLMGLMSTKGAAASTPFLLVLPVITIFFHRFCK  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYD---GIS  683
             GRYE AF K+PLQEA M+DTLE+AREPNFNLK ++++AY+HPVFK +ED+ + +   G +
Sbjct  674   GRYEPAFLKYPLQEAMMRDTLERAREPNFNLKSFMRNAYVHPVFKNDEDDDEEEDEVGSN  733

Query  682   EKA--DEENVLVQTKRQSRKNT  623
              K   D+  V+V TKRQSR++T
Sbjct  734   RKNGDDDGGVIVPTKRQSRRST  755



>gb|KJB69236.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
 gb|KJB69242.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
 gb|KJB69244.1| hypothetical protein B456_011G012200 [Gossypium raimondii]
Length=772

 Score =   358 bits (918),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 182/257 (71%), Positives = 211/257 (82%), Gaps = 14/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A P+           +ATFFITYIMVDGW GIAGE+L LK LI++HLKN FLVKTEK
Sbjct  503   IGVAVPL-----------RATFFITYIMVDGWAGIAGEILMLKPLIIYHLKNFFLVKTEK  551

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGSL FN  EP+IQLYFLLGLVYAAVTP LLPFI++FF  AYVVFRHQIINVY
Sbjct  552   DREEAMDPGSLGFNTGEPQIQLYFLLGLVYAAVTPALLPFIVIFFGLAYVVFRHQIINVY  611

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRII AL+ SQV+ +GLL++K AAQS PFLI L VLTI F+ +CK
Sbjct  612   NQEYESAAAFWPDVHGRIIIALLISQVALIGLLTSKKAAQSTPFLIALVVLTIWFYTFCK  671

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
              RYE AF ++PLQEA MKDTLE+AREPN NLKPYLQ+AYIHPVFK  ++E ++D  SE  
Sbjct  672   ARYEPAFVRYPLQEAMMKDTLERAREPNLNLKPYLQNAYIHPVFKEEDEEDEFDFKSE--  729

Query  673   DEENVLVQTKRQSRKNT  623
               E+VLV TKRQSR++T
Sbjct  730   -NESVLVPTKRQSRRST  745



>ref|XP_012092360.1| PREDICTED: uncharacterized protein LOC105650086 [Jatropha curcas]
Length=1697

 Score =   371 bits (952),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 188/259 (73%), Positives = 209/259 (81%), Gaps = 13/259 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW GIAGEVL LK LILFHLKN FLVKTEK
Sbjct  504   IGVAIPM-----------KATFFITYIMVDGWAGIAGEVLMLKPLILFHLKNFFLVKTEK  552

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGSL FN  EPRIQ YFLLGLVYA VTP LLPFI+VFF FAYVVFRHQIINVY
Sbjct  553   DREEAMDPGSLGFNTGEPRIQFYFLLGLVYATVTPALLPFIIVFFGFAYVVFRHQIINVY  612

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAA+WPDVHGR++ ALI SQV  +GLLSTK AA S PFLI LP+LTI FH +CK
Sbjct  613   NQEYESAAAYWPDVHGRVVTALIISQVLMIGLLSTKRAALSTPFLIALPILTIWFHRFCK  672

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDG--ISE  680
             GRYE AF K+PLQEA M+DTLE+AREPN NLK YLQ+AY HPVFK  +D  + +   +SE
Sbjct  673   GRYEPAFVKYPLQEAMMRDTLERAREPNLNLKGYLQNAYAHPVFKEADDGDEDEDEILSE  732

Query  679   KADEENVLVQTKRQSRKNT  623
             K + E+VLV TKRQSR+NT
Sbjct  733   KLESESVLVPTKRQSRRNT  751



>ref|XP_009803475.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana sylvestris]
 ref|XP_009803477.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana sylvestris]
Length=768

 Score =   357 bits (917),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 184/257 (72%), Positives = 210/257 (82%), Gaps = 11/257 (4%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW GIAGE+LRLK LI+FHLKN FLVKTE 
Sbjct  501   IGVAIPM-----------KATFFITYIMVDGWAGIAGEILRLKPLIIFHLKNFFLVKTEN  549

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DR+ AMN GSL FN  EP+IQLYFLLGLVYA VTP LLPFILVFF  A++VFRHQIINVY
Sbjct  550   DRKKAMNAGSLGFNTGEPQIQLYFLLGLVYAVVTPFLLPFILVFFGLAFIVFRHQIINVY  609

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQ+YES AAFWPDVHGRIIFAL+FSQ+S LGLL TKHAAQSAPFLI LPVLTI+FH +CK
Sbjct  610   NQKYESGAAFWPDVHGRIIFALVFSQLSLLGLLGTKHAAQSAPFLIALPVLTISFHKFCK  669

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AFT++PLQEA+ KDTLE+A+EPN NLK YLQ+AY+HPVFK ++++ D +   +  
Sbjct  670   GRYEPAFTRYPLQEARRKDTLERAKEPNLNLKAYLQNAYLHPVFKSDDEDEDEEFDDKLE  729

Query  673   DEENVLVQTKRQSRKNT  623
                 VLV TKRQSR+NT
Sbjct  730   SNGTVLVPTKRQSRENT  746



>ref|NP_001043256.1| Os01g0534900 [Oryza sativa Japonica Group]
 dbj|BAD87679.1| putative ERD4 protein [Oryza sativa Japonica Group]
 dbj|BAF05170.1| Os01g0534900 [Oryza sativa Japonica Group]
 dbj|BAG96168.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70822.1| hypothetical protein OsI_02298 [Oryza sativa Indica Group]
 gb|EEE54743.1| hypothetical protein OsJ_02101 [Oryza sativa Japonica Group]
 gb|AIU34628.1| hyperosmolality-gated Ca2+ permeable channel 1.1 [Oryza sativa]
Length=768

 Score =   357 bits (916),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 175/240 (73%), Positives = 203/240 (85%), Gaps = 1/240 (0%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             MKATFFITY+MVDGW G+AGE+LRLK LI+FHLKN FLVKTEKDRE+AM+PGS+ F+ NE
Sbjct  507   MKATFFITYVMVDGWAGVAGEILRLKPLIIFHLKNFFLVKTEKDREEAMDPGSIGFDSNE  566

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             P+IQLYFLLGLVYA VTP LLPFIL+FF  AYVV+RHQIINVYNQEYESAAAFWP VHGR
Sbjct  567   PQIQLYFLLGLVYAVVTPFLLPFILIFFGLAYVVYRHQIINVYNQEYESAAAFWPSVHGR  626

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             II ALI SQ+  LGLLSTK A QS P L+VLPV+T  F+ YCK RYE AF ++PLQ+A  
Sbjct  627   IIVALIVSQLLLLGLLSTKGAGQSTPVLLVLPVVTFYFYKYCKNRYEPAFVEYPLQDAMR  686

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  623
             KDTLE+AREP F+LK YL +AYIHPVFKG+ED+  +  IS++ + E VLV TKRQSR+NT
Sbjct  687   KDTLERAREPGFDLKGYLMNAYIHPVFKGDEDDEKF-SISDEPEAEQVLVATKRQSRRNT  745



>ref|XP_003529649.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X1 [Glycine max]
 ref|XP_006584087.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Glycine max]
 gb|KHN35714.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=777

 Score =   357 bits (916),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 177/243 (73%), Positives = 205/243 (84%), Gaps = 3/243 (1%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             +KA+FFITYIMVDGW GIA EVL LK LI++HLKN FLVKTEKDRE+AM+PGS+ FN  E
Sbjct  509   LKASFFITYIMVDGWAGIAAEVLMLKPLIIYHLKNFFLVKTEKDREEAMDPGSIGFNTGE  568

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             PRIQLYFLLGLVYA+VTP +LPFI+VFF  AYVVFRHQIINVYNQEYES AAFWPDVH R
Sbjct  569   PRIQLYFLLGLVYASVTPTVLPFIIVFFGLAYVVFRHQIINVYNQEYESGAAFWPDVHFR  628

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             +I ALI SQ+  +GLL+TK AA S PFLIVLPVLTI FH+YCKGR+E AF ++PLQEA M
Sbjct  629   VIIALIVSQIVLMGLLTTKEAASSTPFLIVLPVLTIWFHIYCKGRFEPAFVRYPLQEAMM  688

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGN---EDEYDYDGISEKADEENVLVQTKRQSR  632
             KDTLE+A +PNFNLK YLQ+AY+HPVFK +   EDE D + +S K + E+V V TKRQSR
Sbjct  689   KDTLERATDPNFNLKAYLQNAYVHPVFKASLFDEDEEDEEVMSLKLETESVTVPTKRQSR  748

Query  631   KNT  623
             +NT
Sbjct  749   RNT  751



>emb|CDP11354.1| unnamed protein product [Coffea canephora]
Length=777

 Score =   357 bits (916),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 175/252 (69%), Positives = 206/252 (82%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRL+ LI++HLKN F+VKTE DRE+A
Sbjct  507   PKTIGVSIP---MKATFFITYIMVDGWAGVAGEILRLRPLIIYHLKNFFMVKTETDREEA  563

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             MNPGSL FN  EP+IQLYFLLGLVYA V+PILLPFI++FF  AY+V+RHQI+NVYNQEYE
Sbjct  564   MNPGSLGFNTGEPQIQLYFLLGLVYAVVSPILLPFIVIFFGLAYIVYRHQIMNVYNQEYE  623

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRII ALI SQ+  LGLLSTK A+QS PFLI LPVLTI F  YCKGRYE 
Sbjct  624   SAAAFWPDVHGRIIIALIVSQLLLLGLLSTKDASQSTPFLITLPVLTICFDRYCKGRYEP  683

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQ+A MKD L + REPN NLK YL+ AYIHPVFK   D+Y+ + +SE  ++E  
Sbjct  684   AFVRYPLQQAMMKDILNRTREPNVNLKDYLRSAYIHPVFKAG-DDYENNLVSEDEEQEPT  742

Query  658   LVQTKRQSRKNT  623
             LV TKRQSR++T
Sbjct  743   LVPTKRQSRRST  754



>ref|XP_009619499.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana tomentosiformis]
 ref|XP_009619500.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Nicotiana tomentosiformis]
Length=768

 Score =   357 bits (915),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 184/257 (72%), Positives = 211/257 (82%), Gaps = 11/257 (4%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW GIAGE+LRLK LI+FHLKN FLVKTE 
Sbjct  501   IGVAIPM-----------KATFFITYIMVDGWAGIAGEILRLKPLIIFHLKNFFLVKTEN  549

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DR+ AMN GSL FN  EP+IQLYFLLGLVYA VTP LLPFILVFF  A++VFRHQIINVY
Sbjct  550   DRKKAMNAGSLGFNTGEPQIQLYFLLGLVYAVVTPFLLPFILVFFGLAFIVFRHQIINVY  609

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQ+YES AAFWPDVHGR+IFAL+FSQ+S LGLLSTKHA QSAPFLI LPVLTI+FH +CK
Sbjct  610   NQKYESGAAFWPDVHGRVIFALVFSQLSLLGLLSTKHAVQSAPFLIALPVLTISFHKFCK  669

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AFT++PLQEA+ KDTLE+A+EPN NLK YLQ+AY+HPVFKG++++ D +   +  
Sbjct  670   GRYEPAFTRYPLQEARRKDTLERAKEPNLNLKAYLQNAYLHPVFKGDDEDEDEEIDDKLE  729

Query  673   DEENVLVQTKRQSRKNT  623
                 VLV TKRQSR+NT
Sbjct  730   SNGTVLVPTKRQSRENT  746



>gb|KHG01808.1| putative membrane C2G11.09 [Gossypium arboreum]
Length=772

 Score =   357 bits (915),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 182/257 (71%), Positives = 210/257 (82%), Gaps = 14/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A P+           +ATFFITYIMVDGW GIAGE+L LK LI++HLKN FLVKTEK
Sbjct  503   IGVAVPL-----------RATFFITYIMVDGWAGIAGEILMLKPLIIYHLKNFFLVKTEK  551

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGSL FN  EP+IQLYFLLGLVYAAVTP LLPFI++FF  AYVVFRHQIINVY
Sbjct  552   DREEAMDPGSLGFNTGEPQIQLYFLLGLVYAAVTPALLPFIVIFFGLAYVVFRHQIINVY  611

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRII AL+ SQV+ +GLL++K AAQS PFLI L VLTI F+  CK
Sbjct  612   NQEYESAAAFWPDVHGRIIIALLISQVALIGLLTSKKAAQSTPFLIALVVLTIWFYTLCK  671

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
              RYE AF ++PLQEA MKDTLE+AREPN NLKPYLQ+AYIHPVFK  ++E ++D  SE  
Sbjct  672   ARYEPAFVRYPLQEAMMKDTLERAREPNLNLKPYLQNAYIHPVFKEEDEEDEFDFKSE--  729

Query  673   DEENVLVQTKRQSRKNT  623
               E+VLV TKRQSR++T
Sbjct  730   -NESVLVPTKRQSRRST  745



>gb|KJB10674.1| hypothetical protein B456_001G215500 [Gossypium raimondii]
Length=729

 Score =   355 bits (911),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 171/240 (71%), Positives = 200/240 (83%), Gaps = 1/240 (0%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             MKATFFITYIMVDGW G+A E+LRLK LI++HLKN FLVKTEKDRE+AM+PG++ FN  E
Sbjct  468   MKATFFITYIMVDGWAGVAAEILRLKPLIIYHLKNFFLVKTEKDREEAMDPGTIGFNTGE  527

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             P+IQLYFLLGLVYA VTPILLPF++VFFA AYVVFRHQIINVYNQEYESAAA+WPDVH R
Sbjct  528   PQIQLYFLLGLVYAIVTPILLPFVIVFFALAYVVFRHQIINVYNQEYESAAAYWPDVHLR  587

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             II ALI SQ+  +GLLSTK AA S P LI LP+LTI FH +CKGRYE AF ++PLQEA M
Sbjct  588   IIVALIVSQLLLMGLLSTKEAASSTPLLITLPILTIWFHRFCKGRYEPAFVRNPLQEAMM  647

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  623
             KDTLE+AREPN NLK +LQ+AYIHPVFK  + +   D   E+ +EE  L+ TKR S+++T
Sbjct  648   KDTLERAREPNLNLKGFLQNAYIHPVFKSADGD-KIDVAMEEWEEEPSLIATKRTSKRST  706



>gb|KJB10673.1| hypothetical protein B456_001G215500 [Gossypium raimondii]
Length=768

 Score =   356 bits (913),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 171/240 (71%), Positives = 200/240 (83%), Gaps = 1/240 (0%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             MKATFFITYIMVDGW G+A E+LRLK LI++HLKN FLVKTEKDRE+AM+PG++ FN  E
Sbjct  507   MKATFFITYIMVDGWAGVAAEILRLKPLIIYHLKNFFLVKTEKDREEAMDPGTIGFNTGE  566

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             P+IQLYFLLGLVYA VTPILLPF++VFFA AYVVFRHQIINVYNQEYESAAA+WPDVH R
Sbjct  567   PQIQLYFLLGLVYAIVTPILLPFVIVFFALAYVVFRHQIINVYNQEYESAAAYWPDVHLR  626

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             II ALI SQ+  +GLLSTK AA S P LI LP+LTI FH +CKGRYE AF ++PLQEA M
Sbjct  627   IIVALIVSQLLLMGLLSTKEAASSTPLLITLPILTIWFHRFCKGRYEPAFVRNPLQEAMM  686

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  623
             KDTLE+AREPN NLK +LQ+AYIHPVFK  + +   D   E+ +EE  L+ TKR S+++T
Sbjct  687   KDTLERAREPNLNLKGFLQNAYIHPVFKSADGD-KIDVAMEEWEEEPSLIATKRTSKRST  745



>ref|XP_010473449.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010473450.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010473451.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
Length=779

 Score =   356 bits (914),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 176/260 (68%), Positives = 209/260 (80%), Gaps = 14/260 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             +G+A P+           KATFFITYIMVDGW G+AGE+LRLK L++FHLKN FLVKTEK
Sbjct  504   VGVAIPI-----------KATFFITYIMVDGWAGVAGEILRLKPLVIFHLKNFFLVKTEK  552

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PG + F   EPRIQLYFLLGLVYA VTP+LLPFI+ FF FAY++FRHQIINVY
Sbjct  553   DREEAMDPGQIDFYATEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYLIFRHQIINVY  612

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRII ALI SQ+  LGL+STK   QS PFL+VL +LT  FH +CK
Sbjct  613   NQEYESAAAFWPDVHGRIISALIISQILLLGLMSTKGKVQSTPFLLVLAILTFVFHRFCK  672

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYD-YDGISEK  677
             GRYESAF  +PLQEA +KDTLE+AREPN NLK +LQ+AYIHPVFK  E E D ++G++E 
Sbjct  673   GRYESAFVINPLQEAMIKDTLERAREPNLNLKGFLQNAYIHPVFKDEEFEDDQFEGLTED  732

Query  676   ADEEN-VLVQTKRQS-RKNT  623
             +D+E+ V+V TKRQ  R+ T
Sbjct  733   SDDEDCVVVPTKRQRPRRKT  752



>ref|NP_001147493.1| LOC100281102 [Zea mays]
 gb|ACG27714.1| HYP1 [Zea mays]
Length=768

 Score =   355 bits (911),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 174/253 (69%), Positives = 202/253 (80%), Gaps = 4/253 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P ++G S     MKATFFITY+MVDGWTGIAGE+LRLK LI FHLKN FLVKTEKDRE+A
Sbjct  498   PRIIGDSIP---MKATFFITYVMVDGWTGIAGEILRLKPLIFFHLKNFFLVKTEKDREEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGS+CF+  EPRIQLYFLLGLVYAAVTP LLPFILVFF FAYVVFRHQIINVYNQ+YE
Sbjct  555   MDPGSICFDSTEPRIQLYFLLGLVYAAVTPFLLPFILVFFGFAYVVFRHQIINVYNQQYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAA FWP VHGRII ALI SQ+  LGL+ST    Q+ P L+VLPVLT  F+ YCK R+E 
Sbjct  615   SAAQFWPSVHGRIITALIVSQLLLLGLMSTNDFEQTTPVLLVLPVLTFGFYKYCKNRFEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA-DEEN  662
             AF ++PLQEA  KDTLE+AREPN +LK YL ++Y+HPVFKG+E +  Y  + +    EE 
Sbjct  675   AFVRNPLQEAMKKDTLERAREPNLDLKAYLANSYLHPVFKGDEGDDRYSVMDDDGWMEEE  734

Query  661   VLVQTKRQSRKNT  623
             V+V TKR SR+ T
Sbjct  735   VIVPTKRHSRRTT  747



>gb|AFW81357.1| HYP1 isoform 1 [Zea mays]
 gb|AFW81358.1| HYP1 isoform 2 [Zea mays]
Length=768

 Score =   355 bits (911),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 174/253 (69%), Positives = 202/253 (80%), Gaps = 4/253 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P ++G S     MKATFFITY+MVDGWTGIAGE+LRLK LI FHLKN FLVKTEKDRE+A
Sbjct  498   PRIIGDSIP---MKATFFITYVMVDGWTGIAGEILRLKPLIFFHLKNFFLVKTEKDREEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGS+CF+  EPRIQLYFLLGLVYAAVTP LLPFILVFF FAYVVFRHQIINVYNQ+YE
Sbjct  555   MDPGSICFDSTEPRIQLYFLLGLVYAAVTPFLLPFILVFFGFAYVVFRHQIINVYNQQYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAA FWP VHGRII ALI SQ+  LGL+ST    Q+ P L+VLPVLT  F+ YCK R+E 
Sbjct  615   SAAQFWPSVHGRIITALIVSQLLLLGLMSTNDFEQTTPVLLVLPVLTFGFYKYCKNRFEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA-DEEN  662
             AF ++PLQEA  KDTLE+AREPN +LK YL ++Y+HPVFKG+E +  Y  + +    EE 
Sbjct  675   AFVRNPLQEAMKKDTLERAREPNLDLKAYLANSYLHPVFKGDEGDDRYSVMDDDGWMEEE  734

Query  661   VLVQTKRQSRKNT  623
             V+V TKR SR+ T
Sbjct  735   VIVPTKRHSRRTT  747



>ref|XP_006654880.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Oryza 
brachyantha]
Length=770

 Score =   355 bits (911),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 174/257 (68%), Positives = 203/257 (79%), Gaps = 12/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           +ATFFITY++VDGWTGIAGE+LRLKALI FHLKN FLVKTEK
Sbjct  501   IGVAIPM-----------RATFFITYVLVDGWTGIAGEILRLKALIFFHLKNFFLVKTEK  549

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+CF+  EPRIQLYFLLGLVYA VTP+LLPFILVFF  AYVV+RHQIINVY
Sbjct  550   DREEAMDPGSICFDSCEPRIQLYFLLGLVYAVVTPLLLPFILVFFGLAYVVYRHQIINVY  609

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQ+YES A FWP VHGRII ALI SQ+  +GLLSTK   +S P L+VLPVLT  F+ YCK
Sbjct  610   NQQYESGAQFWPSVHGRIIVALIVSQLLLIGLLSTKGFEESTPVLLVLPVLTFWFYKYCK  669

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
              R+E AF ++PLQEA  KDT+E+AREP F+LK YL +AY+HPVFK NE+E +   ISE  
Sbjct  670   NRFEPAFVRNPLQEAMRKDTVERAREPTFDLKAYLTNAYLHPVFKSNEEE-EKMSISEDI  728

Query  673   DEENVLVQTKRQSRKNT  623
               E V+V TKRQSR+ T
Sbjct  729   GMEEVIVPTKRQSRRTT  745



>sp|F4HYR3.2|CSCL6_ARATH RecName: Full=CSC1-like protein At1g62320 [Arabidopsis thaliana]
 gb|AAF70851.1|AC003113_18 F24O1.4 [Arabidopsis thaliana]
Length=778

 Score =   355 bits (911),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 172/258 (67%), Positives = 204/258 (79%), Gaps = 13/258 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             +G+A P+           KATFFITYIMVDGW G+AGE+ RLK L++FHLKN F VKTEK
Sbjct  504   VGVAIPI-----------KATFFITYIMVDGWAGVAGEIFRLKPLVIFHLKNFFFVKTEK  552

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PG + F   EPRIQLYFLLGLVYA VTP+LLPFI+ FF FAY+VFRHQIINVY
Sbjct  553   DREEAMDPGQIDFYATEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYLVFRHQIINVY  612

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQ+YESA AFWPDVHGRII ALI SQ+  LGL+STK   QS PFL+VL +LT  FH +CK
Sbjct  613   NQKYESAGAFWPDVHGRIISALIISQILLLGLMSTKGKVQSTPFLLVLAILTFGFHRFCK  672

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYESAF  +PLQEA +KDTLE+AREPN NLK +LQ+AY+HPVFK  ED  D +G+ E +
Sbjct  673   GRYESAFVINPLQEAMIKDTLERAREPNLNLKGFLQNAYVHPVFKDEEDS-DEEGLIEDS  731

Query  673   DEEN-VLVQTKRQSRKNT  623
             D+E+ V+VQTKRQ  + T
Sbjct  732   DDEDCVVVQTKRQRSRRT  749



>emb|CDY32438.1| BnaC03g42220D [Brassica napus]
Length=756

 Score =   354 bits (909),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 168/253 (66%), Positives = 207/253 (82%), Gaps = 4/253 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK L+++HLKN FLVKTEKDRE+A
Sbjct  499   PKTIGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLVIYHLKNFFLVKTEKDREEA  555

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG++ FN  EP+IQLYF+LGLVYAAV+PILLPFILVFFA AYVV+RHQIINVYNQEYE
Sbjct  556   MDPGTIGFNTGEPQIQLYFILGLVYAAVSPILLPFILVFFALAYVVYRHQIINVYNQEYE  615

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SA AFWPDVH RI+ ALI SQ+  +GLLSTKHA++S P L +LPVLTI FH +CKGRYE 
Sbjct  616   SAGAFWPDVHRRIVIALIVSQLLLMGLLSTKHASRSTPLLFILPVLTIGFHRFCKGRYEP  675

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISE-KADEEN  662
              F ++PLQ+A +KDTLE+ +EPN NLK +LQ+AY+HPVFK  ++  D   + E +AD+  
Sbjct  676   VFVRYPLQDAMVKDTLERTKEPNLNLKTFLQNAYVHPVFKAADNVKDEMVVEEPRADQTP  735

Query  661   VLVQTKRQSRKNT  623
              LV TKR S+++T
Sbjct  736   DLVATKRSSKRHT  748



>ref|XP_009135761.1| PREDICTED: CSC1-like protein At3g21620 [Brassica rapa]
Length=756

 Score =   354 bits (908),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 167/253 (66%), Positives = 207/253 (82%), Gaps = 4/253 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK L+++HLKN FLVKTEKDRE+A
Sbjct  499   PKTIGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLVIYHLKNFFLVKTEKDREEA  555

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG++ FN  EP+IQLYF+LGLVYAAV+PILLPFILVFFA AYVV+RHQIINVYNQEYE
Sbjct  556   MDPGTIGFNTGEPQIQLYFILGLVYAAVSPILLPFILVFFALAYVVYRHQIINVYNQEYE  615

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SA AFWPDVH R++ ALI SQ+  +GLLSTKHA++S P L +LPVLTI FH +CKGRYE 
Sbjct  616   SAGAFWPDVHRRVVIALIVSQLLLMGLLSTKHASRSTPLLFILPVLTIGFHRFCKGRYEP  675

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISE-KADEEN  662
              F ++PLQ+A +KDTLE+ +EPN NLK +LQ+AY+HPVFK  ++  D   + E +AD+  
Sbjct  676   VFVRYPLQDAMVKDTLERTKEPNLNLKTFLQNAYVHPVFKAADNVKDEMVVEEPRADQTP  735

Query  661   VLVQTKRQSRKNT  623
              LV TKR S+++T
Sbjct  736   DLVATKRSSKRHT  748



>emb|CDY48898.1| BnaA03g36370D [Brassica napus]
Length=756

 Score =   354 bits (908),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 167/253 (66%), Positives = 207/253 (82%), Gaps = 4/253 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK L+++HLKN FLVKTEKDRE+A
Sbjct  499   PKTIGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLVIYHLKNFFLVKTEKDREEA  555

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG++ FN  EP+IQLYF+LGLVYAAV+PILLPFILVFFA AYVV+RHQIINVYNQEYE
Sbjct  556   MDPGTIGFNTGEPQIQLYFILGLVYAAVSPILLPFILVFFALAYVVYRHQIINVYNQEYE  615

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SA AFWPDVH R++ ALI SQ+  +GLLSTKHA++S P L +LPVLTI FH +CKGRYE 
Sbjct  616   SAGAFWPDVHRRVVIALIVSQLLLMGLLSTKHASRSTPLLFILPVLTIGFHRFCKGRYEP  675

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISE-KADEEN  662
              F ++PLQ+A +KDTLE+ +EPN NLK +LQ+AY+HPVFK  ++  D   + E +AD+  
Sbjct  676   VFVRYPLQDAMVKDTLERTKEPNLNLKTFLQNAYVHPVFKAADNVKDEMVVEEPRADQTP  735

Query  661   VLVQTKRQSRKNT  623
              LV TKR S+++T
Sbjct  736   DLVATKRSSKRHT  748



>ref|XP_003610472.1| Membrane protein, putative [Medicago truncatula]
 ref|XP_003619262.1| Membrane protein, putative [Medicago truncatula]
 gb|AES92669.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=774

 Score =   354 bits (909),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 173/242 (71%), Positives = 200/242 (83%), Gaps = 2/242 (1%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             +KA+FFITYIMVDGW+GIA EVL LK LI++HLKN FLVKTEKDRE+AMNPGS+ FN  E
Sbjct  509   LKASFFITYIMVDGWSGIAAEVLMLKPLIMYHLKNFFLVKTEKDREEAMNPGSIGFNTGE  568

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             PRIQLYFLLGLVYAAVTP +LPFI++FF  AYVVFRHQIINVYNQEYES AAFWPDVH R
Sbjct  569   PRIQLYFLLGLVYAAVTPTVLPFIIIFFGLAYVVFRHQIINVYNQEYESGAAFWPDVHFR  628

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             +I AL+ SQ+  +GLL+TK AA S PFLIVLP+LTI FH YCKGR+ESAF K PLQEA M
Sbjct  629   VIIALLVSQIVLMGLLTTKKAASSTPFLIVLPILTIWFHRYCKGRFESAFVKFPLQEAMM  688

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNE--DEYDYDGISEKADEENVLVQTKRQSRK  629
             KDTLE+A EPN N+K YLQ AY+HPVFK +   D  + D +S K + E+  V TKRQSR+
Sbjct  689   KDTLERATEPNLNVKGYLQHAYVHPVFKASHDDDADEEDAMSLKWETESATVATKRQSRR  748

Query  628   NT  623
             +T
Sbjct  749   ST  750



>emb|CDY12941.1| BnaA09g13330D [Brassica napus]
Length=779

 Score =   354 bits (909),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 175/259 (68%), Positives = 205/259 (79%), Gaps = 13/259 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             +G+A P+           KATFFITYIMVDGW G+AGE+LRLK  ++FHLKN FLVKTEK
Sbjct  504   VGVAIPI-----------KATFFITYIMVDGWAGVAGEILRLKPFVIFHLKNFFLVKTEK  552

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PG + F   EPRIQLYFLLGLVYA VTP+LLPFI+ FF FAY++FRHQIINVY
Sbjct  553   DREEAMDPGQIDFYATEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYIIFRHQIINVY  612

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAA+WPDVHGRII ALI SQ+  +GL+STK  AQS PFL++LP+LTI FH +CK
Sbjct  613   NQEYESAAAYWPDVHGRIISALIISQILLIGLMSTKGKAQSTPFLVILPILTIGFHRFCK  672

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDG--ISE  680
             GRYESAF  +PLQEA +KDTLE+AREPN NLK +LQ+AYIHPVFK  E E D     I +
Sbjct  673   GRYESAFVVNPLQEAMIKDTLERAREPNLNLKGFLQNAYIHPVFKDEECEDDEYEELIED  732

Query  679   KADEENVLVQTKRQSRKNT  623
               DE  V+V TKRQSR+ T
Sbjct  733   SDDENCVVVPTKRQSRRTT  751



>gb|EYU27725.1| hypothetical protein MIMGU_mgv1a001730mg [Erythranthe guttata]
Length=768

 Score =   354 bits (908),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 175/257 (68%), Positives = 207/257 (81%), Gaps = 12/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITY+M+DGW G+AGE+LRLK LI FHLKN FLVKTEK
Sbjct  503   IGVAIPM-----------KATFFITYVMIDGWAGVAGEILRLKPLIFFHLKNFFLVKTEK  551

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE AM+ GS+ FN  EP+IQLYFLLGLVYA VTPI LPFILVFFA A+VV+RHQIINVY
Sbjct  552   DREAAMDAGSIGFNTGEPQIQLYFLLGLVYAVVTPIFLPFILVFFALAFVVYRHQIINVY  611

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWP VHGRI+FALIFSQ+  +GL+STK A  + PFLI LP+++  FHL+C+
Sbjct  612   NQEYESAAAFWPAVHGRIMFALIFSQIVLIGLMSTKRAVTTTPFLIALPIMSYFFHLFCR  671

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GR+E AF  +PLQEA MKDTLE+AREPN NLK YLQ++Y+HPVFK  E+E D D ++ K 
Sbjct  672   GRFEPAFVNYPLQEAMMKDTLERAREPNLNLKGYLQNSYVHPVFKDEEEEEDDDHVNGKY  731

Query  673   DEENVLVQTKRQSRKNT  623
             D +N +V TKRQSR+NT
Sbjct  732   D-DNAVVATKRQSRRNT  747



>ref|XP_009113086.1| PREDICTED: CSC1-like protein At1g62320 [Brassica rapa]
Length=779

 Score =   353 bits (907),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 174/259 (67%), Positives = 210/259 (81%), Gaps = 13/259 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             +G+A P+           KATFFITYIMVDGW G+AGE+LRLK  ++FHLKN FLVKTEK
Sbjct  504   VGVAIPI-----------KATFFITYIMVDGWAGVAGEILRLKPFVIFHLKNFFLVKTEK  552

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PG + F   EPRIQLYFLLGLVYA VTP+LLPFI+ FF FAY++FRHQIINVY
Sbjct  553   DREEAMDPGQIDFYATEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYLIFRHQIINVY  612

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAA+WPDVHGRII ALI SQ+  +GL+STK  AQS PFL++LP+LTI FH +CK
Sbjct  613   NQEYESAAAYWPDVHGRIISALIISQILLIGLMSTKGKAQSTPFLVILPILTIGFHRFCK  672

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFK-GNEDEYDYDGISEK  677
             GRYESAF  +PLQEA +KDTLE+AREPN NLK +LQ+AYIHPVFK    ++ +Y+ + E 
Sbjct  673   GRYESAFVVNPLQEAMIKDTLERAREPNLNLKGFLQNAYIHPVFKDEECEDDEYEELIED  732

Query  676   ADEEN-VLVQTKRQSRKNT  623
             +D+EN V+V TKRQSR+ T
Sbjct  733   SDDENCVVVPTKRQSRRTT  751



>gb|EPS71959.1| hypothetical protein M569_02795, partial [Genlisea aurea]
Length=761

 Score =   353 bits (905),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 174/259 (67%), Positives = 207/259 (80%), Gaps = 13/259 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITY+MVDGW G+AGEVLRLK LI +HLKN FLVKTEK
Sbjct  505   IGVAIPM-----------KATFFITYVMVDGWAGVAGEVLRLKPLIFYHLKNFFLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EP+IQLYFLLG VYA VTP L+PFILVFFAFAYV++RHQIINVY
Sbjct  554   DREEAMDPGSIGFNTGEPQIQLYFLLGFVYAVVTPFLIPFILVFFAFAYVIYRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSA-PFLIVLPVLTITFHLYC  857
             NQ YESAAAFWP VHGRIIF+L+FSQ+  LGLLS+K AAQ A PFLI LP+LTI FH+ C
Sbjct  614   NQVYESAAAFWPGVHGRIIFSLVFSQIVLLGLLSSKGAAQEATPFLIALPILTIWFHIVC  673

Query  856   KGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNE-DEYDYDGISE  680
             KGRYE AF ++PLQEA +KDTLE+ RE N NLK YL+DAY+HPVFK ++ ++       +
Sbjct  674   KGRYEPAFIRYPLQEAMIKDTLEKTRERNLNLKKYLRDAYVHPVFKNDDANDDHGYDYDD  733

Query  679   KADEENVLVQTKRQSRKNT  623
              + ++N LV TKRQSR++T
Sbjct  734   DSTKDNNLVPTKRQSRRST  752



>ref|XP_010430277.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010430278.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010430279.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010430280.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010430281.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
Length=780

 Score =   353 bits (906),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 175/262 (67%), Positives = 210/262 (80%), Gaps = 17/262 (6%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             +G+A P+           KATFFITYIMVDGW G+AGE+LRLK L++FHLKN FLVKTEK
Sbjct  504   VGVAIPI-----------KATFFITYIMVDGWAGVAGEILRLKPLVIFHLKNFFLVKTEK  552

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PG + F   EPRIQLYFLLGLVYA VTP+LLPFI+ FF FAY++FRHQIINVY
Sbjct  553   DREEAMDPGQIDFYATEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYLIFRHQIINVY  612

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRII ALI SQ+  LGL+STK   QS PFL+VL +LT  FH +CK
Sbjct  613   NQEYESAAAFWPDVHGRIISALIISQILLLGLMSTKGKVQSTPFLLVLAILTFVFHRFCK  672

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNE---DEYDYDGIS  683
             GRYESAF  +PLQEA +KDTLE+AREPN NLK +LQ+AYIHPVFK  E   D++D +G++
Sbjct  673   GRYESAFVINPLQEAMIKDTLERAREPNMNLKGFLQNAYIHPVFKDEEFEDDQFD-EGLT  731

Query  682   EKADEEN-VLVQTKR-QSRKNT  623
             E +D+E+ V+V TKR + R+ T
Sbjct  732   EDSDDEDCVVVPTKRHRPRRKT  753



>ref|XP_010418218.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010418219.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
 ref|XP_010418220.1| PREDICTED: CSC1-like protein At1g62320 [Camelina sativa]
Length=780

 Score =   353 bits (906),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 175/262 (67%), Positives = 210/262 (80%), Gaps = 17/262 (6%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             +G+A P+           KATFFITYIMVDGW G+AGE+LRLK L++FHLKN FLVKTEK
Sbjct  504   VGVAIPI-----------KATFFITYIMVDGWAGVAGEILRLKPLVIFHLKNFFLVKTEK  552

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PG + F   EPRIQLYFLLGLVYA VTP+LLPFI+ FF FAY++FRHQIINVY
Sbjct  553   DREEAMDPGQIDFYATEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYLIFRHQIINVY  612

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRII ALI SQ+  LGL+STK   QS PFL+VL +LT  FH +CK
Sbjct  613   NQEYESAAAFWPDVHGRIISALIISQILLLGLMSTKGKVQSTPFLLVLAILTFVFHRFCK  672

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNE---DEYDYDGIS  683
             GRYESAF  +PLQEA +KDTLE+AREPN NLK +LQ+AYIHPVFK  E   D++D +G++
Sbjct  673   GRYESAFVINPLQEAMIKDTLERAREPNMNLKGFLQNAYIHPVFKDEEFEDDQFD-EGLT  731

Query  682   EKADEEN-VLVQTKR-QSRKNT  623
             E +D+E+ V+V TKR + R+ T
Sbjct  732   EDSDDEDCVVVPTKRHRPRRKT  753



>ref|XP_006300401.1| hypothetical protein CARUB_v10019839mg [Capsella rubella]
 gb|EOA33299.1| hypothetical protein CARUB_v10019839mg [Capsella rubella]
Length=774

 Score =   353 bits (905),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 174/260 (67%), Positives = 206/260 (79%), Gaps = 14/260 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             +G+A P+           KATFFITYIMVDGW G+AGE+LRLK L++FHLKN FLVKTEK
Sbjct  504   VGVAIPI-----------KATFFITYIMVDGWAGVAGEILRLKPLVIFHLKNFFLVKTEK  552

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PG + F   EPRIQLYFLLGLVYA VTP+LLPFI+ FF FAY++FRHQIINVY
Sbjct  553   DREEAMDPGQIDFYATEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYLIFRHQIINVY  612

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRII ALI SQ+  LGL+STK   QS PFL+VL +LT  FH  CK
Sbjct  613   NQEYESAAAFWPDVHGRIITALIISQILLLGLMSTKGKVQSTPFLLVLSILTFGFHRICK  672

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYD--YDGISE  680
             GRYESAF  +PLQEA +KDTLE+AREPN NLK +LQ+AYIHPVFK  E E D  ++ ++E
Sbjct  673   GRYESAFVINPLQEAMIKDTLERAREPNLNLKGFLQNAYIHPVFKDEEYEEDDQFERLTE  732

Query  679   KADEEN-VLVQTKRQSRKNT  623
              +D+E+ V+V TKRQ  + T
Sbjct  733   DSDDEDCVVVPTKRQKPRRT  752



>ref|XP_004293317.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Fragaria vesca subsp. vesca]
Length=776

 Score =   352 bits (904),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 176/254 (69%), Positives = 208/254 (82%), Gaps = 5/254 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P+ +G +     +KATFFITYIMVDGW GIA E+L LK LI++HLKN+FLVKT+KDRE+A
Sbjct  503   PVTIGTAVP---IKATFFITYIMVDGWAGIAAEILMLKPLIIYHLKNTFLVKTDKDREEA  559

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGS+ FN  EPRIQLY LLGLVYA +TP+LLPFI++FF  AYVVFRHQIINVYNQEYE
Sbjct  560   MDPGSIGFNTGEPRIQLYILLGLVYATLTPVLLPFIIIFFGLAYVVFRHQIINVYNQEYE  619

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVHGRI+ AL+ SQ+  LGLL+TK AAQS PFL+ LPVLT  F+ YC+GR+E 
Sbjct  620   SAAAFWPDVHGRILSALLISQLVLLGLLTTKKAAQSTPFLLALPVLTFAFYKYCQGRFEP  679

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGIS-EKADEEN  662
             AF ++PLQEAKMKDTLE AREPN NLK YLQ AY+HPVFK  +D+ D D  S EK + E+
Sbjct  680   AFVRYPLQEAKMKDTLESAREPNLNLKGYLQSAYVHPVFKECDDDDDEDHYSFEKYENES  739

Query  661   -VLVQTKRQSRKNT  623
              V V TKRQSR+NT
Sbjct  740   CVTVATKRQSRRNT  753



>emb|CDP03600.1| unnamed protein product [Coffea canephora]
Length=756

 Score =   351 bits (901),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 172/241 (71%), Positives = 198/241 (82%), Gaps = 5/241 (2%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             MKATFFITYIMVDGW GIA E+LRL  L++FHLKN+FLVKTE+DREDAM+PGS+ F+ +E
Sbjct  508   MKATFFITYIMVDGWAGIAAEILRLVPLVMFHLKNTFLVKTEQDREDAMDPGSINFSTSE  567

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             PRIQLYFLLGLVY+ VTPILLPFI++FFAFAYVVFRHQIINVY+Q+YES A FWPDVH R
Sbjct  568   PRIQLYFLLGLVYSVVTPILLPFIIIFFAFAYVVFRHQIINVYDQKYESGAKFWPDVHRR  627

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             II AL+ SQ+  +GLLSTK AA S P LIVLPVLTI FHL+CKGR+ESAF K PLQ+A +
Sbjct  628   IIVALVISQLLLMGLLSTKKAANSTPLLIVLPVLTIWFHLFCKGRFESAFVKFPLQDAMV  687

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEE-NVLVQTKRQSRKN  626
             KDTLE+A EPN NLK YL DAYIHPVFK  +     D      DEE N LV TKR SR++
Sbjct  688   KDTLERATEPNLNLKAYLHDAYIHPVFKCVQ----LDKPKAVDDEENNPLVATKRNSRRD  743

Query  625   T  623
             +
Sbjct  744   S  744



>ref|XP_011046975.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
 ref|XP_011046976.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
Length=774

 Score =   351 bits (901),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 184/258 (71%), Positives = 214/258 (83%), Gaps = 12/258 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW GIAGEVL LK L+L+HLKN  LVKTEK
Sbjct  505   IGVAVPM-----------KATFFITYIMVDGWAGIAGEVLMLKPLVLYHLKNFLLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGSL FN  EPRIQLYFLLGLVYA VTP+LLPFI++FFAFA+ VFRHQIINVY
Sbjct  554   DREEAMDPGSLGFNTGEPRIQLYFLLGLVYATVTPVLLPFIIIFFAFAFAVFRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYES AAFWPDVHGR+I AL+ SQ++ +GL+STK AAQS PFLI LPVLTI FH++C 
Sbjct  614   NQEYESGAAFWPDVHGRVITALVISQLALMGLMSTKEAAQSTPFLIALPVLTIWFHMFCN  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDG-ISEK  677
             GR++SAF K+PLQEA MKDTLE+AR+PNFNLK YLQ AY+HPVFK ++D+ D D  +S K
Sbjct  674   GRHKSAFVKYPLQEAMMKDTLERARDPNFNLKAYLQSAYVHPVFKVDDDDIDEDDLLSGK  733

Query  676   ADEENVLVQTKRQSRKNT  623
              + E+VLV TKRQSR+NT
Sbjct  734   METESVLVPTKRQSRRNT  751



>gb|KCW77011.1| hypothetical protein EUGRSUZ_D01358 [Eucalyptus grandis]
Length=663

 Score =   348 bits (893),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 172/240 (72%), Positives = 201/240 (84%), Gaps = 1/240 (0%)
 Frame = -2

Query  1339  KATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNEP  1160
             +ATFFITYIMVDGW GIA E+L LK LI++HLKN FLVKTEKDRE+AM+PGS+ FN  EP
Sbjct  401   RATFFITYIMVDGWAGIAAEILMLKPLIIYHLKNFFLVKTEKDREEAMDPGSIGFNTGEP  460

Query  1159  RIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGRI  980
             +IQ YFLLGLVYA VTP LLPFILVFF  AYVVFRHQIINVYNQEYESAAAFWPDVH R+
Sbjct  461   QIQFYFLLGLVYATVTPALLPFILVFFGLAYVVFRHQIINVYNQEYESAAAFWPDVHRRV  520

Query  979   IFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKMK  800
             I AL+ SQ+   GL++TK AA S PFLI LPVLTI FH++CKGR+E AF ++PLQEA MK
Sbjct  521   IVALVVSQLLLFGLMATKQAANSTPFLIALPVLTIYFHMFCKGRFEPAFVRYPLQEAMMK  580

Query  799   DTLEQAREPNFNLKPYLQDAYIHPVFK-GNEDEYDYDGISEKADEENVLVQTKRQSRKNT  623
             DTLE+AREP+ NLK +LQ+AY+HPVFK  ++D+ D D + EK D E+VLV TKR SR+NT
Sbjct  581   DTLERAREPHVNLKSFLQNAYLHPVFKSADDDDEDDDDVDEKWDNESVLVPTKRSSRRNT  640



>ref|XP_011014901.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
Length=774

 Score =   351 bits (901),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 184/258 (71%), Positives = 214/258 (83%), Gaps = 12/258 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW GIAGEVL LK L+L+HLKN  LVKTEK
Sbjct  505   IGVAVPM-----------KATFFITYIMVDGWAGIAGEVLMLKPLVLYHLKNFLLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGSL FN  EPRIQLYFLLGLVYA VTP+LLPFI++FFAFA+ VFRHQIINVY
Sbjct  554   DREEAMDPGSLGFNSGEPRIQLYFLLGLVYATVTPVLLPFIIIFFAFAFAVFRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYES AAFWPDVHGR+I AL+ SQ++ +GL+STK AAQS PFLI LPVLTI FH++C 
Sbjct  614   NQEYESGAAFWPDVHGRVITALVISQLALMGLMSTKEAAQSTPFLIALPVLTIWFHMFCN  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDG-ISEK  677
             GR++SAF K+PLQEA MKDTLE+AR+PNFNLK YLQ AY+HPVFK ++D+ D D  +S K
Sbjct  674   GRHKSAFVKYPLQEAMMKDTLERARDPNFNLKAYLQSAYVHPVFKVDDDDIDEDDLLSGK  733

Query  676   ADEENVLVQTKRQSRKNT  623
              + E+VLV TKRQSR+NT
Sbjct  734   METESVLVPTKRQSRRNT  751



>ref|XP_003555683.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoformX1 
[Glycine max]
 ref|XP_006605689.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Glycine max]
Length=774

 Score =   351 bits (900),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 174/242 (72%), Positives = 201/242 (83%), Gaps = 2/242 (1%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             +KA+FFITYIMVDGW  IA EVL LK LI++HLKN FLVKTEKDRE+AM+PGS+ FN  E
Sbjct  509   LKASFFITYIMVDGWASIAAEVLMLKPLIVYHLKNFFLVKTEKDREEAMDPGSIGFNTGE  568

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             PRIQLYFLLGLVYAAVTP +LPFI VFF  AY+VFRHQIINVYNQEYES AAFWPDVH R
Sbjct  569   PRIQLYFLLGLVYAAVTPAVLPFITVFFGLAYLVFRHQIINVYNQEYESGAAFWPDVHFR  628

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             I+ ALI SQ+  +GLL+TK AA S PFLIVLP+LTI FH YCKGR+ESAF K PLQEA M
Sbjct  629   IVMALIVSQIVLMGLLTTKKAASSTPFLIVLPILTIWFHRYCKGRFESAFVKFPLQEAMM  688

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGN--EDEYDYDGISEKADEENVLVQTKRQSRK  629
             KDTLE+A EPN NLK YLQ+AY+HPVFK +  +D+ + D +S   + E+V V+TKRQSR+
Sbjct  689   KDTLERATEPNLNLKGYLQNAYVHPVFKDSMDDDDDEEDRLSIDLETESVTVRTKRQSRR  748

Query  628   NT  623
             NT
Sbjct  749   NT  750



>gb|KHN28986.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=774

 Score =   351 bits (900),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 174/242 (72%), Positives = 201/242 (83%), Gaps = 2/242 (1%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             +KA+FFITYIMVDGW  IA EVL LK LI++HLKN FLVKTEKDRE+AM+PGS+ FN  E
Sbjct  509   LKASFFITYIMVDGWASIAAEVLMLKPLIVYHLKNFFLVKTEKDREEAMDPGSIGFNTGE  568

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             PRIQLYFLLGLVYAAVTP +LPFI VFF  AY+VFRHQIINVYNQEYES AAFWPDVH R
Sbjct  569   PRIQLYFLLGLVYAAVTPAVLPFITVFFGLAYLVFRHQIINVYNQEYESGAAFWPDVHFR  628

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             I+ ALI SQ+  +GLL+TK AA S PFLIVLP+LTI FH YCKGR+ESAF K PLQEA M
Sbjct  629   IVMALIVSQIVLMGLLTTKKAASSTPFLIVLPILTIWFHRYCKGRFESAFVKFPLQEAMM  688

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGN--EDEYDYDGISEKADEENVLVQTKRQSRK  629
             KDTLE+A EPN NLK YLQ+AY+HPVFK +  +D+ + D +S   + E+V V+TKRQSR+
Sbjct  689   KDTLERATEPNLNLKGYLQNAYVHPVFKDSMDDDDDEEDRLSIDLETESVTVRTKRQSRR  748

Query  628   NT  623
             NT
Sbjct  749   NT  750



>ref|XP_010921296.1| PREDICTED: calcium permeable stress-gated cation channel 1 isoform 
X1 [Elaeis guineensis]
Length=760

 Score =   350 bits (898),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 180/252 (71%), Positives = 207/252 (82%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW GIAGE+LRLK LI++HLKN FLVKTEKDRE+A
Sbjct  498   PKTIGVSIP---MKATFFITYIMVDGWAGIAGEILRLKPLIIYHLKNFFLVKTEKDREEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGS+ F  +EP+IQLYFLLGLVYA VTP LLPFI++FF  AYVVFRHQIINVYNQEYE
Sbjct  555   MDPGSVDFGSSEPQIQLYFLLGLVYAVVTPFLLPFIIIFFGLAYVVFRHQIINVYNQEYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S AAFWPDVHGRII ALI SQ+  LGLLSTKHA+QS P LI LP+LTI FH +CK RYE 
Sbjct  615   SGAAFWPDVHGRIITALIISQLLLLGLLSTKHASQSTPLLIALPILTIWFHRFCKNRYEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF  +PLQEA MKDT+EQAREPN +LK YL +AYIHPVFK  ED+ ++  I E+ + +N 
Sbjct  675   AFVIYPLQEAMMKDTVEQAREPNLDLKAYLLNAYIHPVFKDGEDDDNF-SIGEEQEYDNT  733

Query  658   LVQTKRQSRKNT  623
             LV TKRQSR+NT
Sbjct  734   LVPTKRQSRRNT  745



>ref|XP_007145950.1| hypothetical protein PHAVU_006G000300g [Phaseolus vulgaris]
 gb|ESW17944.1| hypothetical protein PHAVU_006G000300g [Phaseolus vulgaris]
Length=773

 Score =   350 bits (899),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 172/242 (71%), Positives = 199/242 (82%), Gaps = 2/242 (1%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             +KA+FFITYIMVDGW  IA EVL LK LI +HLKN FLVKTEKDRE+AM+PGS+ FN  E
Sbjct  509   LKASFFITYIMVDGWASIAAEVLMLKPLIFYHLKNFFLVKTEKDREEAMDPGSIGFNTGE  568

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             PRIQLYFLLGLVYAAVTP +LPFI+VFF  AY+VFRHQIINVYNQEYES AAFWPDVH R
Sbjct  569   PRIQLYFLLGLVYAAVTPAVLPFIIVFFGLAYLVFRHQIINVYNQEYESGAAFWPDVHFR  628

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             II ALI SQ+  +GLL+TK AA S PFLIVLP+LTI FH YCKGR+ESAF K PLQEA M
Sbjct  629   IILALIVSQIVLMGLLTTKKAASSTPFLIVLPILTIWFHRYCKGRFESAFVKFPLQEAMM  688

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDG--ISEKADEENVLVQTKRQSRK  629
             KDTLE+A EPN NLK YLQ+AY+HP+FK + +E   +   +  + + E+ +V+TKRQSRK
Sbjct  689   KDTLERAIEPNLNLKGYLQNAYVHPIFKDSMEEETDEEEILGMEFETESAIVRTKRQSRK  748

Query  628   NT  623
             NT
Sbjct  749   NT  750



>ref|XP_008675529.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Zea mays]
 ref|XP_008675530.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Zea mays]
 tpg|DAA59084.1| TPA: hypothetical protein ZEAMMB73_475653 [Zea mays]
Length=768

 Score =   350 bits (898),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 172/240 (72%), Positives = 200/240 (83%), Gaps = 1/240 (0%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             MKATFFITY MVDGW G+AGE+LRLK L++FHLKN FLVKTEKDRE+AM+PGS+ F+ +E
Sbjct  507   MKATFFITYTMVDGWAGVAGEILRLKPLVIFHLKNFFLVKTEKDREEAMDPGSIGFDSSE  566

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             P+IQLYFLLGLVYAAVTP LLPF+L+FF FAYVV+RHQIINVYNQEYESAAAFWP VHGR
Sbjct  567   PQIQLYFLLGLVYAAVTPFLLPFVLIFFGFAYVVYRHQIINVYNQEYESAAAFWPSVHGR  626

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             II ALI SQ+  LGLLSTK A QS P L+VLPV+T  FH YC  RY+  F K PLQEA  
Sbjct  627   IITALIVSQLLLLGLLSTKGAGQSTPVLLVLPVVTFYFHKYCNNRYKPTFVKCPLQEAMK  686

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  623
             KDTLE+AREP F+LK YL +AYIHPVFKG+ D+ D   ++++ + E VLV TKRQSR+NT
Sbjct  687   KDTLERAREPGFDLKGYLMNAYIHPVFKGDGDD-DKFSVADEPEAEQVLVATKRQSRRNT  745



>ref|XP_011046977.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
 ref|XP_011046978.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Populus euphratica]
Length=774

 Score =   350 bits (898),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 184/258 (71%), Positives = 213/258 (83%), Gaps = 12/258 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW GIAGEVL LK LI +HLKN  LVKTEK
Sbjct  505   IGVAVPM-----------KATFFITYIMVDGWAGIAGEVLMLKPLIFYHLKNFLLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGSL FN  EPRIQLYFLLGLVYA VTP+LLPFI++FFAFA+ VFRHQIINVY
Sbjct  554   DREEAMDPGSLGFNTGEPRIQLYFLLGLVYATVTPVLLPFIIIFFAFAFAVFRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYES AAFWPDVHGR+I AL+ SQ++ +GL+STK AAQS PFLI LPVLTI FH++C 
Sbjct  614   NQEYESGAAFWPDVHGRVITALVISQLALMGLMSTKEAAQSTPFLIALPVLTIWFHMFCN  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDG-ISEK  677
             GR++SAF K+PLQEA MKDTLE+AR+PNFNLK YLQ AY+HPVFK ++D+ D D  +S K
Sbjct  674   GRHKSAFVKYPLQEAMMKDTLERARDPNFNLKAYLQSAYVHPVFKVDDDDIDEDDLLSGK  733

Query  676   ADEENVLVQTKRQSRKNT  623
              + E+VLV TKRQSR+NT
Sbjct  734   METESVLVPTKRQSRRNT  751



>ref|XP_006843810.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Amborella 
trichopoda]
 gb|ERN05485.1| hypothetical protein AMTR_s00007p00254340 [Amborella trichopoda]
Length=763

 Score =   349 bits (896),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 175/253 (69%), Positives = 206/253 (81%), Gaps = 7/253 (3%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P+ +G+S     MKATFFITY+M+DGW GIA E+LRLK L+++HLKN FLVKTEKDRE+A
Sbjct  498   PITIGVSIP---MKATFFITYVMLDGWAGIAAEILRLKPLVIYHLKNFFLVKTEKDREEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGSL FN +EP+IQLYFLLGLVYA VTP+LLPFI+VFF FAYVVFRHQ+INVYNQEYE
Sbjct  555   MDPGSLGFNSSEPQIQLYFLLGLVYAVVTPVLLPFIVVFFGFAYVVFRHQVINVYNQEYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S AAFWPDVHGRII AL+ SQ+  LGLLSTK AAQS P L+ LPVLTI FH +CK R+ES
Sbjct  615   SGAAFWPDVHGRIITALVISQLLLLGLLSTKLAAQSTPLLLALPVLTIWFHRFCKDRFES  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGIS-EKADEEN  662
             AF K PL+EA +KDTLE+A +PN NLK YL +AYIHPVFKG E+    D +S    +++ 
Sbjct  675   AFVKFPLEEAMIKDTLERATDPNLNLKGYLSNAYIHPVFKGGEES---DSVSLADIEQDE  731

Query  661   VLVQTKRQSRKNT  623
              LV TKRQSR NT
Sbjct  732   ALVPTKRQSRMNT  744



>ref|XP_010924083.1| PREDICTED: protein OSCA1-like isoform X6 [Elaeis guineensis]
Length=684

 Score =   347 bits (890),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 180/252 (71%), Positives = 206/252 (82%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFI+YIMVDGW GIAGE+LRLK LI+FHLKN FLVKTEKDRE+A
Sbjct  416   PKTIGVSIP---MKATFFISYIMVDGWAGIAGEILRLKPLIVFHLKNFFLVKTEKDREEA  472

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGS+ F  +EP+IQLYFLLGLVYA VTP LLPFI++FF  AY VFRHQIINVYNQEYE
Sbjct  473   MDPGSIEFGSSEPQIQLYFLLGLVYAVVTPFLLPFIIIFFGLAYAVFRHQIINVYNQEYE  532

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S AAFWPDVHGRII ALI SQ+  LGLLSTK AAQS PFLI LP+LTI FH +CK RYE 
Sbjct  533   SGAAFWPDVHGRIITALIISQLLLLGLLSTKEAAQSTPFLIALPILTIWFHRFCKSRYEP  592

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF K+PLQEA MKDTLE+A+EPN +LK YL +AY+HPVFK + DE D   + E+   +NV
Sbjct  593   AFVKYPLQEAMMKDTLERAKEPNLDLKAYLVNAYVHPVFK-DGDEDDSFSVDEEVVYDNV  651

Query  658   LVQTKRQSRKNT  623
             LV TKRQSR+NT
Sbjct  652   LVPTKRQSRRNT  663



>gb|EYU33878.1| hypothetical protein MIMGU_mgv1a018274mg [Erythranthe guttata]
Length=770

 Score =   349 bits (896),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 176/261 (67%), Positives = 206/261 (79%), Gaps = 15/261 (6%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITY+MVDGW G+AGE+LRLK LI FHLKN FLVKTEK
Sbjct  506   IGVAIPM-----------KATFFITYVMVDGWAGVAGEILRLKPLIFFHLKNFFLVKTEK  554

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DR++AM+PGS+ FN  EP+IQLYFLLGLVYA VTPI LPFILVFFA AYVVFRHQIINVY
Sbjct  555   DRDEAMDPGSIGFNTGEPQIQLYFLLGLVYAVVTPIFLPFILVFFALAYVVFRHQIINVY  614

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWP VHGRII AL+FSQ+  +GL+STK  AQS P LI LPVLTI FH +CK
Sbjct  615   NQEYESAAAFWPGVHGRIISALVFSQLVLMGLMSTKGNAQSTPILIALPVLTIWFHRFCK  674

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGI----  686
             GRYE AF ++PLQEA MKDTLE++REPN N+K YL+ AYIHPVFK  +++ + +      
Sbjct  675   GRYEPAFIRYPLQEAMMKDTLERSREPNLNVKSYLEYAYIHPVFKNEDEDDEDEYEGECN  734

Query  685   SEKADEENVLVQTKRQSRKNT  623
             + K  + +VLV TKR SR++T
Sbjct  735   NGKLLDGSVLVPTKRHSRRHT  755



>ref|XP_008799225.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Phoenix dactylifera]
Length=762

 Score =   349 bits (896),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 179/252 (71%), Positives = 206/252 (82%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW GIAGE+LRLK L+++HLKN FLVKTEKDRE+A
Sbjct  498   PKTIGVSIP---MKATFFITYIMVDGWAGIAGEILRLKPLVIYHLKNFFLVKTEKDREEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGS+ F  +EP+IQLYFLLGLVYA VTP LLPFI++FF  AYVVFRHQIINVYNQEYE
Sbjct  555   MDPGSIDFGSSEPQIQLYFLLGLVYAVVTPFLLPFIIIFFGLAYVVFRHQIINVYNQEYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S AAFWP VHGRII ALI SQ+  LGLLSTK AAQS P LI LP+LTI+FH +CK RYE 
Sbjct  615   SGAAFWPAVHGRIICALIISQLLLLGLLSTKQAAQSTPLLIALPILTISFHRFCKNRYEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF K+PLQEA MKDTLE AREPN +LK YL +AYIHPVFK  ED+ ++  + E+ + +N 
Sbjct  675   AFVKYPLQEAMMKDTLEHAREPNLDLKSYLLNAYIHPVFKDEEDDDNF-SMGEEREYDNT  733

Query  658   LVQTKRQSRKNT  623
             LV TKRQSRKNT
Sbjct  734   LVPTKRQSRKNT  745



>ref|XP_008673458.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Zea mays]
Length=768

 Score =   349 bits (895),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 172/240 (72%), Positives = 199/240 (83%), Gaps = 1/240 (0%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             MKATFFITY MVDGW G+AGE+LRLK L++FHLKN FLVKTEKDRE+AM+PGS+ F+ +E
Sbjct  507   MKATFFITYTMVDGWAGVAGEILRLKPLVIFHLKNFFLVKTEKDREEAMDPGSIGFDSSE  566

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             P+IQLYFLLGLVYAAVTP LLPF+L+FF FAYVV+RHQIINVYNQEYESAAAFWP VHGR
Sbjct  567   PQIQLYFLLGLVYAAVTPFLLPFVLIFFGFAYVVYRHQIINVYNQEYESAAAFWPSVHGR  626

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             II ALI SQ+  LGLLSTK A QS P L+VLPV+T  FH YC  RY+  F K PLQEA  
Sbjct  627   IITALIVSQLLLLGLLSTKGAGQSTPVLLVLPVVTFYFHKYCNNRYKPTFVKCPLQEAMK  686

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  623
             KDTLE+AREP F+LK YL +AYIHPVFKG+ D+ D   + ++ + E VLV TKRQSR+NT
Sbjct  687   KDTLERAREPGFDLKGYLMNAYIHPVFKGDGDD-DKFSVVDQPEAEQVLVATKRQSRRNT  745



>ref|XP_008371060.1| PREDICTED: transmembrane protein 63B-like [Malus domestica]
Length=772

 Score =   349 bits (895),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 180/257 (70%), Positives = 203/257 (79%), Gaps = 12/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFI+YIMVDGW GIA E+L LK LI++HLKN FLVKT+K
Sbjct  505   IGVAIPM-----------KATFFISYIMVDGWAGIAAEILMLKPLIIYHLKNFFLVKTDK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ FN  EP+IQLY LLGLVYA VTP LLPFI++FF  AYVVFRHQIINVY
Sbjct  554   DREEAMDPGSIGFNTGEPQIQLYILLGLVYATVTPTLLPFIIIFFGLAYVVFRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGRII ALI SQ+   GLLSTK AA S PFLI LPVLT++FH YCK
Sbjct  614   NQEYESAAAFWPDVHGRIITALIISQLLLFGLLSTKEAASSTPFLIALPVLTLSFHRYCK  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GR+E AFT +PLQEA MKDTLE+AREPN NLK YLQ AYIHPVF    DE +     EK 
Sbjct  674   GRFEPAFTTYPLQEAMMKDTLERAREPNLNLKGYLQSAYIHPVFH-ECDEEEDHESFEKE  732

Query  673   DEENVLVQTKRQSRKNT  623
             + E+V+V TKRQSR+NT
Sbjct  733   ESESVIVPTKRQSRRNT  749



>emb|CDY32032.1| BnaA03g60360D [Brassica napus]
Length=796

 Score =   349 bits (896),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 170/256 (66%), Positives = 206/256 (80%), Gaps = 13/256 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             +G+A P+           KATFFITYIMVDGW G+AGE+LRLKA I+FHLKN FLVKTEK
Sbjct  505   VGVAIPI-----------KATFFITYIMVDGWAGVAGEILRLKAFIIFHLKNLFLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PG + F  NEPRIQLYFLLGLVYA VTP+LLPFI+ FF FAY++FRHQIINVY
Sbjct  554   DREEAMDPGQIDFYVNEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYLIFRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQ+YESAAA+WPDVHGRII ALI SQ+  +GL+STK  AQS PFL+VLP+LT  FH +CK
Sbjct  614   NQKYESAAAYWPDVHGRIISALIISQLLLIGLMSTKGKAQSTPFLVVLPILTFCFHRFCK  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYD-YDGISEK  677
              RYES F  +PLQEA +KD++E+AREPN NLK +L++AYIHPVFK  E E D ++ + E 
Sbjct  674   DRYESVFVINPLQEAMIKDSMERAREPNLNLKRFLKNAYIHPVFKDKEYEDDLHEELIED  733

Query  676   ADEEN-VLVQTKRQSR  632
             +D+EN V+V TK QS+
Sbjct  734   SDDENCVVVPTKHQSQ  749



>ref|XP_010924080.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X3 [Elaeis guineensis]
Length=732

 Score =   347 bits (891),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 180/252 (71%), Positives = 206/252 (82%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFI+YIMVDGW GIAGE+LRLK LI+FHLKN FLVKTEKDRE+A
Sbjct  464   PKTIGVSIP---MKATFFISYIMVDGWAGIAGEILRLKPLIVFHLKNFFLVKTEKDREEA  520

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGS+ F  +EP+IQLYFLLGLVYA VTP LLPFI++FF  AY VFRHQIINVYNQEYE
Sbjct  521   MDPGSIEFGSSEPQIQLYFLLGLVYAVVTPFLLPFIIIFFGLAYAVFRHQIINVYNQEYE  580

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S AAFWPDVHGRII ALI SQ+  LGLLSTK AAQS PFLI LP+LTI FH +CK RYE 
Sbjct  581   SGAAFWPDVHGRIITALIISQLLLLGLLSTKEAAQSTPFLIALPILTIWFHRFCKSRYEP  640

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF K+PLQEA MKDTLE+A+EPN +LK YL +AY+HPVFK + DE D   + E+   +NV
Sbjct  641   AFVKYPLQEAMMKDTLERAKEPNLDLKAYLVNAYVHPVFK-DGDEDDSFSVDEEVVYDNV  699

Query  658   LVQTKRQSRKNT  623
             LV TKRQSR+NT
Sbjct  700   LVPTKRQSRRNT  711



>ref|XP_011625695.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Amborella 
trichopoda]
Length=765

 Score =   348 bits (893),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 172/252 (68%), Positives = 201/252 (80%), Gaps = 5/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYI+VDGW+G+A EVLRLK LI++HLKN+ LVKTEKDREDA
Sbjct  500   PKTIGVSIP---MKATFFITYILVDGWSGVAAEVLRLKPLIMYHLKNALLVKTEKDREDA  556

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             MNPGSL F  +EP++QLYFLLGLVYA VTPILLPFI+VFF  AY+V+RHQIINVYNQEYE
Sbjct  557   MNPGSLGFASSEPQLQLYFLLGLVYAVVTPILLPFIVVFFGLAYMVYRHQIINVYNQEYE  616

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAA+FWPDVHGRI+ A++ SQ+  +GL+ST+ AAQS   LI LP+LTI FHL CK R+ES
Sbjct  617   SAASFWPDVHGRIVTAMVISQLVLMGLVSTRGAAQSTTVLIPLPILTIWFHLVCKSRFES  676

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF K PLQEA MKDTLE+A EPN NLK YLQDAYIHPVFKG    +      E  +E N 
Sbjct  677   AFVKFPLQEAMMKDTLERATEPNLNLKVYLQDAYIHPVFKGGNGHHQPKPGFE--EETNP  734

Query  658   LVQTKRQSRKNT  623
             LV TKR S+ +T
Sbjct  735   LVPTKRHSQLST  746



>ref|XP_009123383.1| PREDICTED: CSC1-like protein At1g62320 [Brassica rapa]
Length=762

 Score =   348 bits (893),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 169/256 (66%), Positives = 206/256 (80%), Gaps = 13/256 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             +G+A P+           KATFFITYIMVDGW G+AGE+LRLKA I+FHLKN FLVKTEK
Sbjct  505   VGVAIPI-----------KATFFITYIMVDGWAGVAGEILRLKAFIIFHLKNLFLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PG + F  NEPRIQLYFLLGLVYA VTP+LLPFI+ FF FAY++FRHQIINVY
Sbjct  554   DREEAMDPGQIDFYVNEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYLIFRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQ+YESAAA+WPDVHGRI+ ALI SQ+  +GL+STK  AQS PFL+VLP+LT  FH +CK
Sbjct  614   NQKYESAAAYWPDVHGRIVSALIISQLLLIGLMSTKGKAQSTPFLVVLPILTFCFHRFCK  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYD-YDGISEK  677
              RYES F  +PLQEA +KD++E+AREPN NLK +L++AYIHPVFK  E E D ++ + E 
Sbjct  674   DRYESVFVINPLQEAMIKDSMERAREPNLNLKRFLKNAYIHPVFKDKEYEDDLHEELIED  733

Query  676   ADEEN-VLVQTKRQSR  632
             +D+EN V+V TK QS+
Sbjct  734   SDDENCVVVPTKHQSQ  749



>ref|XP_010924079.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Elaeis guineensis]
Length=745

 Score =   347 bits (891),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 180/252 (71%), Positives = 206/252 (82%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFI+YIMVDGW GIAGE+LRLK LI+FHLKN FLVKTEKDRE+A
Sbjct  477   PKTIGVSIP---MKATFFISYIMVDGWAGIAGEILRLKPLIVFHLKNFFLVKTEKDREEA  533

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGS+ F  +EP+IQLYFLLGLVYA VTP LLPFI++FF  AY VFRHQIINVYNQEYE
Sbjct  534   MDPGSIEFGSSEPQIQLYFLLGLVYAVVTPFLLPFIIIFFGLAYAVFRHQIINVYNQEYE  593

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S AAFWPDVHGRII ALI SQ+  LGLLSTK AAQS PFLI LP+LTI FH +CK RYE 
Sbjct  594   SGAAFWPDVHGRIITALIISQLLLLGLLSTKEAAQSTPFLIALPILTIWFHRFCKSRYEP  653

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF K+PLQEA MKDTLE+A+EPN +LK YL +AY+HPVFK + DE D   + E+   +NV
Sbjct  654   AFVKYPLQEAMMKDTLERAKEPNLDLKAYLVNAYVHPVFK-DGDEDDSFSVDEEVVYDNV  712

Query  658   LVQTKRQSRKNT  623
             LV TKRQSR+NT
Sbjct  713   LVPTKRQSRRNT  724



>ref|XP_010924081.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X4 [Elaeis guineensis]
Length=726

 Score =   347 bits (890),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 180/252 (71%), Positives = 206/252 (82%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFI+YIMVDGW GIAGE+LRLK LI+FHLKN FLVKTEKDRE+A
Sbjct  458   PKTIGVSIP---MKATFFISYIMVDGWAGIAGEILRLKPLIVFHLKNFFLVKTEKDREEA  514

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGS+ F  +EP+IQLYFLLGLVYA VTP LLPFI++FF  AY VFRHQIINVYNQEYE
Sbjct  515   MDPGSIEFGSSEPQIQLYFLLGLVYAVVTPFLLPFIIIFFGLAYAVFRHQIINVYNQEYE  574

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S AAFWPDVHGRII ALI SQ+  LGLLSTK AAQS PFLI LP+LTI FH +CK RYE 
Sbjct  575   SGAAFWPDVHGRIITALIISQLLLLGLLSTKEAAQSTPFLIALPILTIWFHRFCKSRYEP  634

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF K+PLQEA MKDTLE+A+EPN +LK YL +AY+HPVFK + DE D   + E+   +NV
Sbjct  635   AFVKYPLQEAMMKDTLERAKEPNLDLKAYLVNAYVHPVFK-DGDEDDSFSVDEEVVYDNV  693

Query  658   LVQTKRQSRKNT  623
             LV TKRQSR+NT
Sbjct  694   LVPTKRQSRRNT  705



>ref|XP_003542161.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Glycine 
max]
 gb|KHN42234.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=774

 Score =   348 bits (893),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 170/242 (70%), Positives = 200/242 (83%), Gaps = 2/242 (1%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             +KA+FFITYIM+DGW  IA EVL LK LI++HLKN FLVKTEKDRE+AM+PGS+ FN  E
Sbjct  509   LKASFFITYIMIDGWASIAAEVLMLKPLIVYHLKNFFLVKTEKDREEAMDPGSIGFNTGE  568

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             PRIQLYFLLGLVYAAVTP +LPFI+VFF  AY+VFRHQIINVYNQEYES AAFWPDVH R
Sbjct  569   PRIQLYFLLGLVYAAVTPAVLPFIIVFFGLAYLVFRHQIINVYNQEYESGAAFWPDVHFR  628

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             I+ AL+ SQ+  +GLL+TK AA S PFL+VLP+LTI FH YCKGR+ESAF K PLQEA M
Sbjct  629   IVMALLVSQIVLMGLLTTKKAASSTPFLVVLPILTIWFHRYCKGRFESAFVKFPLQEAMM  688

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDG--ISEKADEENVLVQTKRQSRK  629
             KDTLE+  EPN NLK YLQ+AY+HPVFK + D+ D +   +S   + E+V V+TKRQSR+
Sbjct  689   KDTLERTTEPNLNLKGYLQNAYVHPVFKDSMDDDDDEEDILSMDLETESVTVRTKRQSRR  748

Query  628   NT  623
             NT
Sbjct  749   NT  750



>ref|XP_006850790.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Amborella 
trichopoda]
 gb|ERN12371.1| hypothetical protein AMTR_s00025p00102970 [Amborella trichopoda]
Length=765

 Score =   348 bits (892),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 172/252 (68%), Positives = 201/252 (80%), Gaps = 5/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYI+VDGW+G+A EVLRLK LI++HLKN+ LVKTEKDREDA
Sbjct  500   PKTIGVSIP---MKATFFITYILVDGWSGVAAEVLRLKPLIMYHLKNALLVKTEKDREDA  556

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             MNPGSL F  +EP++QLYFLLGLVYA VTPILLPFI+VFF  AY+V+RHQIINVYNQEYE
Sbjct  557   MNPGSLGFASSEPQLQLYFLLGLVYAVVTPILLPFIVVFFGLAYMVYRHQIINVYNQEYE  616

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAA+FWPDVHGRI+ A++ SQ+  +GL+ST+ AAQS   LI LP+LTI FHL CK R+ES
Sbjct  617   SAASFWPDVHGRIVTAMVISQLVLMGLVSTRGAAQSTTVLIPLPILTIWFHLVCKSRFES  676

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF K PLQEA MKDTLE+A EPN NLK YLQDAYIHPVFKG    +      E  +E N 
Sbjct  677   AFVKFPLQEAMMKDTLERATEPNLNLKVYLQDAYIHPVFKGGNGHHQPKPGFE--EETNP  734

Query  658   LVQTKRQSRKNT  623
             LV TKR S+ +T
Sbjct  735   LVPTKRHSQLST  746



>ref|XP_010052882.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Eucalyptus grandis]
 gb|KCW77010.1| hypothetical protein EUGRSUZ_D01358 [Eucalyptus grandis]
Length=774

 Score =   347 bits (891),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 172/240 (72%), Positives = 201/240 (84%), Gaps = 1/240 (0%)
 Frame = -2

Query  1339  KATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNEP  1160
             +ATFFITYIMVDGW GIA E+L LK LI++HLKN FLVKTEKDRE+AM+PGS+ FN  EP
Sbjct  512   RATFFITYIMVDGWAGIAAEILMLKPLIIYHLKNFFLVKTEKDREEAMDPGSIGFNTGEP  571

Query  1159  RIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGRI  980
             +IQ YFLLGLVYA VTP LLPFILVFF  AYVVFRHQIINVYNQEYESAAAFWPDVH R+
Sbjct  572   QIQFYFLLGLVYATVTPALLPFILVFFGLAYVVFRHQIINVYNQEYESAAAFWPDVHRRV  631

Query  979   IFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKMK  800
             I AL+ SQ+   GL++TK AA S PFLI LPVLTI FH++CKGR+E AF ++PLQEA MK
Sbjct  632   IVALVVSQLLLFGLMATKQAANSTPFLIALPVLTIYFHMFCKGRFEPAFVRYPLQEAMMK  691

Query  799   DTLEQAREPNFNLKPYLQDAYIHPVFK-GNEDEYDYDGISEKADEENVLVQTKRQSRKNT  623
             DTLE+AREP+ NLK +LQ+AY+HPVFK  ++D+ D D + EK D E+VLV TKR SR+NT
Sbjct  692   DTLERAREPHVNLKSFLQNAYLHPVFKSADDDDEDDDDVDEKWDNESVLVPTKRSSRRNT  751



>ref|XP_010924075.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010924076.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010924077.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X1 [Elaeis guineensis]
Length=766

 Score =   347 bits (891),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 180/252 (71%), Positives = 206/252 (82%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFI+YIMVDGW GIAGE+LRLK LI+FHLKN FLVKTEKDRE+A
Sbjct  498   PKTIGVSIP---MKATFFISYIMVDGWAGIAGEILRLKPLIVFHLKNFFLVKTEKDREEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGS+ F  +EP+IQLYFLLGLVYA VTP LLPFI++FF  AY VFRHQIINVYNQEYE
Sbjct  555   MDPGSIEFGSSEPQIQLYFLLGLVYAVVTPFLLPFIIIFFGLAYAVFRHQIINVYNQEYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S AAFWPDVHGRII ALI SQ+  LGLLSTK AAQS PFLI LP+LTI FH +CK RYE 
Sbjct  615   SGAAFWPDVHGRIITALIISQLLLLGLLSTKEAAQSTPFLIALPILTIWFHRFCKSRYEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF K+PLQEA MKDTLE+A+EPN +LK YL +AY+HPVFK + DE D   + E+   +NV
Sbjct  675   AFVKYPLQEAMMKDTLERAKEPNLDLKAYLVNAYVHPVFK-DGDEDDSFSVDEEVVYDNV  733

Query  658   LVQTKRQSRKNT  623
             LV TKRQSR+NT
Sbjct  734   LVPTKRQSRRNT  745



>ref|XP_004295293.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Fragaria vesca subsp. vesca]
Length=772

 Score =   347 bits (890),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 171/257 (67%), Positives = 203/257 (79%), Gaps = 14/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A P+           KATFFITYIMVDGW GIA E+L LK LI++HLKN+FLVKT+K
Sbjct  506   IGVAIPI-----------KATFFITYIMVDGWAGIAAEILMLKPLIMYHLKNTFLVKTDK  554

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGS+ F+  EPRIQLY LLGLVY+ +TP+LLPFI+VFF  AY+VFRHQIINVY
Sbjct  555   DREEAMDPGSIGFHTREPRIQLYILLGLVYSTMTPVLLPFIVVFFGLAYLVFRHQIINVY  614

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYESAAAFWPDVHGR++ ALI SQ+  +GLLSTK A  S PFL+ LP++T+ F+ YC 
Sbjct  615   NQEYESAAAFWPDVHGRVVSALILSQLVLMGLLSTKGAKISTPFLLPLPIMTVAFYKYCA  674

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYE AF ++PLQEAKMKDTLE AREPN NLK YLQ AY+HPVFK   +  + D   EKA
Sbjct  675   GRYEPAFVRYPLQEAKMKDTLEHAREPNLNLKGYLQSAYVHPVFK---ECAEDDDEEEKA  731

Query  673   DEENVLVQTKRQSRKNT  623
               E V+V TKRQSR+NT
Sbjct  732   LYETVIVATKRQSRRNT  748



>ref|XP_010466416.1| PREDICTED: CSC1-like protein At3g21620 isoform X2 [Camelina sativa]
Length=682

 Score =   343 bits (881),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 164/251 (65%), Positives = 201/251 (80%), Gaps = 4/251 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI++HLKN FLVKTEKDRE+A
Sbjct  424   PKTIGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREEA  480

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG++ FN  EP+IQLYF+LGLVYAAV+PILLPFILVFF  AYVV+RHQIINVYNQEYE
Sbjct  481   MDPGTIGFNTGEPQIQLYFILGLVYAAVSPILLPFILVFFGLAYVVYRHQIINVYNQEYE  540

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SA AFWPDVH R++ ALI SQ+  +GLLSTK AA+S P L +LPVLTI FH +CKGRY+ 
Sbjct  541   SAGAFWPDVHRRVVIALIVSQLLLMGLLSTKRAARSTPLLFILPVLTIGFHKFCKGRYQP  600

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISE-KADEEN  662
              F ++PLQ+A +KDTLE+ REPN NLKP+LQ+AY HPVFK  ++  +   + E + +   
Sbjct  601   VFVRYPLQDAMVKDTLERTREPNLNLKPFLQNAYAHPVFKAADNLANEMVVEEPEPNRTP  660

Query  661   VLVQTKRQSRK  629
              LV TKR S++
Sbjct  661   DLVATKRGSKR  671



>ref|XP_010488177.1| PREDICTED: CSC1-like protein At3g21620 isoform X2 [Camelina sativa]
Length=682

 Score =   343 bits (881),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 164/251 (65%), Positives = 201/251 (80%), Gaps = 4/251 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI++HLKN FLVKTEKDRE+A
Sbjct  424   PKTIGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREEA  480

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG++ FN  EP+IQLYF+LGLVYAAV+PILLPFILVFF  AYVV+RHQIINVYNQEYE
Sbjct  481   MDPGTIGFNTGEPQIQLYFILGLVYAAVSPILLPFILVFFGLAYVVYRHQIINVYNQEYE  540

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SA AFWPDVH R++ ALI SQ+  +GLLSTK AA+S P L +LPVLTI FH +CKGRY+ 
Sbjct  541   SAGAFWPDVHRRVVIALIVSQLLLMGLLSTKRAARSTPLLFILPVLTIGFHKFCKGRYQP  600

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISE-KADEEN  662
              F ++PLQ+A +KDTLE+ REPN NLKP+LQ+AY HPVFK  ++  +   + E + +   
Sbjct  601   VFVRYPLQDAMVKDTLERTREPNLNLKPFLQNAYAHPVFKAADNLANEMVVEEPEPNRTP  660

Query  661   VLVQTKRQSRK  629
              LV TKR S++
Sbjct  661   DLVATKRGSKR  671



>gb|KJB42870.1| hypothetical protein B456_007G171500 [Gossypium raimondii]
Length=768

 Score =   344 bits (883),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 170/252 (67%), Positives = 201/252 (80%), Gaps = 5/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI++HLKNSFLVKTEKDRE+A
Sbjct  499   PKTIGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNSFLVKTEKDREEA  555

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG++ FN  EP+IQLYFLLGLVYA VTPILLPFI+VFFA AYVV+RHQIINVY+QEYE
Sbjct  556   MDPGTIGFNTGEPQIQLYFLLGLVYAVVTPILLPFIIVFFALAYVVYRHQIINVYHQEYE  615

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVH R++ ALI SQ+  +GLLSTK A+QS P LI LPVLTI FH +CKGRYE 
Sbjct  616   SAAAFWPDVHVRVVAALIVSQLLLMGLLSTKEASQSTPLLITLPVLTICFHRFCKGRYEP  675

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQEA MKDTLE+A+E N NLK +LQ+AYIHPVFK  ++         +      
Sbjct  676   AFVRYPLQEAMMKDTLERAKEANLNLKGFLQNAYIHPVFKSADESDSESESEWERSP--A  733

Query  658   LVQTKRQSRKNT  623
             LV TKR S++ T
Sbjct  734   LVATKRTSKRFT  745



>gb|KJB42871.1| hypothetical protein B456_007G171500 [Gossypium raimondii]
Length=788

 Score =   345 bits (884),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 170/252 (67%), Positives = 201/252 (80%), Gaps = 5/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI++HLKNSFLVKTEKDRE+A
Sbjct  519   PKTIGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNSFLVKTEKDREEA  575

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG++ FN  EP+IQLYFLLGLVYA VTPILLPFI+VFFA AYVV+RHQIINVY+QEYE
Sbjct  576   MDPGTIGFNTGEPQIQLYFLLGLVYAVVTPILLPFIIVFFALAYVVYRHQIINVYHQEYE  635

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVH R++ ALI SQ+  +GLLSTK A+QS P LI LPVLTI FH +CKGRYE 
Sbjct  636   SAAAFWPDVHVRVVAALIVSQLLLMGLLSTKEASQSTPLLITLPVLTICFHRFCKGRYEP  695

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQEA MKDTLE+A+E N NLK +LQ+AYIHPVFK  ++         +      
Sbjct  696   AFVRYPLQEAMMKDTLERAKEANLNLKGFLQNAYIHPVFKSADESDSESESEWERSP--A  753

Query  658   LVQTKRQSRKNT  623
             LV TKR S++ T
Sbjct  754   LVATKRTSKRFT  765



>ref|NP_188799.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 sp|Q9LVE4.1|CSCL4_ARATH RecName: Full=CSC1-like protein At3g21620 [Arabidopsis thaliana]
 dbj|BAB02357.1| unnamed protein product [Arabidopsis thaliana]
 gb|AEE76531.1| early-responsive to dehydration stress-related protein [Arabidopsis 
thaliana]
 gb|AIU34617.1| hyperosmolality-gated Ca2+ permeable channel 1.5 [Arabidopsis 
thaliana]
Length=756

 Score =   344 bits (882),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 167/251 (67%), Positives = 202/251 (80%), Gaps = 4/251 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI++HLKN FLVKTEKDRE+A
Sbjct  499   PKTIGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREEA  555

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG++ FN  EP+IQLYF+LGLVYAAV+PILLPFILVFFA AYVV+RHQIINVYNQEYE
Sbjct  556   MDPGTIGFNTGEPQIQLYFILGLVYAAVSPILLPFILVFFALAYVVYRHQIINVYNQEYE  615

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVH R++ ALI SQ+  +GLLSTK AA+S P L +LPVLTI FH +C+GRY+ 
Sbjct  616   SAAAFWPDVHRRVVIALIVSQLLLMGLLSTKKAARSTPLLFILPVLTIGFHKFCQGRYQP  675

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA-DEEN  662
              F  +PLQ+A +KDTLE+ REPN NLK +LQ+AY HPVFK  ++  +   + E A D+  
Sbjct  676   IFVTYPLQDAMVKDTLERMREPNLNLKTFLQNAYAHPVFKAADNLANEMVVEEPAPDKTP  735

Query  661   VLVQTKRQSRK  629
              LV TKR SR+
Sbjct  736   DLVATKRGSRR  746



>ref|XP_008803557.1| PREDICTED: LOW QUALITY PROTEIN: calcium permeable stress-gated 
cation channel 1-like [Phoenix dactylifera]
Length=767

 Score =   344 bits (882),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 178/252 (71%), Positives = 206/252 (82%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFI+YIMVDGW GIAGE+LRLK LI++HLKN FLVKTEKDRE A
Sbjct  498   PKTIGVSIP---MKATFFISYIMVDGWAGIAGEILRLKPLIIYHLKNFFLVKTEKDREQA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGS+ F  +EP+IQLYFLLGLVYA VTP LLPFI+VFF  AY VFRHQIINVYNQEYE
Sbjct  555   MDPGSIEFGSSEPQIQLYFLLGLVYAVVTPFLLPFIIVFFVLAYAVFRHQIINVYNQEYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S AAFWPDVHGRII ALI SQ+  LGLLSTK AAQS PFLI LP+LTI FH +CK RYE 
Sbjct  615   SGAAFWPDVHGRIITALIISQLLLLGLLSTKEAAQSTPFLIALPILTIWFHRFCKSRYEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF K+PLQEA MKDTLE+A+EPN +LK YL +AYIHPVFK  E++ D   + ++ + +NV
Sbjct  675   AFVKYPLQEAMMKDTLERAKEPNLDLKAYLINAYIHPVFKDGEED-DSFAVGDEREYDNV  733

Query  658   LVQTKRQSRKNT  623
             LV TKRQSR++T
Sbjct  734   LVPTKRQSRRST  745



>ref|XP_006406250.1| hypothetical protein EUTSA_v10020132mg [Eutrema salsugineum]
 gb|ESQ47703.1| hypothetical protein EUTSA_v10020132mg [Eutrema salsugineum]
Length=757

 Score =   344 bits (882),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 202/252 (80%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI++HLKN FLVKTEKDRE+A
Sbjct  499   PKTIGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREEA  555

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG++ FN  EP+IQLYF+LGLVYAAV+PILLPFILVFFA AYVV+RHQIINVYNQEYE
Sbjct  556   MDPGTIGFNTGEPQIQLYFILGLVYAAVSPILLPFILVFFALAYVVYRHQIINVYNQEYE  615

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SA +FWPDVH R++ ALI SQ+  +GLLSTK AA+S P L +LPVLTI FH +CKGRY+ 
Sbjct  616   SAGSFWPDVHRRVVIALIVSQLLLMGLLSTKRAARSTPLLFILPVLTIGFHRFCKGRYQP  675

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISE-KADEEN  662
              F  +PLQ+A +KDTLE+ REPN NLK +LQ+AY+HPVFK  ++  +   + E + D   
Sbjct  676   VFVTYPLQDAMVKDTLERTREPNLNLKTFLQNAYVHPVFKAADNIGNEMVVEEPQPDRTP  735

Query  661   VLVQTKRQSRKN  626
              LV TKR SR++
Sbjct  736   DLVATKRGSRRH  747



>dbj|BAD94445.1| hypothetical protein [Arabidopsis thaliana]
Length=756

 Score =   343 bits (881),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 167/251 (67%), Positives = 202/251 (80%), Gaps = 4/251 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI++HLKN FLVKTEKDRE+A
Sbjct  499   PKTIGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREEA  555

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG++ FN  EP+IQLYF+LGLVYAAV+PILLPFILVFFA AYVV+RHQIINVYNQEYE
Sbjct  556   MDPGTIGFNTGEPQIQLYFILGLVYAAVSPILLPFILVFFALAYVVYRHQIINVYNQEYE  615

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVH R++ ALI SQ+  +GLLSTK AA+S P L +LPVLTI FH +C+GRY+ 
Sbjct  616   SAAAFWPDVHRRVVIALIVSQLLLMGLLSTKKAARSTPLLFILPVLTIGFHKFCQGRYQP  675

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA-DEEN  662
              F  +PLQ+A +KDTLE+ REPN NLK +LQ+AY HPVFK  ++  +   + E A D+  
Sbjct  676   IFVTYPLQDAMVKDTLERMREPNLNLKTFLQNAYAHPVFKAADNLANEMVVEEPAPDKTP  735

Query  661   VLVQTKRQSRK  629
              LV TKR SR+
Sbjct  736   DLVATKRGSRR  746



>ref|XP_010466415.1| PREDICTED: CSC1-like protein At3g21620 isoform X1 [Camelina sativa]
Length=757

 Score =   343 bits (881),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 164/251 (65%), Positives = 201/251 (80%), Gaps = 4/251 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI++HLKN FLVKTEKDRE+A
Sbjct  499   PKTIGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREEA  555

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG++ FN  EP+IQLYF+LGLVYAAV+PILLPFILVFF  AYVV+RHQIINVYNQEYE
Sbjct  556   MDPGTIGFNTGEPQIQLYFILGLVYAAVSPILLPFILVFFGLAYVVYRHQIINVYNQEYE  615

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SA AFWPDVH R++ ALI SQ+  +GLLSTK AA+S P L +LPVLTI FH +CKGRY+ 
Sbjct  616   SAGAFWPDVHRRVVIALIVSQLLLMGLLSTKRAARSTPLLFILPVLTIGFHKFCKGRYQP  675

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISE-KADEEN  662
              F ++PLQ+A +KDTLE+ REPN NLKP+LQ+AY HPVFK  ++  +   + E + +   
Sbjct  676   VFVRYPLQDAMVKDTLERTREPNLNLKPFLQNAYAHPVFKAADNLANEMVVEEPEPNRTP  735

Query  661   VLVQTKRQSRK  629
              LV TKR S++
Sbjct  736   DLVATKRGSKR  746



>ref|XP_010488175.1| PREDICTED: CSC1-like protein At3g21620 isoform X1 [Camelina sativa]
 ref|XP_010488176.1| PREDICTED: CSC1-like protein At3g21620 isoform X1 [Camelina sativa]
Length=757

 Score =   343 bits (881),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 164/251 (65%), Positives = 201/251 (80%), Gaps = 4/251 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI++HLKN FLVKTEKDRE+A
Sbjct  499   PKTIGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREEA  555

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG++ FN  EP+IQLYF+LGLVYAAV+PILLPFILVFF  AYVV+RHQIINVYNQEYE
Sbjct  556   MDPGTIGFNTGEPQIQLYFILGLVYAAVSPILLPFILVFFGLAYVVYRHQIINVYNQEYE  615

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SA AFWPDVH R++ ALI SQ+  +GLLSTK AA+S P L +LPVLTI FH +CKGRY+ 
Sbjct  616   SAGAFWPDVHRRVVIALIVSQLLLMGLLSTKRAARSTPLLFILPVLTIGFHKFCKGRYQP  675

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISE-KADEEN  662
              F ++PLQ+A +KDTLE+ REPN NLKP+LQ+AY HPVFK  ++  +   + E + +   
Sbjct  676   VFVRYPLQDAMVKDTLERTREPNLNLKPFLQNAYAHPVFKAADNLANEMVVEEPEPNRTP  735

Query  661   VLVQTKRQSRK  629
              LV TKR S++
Sbjct  736   DLVATKRGSKR  746



>ref|XP_010510410.1| PREDICTED: CSC1-like protein At3g21620 [Camelina sativa]
Length=757

 Score =   343 bits (880),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 164/251 (65%), Positives = 201/251 (80%), Gaps = 4/251 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI++HLKN FLVKTEKDRE+A
Sbjct  499   PKTIGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREEA  555

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG++ FN  EP+IQLYF+LGLVYAAV+PILLPFILVFF  AYVV+RHQIINVYNQEYE
Sbjct  556   MDPGTIGFNTGEPQIQLYFILGLVYAAVSPILLPFILVFFGLAYVVYRHQIINVYNQEYE  615

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SA AFWPDVH R++ ALI SQ+  +GLLSTK AA+S P L +LPVLTI FH +CKGR++ 
Sbjct  616   SAGAFWPDVHRRVVIALIVSQLLLMGLLSTKRAARSTPLLFILPVLTIGFHKFCKGRHQP  675

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISE-KADEEN  662
              F ++PLQ+A +KDTLE+ REPN NLKP+LQ+AY HPVFK  +D  +   + E + +   
Sbjct  676   VFVRYPLQDAMVKDTLERTREPNLNLKPFLQNAYAHPVFKAADDLANELVVEEPEPNRTP  735

Query  661   VLVQTKRQSRK  629
              LV TKR S++
Sbjct  736   DLVATKRGSKR  746



>ref|XP_004960982.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Setaria 
italica]
Length=768

 Score =   343 bits (879),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 174/254 (69%), Positives = 202/254 (80%), Gaps = 5/254 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P ++G S     MKATFFITY+MVDGW G+AGE+LRLK LI FHLKN FLVKTEKDRE+A
Sbjct  499   PKLIGFSVP---MKATFFITYVMVDGWAGVAGEILRLKPLIFFHLKNFFLVKTEKDREEA  555

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGS+CF+  EPRIQLYFLLGLVYAAVTP+LLPFILVFF FAYVV+RHQIINVYNQ+YE
Sbjct  556   MDPGSICFDSCEPRIQLYFLLGLVYAAVTPLLLPFILVFFGFAYVVYRHQIINVYNQQYE  615

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S A FWP VHGRII ALI SQ+  LGLLSTK   ++ P L+VLPVLT  F  YCK RYE 
Sbjct  616   SGAQFWPSVHGRIITALIVSQLLLLGLLSTKGLEEATPVLLVLPVLTFWFFKYCKHRYEP  675

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYD-YDGISEKA-DEE  665
             AF ++PLQEA  KDTLE+AREPNF+LK YL ++Y+HPVFKG + + D Y  + +    EE
Sbjct  676   AFVRNPLQEAMRKDTLERAREPNFDLKAYLANSYLHPVFKGTDHDDDRYSTVDDDGWMEE  735

Query  664   NVLVQTKRQSRKNT  623
              VLV TKR SR+ T
Sbjct  736   EVLVPTKRHSRRTT  749



>ref|XP_002885454.1| hypothetical protein ARALYDRAFT_342312 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61713.1| hypothetical protein ARALYDRAFT_342312 [Arabidopsis lyrata subsp. 
lyrata]
Length=756

 Score =   342 bits (878),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 165/251 (66%), Positives = 201/251 (80%), Gaps = 4/251 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI++HLKN FLVKTEKDRE+A
Sbjct  499   PKTIGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREEA  555

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG++ FN  EP+IQLYF+LGLVYAAV+PILLPFILVFFA AYVV+RHQ+INVYNQEYE
Sbjct  556   MDPGTIGFNTGEPQIQLYFILGLVYAAVSPILLPFILVFFALAYVVYRHQVINVYNQEYE  615

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVH R++ ALI SQ+  +GLLSTK AA+S P L +LPVLTI FH +C+GRY+ 
Sbjct  616   SAAAFWPDVHRRVVIALIVSQLLLMGLLSTKRAARSTPLLFILPVLTIGFHKFCQGRYQP  675

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISE-KADEEN  662
              F ++PLQ+A +KDTLE+ REPN NLK +LQ+AY HPVFK  ++  +   + E   D   
Sbjct  676   IFVRYPLQDAMVKDTLERMREPNLNLKTFLQNAYAHPVFKAADNLANEMVVEEPHPDRTP  735

Query  661   VLVQTKRQSRK  629
              LV TKR SR+
Sbjct  736   DLVATKRGSRR  746



>ref|XP_011046985.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
isoform X2 [Populus euphratica]
Length=1186

 Score =   351 bits (900),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 166/226 (73%), Positives = 188/226 (83%), Gaps = 11/226 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW GIAGEVL LK LI +HLKN  LVKTEK
Sbjct  505   IGVAVPM-----------KATFFITYIMVDGWAGIAGEVLMLKPLIFYHLKNFLLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGSL F+  EPRIQLYFLLGLVYA VTP+LLPFI++FFAFAY+VFRHQIINVY
Sbjct  554   DREEAMDPGSLGFHTGEPRIQLYFLLGLVYATVTPVLLPFIIIFFAFAYLVFRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYES AAFWPDVHGRII  L+ SQ++ +GLL TK AAQS PFLI LPVLTI FH++C 
Sbjct  614   NQEYESGAAFWPDVHGRIITGLVISQLALMGLLGTKEAAQSTPFLISLPVLTIWFHMFCN  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKG  716
             GR++SAF K+PLQEA MKDTLE+AR+PNFNLK YL  AY+HP+FKG
Sbjct  674   GRHKSAFVKYPLQEAMMKDTLERARDPNFNLKSYLHSAYVHPIFKG  719



>ref|XP_006299035.1| hypothetical protein CARUB_v10015172mg [Capsella rubella]
 gb|EOA31933.1| hypothetical protein CARUB_v10015172mg [Capsella rubella]
Length=756

 Score =   342 bits (876),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 200/252 (79%), Gaps = 6/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI++HLKN FLVKTEKDRE+A
Sbjct  499   PKTIGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNFFLVKTEKDREEA  555

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG++ FN  EP+IQLYF+LGLVYAAV+PILLPFILVFF  AYVV+RHQIINVYNQEYE
Sbjct  556   MDPGTIGFNTGEPQIQLYFILGLVYAAVSPILLPFILVFFGLAYVVYRHQIINVYNQEYE  615

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SA AFWPDVH R++ AL+ SQ+  +GLLSTK AA+S P L +LPVLTI FH +CKGRY+ 
Sbjct  616   SAGAFWPDVHRRVVIALVVSQLLLMGLLSTKRAARSTPLLFILPVLTIGFHKFCKGRYQP  675

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
              F ++PLQ+A +KDTLE+ REPN NLKP+LQ+AY HPVFK   D    + + E+ +    
Sbjct  676   VFVRYPLQDAMVKDTLERIREPNLNLKPFLQNAYAHPVFKA-ADNLALEMVVEEPEPGRT  734

Query  658   --LVQTKRQSRK  629
               LV TKR S++
Sbjct  735   PDLVATKRGSKR  746



>gb|EMS50375.1| Transmembrane protein 63B [Triticum urartu]
Length=749

 Score =   341 bits (875),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 170/252 (67%), Positives = 200/252 (79%), Gaps = 5/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P ++G++     MKATFFITY+MVDGWTG+A EVLRLKA I+FHLKN FLVKTEKDRE+A
Sbjct  482   PRIIGVAIP---MKATFFITYVMVDGWTGVALEVLRLKAFIMFHLKNFFLVKTEKDREEA  538

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGS+C  ++EPRIQLYFLLGLVYA VTP+LLPFILVFFA AYVV+RHQIINVYNQ YE
Sbjct  539   MDPGSICLYWSEPRIQLYFLLGLVYAVVTPLLLPFILVFFALAYVVYRHQIINVYNQRYE  598

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S A FWP+VH RII ALI SQ+  LGLLSTK   ++ P L+ LPVLTI FH YCK RYE 
Sbjct  599   SGAQFWPNVHLRIITALIVSQLLFLGLLSTKGLEEATPALLALPVLTIWFHKYCKHRYEP  658

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQ+   KDTLE+ARE NF+LK YL DAY+HPVFK NE    Y  +++    E V
Sbjct  659   AFVRNPLQDVMRKDTLERARERNFDLKAYLADAYLHPVFKSNEAGKFY--VADDPGAEAV  716

Query  658   LVQTKRQSRKNT  623
             +V TKRQSR+ T
Sbjct  717   IVPTKRQSRRIT  728



>ref|XP_002271834.1| PREDICTED: CSC1-like protein At4g02900 [Vitis vinifera]
Length=756

 Score =   341 bits (874),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 169/248 (68%), Positives = 199/248 (80%), Gaps = 6/248 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+A E+LRL  LI+FHLKN+FLVKTE+DRE A
Sbjct  499   PKTVGVSIP---MKATFFITYIMVDGWAGVAAEILRLVPLIMFHLKNAFLVKTEQDREQA  555

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG L F+ +EPRIQLYFLLGLVYAAVTPILLPFI++FF+FAY+VFRHQIINVY+Q+YE
Sbjct  556   MDPGCLNFSISEPRIQLYFLLGLVYAAVTPILLPFIIIFFSFAYMVFRHQIINVYDQKYE  615

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S AAFWP VH R+I  L+ SQ+  +GLL+TK  ++S PFLIVLPVLT  FH +C GR+ES
Sbjct  616   SGAAFWPSVHQRVIIGLMISQLLLMGLLNTKDFSKSTPFLIVLPVLTFWFHRFCNGRFES  675

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF + PLQEA +KDTLE+A EPN NLK YLQDAYIHPVFKG E E   + I E  +E N 
Sbjct  676   AFVRFPLQEAMVKDTLERATEPNLNLKNYLQDAYIHPVFKGGEFERP-EVIDE--EENNP  732

Query  658   LVQTKRQS  635
             LV TKR S
Sbjct  733   LVATKRSS  740



>emb|CBI32349.3| unnamed protein product [Vitis vinifera]
Length=766

 Score =   341 bits (874),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 169/248 (68%), Positives = 199/248 (80%), Gaps = 6/248 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+A E+LRL  LI+FHLKN+FLVKTE+DRE A
Sbjct  509   PKTVGVSIP---MKATFFITYIMVDGWAGVAAEILRLVPLIMFHLKNAFLVKTEQDREQA  565

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG L F+ +EPRIQLYFLLGLVYAAVTPILLPFI++FF+FAY+VFRHQIINVY+Q+YE
Sbjct  566   MDPGCLNFSISEPRIQLYFLLGLVYAAVTPILLPFIIIFFSFAYMVFRHQIINVYDQKYE  625

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S AAFWP VH R+I  L+ SQ+  +GLL+TK  ++S PFLIVLPVLT  FH +C GR+ES
Sbjct  626   SGAAFWPSVHQRVIIGLMISQLLLMGLLNTKDFSKSTPFLIVLPVLTFWFHRFCNGRFES  685

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF + PLQEA +KDTLE+A EPN NLK YLQDAYIHPVFKG E E   + I E  +E N 
Sbjct  686   AFVRFPLQEAMVKDTLERATEPNLNLKNYLQDAYIHPVFKGGEFERP-EVIDE--EENNP  742

Query  658   LVQTKRQS  635
             LV TKR S
Sbjct  743   LVATKRSS  750



>ref|XP_011079804.1| PREDICTED: CSC1-like protein At4g02900 [Sesamum indicum]
 ref|XP_011079805.1| PREDICTED: CSC1-like protein At4g02900 [Sesamum indicum]
Length=765

 Score =   341 bits (874),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 164/249 (66%), Positives = 197/249 (79%), Gaps = 6/249 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P+ +G++     MK TFFITYIMVDGW GIA E+LRL  LILFHLKN+FLVKTE+DR+ A
Sbjct  499   PITVGVAIP---MKGTFFITYIMVDGWAGIAAEILRLVPLILFHLKNTFLVKTEQDRDQA  555

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG + F  +EPRIQLYFLLGLVYA VTP +LPFI++FFAFAYVVFRHQIINVY+Q YE
Sbjct  556   MDPGCITFASSEPRIQLYFLLGLVYAVVTPFVLPFIIIFFAFAYVVFRHQIINVYDQNYE  615

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDVH R++  L+ SQ+  +GLLSTK  A+S P L++LPVLTI FH +CKGR+ES
Sbjct  616   SAAAFWPDVHRRVVIGLVISQLLLMGLLSTKSIAKSTPVLLILPVLTIWFHRFCKGRFES  675

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF K PLQ+A +KDTLE+A EPN NLK YLQDAY+HPVF+  E E      +   +E N 
Sbjct  676   AFVKFPLQDAVVKDTLERATEPNLNLKAYLQDAYVHPVFRTIEIE---KAAAVDEEENNP  732

Query  658   LVQTKRQSR  632
             LV+TKR SR
Sbjct  733   LVETKRNSR  741



>ref|XP_004968885.1| PREDICTED: uncharacterized membrane protein YLR241W-like [Setaria 
italica]
Length=768

 Score =   340 bits (873),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 173/240 (72%), Positives = 201/240 (84%), Gaps = 1/240 (0%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             MKATFFITY+MVDGW G+AGE+LRLK L++FHLKN FLVKTEKDRE+AM+PGS+ F+ +E
Sbjct  507   MKATFFITYVMVDGWAGVAGEILRLKPLVIFHLKNFFLVKTEKDREEAMDPGSIGFDSSE  566

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             P+IQLYFLLGLVYAAVTP LLPFIL+FF FAY+V+RHQIINVYNQEYESAAAFWP VHGR
Sbjct  567   PQIQLYFLLGLVYAAVTPFLLPFILIFFGFAYIVYRHQIINVYNQEYESAAAFWPSVHGR  626

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             II ALI SQ+  LGLLSTK A QS P L+VLPV+T  FH YCK RYE  F K PLQEA  
Sbjct  627   IITALIISQLLLLGLLSTKGAGQSTPVLLVLPVVTFYFHKYCKNRYEPTFVKCPLQEAMK  686

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  623
             KDTLE+AREP F+LK YL +AYIHPVFK ++D+  +  I+ + + E VLV TKRQSR+NT
Sbjct  687   KDTLERAREPGFDLKGYLMNAYIHPVFKVDDDDEKF-SIAGEPEAEQVLVATKRQSRRNT  745



>ref|XP_006391905.1| hypothetical protein EUTSA_v10023297mg [Eutrema salsugineum]
 gb|ESQ29191.1| hypothetical protein EUTSA_v10023297mg [Eutrema salsugineum]
Length=766

 Score =   340 bits (873),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 169/259 (65%), Positives = 203/259 (78%), Gaps = 20/259 (8%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             +G+A P+           KATFFITYIMVDGW G+AGE+LRLK  I+FHLKN FLVKTEK
Sbjct  502   VGVAIPI-----------KATFFITYIMVDGWAGVAGEILRLKPFIIFHLKNFFLVKTEK  550

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PG + F   EPRIQLYFLLGLVYA VTP+LLPFI+ FF FAY++FRHQ     
Sbjct  551   DREEAMDPGQIDFYATEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYLIFRHQ-----  605

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
               EYESAAA+WPDVHGRII ALI SQ+  +GL+S+K  AQS PFL+VLP+LTI FH +CK
Sbjct  606   --EYESAAAYWPDVHGRIISALIISQILLIGLMSSKGKAQSTPFLVVLPILTIGFHRFCK  663

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYD-YDGISEK  677
             GRYESAF  +PLQEA +KDTLE+A+EPN NLK +LQ+AYIHPVFK  E E D ++  +E 
Sbjct  664   GRYESAFVINPLQEAMIKDTLERAKEPNLNLKVFLQNAYIHPVFKDEEYEDDRFEESTED  723

Query  676   ADEEN-VLVQTKRQSRKNT  623
             +D EN V+VQTKR+SR+ T
Sbjct  724   SDNENCVVVQTKRRSRRTT  742



>ref|XP_010255871.1| PREDICTED: CSC1-like protein At4g02900 [Nelumbo nucifera]
Length=759

 Score =   340 bits (871),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 167/240 (70%), Positives = 191/240 (80%), Gaps = 3/240 (1%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             MKATFFITY MVDGW GIA E+LRL  LI+FHLKN+FLVKTEKDRE AM+PGS+ F  +E
Sbjct  507   MKATFFITYTMVDGWAGIAAEILRLVPLIIFHLKNTFLVKTEKDREQAMDPGSIAFASSE  566

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             PRIQLYFLLGLVY+ V PILLPFI+VFF  AY+VFRHQIINVY+Q+YESAAAFWPDVH R
Sbjct  567   PRIQLYFLLGLVYSVVAPILLPFIVVFFGLAYLVFRHQIINVYDQKYESAAAFWPDVHWR  626

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             +I  +I SQ+  +GLLSTK A  S P L+VLP+LTI FH  CK R+ESAF K PLQ+A +
Sbjct  627   LIIGMIISQLLLMGLLSTKDAELSTPLLVVLPILTIWFHRICKNRFESAFVKFPLQDAMV  686

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  623
             KDTLE+A EPN NLK YLQDAYIHPVFK N+ E     I E  DE N LV T+R S +NT
Sbjct  687   KDTLERATEPNLNLKNYLQDAYIHPVFKDNQIEVP-TAIYE--DENNPLVPTRRTSNRNT  743



>ref|XP_010038117.1| PREDICTED: CSC1-like protein At4g02900 [Eucalyptus grandis]
 gb|KCW49929.1| hypothetical protein EUGRSUZ_K03391 [Eucalyptus grandis]
Length=756

 Score =   340 bits (871),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 198/252 (79%), Gaps = 6/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW GIA E+LRL  L++FHLKN+FLVKTEKDRE A
Sbjct  499   PKTVGVSIP---MKATFFITYIMVDGWAGIAAEILRLVPLVMFHLKNTFLVKTEKDREQA  555

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG L F  +EPRIQLYFLLG VY+ VTP+LLPFI+VFFA AY+VFRHQ+INVY+Q+YE
Sbjct  556   MDPGCLGFATSEPRIQLYFLLGFVYSVVTPVLLPFIIVFFALAYMVFRHQVINVYDQKYE  615

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S AAFWPDV  R+I  ++ SQ+  +GL+STK A  S P LIVLP+LTI FHL+CKGR+ES
Sbjct  616   SGAAFWPDVQRRLIIGMVISQLLLMGLMSTKGAKSSTPLLIVLPILTIWFHLFCKGRFES  675

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF K PLQ+A +KDTLE+A EPN NLK YL DAY+HPVF+G E E     I E  +E N 
Sbjct  676   AFVKFPLQDAMVKDTLERATEPNLNLKAYLHDAYVHPVFRGGELEKP-AVIDE--EENNP  732

Query  658   LVQTKRQSRKNT  623
             LV TKR SR+++
Sbjct  733   LVPTKRMSRRSS  744



>gb|KEH23730.1| ERD (early-responsive to dehydration stress) family protein [Medicago 
truncatula]
Length=764

 Score =   339 bits (869),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 157/239 (66%), Positives = 198/239 (83%), Gaps = 3/239 (1%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             MKATFF+TYIM+DGW GIAGE+LRL +LI FHLKN+FLVKTE+DR++AM+PGSL F  +E
Sbjct  510   MKATFFMTYIMIDGWAGIAGEILRLSSLITFHLKNTFLVKTEQDRQNAMDPGSLNFATSE  569

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             PRIQLYF+LG VYA VTP+LLPFI+VFFAF+Y+V+RHQIINVYNQ+YES A FWPDVH R
Sbjct  570   PRIQLYFMLGHVYAPVTPLLLPFIVVFFAFSYMVYRHQIINVYNQQYESGATFWPDVHRR  629

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             ++  LI SQ+  +GLLST+  ++S   L+  PVLTI FHLYCKGR+ESAF K+PL++A +
Sbjct  630   VVIGLIISQILLMGLLSTRGTSKSTLLLVAQPVLTIWFHLYCKGRFESAFVKYPLEDAMV  689

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKN  626
             KDTLE+A EPN NL+ YLQ+AY+HPVFKG+E E     ++ + +EEN L+QTKR  R +
Sbjct  690   KDTLERAIEPNLNLRHYLQEAYVHPVFKGDEFE---KQVNVEDEEENPLIQTKRACRSS  745



>ref|XP_006285697.1| hypothetical protein CARUB_v10007167mg [Capsella rubella]
 gb|EOA18595.1| hypothetical protein CARUB_v10007167mg [Capsella rubella]
Length=763

 Score =   338 bits (867),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 164/254 (65%), Positives = 204/254 (80%), Gaps = 5/254 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI++HLKNSFLV+TEKDRE+A
Sbjct  501   PKTIGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNSFLVRTEKDREEA  557

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
              +PG++ FN  EP+IQLYFLLGLVYAAV+PILLPFILVFF  AYVV+RHQ+INVYNQ+YE
Sbjct  558   TDPGTIGFNTGEPQIQLYFLLGLVYAAVSPILLPFILVFFGLAYVVYRHQVINVYNQKYE  617

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SA  FWPDVH R++ ALI SQ+  +GLLSTKHA++S P L+VLP+LTI FH++CK RY+ 
Sbjct  618   SAGKFWPDVHRRVVTALIVSQLLLMGLLSTKHASKSTPLLLVLPMLTIGFHIHCKCRYQP  677

Query  838   AFTKHPL-QEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISE-KADEE  665
             AF  +PL QEA +KDTLE+ REPN NLK +L+DAY HP F+  ED  +  G+++ K+D  
Sbjct  678   AFVTYPLQQEAMIKDTLERTREPNLNLKAFLRDAYAHPEFRVGEDIDEEMGMTKAKSDMS  737

Query  664   NVLVQTKRQSRKNT  623
               LV T+R S +NT
Sbjct  738   PELVATRRGSWRNT  751



>ref|XP_006352784.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Solanum 
tuberosum]
Length=766

 Score =   338 bits (867),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 163/253 (64%), Positives = 203/253 (80%), Gaps = 8/253 (3%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G++     MKATFFIT+IMVDGW GIA E+LRL  LI+FH+KN+FLVKTE DRE+A
Sbjct  500   PKTIGVTLP---MKATFFITFIMVDGWAGIAAEILRLVPLIMFHIKNTFLVKTEHDREEA  556

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGSL F+ +EPR+QLYFLLGLVY+ VTPILLPFI++FFAF+Y+VFRHQIINVY+Q+YE
Sbjct  557   MDPGSLNFSVSEPRLQLYFLLGLVYSVVTPILLPFIIIFFAFSYMVFRHQIINVYDQKYE  616

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S A+FWPDV+ RI+  L+ S +  +GLLSTK A+QS P LIVL VLTI FH +CKGR+ES
Sbjct  617   SGASFWPDVNRRILIGLVISHLLLIGLLSTKDASQSTPLLIVLTVLTIWFHKFCKGRFES  676

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEE-N  662
              F K PLQ+A +KDT+E+  EPNFNLK YLQDAY+HPV KG     D++ + E  DEE N
Sbjct  677   VFVKFPLQDAVVKDTVERTTEPNFNLKEYLQDAYLHPVLKG----VDFEVLKELDDEEKN  732

Query  661   VLVQTKRQSRKNT  623
              LV TKR SR+++
Sbjct  733   SLVATKRTSRRSS  745



>ref|XP_011046984.1| PREDICTED: uncharacterized protein LOC105141455 isoform X1 [Populus 
euphratica]
Length=1759

 Score =   351 bits (900),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 166/226 (73%), Positives = 188/226 (83%), Gaps = 11/226 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW GIAGEVL LK LI +HLKN  LVKTEK
Sbjct  505   IGVAVPM-----------KATFFITYIMVDGWAGIAGEVLMLKPLIFYHLKNFLLVKTEK  553

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGSL F+  EPRIQLYFLLGLVYA VTP+LLPFI++FFAFAY+VFRHQIINVY
Sbjct  554   DREEAMDPGSLGFHTGEPRIQLYFLLGLVYATVTPVLLPFIIIFFAFAYLVFRHQIINVY  613

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYES AAFWPDVHGRII  L+ SQ++ +GLL TK AAQS PFLI LPVLTI FH++C 
Sbjct  614   NQEYESGAAFWPDVHGRIITGLVISQLALMGLLGTKEAAQSTPFLISLPVLTIWFHMFCN  673

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKG  716
             GR++SAF K+PLQEA MKDTLE+AR+PNFNLK YL  AY+HP+FKG
Sbjct  674   GRHKSAFVKYPLQEAMMKDTLERARDPNFNLKSYLHSAYVHPIFKG  719



>ref|XP_006383869.1| hypothetical protein POPTR_0004s00750g [Populus trichocarpa]
 gb|ERP61666.1| hypothetical protein POPTR_0004s00750g [Populus trichocarpa]
Length=802

 Score =   338 bits (868),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 180/257 (70%), Positives = 211/257 (82%), Gaps = 13/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             IG+A PM           KATFFITYIMVDGW GIAGEVL LK L+L+HLKN FLVKTEK
Sbjct  536   IGVAVPM-----------KATFFITYIMVDGWAGIAGEVLMLKPLVLYHLKNFFLVKTEK  584

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PGSL F+  EPRIQLYFLLGLVYA VTP+LLPFI++FFAFA+ VFRHQIINVY
Sbjct  585   DREEAMDPGSLGFHTGEPRIQLYFLLGLVYATVTPVLLPFIVIFFAFAFAVFRHQIINVY  644

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             NQEYES AAFWPDVHGRII  L+ SQ++ +GLLSTK AAQS PFLI LPVLTI FH +C 
Sbjct  645   NQEYESGAAFWPDVHGRIITGLVISQLALMGLLSTKEAAQSTPFLIALPVLTIWFHRFCN  704

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GR++SAF K+PLQEA MKDTLE+AR+PNFNLK  L  AY+HP+FKG++D+ D   +S + 
Sbjct  705   GRHKSAFVKYPLQEAMMKDTLERARDPNFNLKACLHSAYVHPIFKGDDDDEDD--LSVEM  762

Query  673   DEENVLVQTKRQSRKNT  623
             + E+VLV TKRQS++NT
Sbjct  763   ETESVLVPTKRQSQRNT  779



>ref|XP_009396325.1| PREDICTED: calcium permeable stress-gated cation channel 1-like 
[Musa acuminata subsp. malaccensis]
Length=762

 Score =   337 bits (865),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 178/252 (71%), Positives = 201/252 (80%), Gaps = 6/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIM+DGW GIAGE+LRLK LI++HLKN FLVKTEKDR++A
Sbjct  498   PKTIGVSIP---MKATFFITYIMIDGWAGIAGEILRLKPLIIYHLKNLFLVKTEKDRDEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGS+ F  +EP+IQLYFLLGLVYAAVTP LLPFILVFF  AYVVFRHQIINVYNQEYE
Sbjct  555   MDPGSIEFAISEPQIQLYFLLGLVYAAVTPFLLPFILVFFGLAYVVFRHQIINVYNQEYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAAAFWPDV+ RII ALI SQ+  LGLLSTKHAA S P LI LPVLTI FH +CK RYE 
Sbjct  615   SAAAFWPDVNRRIITALIISQLLLLGLLSTKHAAISTPLLIPLPVLTIWFHRFCKNRYEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF K+PLQEA MKDTL+  REPN ++K YL +AY HPVFK  E E   D +    + EN+
Sbjct  675   AFVKYPLQEAIMKDTLDHVREPNLDMKAYLLNAYTHPVFKNGETE---DKVPGDEEFENI  731

Query  658   LVQTKRQSRKNT  623
             LV TKRQSRK T
Sbjct  732   LVPTKRQSRKGT  743



>gb|EAY97938.1| hypothetical protein OsI_19855 [Oryza sativa Indica Group]
 gb|EEE63624.1| hypothetical protein OsJ_18441 [Oryza sativa Japonica Group]
Length=783

 Score =   338 bits (866),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/240 (67%), Positives = 195/240 (81%), Gaps = 3/240 (1%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             MKATFFITY+MVDGW G+A EVLRLK L++FH+KN+FLV+TE+DRE AM+PGSL F   E
Sbjct  524   MKATFFITYVMVDGWAGVAAEVLRLKPLVMFHIKNTFLVRTERDREQAMDPGSLDFGTTE  583

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             PRIQLYFLLGLVYA VTPILLPFI+VFF+ AY+VFRHQIINVYNQ+YES A FWPDV  R
Sbjct  584   PRIQLYFLLGLVYAVVTPILLPFIIVFFSLAYLVFRHQIINVYNQQYESGAQFWPDVQRR  643

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             ++ ALI SQ+  LGLLST+ A +S   L+ LPVL+I FH  CKGR+E AF K PLQ+A +
Sbjct  644   LVIALIVSQILLLGLLSTQEAEKSTVALLPLPVLSIWFHYVCKGRFEPAFIKFPLQDAMV  703

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  623
             KDTLE+A +P  NL+ YL+DAY+HPVF+ N D Y++ GI E  +E+N +V TKRQSR NT
Sbjct  704   KDTLERANDPTLNLREYLKDAYVHPVFQKN-DIYEFAGIDE--EEKNPMVATKRQSRMNT  760



>ref|NP_001055457.1| Os05g0393800 [Oryza sativa Japonica Group]
 gb|AAT93895.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17371.1| Os05g0393800 [Oryza sativa Japonica Group]
 dbj|BAG91241.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AIU34630.1| hyperosmolality-gated Ca2+ permeable channel 1.3 [Oryza sativa]
Length=767

 Score =   337 bits (864),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/240 (67%), Positives = 195/240 (81%), Gaps = 3/240 (1%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             MKATFFITY+MVDGW G+A EVLRLK L++FH+KN+FLV+TE+DRE AM+PGSL F   E
Sbjct  508   MKATFFITYVMVDGWAGVAAEVLRLKPLVMFHIKNTFLVRTERDREQAMDPGSLDFGTTE  567

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             PRIQLYFLLGLVYA VTPILLPFI+VFF+ AY+VFRHQIINVYNQ+YES A FWPDV  R
Sbjct  568   PRIQLYFLLGLVYAVVTPILLPFIIVFFSLAYLVFRHQIINVYNQQYESGAQFWPDVQRR  627

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             ++ ALI SQ+  LGLLST+ A +S   L+ LPVL+I FH  CKGR+E AF K PLQ+A +
Sbjct  628   LVIALIVSQILLLGLLSTQEAEKSTVALLPLPVLSIWFHYVCKGRFEPAFIKFPLQDAMV  687

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  623
             KDTLE+A +P  NL+ YL+DAY+HPVF+ N D Y++ GI E  +E+N +V TKRQSR NT
Sbjct  688   KDTLERANDPTLNLREYLKDAYVHPVFQKN-DIYEFAGIDE--EEKNPMVATKRQSRMNT  744



>ref|XP_009601393.1| PREDICTED: CSC1-like protein At4g02900 isoform X2 [Nicotiana 
tomentosiformis]
Length=642

 Score =   332 bits (852),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 161/252 (64%), Positives = 202/252 (80%), Gaps = 8/252 (3%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G++     MKATFFIT+IMVDGW GIA E+LRL  L++FH+KN+FLVKT+ DRE A
Sbjct  387   PKTIGVTLP---MKATFFITFIMVDGWAGIAAEILRLVPLVMFHIKNTFLVKTDHDREQA  443

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGSL F+ +EPR+QLYFLLGLVY+ VTPILLPFI+VFFAFAY+VFRHQIINVY+Q+YE
Sbjct  444   MDPGSLNFSVSEPRLQLYFLLGLVYSVVTPILLPFIIVFFAFAYMVFRHQIINVYDQKYE  503

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S A+FWPDV+ RI+  L+ SQ+  +GLLSTK  A+S P LIVL VLTI FH  CKGR+ES
Sbjct  504   SGASFWPDVNRRILIGLVISQLLLIGLLSTKDTAKSTPLLIVLIVLTIWFHKLCKGRFES  563

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
              F K PLQ+A +KDT+E++ EPNFNLK YLQDAY+HPV K  + E     +S++ DEEN 
Sbjct  564   VFVKFPLQDAVVKDTVERSTEPNFNLKEYLQDAYLHPVLKVVKFE-----VSKEIDEENP  618

Query  658   LVQTKRQSRKNT  623
             LV TKR S++++
Sbjct  619   LVATKRTSQRSS  630



>ref|XP_006654360.1| PREDICTED: uncharacterized protein C354.08c-like [Oryza brachyantha]
Length=767

 Score =   334 bits (857),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 162/240 (68%), Positives = 193/240 (80%), Gaps = 3/240 (1%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             MKATFFITY+MVDGW G+A EVLRLKAL++FH+KN+FLV+TE+DRE AM+PGSL F   E
Sbjct  508   MKATFFITYVMVDGWAGVAAEVLRLKALVMFHIKNTFLVRTERDREQAMDPGSLDFGTTE  567

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             PRIQLYFLLGLVYA VTPILLPFI+VFF+ AY+VFRHQIINVY Q+YES A FWPDV  R
Sbjct  568   PRIQLYFLLGLVYAVVTPILLPFIIVFFSLAYLVFRHQIINVYTQQYESGAQFWPDVQRR  627

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             ++ ALI SQ+  LGLLST+ A +S   LI LPVL+I FH +CKGR+E AF K PLQ+A +
Sbjct  628   LVIALIVSQILLLGLLSTQEAEKSTVTLIPLPVLSIWFHHFCKGRFEPAFIKFPLQDAMV  687

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  623
             KDTLE+A +P  NL+ YL+DAY+HPVF  N D Y+   I E  +E+N LV TKRQSR NT
Sbjct  688   KDTLERANDPTLNLREYLKDAYVHPVFHKN-DIYELVAIDE--EEKNPLVATKRQSRMNT  744



>ref|XP_002870239.1| hypothetical protein ARALYDRAFT_493346 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46498.1| hypothetical protein ARALYDRAFT_493346 [Arabidopsis lyrata subsp. 
lyrata]
Length=761

 Score =   334 bits (856),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 161/253 (64%), Positives = 200/253 (79%), Gaps = 5/253 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI++HLKNSFLV+TEKDRE+A
Sbjct  501   PKTIGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNSFLVRTEKDREEA  557

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
              +PG++ FN  EP+IQLYFLLGLVYAAV+PILLPFILVFF  A+VV+RHQ+INVYNQ+YE
Sbjct  558   TDPGTIGFNTGEPQIQLYFLLGLVYAAVSPILLPFILVFFGLAFVVYRHQVINVYNQKYE  617

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SA  FWPDVH R++ AL+ SQ+  +GLLSTKHA++S PFL+VLP+LTI FH++CK RY+ 
Sbjct  618   SAGKFWPDVHRRVVTALVVSQLLLMGLLSTKHASKSTPFLLVLPLLTIGFHMHCKNRYQP  677

Query  838   AFTKHPL-QEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEEN  662
             AF  +PL QEA +KDTL++ REPNFNLK +L+DAY HP F+  ED    + +        
Sbjct  678   AFVTYPLQQEAMIKDTLDRIREPNFNLKAFLRDAYAHPEFRVGEDPEPEEKLESDMSPPE  737

Query  661   VLVQTKRQSRKNT  623
              LV TKR S +NT
Sbjct  738   -LVATKRGSWRNT  749



>ref|NP_176422.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 gb|AEE33953.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 gb|AIU34616.1| hyperosmolality-gated Ca2+ permeable channel 1.4 [Arabidopsis 
thaliana]
Length=769

 Score =   334 bits (856),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 165/258 (64%), Positives = 197/258 (76%), Gaps = 20/258 (8%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             +G+A P+           KATFFITYIMVDGW G+AGE+ RLK L++FHLKN F VKTEK
Sbjct  502   VGVAIPI-----------KATFFITYIMVDGWAGVAGEIFRLKPLVIFHLKNFFFVKTEK  550

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PG + F   EPRIQLYFLLGLVYA VTP+LLPFI+ FF FAY+VFRHQ     
Sbjct  551   DREEAMDPGQIDFYATEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYLVFRHQ-----  605

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
               +YESA AFWPDVHGRII ALI SQ+  LGL+STK   QS PFL+VL +LT  FH +CK
Sbjct  606   --KYESAGAFWPDVHGRIISALIISQILLLGLMSTKGKVQSTPFLLVLAILTFGFHRFCK  663

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYESAF  +PLQEA +KDTLE+AREPN NLK +LQ+AY+HPVFK  ED  D +G+ E +
Sbjct  664   GRYESAFVINPLQEAMIKDTLERAREPNLNLKGFLQNAYVHPVFKDEEDS-DEEGLIEDS  722

Query  673   DEEN-VLVQTKRQSRKNT  623
             D+E+ V+VQTKRQ  + T
Sbjct  723   DDEDCVVVQTKRQRSRRT  740



>gb|EMT18085.1| Putative membrane protein [Aegilops tauschii]
Length=766

 Score =   333 bits (855),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 170/252 (67%), Positives = 201/252 (80%), Gaps = 5/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P V+G++     MKATFFITY+MVDGWTG+A EVLRL+A I+FHLKN FLVKTEKDRE+A
Sbjct  499   PRVIGVAIP---MKATFFITYVMVDGWTGVALEVLRLRAFIMFHLKNFFLVKTEKDREEA  555

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGS+C  ++EPRIQLYFLLGLVYA VTP+LLPFILVFFA AYVV+RHQIINVYNQ YE
Sbjct  556   MDPGSICLYWSEPRIQLYFLLGLVYAVVTPLLLPFILVFFALAYVVYRHQIINVYNQRYE  615

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S A FWP+VH RII ALI SQ+  LGLLSTK   ++ P L+VLPVLTI FH YCK RYE 
Sbjct  616   SGAQFWPNVHLRIITALIVSQLLLLGLLSTKGLEEATPALLVLPVLTIWFHKYCKHRYEP  675

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQE   KDTLE+ARE NF+LK YL DAY+HPVFK NE +  Y  +++      V
Sbjct  676   AFVRNPLQEVMRKDTLERARERNFDLKAYLADAYLHPVFKSNEVDKFY--VADDPGAVEV  733

Query  658   LVQTKRQSRKNT  623
             +V TKR+SR+ T
Sbjct  734   IVPTKRRSRRIT  745



>ref|XP_004493651.1| PREDICTED: uncharacterized protein RSN1-like isoform X1 [Cicer 
arietinum]
 ref|XP_004493652.1| PREDICTED: uncharacterized protein RSN1-like isoform X2 [Cicer 
arietinum]
Length=759

 Score =   333 bits (854),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 161/239 (67%), Positives = 195/239 (82%), Gaps = 3/239 (1%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             MKATFFITYIM+DGW GIAGE+LRL +LI FHLKN+FLVKTE+DR++AM+PGSL F  +E
Sbjct  510   MKATFFITYIMLDGWAGIAGEILRLSSLISFHLKNTFLVKTEQDRQNAMDPGSLEFATSE  569

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             PRIQLYF+LG VYA VTP+LLPFI+VFFAF+Y+VFRHQIINVYNQ+YES A FWPDVH R
Sbjct  570   PRIQLYFMLGHVYAPVTPLLLPFIVVFFAFSYMVFRHQIINVYNQQYESGATFWPDVHRR  629

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             +I  LI SQ+   GLLST+ A +S   LI  PVLTI FHLYCKGR+ESAF + PL++A +
Sbjct  630   VIIGLIISQILLAGLLSTRGANKSTLVLIAQPVLTIWFHLYCKGRFESAFVRFPLEDAMV  689

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKN  626
             KDTLE+A EPN NL+ YLQDA++HPVFK   DE++   I +  +EEN L+QTKR  R +
Sbjct  690   KDTLERAVEPNLNLRLYLQDAFVHPVFKA--DEFEKPVIIDD-EEENPLIQTKRTCRSS  745



>ref|XP_009601331.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Nicotiana 
tomentosiformis]
Length=755

 Score =   333 bits (853),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 161/252 (64%), Positives = 202/252 (80%), Gaps = 8/252 (3%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G++     MKATFFIT+IMVDGW GIA E+LRL  L++FH+KN+FLVKT+ DRE A
Sbjct  500   PKTIGVTLP---MKATFFITFIMVDGWAGIAAEILRLVPLVMFHIKNTFLVKTDHDREQA  556

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGSL F+ +EPR+QLYFLLGLVY+ VTPILLPFI+VFFAFAY+VFRHQIINVY+Q+YE
Sbjct  557   MDPGSLNFSVSEPRLQLYFLLGLVYSVVTPILLPFIIVFFAFAYMVFRHQIINVYDQKYE  616

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S A+FWPDV+ RI+  L+ SQ+  +GLLSTK  A+S P LIVL VLTI FH  CKGR+ES
Sbjct  617   SGASFWPDVNRRILIGLVISQLLLIGLLSTKDTAKSTPLLIVLIVLTIWFHKLCKGRFES  676

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
              F K PLQ+A +KDT+E++ EPNFNLK YLQDAY+HPV K  + E     +S++ DEEN 
Sbjct  677   VFVKFPLQDAVVKDTVERSTEPNFNLKEYLQDAYLHPVLKVVKFE-----VSKEIDEENP  731

Query  658   LVQTKRQSRKNT  623
             LV TKR S++++
Sbjct  732   LVATKRTSQRSS  743



>ref|XP_004242328.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Solanum lycopersicum]
Length=766

 Score =   333 bits (853),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/253 (63%), Positives = 201/253 (79%), Gaps = 8/253 (3%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G++     MKATFFIT+IMVDGW GIA E+LRL  LI+FH+KN+FLVKTE DRE+A
Sbjct  500   PKTIGVTLP---MKATFFITFIMVDGWAGIAAEILRLVPLIMFHIKNTFLVKTEHDREEA  556

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGSL F+ +EPR+QLYFLLGLVY+ VTPILLPFI++FFAF+Y+VFRHQIINVY+Q+YE
Sbjct  557   MDPGSLNFSVSEPRLQLYFLLGLVYSVVTPILLPFIIIFFAFSYMVFRHQIINVYDQKYE  616

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S A+FWPDV+ RI+  L+ S +  +GLLSTK A+QS P LIVL VLTI FH +CKGR+ES
Sbjct  617   SGASFWPDVNRRILIGLVISHLLLIGLLSTKEASQSTPLLIVLTVLTIWFHKFCKGRFES  676

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADE-EN  662
              F + PLQ+A +KDT+E+  EPNFNLK YLQDAY+HPV KG     D++   E  DE +N
Sbjct  677   VFVRFPLQDAVVKDTVERTTEPNFNLKEYLQDAYLHPVLKG----VDFEVSREINDEGKN  732

Query  661   VLVQTKRQSRKNT  623
              LV TKR  R+++
Sbjct  733   SLVATKRTCRRSS  745



>ref|XP_002886475.1| F24O1.4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62734.1| F24O1.4 [Arabidopsis lyrata subsp. lyrata]
Length=778

 Score =   333 bits (853),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 164/247 (66%), Positives = 195/247 (79%), Gaps = 11/247 (4%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             +G+A P+           KATFFITYIMVDGW G+AGE+ RLK L++FHLKN F VKTEK
Sbjct  504   VGVAIPI-----------KATFFITYIMVDGWAGVAGEIFRLKPLVIFHLKNFFFVKTEK  552

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE+AM+PG + F   EPRIQLYFLLGLVYA VTP+LLPFI+ FF FAY+VFRHQIINVY
Sbjct  553   DREEAMDPGQIDFYATEPRIQLYFLLGLVYAPVTPVLLPFIIFFFGFAYLVFRHQIINVY  612

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             +Q+YESAAAFWPDVHGRII ALI SQ+  LGL+STK   QS PFL+VL ++T  FH +CK
Sbjct  613   DQKYESAAAFWPDVHGRIISALIISQILLLGLMSTKGKVQSTPFLLVLAIVTFGFHRFCK  672

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GRYESAF  +PLQEA +KDTLE+A+EPN NLK +LQ+AYIHPVFK  EDE +   I +  
Sbjct  673   GRYESAFVINPLQEAMIKDTLERAKEPNLNLKGFLQNAYIHPVFKDEEDEDEEGLIEDSD  732

Query  673   DEENVLV  653
             DE+ V+V
Sbjct  733   DEDCVVV  739



>ref|XP_003568506.1| PREDICTED: CSC1-like protein At4g02900 [Brachypodium distachyon]
Length=767

 Score =   332 bits (851),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/240 (66%), Positives = 192/240 (80%), Gaps = 3/240 (1%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             MKATFFITY+MVDGW G+A EVLRLK L++FH+KN+FLV+TE+DRE AMNPGSL F   E
Sbjct  508   MKATFFITYVMVDGWAGVAAEVLRLKPLVMFHIKNTFLVRTEQDREQAMNPGSLDFGTTE  567

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             PRIQLYFLLGLVYA VTPILLPFI+VFF+ AY+VFRHQIINVYNQ+YES   FWPDV  R
Sbjct  568   PRIQLYFLLGLVYAVVTPILLPFIIVFFSLAYLVFRHQIINVYNQQYESGGLFWPDVQRR  627

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             I+ ALI SQ+  LGLLST+ A +S   L+ LPVLTI FH  CKGR+E A+ K PLQEA +
Sbjct  628   IVAALIVSQILLLGLLSTQEAEKSTVSLLPLPVLTIWFHYVCKGRFEPAYIKFPLQEAMV  687

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  623
             KDTLE+A +P  NL+ YL+DAY+HPVF+ N+    Y+ ++   +E+N LV T+RQSR NT
Sbjct  688   KDTLERANDPTLNLRDYLKDAYVHPVFQKND---LYELVAMDEEEKNPLVATRRQSRMNT  744



>ref|XP_010110412.1| Uncharacterized protein RSN1 [Morus notabilis]
 gb|EXC26244.1| Uncharacterized protein RSN1 [Morus notabilis]
Length=365

 Score =   320 bits (819),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 156/234 (67%), Positives = 183/234 (78%), Gaps = 3/234 (1%)
 Frame = -2

Query  1405  ATFFIGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLV  1226
             AT     A P  +G+S     MKATFFITYIMVDGW GIAGE+LRLK L++FHLKN FLV
Sbjct  48    ATRSCTTAIPRTIGVSIP---MKATFFITYIMVDGWAGIAGEILRLKPLVIFHLKNMFLV  104

Query  1225  KTEKDREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQI  1046
             KTE+DRE AMNPGS+ F    P +QLYFLLGLVY  VTPILLPF++VFFA AY+V+RHQI
Sbjct  105   KTERDRERAMNPGSVDFPETIPSLQLYFLLGLVYMVVTPILLPFMVVFFALAYLVYRHQI  164

Query  1045  INVYNQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFH  866
             INVYNQ+YESAAAFWP VH RII +L  SQ+  +GLLSTK AA S P L+VLP+LTI FH
Sbjct  165   INVYNQQYESAAAFWPHVHTRIIASLFISQLLLMGLLSTKKAANSTPLLVVLPILTIAFH  224

Query  865   LYCKGRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDE  704
              YCK R+E AF K+PL+EA  KDT E+A EP+ NLK YL DAY+HP+F+  E+E
Sbjct  225   KYCKHRFEPAFRKYPLEEAMAKDTAERAAEPDLNLKAYLADAYLHPIFQSFEEE  278



>ref|XP_007050676.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
 gb|EOX94833.1| ERD (early-responsive to dehydration stress) family protein [Theobroma 
cacao]
Length=751

 Score =   331 bits (848),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 162/252 (64%), Positives = 197/252 (78%), Gaps = 6/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITY+MVDGW GIA E+LRL  L++FHLKN+FLVKTE+DRE A
Sbjct  498   PKTVGVSIP---MKATFFITYVMVDGWAGIAAEILRLVPLVIFHLKNTFLVKTEQDREQA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG L F  +EPRIQ Y LLGLVY+A+TP+LLPFI++FFAFAY+VFRHQ+INVY+Q YE
Sbjct  555   MDPGCLDFATSEPRIQFYILLGLVYSAITPVLLPFIIIFFAFAYLVFRHQVINVYDQRYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S A+FWPDVH R+I  LI SQ+  +GLLSTK   +S   L+ LP+LTI FH YCKGR+ES
Sbjct  615   SGASFWPDVHRRLIIGLIISQLLLMGLLSTKKIDKSTIALLPLPILTIWFHRYCKGRFES  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF K PLQ+A +KDTLE A EPN NLK YL+DAYIHPVFKG + E     I E  +E+N 
Sbjct  675   AFVKFPLQDAMIKDTLEHATEPNLNLKAYLKDAYIHPVFKGTDFERP-QLICE--EEDNP  731

Query  658   LVQTKRQSRKNT  623
             LV TKR S++N+
Sbjct  732   LVPTKRTSKQNS  743



>ref|XP_008808245.1| PREDICTED: CSC1-like protein At4g02900 isoform X1 [Phoenix dactylifera]
Length=759

 Score =   330 bits (846),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/252 (62%), Positives = 197/252 (78%), Gaps = 6/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P+++G +      KATFFITYIM+DGW G+A E++RLK LI++HLKN+FLVKTE+DRE A
Sbjct  499   PVIVGTAIP---AKATFFITYIMLDGWAGVASEIVRLKPLIIYHLKNAFLVKTEQDREQA  555

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGSL F  +EPRIQLYFLLGLVY+ VTPI LPFI+VFF+ +YVVFRHQIINVY+QEYE
Sbjct  556   MDPGSLDFASSEPRIQLYFLLGLVYSVVTPIFLPFIVVFFSLSYVVFRHQIINVYDQEYE  615

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S AAFWPDVH R+I A+I SQ++ +GL+STK    + P LI LP+LTI FH YCK R+E 
Sbjct  616   SGAAFWPDVHRRLIIAMIISQLTLMGLMSTKDPKHATPVLIALPILTIWFHKYCKSRFEP  675

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF K PLQEA +KDTLE+A++PN NL+ YLQDAY+HPVF   + E     ++   +E N 
Sbjct  676   AFVKFPLQEAVVKDTLERAKDPNLNLRSYLQDAYVHPVFHSKDIE---RLVAIDEEENNP  732

Query  658   LVQTKRQSRKNT  623
             LV TKR S ++T
Sbjct  733   LVPTKRNSNRST  744



>ref|XP_006479762.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X2 [Citrus sinensis]
Length=760

 Score =   329 bits (844),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/248 (65%), Positives = 196/248 (79%), Gaps = 5/248 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P   G+S     MKATFFITY MVDGW GIA E++RL  L++FHLKN+FLVKT++DR++A
Sbjct  498   PKTFGVSIP---MKATFFITYTMVDGWAGIAAEIIRLVPLVIFHLKNTFLVKTDQDRDEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG L F  NEPRIQ Y LLGLVYA VTPILLPFI+VFFAF+YVVFRHQ+INVY+Q YE
Sbjct  555   MDPGYLRFGTNEPRIQFYILLGLVYAPVTPILLPFIIVFFAFSYVVFRHQVINVYDQIYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S AAFWPDVH RII  LI SQ+  +GLLST+ A +S P LI+LPV+TI FH+YCKGR+E 
Sbjct  615   SGAAFWPDVHRRIIINLIISQLLLMGLLSTRKADKSTPLLILLPVITIWFHVYCKGRFEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF   PLQEA +KDTLE+A EPN NL+ YLQDAY+HPVFKG +++ +   + E+ D  + 
Sbjct  675   AFVTFPLQEAMVKDTLERATEPNLNLRTYLQDAYVHPVFKGIQEQ-NPPAVEEEED-SSP  732

Query  658   LVQTKRQS  635
             LV TKR++
Sbjct  733   LVATKRRN  740



>ref|XP_006444131.1| hypothetical protein CICLE_v10024532mg [Citrus clementina]
 ref|XP_006479761.1| PREDICTED: uncharacterized membrane protein C2G11.09-like isoform 
X1 [Citrus sinensis]
 gb|ESR57371.1| hypothetical protein CICLE_v10024532mg [Citrus clementina]
Length=760

 Score =   329 bits (843),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 160/248 (65%), Positives = 196/248 (79%), Gaps = 5/248 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P   G+S     MKATFFITY MVDGW GIA E++RL  L++FHLKN+FLVKT++DR++A
Sbjct  498   PKTFGVSIP---MKATFFITYTMVDGWAGIAAEIIRLVPLVIFHLKNTFLVKTDQDRDEA  554

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG L F  NEPRIQ Y LLGLVYA VTPILLPFI+VFFAF+YVVFRHQ+INVY+Q YE
Sbjct  555   MDPGYLRFGTNEPRIQFYILLGLVYAPVTPILLPFIIVFFAFSYVVFRHQVINVYDQIYE  614

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S AAFWPDVH RII  LI SQ+  +GLLST+ A +S P LI+LPV+TI FH+YCKGR+E 
Sbjct  615   SGAAFWPDVHRRIIINLIISQLLLMGLLSTRKADKSTPLLILLPVITIWFHVYCKGRFEP  674

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF   PLQEA +KDTLE+A EPN NL+ YLQDAY+HPVFKG +++ +   + E+ D  + 
Sbjct  675   AFVTFPLQEAMVKDTLERATEPNLNLRTYLQDAYVHPVFKGIQEQ-NPPAVEEEED-SSP  732

Query  658   LVQTKRQS  635
             LV TKR++
Sbjct  733   LVATKRRN  740



>gb|EMT23208.1| Putative membrane protein [Aegilops tauschii]
Length=849

 Score =   331 bits (848),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 163/252 (65%), Positives = 200/252 (79%), Gaps = 5/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P ++G++     MKATFFITY+MVDGW G++ E+LR++A +L+HLKN FLVKTEKDRE+A
Sbjct  491   PRIIGVAIP---MKATFFITYVMVDGWAGVSLEILRIRAFVLYHLKNFFLVKTEKDREEA  547

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGS+CF ++EPRIQLYFLLGLVYAAVTP+LLPFILVFFA  YVV+RHQIINVY+Q YE
Sbjct  548   MDPGSICFYWSEPRIQLYFLLGLVYAAVTPLLLPFILVFFALGYVVYRHQIINVYHQRYE  607

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S A FWP+VH RII ALI SQ+  LGLLSTK   ++ P L+VLP+LT  FH YC  RY+ 
Sbjct  608   SGAQFWPNVHLRIIVALIASQLLLLGLLSTKGLEEATPVLLVLPILTFWFHKYCTHRYKP  667

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQEA  KDTLE AREPNF+LK YL D+Y+HPVFK   D+ D   ++E    E V
Sbjct  668   AFVRNPLQEAMRKDTLEHAREPNFDLKSYLADSYLHPVFKS--DDVDKFYVAEDPGAEEV  725

Query  658   LVQTKRQSRKNT  623
             +V TKRQSR+ T
Sbjct  726   IVATKRQSRRTT  737



>ref|XP_009147362.1| PREDICTED: CSC1-like protein At4g15430 isoform X2 [Brassica rapa]
Length=761

 Score =   329 bits (843),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 158/252 (63%), Positives = 198/252 (79%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AG +LRLK LI++HLKNSFLV+TE DRE+A
Sbjct  501   PKTIGVSIP---MKATFFITYIMVDGWAGVAGAILRLKPLIIYHLKNSFLVRTENDREEA  557

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
              + G++ FN  EP+IQLYFLLGLVYAAV+PILLPFI++FFA AYVV+RHQ+INVYNQ YE
Sbjct  558   TDAGTIGFNTGEPQIQLYFLLGLVYAAVSPILLPFIILFFALAYVVYRHQVINVYNQNYE  617

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SA  FWPDVH R++ ALI SQ+  +GLLSTK A++S PFL+VLPVLTI FH++CK RY+ 
Sbjct  618   SAGKFWPDVHRRVVTALIVSQLLLMGLLSTKQASKSTPFLLVLPVLTIGFHMHCKCRYQP  677

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++ LQEA +KDTLE+ REPN NLK + ++AY HP F+  ED  + +   EK ++   
Sbjct  678   AFVRYSLQEAMIKDTLERTREPNLNLKAFFRNAYAHPEFRVGED-LELEMAVEKPNKTPE  736

Query  658   LVQTKRQSRKNT  623
             LV TKR S +NT
Sbjct  737   LVATKRGSWRNT  748



>ref|XP_009147329.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Brassica rapa]
 ref|XP_009147337.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Brassica rapa]
 ref|XP_009147346.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Brassica rapa]
 ref|XP_009147353.1| PREDICTED: CSC1-like protein At4g15430 isoform X1 [Brassica rapa]
Length=762

 Score =   329 bits (843),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 158/252 (63%), Positives = 198/252 (79%), Gaps = 4/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AG +LRLK LI++HLKNSFLV+TE DRE+A
Sbjct  502   PKTIGVSIP---MKATFFITYIMVDGWAGVAGAILRLKPLIIYHLKNSFLVRTENDREEA  558

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
              + G++ FN  EP+IQLYFLLGLVYAAV+PILLPFI++FFA AYVV+RHQ+INVYNQ YE
Sbjct  559   TDAGTIGFNTGEPQIQLYFLLGLVYAAVSPILLPFIILFFALAYVVYRHQVINVYNQNYE  618

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SA  FWPDVH R++ ALI SQ+  +GLLSTK A++S PFL+VLPVLTI FH++CK RY+ 
Sbjct  619   SAGKFWPDVHRRVVTALIVSQLLLMGLLSTKQASKSTPFLLVLPVLTIGFHMHCKCRYQP  678

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++ LQEA +KDTLE+ REPN NLK + ++AY HP F+  ED  + +   EK ++   
Sbjct  679   AFVRYSLQEAMIKDTLERTREPNLNLKAFFRNAYAHPEFRVGED-LELEMAVEKPNKTPE  737

Query  658   LVQTKRQSRKNT  623
             LV TKR S +NT
Sbjct  738   LVATKRGSWRNT  749



>gb|EMS65241.1| Uncharacterized membrane protein C2G11.09 [Triticum urartu]
Length=813

 Score =   330 bits (845),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 163/252 (65%), Positives = 199/252 (79%), Gaps = 5/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P ++G++     MKATFFITY+MVDGW G++ E+LR++A +L+HLKN FLVKTEKDRE+A
Sbjct  546   PRIIGVAIP---MKATFFITYVMVDGWAGVSLEILRIRAFVLYHLKNFFLVKTEKDREEA  602

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGS+CF ++EPRIQLYFLLGLVYAAVTP+LLPFILVFFA  YVV+RHQIINVY+Q YE
Sbjct  603   MDPGSICFYWSEPRIQLYFLLGLVYAAVTPLLLPFILVFFALGYVVYRHQIINVYHQRYE  662

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S A FWP+VH RII ALI SQ+  LGLLSTK   ++ P L+VLP+LT  FH YC  RY+ 
Sbjct  663   SGAQFWPNVHLRIIVALIASQLLLLGLLSTKGLEEATPVLLVLPILTFWFHKYCTHRYKP  722

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF ++PLQEA  KDTLE AREPNF+LK YL D+Y+HPVFK   D  D   ++E    E V
Sbjct  723   AFVRNPLQEAMRKDTLEHAREPNFDLKSYLADSYLHPVFKS--DHVDKFYVAEDPGAEEV  780

Query  658   LVQTKRQSRKNT  623
             +V TKRQSR+ T
Sbjct  781   IVATKRQSRRTT  792



>gb|KHN19872.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=716

 Score =   327 bits (839),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 155/240 (65%), Positives = 191/240 (80%), Gaps = 3/240 (1%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             MKATFFITYIM+DGW GIA E+LRL  LI FH+KN+FLVKTE+DR++AM+PGSL F  +E
Sbjct  469   MKATFFITYIMIDGWAGIAAEILRLAPLITFHVKNTFLVKTEQDRQNAMDPGSLEFATSE  528

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             PRIQLYF+LG VYA VTP LLPFI+VFFAFAY++FRHQIINVYNQ+YES  +FWPD+HGR
Sbjct  529   PRIQLYFMLGHVYAPVTPFLLPFIVVFFAFAYMIFRHQIINVYNQQYESGGSFWPDIHGR  588

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             +I  LI SQ+  +GLLST+   +S   LI  P+LT+ FH YCKGR+ESAF K PL+EA +
Sbjct  589   VISGLIISQILLMGLLSTRGTDKSTLVLIAQPILTLWFHRYCKGRFESAFVKFPLEEAMV  648

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  623
             KDTLE+A EPN NL+ YLQDAY+HP FKG  D++    I +  +E N L+QT R SR+ +
Sbjct  649   KDTLERAVEPNLNLRIYLQDAYVHPGFKG--DDFQKPAIIDD-EENNPLIQTTRASRRGS  705



>ref|XP_006604421.1| PREDICTED: uncharacterized protein RSN1-like isoform X2 [Glycine 
max]
Length=756

 Score =   328 bits (841),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 155/240 (65%), Positives = 192/240 (80%), Gaps = 3/240 (1%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             MKATFFITYIM+DGW GIA E+LRL  LI FH+KN+FLVKTE+DR++AM+PGSL F  +E
Sbjct  509   MKATFFITYIMIDGWAGIAAEILRLSPLITFHMKNTFLVKTEQDRQNAMDPGSLEFATSE  568

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             PRIQLYF+LG VYA VTP LLPFI+VFFAFAY++FRHQIINVY Q+YES  AFWPDVHGR
Sbjct  569   PRIQLYFMLGHVYAPVTPFLLPFIVVFFAFAYMIFRHQIINVYAQQYESGGAFWPDVHGR  628

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             ++  LI SQ+  +GLL+T+   +S   LI  P+LT  FH YCKGR+ESAF K PL+EA +
Sbjct  629   VVMGLIISQILLMGLLTTRGTDKSTLVLIAQPILTFWFHRYCKGRFESAFVKFPLEEAMV  688

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  623
             KDTLE+A EPN NL+ YLQDAY+HPVFKG  D+++   I +  +E N L+QT R SR+++
Sbjct  689   KDTLERAVEPNLNLRIYLQDAYVHPVFKG--DDFEKPAIIDD-EEGNPLIQTTRASRQDS  745



>ref|XP_003553451.1| PREDICTED: uncharacterized protein RSN1-like isoform X1 [Glycine 
max]
 gb|KHN45373.1| Putative membrane protein C2G11.09 [Glycine soja]
Length=756

 Score =   328 bits (841),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 155/240 (65%), Positives = 192/240 (80%), Gaps = 3/240 (1%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             MKATFFITYIM+DGW GIA E+LRL  LI FH+KN+FLVKTE+DR++AM+PGSL F  +E
Sbjct  509   MKATFFITYIMIDGWAGIAAEILRLSPLITFHMKNTFLVKTEQDRQNAMDPGSLEFATSE  568

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             PRIQLYF+LG VYA VTP LLPFI+VFFAFAY++FRHQIINVY Q+YES  AFWPDVHGR
Sbjct  569   PRIQLYFMLGHVYAPVTPFLLPFIVVFFAFAYMIFRHQIINVYAQQYESGGAFWPDVHGR  628

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             ++  LI SQ+  +GLL+T+   +S   LI  P+LT  FH YCKGR+ESAF K PL+EA +
Sbjct  629   VVMGLIISQILLMGLLTTRGTDKSTLVLIAQPILTFWFHRYCKGRFESAFVKFPLEEAMV  688

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  623
             KDTLE+A EPN NL+ YLQDAY+HPVFKG  D+++   I +  +E N L+QT R SR+++
Sbjct  689   KDTLERAVEPNLNLRIYLQDAYVHPVFKG--DDFEKPAIIDD-EEGNPLIQTTRASRQDS  745



>gb|AAC79116.1| hypothetical protein [Arabidopsis thaliana]
Length=680

 Score =   326 bits (835),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 160/252 (63%), Positives = 197/252 (78%), Gaps = 6/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW GIA E+LR+  L++FHLKN+FLVKTE+DR+ A
Sbjct  394   PKTVGVSIP---MKATFFITYIMVDGWAGIAAEILRVVPLVIFHLKNTFLVKTEQDRQQA  450

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG L F  +EPRIQ YFLLGLVYAAV PILLPFI+VFFAFAYVVFRHQ+INVY+Q+YE
Sbjct  451   MDPGHLDFATSEPRIQFYFLLGLVYAAVAPILLPFIIVFFAFAYVVFRHQVINVYDQKYE  510

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S A +WPDVH R+I  LI SQ+  +GLLSTK  A+    L+  P+LT  F+ YC GR+ES
Sbjct  511   SGARYWPDVHRRLIICLIISQLLMMGLLSTKKFAKVTALLLPQPILTFWFYRYCAGRFES  570

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF+K PLQEA +KDTLE+A EPN NLK YL+DAY+HPVFKGN  ++D   + ++ +E N 
Sbjct  571   AFSKFPLQEAMVKDTLEKATEPNLNLKEYLKDAYVHPVFKGN--DFDRPRVVDE-EESNP  627

Query  658   LVQTKRQSRKNT  623
             LV+TKR S+  T
Sbjct  628   LVRTKRTSQGTT  639



>ref|XP_003520558.1| PREDICTED: uncharacterized membrane protein C2G11.09-like [Glycine 
max]
Length=756

 Score =   327 bits (839),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/240 (65%), Positives = 191/240 (80%), Gaps = 3/240 (1%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             MKATFFITYIM+DGW GIA E+LRL  LI FH+KN+FLVKTE+DR++AM+PGSL F  +E
Sbjct  509   MKATFFITYIMIDGWAGIAAEILRLAPLITFHVKNTFLVKTEQDRQNAMDPGSLEFATSE  568

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             PRIQLYF+LG VYA VTP LLPFI+VFFAFAY++FRHQIINVYNQ+YES  +FWPD+HGR
Sbjct  569   PRIQLYFMLGHVYAPVTPFLLPFIVVFFAFAYMIFRHQIINVYNQQYESGGSFWPDIHGR  628

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             +I  LI SQ+  +GLLST+   +S   LI  P+LT+ FH YCKGR+ESAF K PL+EA +
Sbjct  629   VISGLIISQILLMGLLSTRGTDKSTLVLIAQPILTLWFHRYCKGRFESAFVKFPLEEAMV  688

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  623
             KDTLE+A EPN NL+ YLQDAY+HP FKG  D++    I +  +E N L+QT R SR+ +
Sbjct  689   KDTLERAVEPNLNLRIYLQDAYVHPGFKG--DDFQKPAIIDD-EENNPLIQTTRASRRGS  745



>gb|KFK30891.1| hypothetical protein AALP_AA6G039600 [Arabis alpina]
Length=684

 Score =   325 bits (833),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 159/252 (63%), Positives = 197/252 (78%), Gaps = 6/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW GIA E+LRL  L++FHLKN+FLVKTE+DR+ A
Sbjct  415   PKTVGVSIP---MKATFFITYIMVDGWAGIAAEILRLVPLVMFHLKNAFLVKTEQDRQQA  471

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG L F   EPRIQ YFLLGLVYAAVTPILLPFI+VFFAF+YVVFRHQ+INVY+Q+YE
Sbjct  472   MDPGHLDFATTEPRIQFYFLLGLVYAAVTPILLPFIIVFFAFSYVVFRHQVINVYDQKYE  531

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S A +WPDVH R+I  LI SQ+  +GLLSTK  A++   L+  P+LTI F+ YC GR+ES
Sbjct  532   SGARYWPDVHRRLIICLIISQLLMMGLLSTKKLAKATVLLLPQPILTIWFNRYCAGRFES  591

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF+K PLQEA +KDTLE+A EPN NLK YL+DAY+HPVFKG   ++D   + ++ +E N 
Sbjct  592   AFSKFPLQEAMVKDTLEKATEPNLNLKEYLKDAYVHPVFKGK--DFDRPRVVDE-EESNP  648

Query  658   LVQTKRQSRKNT  623
             LV T+R S+  +
Sbjct  649   LVPTRRTSQATS  660



>gb|KFK30892.1| hypothetical protein AALP_AA6G039600 [Arabis alpina]
Length=693

 Score =   325 bits (833),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 159/252 (63%), Positives = 197/252 (78%), Gaps = 6/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW GIA E+LRL  L++FHLKN+FLVKTE+DR+ A
Sbjct  424   PKTVGVSIP---MKATFFITYIMVDGWAGIAAEILRLVPLVMFHLKNAFLVKTEQDRQQA  480

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG L F   EPRIQ YFLLGLVYAAVTPILLPFI+VFFAF+YVVFRHQ+INVY+Q+YE
Sbjct  481   MDPGHLDFATTEPRIQFYFLLGLVYAAVTPILLPFIIVFFAFSYVVFRHQVINVYDQKYE  540

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S A +WPDVH R+I  LI SQ+  +GLLSTK  A++   L+  P+LTI F+ YC GR+ES
Sbjct  541   SGARYWPDVHRRLIICLIISQLLMMGLLSTKKLAKATVLLLPQPILTIWFNRYCAGRFES  600

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF+K PLQEA +KDTLE+A EPN NLK YL+DAY+HPVFKG   ++D   + ++ +E N 
Sbjct  601   AFSKFPLQEAMVKDTLEKATEPNLNLKEYLKDAYVHPVFKGK--DFDRPRVVDE-EESNP  657

Query  658   LVQTKRQSRKNT  623
             LV T+R S+  +
Sbjct  658   LVPTRRTSQATS  669



>ref|XP_010326353.1| PREDICTED: CSC1-like protein At4g02900 [Solanum lycopersicum]
Length=751

 Score =   325 bits (834),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 166/253 (66%), Positives = 201/253 (79%), Gaps = 9/253 (4%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G++     +KATFFITYIMVDGW GIA E+LRL   I+FHLKN+FLVKT++DR+ A
Sbjct  499   PKTVGVAMP---LKATFFITYIMVDGWAGIAAEILRLVPFIMFHLKNTFLVKTDQDRQQA  555

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
              +PGSL F+ +EPRIQLYFLLGLVY+ VTPILLPFI+VFFAF+Y+VFRHQIINVY+Q+YE
Sbjct  556   TDPGSLNFSVSEPRIQLYFLLGLVYSVVTPILLPFIIVFFAFSYMVFRHQIINVYDQKYE  615

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S AAFWPDVH RI+  L+ SQ+  LGLLSTK+ ++S P +I LPVLTI FH++CKGRYES
Sbjct  616   SGAAFWPDVHRRILTGLVISQLLLLGLLSTKNISKSTPVMIALPVLTIWFHIFCKGRYES  675

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEE-N  662
             AF K PLQ+A +KDTLE+A EP  NLK YL+ AY+HPVFKG E     D  S   DEE N
Sbjct  676   AFVKFPLQDAMVKDTLERATEPTLNLKAYLKTAYVHPVFKGVE----LDRPSAVDDEENN  731

Query  661   VLVQTKRQSRKNT  623
              LV TKR SR+N+
Sbjct  732   PLVPTKR-SRRNS  743



>ref|XP_009625807.1| PREDICTED: CSC1-like protein At4g02900 [Nicotiana tomentosiformis]
 ref|XP_009625808.1| PREDICTED: CSC1-like protein At4g02900 [Nicotiana tomentosiformis]
Length=750

 Score =   325 bits (833),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 165/257 (64%), Positives = 198/257 (77%), Gaps = 14/257 (5%)
 Frame = -2

Query  1393  IGIAAPMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEK  1214
             +G+A P+           KATFFITYIMVDGW GIA E+LRL  L++FHLKN+FLVKT++
Sbjct  502   VGVAIPL-----------KATFFITYIMVDGWAGIAAEILRLVPLVMFHLKNTFLVKTDQ  550

Query  1213  DREDAMNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVY  1034
             DRE A +PGSL F+ +EPRIQLYFLLGLVY+ VTPILLPFI+VFFAFAY+VFRHQIINVY
Sbjct  551   DREQATDPGSLNFSVSEPRIQLYFLLGLVYSVVTPILLPFIIVFFAFAYMVFRHQIINVY  610

Query  1033  NQEYESAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCK  854
             +Q+YES A+FWPDVH RII  L+ SQ+  LGLLSTK+ A+S   LI LP+LTI FH++CK
Sbjct  611   DQKYESGASFWPDVHRRIIVGLVISQLLLLGLLSTKNVARSNVILIALPILTIWFHIFCK  670

Query  853   GRYESAFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA  674
             GR+ESAF K PLQ+A +KDTLE+A EPN NLK YL+DAY+HPVFKG E E      +   
Sbjct  671   GRFESAFVKFPLQDAMVKDTLERATEPNLNLKAYLKDAYVHPVFKGVEFE---RPTALDD  727

Query  673   DEENVLVQTKRQSRKNT  623
             +E N LV TKR     T
Sbjct  728   EENNPLVPTKRCRGSKT  744



>ref|XP_011625696.1| PREDICTED: CSC1-like protein At4g02900 isoform X3 [Amborella 
trichopoda]
Length=758

 Score =   325 bits (833),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 194/252 (77%), Gaps = 12/252 (5%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYI+VDGW+G+A EVLRLK LI++HLKN+ LVKTEKDREDA
Sbjct  500   PKTIGVSIP---MKATFFITYILVDGWSGVAAEVLRLKPLIMYHLKNALLVKTEKDREDA  556

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             MNPGSL F  +EP++QLYFLLGLVYA VTPILLPFI+VFF  AY+V+RH       Q+YE
Sbjct  557   MNPGSLGFASSEPQLQLYFLLGLVYAVVTPILLPFIVVFFGLAYMVYRH-------QKYE  609

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SAA+FWPDVHGRI+ A++ SQ+  +GL+ST+ AAQS   LI LP+LTI FHL CK R+ES
Sbjct  610   SAASFWPDVHGRIVTAMVISQLVLMGLVSTRGAAQSTTVLIPLPILTIWFHLVCKSRFES  669

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF K PLQEA MKDTLE+A EPN NLK YLQDAYIHPVFKG    +      E  +E N 
Sbjct  670   AFVKFPLQEAMMKDTLERATEPNLNLKVYLQDAYIHPVFKGGNGHHQPKPGFE--EETNP  727

Query  658   LVQTKRQSRKNT  623
             LV TKR S+ +T
Sbjct  728   LVPTKRHSQLST  739



>ref|NP_192199.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 sp|Q9SY14.1|CSCL2_ARATH RecName: Full=CSC1-like protein At4g02900 [Arabidopsis thaliana]
 gb|AAD15333.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB77775.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82248.1| ERD (early-responsive to dehydration stress) family protein [Arabidopsis 
thaliana]
 gb|AIU34619.1| hyperosmolality-gated Ca2+ permeable channel 1.7 [Arabidopsis 
thaliana]
Length=785

 Score =   325 bits (834),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 160/252 (63%), Positives = 197/252 (78%), Gaps = 6/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW GIA E+LR+  L++FHLKN+FLVKTE+DR+ A
Sbjct  499   PKTVGVSIP---MKATFFITYIMVDGWAGIAAEILRVVPLVIFHLKNTFLVKTEQDRQQA  555

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PG L F  +EPRIQ YFLLGLVYAAV PILLPFI+VFFAFAYVVFRHQ+INVY+Q+YE
Sbjct  556   MDPGHLDFATSEPRIQFYFLLGLVYAAVAPILLPFIIVFFAFAYVVFRHQVINVYDQKYE  615

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S A +WPDVH R+I  LI SQ+  +GLLSTK  A+    L+  P+LT  F+ YC GR+ES
Sbjct  616   SGARYWPDVHRRLIICLIISQLLMMGLLSTKKFAKVTALLLPQPILTFWFYRYCAGRFES  675

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF+K PLQEA +KDTLE+A EPN NLK YL+DAY+HPVFKGN  ++D   + ++ +E N 
Sbjct  676   AFSKFPLQEAMVKDTLEKATEPNLNLKEYLKDAYVHPVFKGN--DFDRPRVVDE-EESNP  732

Query  658   LVQTKRQSRKNT  623
             LV+TKR S+  T
Sbjct  733   LVRTKRTSQGTT  744



>gb|EYU46618.1| hypothetical protein MIMGU_mgv1a001779mg [Erythranthe guttata]
Length=760

 Score =   325 bits (832),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/238 (66%), Positives = 188/238 (79%), Gaps = 7/238 (3%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P+ +G++     MKATFFITYIMVDGW GIA E+LRL  LI+FHLKN+FLVKTE+DRE A
Sbjct  499   PITVGVAIP---MKATFFITYIMVDGWAGIAAEILRLVPLIMFHLKNTFLVKTEQDREQA  555

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+ G + F  +EPRIQLYFLLGLVY+ VTP++LPFI+VFFAF+YVVFRHQIINVY+Q+YE
Sbjct  556   MDAGCINFPSSEPRIQLYFLLGLVYSVVTPLILPFIIVFFAFSYVVFRHQIINVYDQKYE  615

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S AAFWP VH R+I  L+ SQ   LGLLSTK  A++ PFLI LPVLTI FH +CKGR+ES
Sbjct  616   SGAAFWPAVHRRVIIGLVISQFLLLGLLSTKRIAKATPFLIALPVLTIWFHRFCKGRFES  675

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEE  665
             AF K PLQ+  +KDTLE+A EPN NLK YLQD+Y+HPVFK     +D + +    DEE
Sbjct  676   AFVKFPLQDTMVKDTLERATEPNLNLKAYLQDSYLHPVFKS----FDIERLGVAVDEE  729



>ref|XP_008234907.1| PREDICTED: uncharacterized protein RSN1 isoform X1 [Prunus mume]
Length=756

 Score =   324 bits (831),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 160/242 (66%), Positives = 188/242 (78%), Gaps = 7/242 (3%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             MKATFFITYIMVDGW+G+A E++RL  LILFHLKN+FLVKTE+DRE AM+PGSL F  NE
Sbjct  508   MKATFFITYIMVDGWSGVAAEIVRLVPLILFHLKNTFLVKTEEDREQAMDPGSLNFATNE  567

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             PR QLYFLLGLVY  VTPILLPFIL+FF+FAY+VFRHQIINVY+Q+YESAAAFWP VH R
Sbjct  568   PRTQLYFLLGLVYCVVTPILLPFILIFFSFAYLVFRHQIINVYDQKYESAAAFWPQVHLR  627

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             +I  LI SQ+  +GL ST   A+S   L+  PVLTI FH  CKGR+ESAF K PLQEA +
Sbjct  628   VIIGLIISQILLMGLFSTLGVAKSTFILVAQPVLTIWFHRVCKGRFESAFLKFPLQEAMV  687

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV--LVQTKRQSRK  629
             KDT+E+A EPN NL  YL+DAY+HPVFKG + +       E  DEE+   LV TKR S+ 
Sbjct  688   KDTVEKATEPNLNLMNYLKDAYVHPVFKGGQSQKH-----EDPDEEDSSPLVPTKRTSQM  742

Query  628   NT  623
              +
Sbjct  743   GS  744



>ref|XP_006854105.1| PREDICTED: CSC1-like protein At1g32090 isoform X1 [Amborella 
trichopoda]
 gb|ERN15572.1| hypothetical protein AMTR_s00048p00143150 [Amborella trichopoda]
Length=760

 Score =   324 bits (831),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/224 (69%), Positives = 182/224 (81%), Gaps = 3/224 (1%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFF+TYIMVDGW GIAGE+LRLK L++FHLKN FLVKTE+DRE+A
Sbjct  501   PRTIGVSIP---MKATFFVTYIMVDGWAGIAGEILRLKPLVIFHLKNMFLVKTERDRENA  557

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGS+  + + P +QLYFLLGLVYA VTPILLPFILVFF FAY+V+RHQIINVYNQEYE
Sbjct  558   MDPGSIELSNSLPTLQLYFLLGLVYAVVTPILLPFILVFFGFAYLVYRHQIINVYNQEYE  617

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S AAFWP VHGRII +L+ SQ   LGLLSTK AA S P LIVLPVLTI FH YCK R+E 
Sbjct  618   SVAAFWPHVHGRIIASLLISQFLLLGLLSTKKAADSTPLLIVLPVLTIWFHKYCKSRFEP  677

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNED  707
             AF K+PL+EA  +DT+E+A EPN NL  YL DAY+HP+F+  +D
Sbjct  678   AFRKYPLEEAMARDTMERAEEPNLNLMAYLADAYLHPIFQSFDD  721



>ref|XP_011626938.1| PREDICTED: CSC1-like protein At1g32090 isoform X2 [Amborella 
trichopoda]
Length=760

 Score =   324 bits (831),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/224 (69%), Positives = 182/224 (81%), Gaps = 3/224 (1%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFF+TYIMVDGW GIAGE+LRLK L++FHLKN FLVKTE+DRE+A
Sbjct  501   PRTIGVSIP---MKATFFVTYIMVDGWAGIAGEILRLKPLVIFHLKNMFLVKTERDRENA  557

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGS+  + + P +QLYFLLGLVYA VTPILLPFILVFF FAY+V+RHQIINVYNQEYE
Sbjct  558   MDPGSIELSNSLPTLQLYFLLGLVYAVVTPILLPFILVFFGFAYLVYRHQIINVYNQEYE  617

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S AAFWP VHGRII +L+ SQ   LGLLSTK AA S P LIVLPVLTI FH YCK R+E 
Sbjct  618   SVAAFWPHVHGRIIASLLISQFLLLGLLSTKKAADSTPLLIVLPVLTIWFHKYCKSRFEP  677

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNED  707
             AF K+PL+EA  +DT+E+A EPN NL  YL DAY+HP+F+  +D
Sbjct  678   AFRKYPLEEAMARDTMERAEEPNLNLMAYLADAYLHPIFQSFDD  721



>ref|XP_002441130.1| hypothetical protein SORBIDRAFT_09g021010 [Sorghum bicolor]
 gb|EES19560.1| hypothetical protein SORBIDRAFT_09g021010 [Sorghum bicolor]
Length=768

 Score =   324 bits (831),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 161/252 (64%), Positives = 197/252 (78%), Gaps = 6/252 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P V+G S     MKATFF+TYIMVDGW+GIA EVLRLK L++FH+KN+FLV+TE DRE A
Sbjct  499   PEVIGESIP---MKATFFMTYIMVDGWSGIAAEVLRLKPLVIFHIKNAFLVRTEHDREQA  555

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
             M+PGSL F  +EPR+QLYFLLGLVYA VTP+LLPFI+VFF+ AY+VFRHQIINVY+Q YE
Sbjct  556   MDPGSLDFYNSEPRLQLYFLLGLVYAVVTPMLLPFIIVFFSLAYLVFRHQIINVYSQRYE  615

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             S A FWPDVH R+I ALI SQ+  LGLLST+ A +S   L+ LPVL+I FH  CKGR+E 
Sbjct  616   SGAQFWPDVHMRLIIALIVSQILLLGLLSTQEAEKSTVALLPLPVLSIWFHHVCKGRFEP  675

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENV  659
             AF K PLQ+A +KDTLE AR+P  NL+ YL+ AY+HPVF+ N+    Y  ++   +E+N 
Sbjct  676   AFVKFPLQDAMVKDTLELARDPTLNLREYLKGAYVHPVFQKND---IYKVVAMDEEEKNP  732

Query  658   LVQTKRQSRKNT  623
             +V TKRQSR NT
Sbjct  733   IVVTKRQSRMNT  744



>dbj|BAJ96091.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=768

 Score =   324 bits (831),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 159/240 (66%), Positives = 189/240 (79%), Gaps = 3/240 (1%)
 Frame = -2

Query  1342  MKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDAMNPGSLCFNFNE  1163
             MKATFFITYIMVDGW GIA EVLRLK LI+FH+KN+FLV+TE+DRE AM+PGSL F   E
Sbjct  509   MKATFFITYIMVDGWAGIAAEVLRLKPLIMFHIKNTFLVRTEQDREQAMDPGSLEFGSTE  568

Query  1162  PRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYESAAAFWPDVHGR  983
             PRIQLYFLLGLVYA V+PI+LPFI+VFF  AY+VFRHQIINVYNQ+YES A FWPDVHGR
Sbjct  569   PRIQLYFLLGLVYAVVSPIILPFIIVFFGLAYLVFRHQIINVYNQQYESGAQFWPDVHGR  628

Query  982   IIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYESAFTKHPLQEAKM  803
             I+ AL+ SQV  +GLLST+ A QS   L+ LPVLTI F   CKGR+E A+ K PLQEA +
Sbjct  629   IVTALVISQVLLIGLLSTQEAEQSTVALLPLPVLTIWFRYVCKGRFEPAYIKFPLQEAMV  688

Query  802   KDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKADEENVLVQTKRQSRKNT  623
             KDTL++A +P  NL+ YL+DAY+HPVF+   D Y+   + E  +E   LV TKR+SR  T
Sbjct  689   KDTLQRANDPMLNLREYLKDAYVHPVFRSG-DVYELLAMDE--EENPHLVATKRRSRMTT  745



>ref|XP_010434984.1| PREDICTED: CSC1-like protein At4g15430 isoform X2 [Camelina sativa]
Length=762

 Score =   324 bits (830),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 166/254 (65%), Positives = 203/254 (80%), Gaps = 6/254 (2%)
 Frame = -2

Query  1378  PMVLGISSAD*WMKATFFITYIMVDGWTGIAGEVLRLKALILFHLKNSFLVKTEKDREDA  1199
             P  +G+S     MKATFFITYIMVDGW G+AGE+LRLK LI++HLKNSFLV+TEKDRE+A
Sbjct  501   PKTIGVSIP---MKATFFITYIMVDGWAGVAGEILRLKPLIIYHLKNSFLVRTEKDREEA  557

Query  1198  MNPGSLCFNFNEPRIQLYFLLGLVYAAVTPILLPFILVFFAFAYVVFRHQIINVYNQEYE  1019
              +PG++ FN  EP+IQLYFLLGLVYA V+PILLPFILVFF  AYVV+RHQ+INVYNQ+YE
Sbjct  558   TDPGTIGFNTGEPQIQLYFLLGLVYATVSPILLPFILVFFGLAYVVYRHQVINVYNQKYE  617

Query  1018  SAAAFWPDVHGRIIFALIFSQVSTLGLLSTKHAAQSAPFLIVLPVLTITFHLYCKGRYES  839
             SA  FWPDVH R++ ALI SQ+  +GLLSTKHA++S P L+VLP+LTI FH++CK RY+ 
Sbjct  618   SAGKFWPDVHRRVVTALIVSQLLLMGLLSTKHASKSTPLLLVLPLLTIGFHIHCKCRYQP  677

Query  838   AFTKHPLQEAKMKDTLEQAREPNFNLKPYLQDAYIHPVFKGNEDEYDYDGISEKA--DEE  665
             AF  +PLQEA +KDTLE+ REPN NLK +L+DAY HP F+  E+ YD +   EKA  D+ 
Sbjct  678   AFVTYPLQEAMIKDTLERTREPNLNLKEFLRDAYAHPEFRVGEN-YDQEMGLEKARSDKS  736

Query  664   NVLVQTKRQSRKNT  623
               LV TKR S +NT
Sbjct  737   PDLVATKRGSWRNT  750



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4188676980598