BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13567

Length=793
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009804950.1|  PREDICTED: gamma aminobutyrate transaminase ...    335   3e-108   Nicotiana sylvestris
ref|XP_009592076.1|  PREDICTED: gamma aminobutyrate transaminase ...    330   1e-106   Nicotiana tomentosiformis
ref|XP_010313637.1|  PREDICTED: gamma aminobutyrate transaminase ...    330   3e-106   
ref|XP_009789181.1|  PREDICTED: gamma aminobutyrate transaminase ...    328   8e-106   Nicotiana sylvestris
ref|NP_001233777.1|  gamma aminobutyrate transaminase 3, chloropl...    327   5e-105   
ref|XP_006351982.1|  PREDICTED: gamma aminobutyrate transaminase ...    326   5e-105   Solanum tuberosum [potatoes]
ref|XP_006357874.1|  PREDICTED: gamma aminobutyrate transaminase ...    325   2e-104   Solanum tuberosum [potatoes]
gb|AGX01485.1|  mitochondrial gamma aminobutyrate transaminase 1        323   1e-103   Nicotiana tabacum [American tobacco]
ref|NP_001234336.1|  gamma aminobutyrate transaminase 1, mitochon...    320   1e-102   
ref|XP_009610291.1|  PREDICTED: gamma aminobutyrate transaminase ...    320   1e-102   Nicotiana tomentosiformis
ref|XP_009610292.1|  PREDICTED: gamma aminobutyrate transaminase ...    310   7e-99    Nicotiana tomentosiformis
ref|XP_011100393.1|  PREDICTED: gamma aminobutyrate transaminase ...    310   9e-99    Sesamum indicum [beniseed]
gb|EYU42835.1|  hypothetical protein MIMGU_mgv1a004733mg                308   3e-98    Erythranthe guttata [common monkey flower]
ref|XP_012081034.1|  PREDICTED: gamma aminobutyrate transaminase ...    308   5e-98    Jatropha curcas
ref|XP_010941664.1|  PREDICTED: probable gamma-aminobutyrate tran...    308   5e-98    Elaeis guineensis
ref|XP_006429770.1|  hypothetical protein CICLE_v10011509mg             305   7e-97    Citrus clementina [clementine]
ref|XP_008652021.1|  PREDICTED: gamma aminobutyrate transaminase ...    305   9e-97    
gb|KDO64363.1|  hypothetical protein CISIN_1g010250mg                   305   1e-96    Citrus sinensis [apfelsine]
ref|XP_010036076.1|  PREDICTED: gamma aminobutyrate transaminase ...    301   3e-95    Eucalyptus grandis [rose gum]
ref|XP_009399251.1|  PREDICTED: probable gamma-aminobutyrate tran...    300   4e-95    Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG00607.1|  Adenosylmethionine-8-amino-7-oxononanoate aminotr...    296   5e-95    Gossypium arboreum [tree cotton]
ref|XP_011100394.1|  PREDICTED: gamma aminobutyrate transaminase ...    300   8e-95    
ref|XP_008798241.1|  PREDICTED: gamma-aminobutyrate transaminase ...    299   1e-94    
ref|XP_008229658.1|  PREDICTED: gamma aminobutyrate transaminase ...    299   1e-94    Prunus mume [ume]
ref|XP_007049029.1|  Pyridoxal phosphate-dependent transferases s...    298   7e-94    
ref|XP_007215238.1|  hypothetical protein PRUPE_ppa004369mg             297   1e-93    Prunus persica
ref|XP_002307913.1|  POLLEN-PISTIL INTERACTION 2 family protein         296   3e-93    
ref|XP_002322549.2|  hypothetical protein POPTR_0016s02000g             295   8e-93    Populus trichocarpa [western balsam poplar]
sp|B8BBZ7.1|GATP3_ORYSI  RecName: Full=Probable gamma-aminobutyra...    295   9e-93    Oryza sativa Indica Group [Indian rice]
gb|AGF95098.1|  4-aminobutyrate aminotransferase                        285   1e-92    Prunus persica
ref|XP_009349580.1|  PREDICTED: gamma aminobutyrate transaminase ...    294   2e-92    Pyrus x bretschneideri [bai li]
ref|XP_009349581.1|  PREDICTED: gamma aminobutyrate transaminase ...    294   2e-92    Pyrus x bretschneideri [bai li]
ref|XP_006858237.1|  PREDICTED: probable gamma-aminobutyrate tran...    294   2e-92    Amborella trichopoda
ref|XP_011001061.1|  PREDICTED: gamma aminobutyrate transaminase ...    293   3e-92    Populus euphratica
ref|XP_009347869.1|  PREDICTED: probable gamma-aminobutyrate tran...    293   3e-92    Pyrus x bretschneideri [bai li]
gb|AFS28620.1|  gamma-aminobutyrate transaminase 1                      293   4e-92    Malus domestica [apple tree]
ref|XP_008365554.1|  PREDICTED: gamma-aminobutyrate transaminase ...    293   4e-92    
ref|NP_001061237.1|  Os08g0205900                                       292   6e-92    
ref|XP_002268803.1|  PREDICTED: gamma aminobutyrate transaminase ...    292   7e-92    Vitis vinifera
emb|CBI34106.3|  unnamed protein product                                293   7e-92    Vitis vinifera
emb|CDP16027.1|  unnamed protein product                                292   1e-91    Coffea canephora [robusta coffee]
ref|XP_002445207.1|  hypothetical protein SORBIDRAFT_07g005930          291   1e-91    Sorghum bicolor [broomcorn]
ref|XP_010260596.1|  PREDICTED: probable gamma-aminobutyrate tran...    292   1e-91    Nelumbo nucifera [Indian lotus]
ref|XP_006659928.1|  PREDICTED: probable gamma-aminobutyrate tran...    291   3e-91    
ref|XP_011004456.1|  PREDICTED: gamma aminobutyrate transaminase ...    290   4e-91    Populus euphratica
ref|XP_004972609.1|  PREDICTED: probable gamma-aminobutyrate tran...    290   5e-91    Setaria italica
ref|XP_008378345.1|  PREDICTED: gamma aminobutyrate transaminase ...    290   7e-91    Malus domestica [apple tree]
ref|NP_001280788.1|  gamma aminobutyrate transaminase 3, chloropl...    290   7e-91    Malus domestica [apple tree]
ref|XP_004303943.1|  PREDICTED: gamma aminobutyrate transaminase ...    289   1e-90    Fragaria vesca subsp. vesca
ref|XP_002521054.1|  aminobutyrate aminotransferase, putative           290   1e-90    
ref|XP_010234450.1|  PREDICTED: probable gamma-aminobutyrate tran...    288   4e-90    Brachypodium distachyon [annual false brome]
ref|XP_003573535.1|  PREDICTED: probable gamma-aminobutyrate tran...    288   4e-90    Brachypodium distachyon [annual false brome]
dbj|BAK05511.1|  predicted protein                                      287   6e-90    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW59441.1|  putative aminotransferase class III superfamily p...    285   9e-90    
ref|NP_001053863.1|  Os04g0614600                                       286   2e-89    
gb|EEC77995.1|  hypothetical protein OsI_17385                          285   3e-89    Oryza sativa Indica Group [Indian rice]
ref|XP_004147736.1|  PREDICTED: gamma aminobutyrate transaminase ...    285   3e-89    Cucumis sativus [cucumbers]
ref|NP_001152508.1|  aminotransferase y4uB                              285   3e-89    Zea mays [maize]
sp|Q01K11.1|GATP1_ORYSI  RecName: Full=Gamma-aminobutyrate transa...    285   3e-89    Oryza sativa Indica Group [Indian rice]
gb|ACF87978.1|  unknown                                                 285   4e-89    Zea mays [maize]
ref|XP_006652817.1|  PREDICTED: gamma-aminobutyrate transaminase ...    285   4e-89    Oryza brachyantha
ref|XP_004976801.1|  PREDICTED: gamma-aminobutyrate transaminase ...    285   6e-89    Setaria italica
ref|XP_006592029.1|  PREDICTED: gamma aminobutyrate transaminase ...    283   2e-88    Glycine max [soybeans]
ref|XP_008677242.1|  PREDICTED: aminotransferase y4uB isoform X1        282   3e-88    Zea mays [maize]
emb|CDY58748.1|  BnaCnng33690D                                          282   3e-88    Brassica napus [oilseed rape]
gb|AFW61008.1|  putative aminotransferase class III superfamily p...    282   4e-88    
gb|AFW61009.1|  putative aminotransferase class III superfamily p...    283   4e-88    
dbj|BAI66419.1|  aminotransferase                                       282   8e-88    Triticum aestivum [Canadian hard winter wheat]
gb|KHN05488.1|  Putative aminotransferase y4uB                          282   8e-88    Glycine soja [wild soybean]
ref|XP_003580544.1|  PREDICTED: gamma-aminobutyrate transaminase ...    281   1e-87    Brachypodium distachyon [annual false brome]
ref|NP_001148620.1|  aminotransferase y4uB                              281   1e-87    Zea mays [maize]
ref|XP_006406200.1|  hypothetical protein EUTSA_v10020563mg             281   1e-87    Eutrema salsugineum [saltwater cress]
ref|XP_008451896.1|  PREDICTED: gamma aminobutyrate transaminase ...    280   2e-87    Cucumis melo [Oriental melon]
ref|XP_008451895.1|  PREDICTED: gamma aminobutyrate transaminase ...    280   3e-87    Cucumis melo [Oriental melon]
ref|XP_002447091.1|  hypothetical protein SORBIDRAFT_06g028440          280   3e-87    Sorghum bicolor [broomcorn]
ref|XP_002883348.1|  gamma-aminobutyrate transaminase subunit pre...    280   3e-87    
ref|XP_010525162.1|  PREDICTED: gamma-aminobutyrate transaminase ...    279   6e-87    Tarenaya hassleriana [spider flower]
tpg|DAA59557.1|  TPA: putative aminotransferase class III superfa...    277   1e-86    
gb|KDO64364.1|  hypothetical protein CISIN_1g010250mg                   276   1e-86    Citrus sinensis [apfelsine]
ref|XP_010488236.1|  PREDICTED: gamma-aminobutyrate transaminase ...    278   2e-86    Camelina sativa [gold-of-pleasure]
ref|XP_003537747.1|  PREDICTED: gamma aminobutyrate transaminase ...    278   2e-86    Glycine max [soybeans]
ref|XP_009145420.1|  PREDICTED: gamma-aminobutyrate transaminase ...    277   3e-86    Brassica rapa
emb|CDY37389.1|  BnaC05g30410D                                          277   3e-86    Brassica napus [oilseed rape]
gb|KHN09253.1|  Putative aminotransferase y4uB                          278   6e-86    Glycine soja [wild soybean]
ref|XP_008668890.1|  PREDICTED: gamma-aminobutyrate transaminase ...    277   6e-86    Zea mays [maize]
ref|XP_009109118.1|  PREDICTED: gamma-aminobutyrate transaminase ...    276   7e-86    Brassica rapa
ref|XP_006592030.1|  PREDICTED: gamma aminobutyrate transaminase ...    276   9e-86    Glycine max [soybeans]
ref|XP_004505667.1|  PREDICTED: gamma aminobutyrate transaminase ...    276   1e-85    Cicer arietinum [garbanzo]
emb|CDY39506.1|  BnaA01g24820D                                          276   1e-85    Brassica napus [oilseed rape]
ref|XP_010511056.1|  PREDICTED: gamma-aminobutyrate transaminase ...    277   1e-85    
gb|KJB22727.1|  hypothetical protein B456_004G063100                    275   2e-85    Gossypium raimondii
ref|XP_010525163.1|  PREDICTED: LOW QUALITY PROTEIN: gamma-aminob...    275   3e-85    Tarenaya hassleriana [spider flower]
ref|XP_007131572.1|  hypothetical protein PHAVU_011G024300g             275   3e-85    Phaseolus vulgaris [French bean]
ref|XP_006297475.1|  hypothetical protein CARUB_v10013496mg             275   4e-85    
gb|KFK39511.1|  hypothetical protein AALP_AA3G253600                    274   8e-85    Arabis alpina [alpine rockcress]
ref|XP_009776834.1|  PREDICTED: gamma aminobutyrate transaminase ...    268   1e-84    Nicotiana sylvestris
ref|XP_009597725.1|  PREDICTED: gamma aminobutyrate transaminase ...    261   2e-84    
ref|NP_566700.1|  gamma-aminobutyrate transaminase POP2                 273   2e-84    Arabidopsis thaliana [mouse-ear cress]
gb|AAK52899.1|AF351125_1  gamma-aminobutyrate transaminase subuni...    273   2e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466490.1|  PREDICTED: gamma-aminobutyrate transaminase ...    273   2e-84    Camelina sativa [gold-of-pleasure]
dbj|BAB03068.1|  aminotransferase-like protein                          271   4e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010313638.1|  PREDICTED: gamma aminobutyrate transaminase ...    270   4e-84    
ref|NP_001189947.1|  gamma-aminobutyrate transaminase POP2              272   6e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010648197.1|  PREDICTED: gamma aminobutyrate transaminase ...    271   1e-83    Vitis vinifera
emb|CBI34103.3|  unnamed protein product                                269   4e-83    Vitis vinifera
gb|ADM13673.1|  putative aminotransferase                               268   5e-83    Capsicum annuum
ref|XP_010680154.1|  PREDICTED: gamma aminobutyrate transaminase ...    268   1e-82    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003607298.1|  Aminotransferase y4uB                              267   3e-82    Medicago truncatula
gb|AAC78480.1|  putative aminotransferase                               265   5e-82    Capsicum chinense [bonnet pepper]
ref|XP_004244777.1|  PREDICTED: gamma aminobutyrate transaminase ...    265   6e-82    Solanum lycopersicum
ref|XP_011467676.1|  PREDICTED: gamma aminobutyrate transaminase ...    264   1e-81    Fragaria vesca subsp. vesca
gb|ADG65346.1|  putative aminotransferase                               264   2e-81    Capsicum frutescens [bird pepper]
ref|NP_001053862.1|  Os04g0614500                                       259   3e-79    
ref|XP_006406198.1|  hypothetical protein EUTSA_v10020531mg             259   4e-79    
ref|XP_009145417.1|  PREDICTED: gamma-aminobutyrate transaminase ...    259   6e-79    Brassica rapa
ref|XP_006652818.1|  PREDICTED: probable gamma-aminobutyrate tran...    258   8e-79    Oryza brachyantha
emb|CDY10622.1|  BnaA05g17400D                                          257   1e-78    Brassica napus [oilseed rape]
gb|AFK39370.1|  unknown                                                 256   2e-78    Lotus japonicus
ref|XP_006351980.1|  PREDICTED: gamma aminobutyrate transaminase ...    256   2e-78    Solanum tuberosum [potatoes]
ref|XP_008464679.1|  PREDICTED: LOW QUALITY PROTEIN: gamma aminob...    253   1e-76    Cucumis melo [Oriental melon]
emb|CAD12664.1|  viroid RNA-binding protein                             252   1e-76    Solanum lycopersicum
ref|XP_011654001.1|  PREDICTED: gamma aminobutyrate transaminase 2      252   3e-76    Cucumis sativus [cucumbers]
ref|XP_004147774.1|  PREDICTED: gamma aminobutyrate transaminase ...    251   7e-76    Cucumis sativus [cucumbers]
ref|NP_001234340.1|  gamma aminobutyrate transaminase 2                 249   1e-75    
gb|AAK11219.1|AF324485_1  aminotransferase-like protein                 242   1e-72    Oryza sativa [red rice]
ref|NP_001045660.1|  Os02g0112900                                       242   1e-72    
gb|ABF69998.1|  gamma-aminobutyrate transaminase, putative              243   2e-72    Musa acuminata [banana]
gb|EEC77994.1|  hypothetical protein OsI_17384                          241   2e-72    Oryza sativa Indica Group [Indian rice]
ref|XP_008451902.1|  PREDICTED: LOW QUALITY PROTEIN: gamma aminob...    238   2e-71    
gb|EPS57260.1|  hypothetical protein M569_17559                         225   7e-71    Genlisea aurea
gb|EEE61675.1|  hypothetical protein OsJ_16144                          231   4e-69    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010093137.1|  putative aminotransferase y4uB                     230   2e-68    
gb|EMS61591.1|  putative aminotransferase y4uB                          232   2e-68    Triticum urartu
ref|XP_002978448.1|  hypothetical protein SELMODRAFT_177017             229   4e-68    Selaginella moellendorffii
ref|XP_002970285.1|  hypothetical protein SELMODRAFT_270846             229   5e-68    Selaginella moellendorffii
ref|XP_001783174.1|  predicted protein                                  230   5e-68    
ref|XP_008662070.1|  PREDICTED: aminotransferase y4uB isoform X1        218   8e-64    Zea mays [maize]
gb|EMT11453.1|  Putative aminotransferase y4uB                          219   1e-63    
ref|XP_001762156.1|  predicted protein                                  211   3e-61    
gb|EMT06765.1|  Putative aminotransferase y4uB                          195   1e-54    
gb|EEC77996.1|  hypothetical protein OsI_17386                          189   6e-50    Oryza sativa Indica Group [Indian rice]
ref|WP_041862975.1|  aminotransferase                                   174   5e-47    Bordetella petrii
emb|CAP43438.1|  putative aminotransferase                              173   6e-47    Bordetella petrii
ref|WP_044433671.1|  aminotransferase                                   173   1e-46    Skermanella aerolata
ref|WP_026641250.1|  aminotransferase                                   171   3e-46    Bordetella petrii
ref|XP_011468608.1|  PREDICTED: gamma aminobutyrate transaminase ...    167   3e-46    Fragaria vesca subsp. vesca
ref|WP_018897972.1|  aminotransferase                                   171   3e-46    Rhizobium sp. 2MFCol3.1
ref|XP_008652184.1|  PREDICTED: gamma-aminobutyrate transaminase ...    161   9e-46    
ref|XP_008652185.1|  PREDICTED: gamma-aminobutyrate transaminase ...    160   1e-45    Zea mays [maize]
ref|WP_013742690.1|  aminotransferase                                   169   1e-45    Pusillimonas sp. T7-7
ref|WP_024509951.1|  aminotransferase                                   168   6e-45    Bradyrhizobium sp. ARR65
ref|WP_025516482.1|  aminotransferase                                   167   1e-44    Bordetella trematum
ref|WP_028355511.1|  aminotransferase                                   166   2e-44    Bordetella
ref|WP_034191978.1|  aminotransferase                                   166   3e-44    Burkholderia cenocepacia
ref|WP_017775036.1|  aminotransferase                                   166   3e-44    Paraburkholderia kururiensis
ref|WP_018898134.1|  hypothetical protein                               166   3e-44    Rhizobium sp. 2MFCol3.1
ref|WP_037454523.1|  aminotransferase                                   166   3e-44    Skermanella stibiiresistens
ref|WP_012417867.1|  aminotransferase                                   166   4e-44    Bordetella avium
ref|WP_029014519.1|  aminotransferase                                   166   5e-44    Niveispirillum irakense
ref|WP_039371201.1|  aminotransferase                                   165   8e-44    Burkholderia
ref|WP_024810724.1|  aminotransferase                                   165   9e-44    Oceanicola sp. HL-35
ref|WP_042300360.1|  aminotransferase                                   165   1e-43    Paraburkholderia kururiensis
gb|EMS53048.1|  putative aminotransferase y4uB                          166   2e-43    Triticum urartu
ref|WP_031360219.1|  aminotransferase                                   164   2e-43    Caballeronia sordidicola
ref|WP_043683550.1|  aminotransferase                                   164   2e-43    Castellaniella defragrans
ref|WP_041710497.1|  aminotransferase                                   163   5e-43    
ref|WP_023048105.1|  MULTISPECIES: aminotransferase                     162   5e-43    Pseudomonas
ref|WP_012367259.1|  aminotransferase                                   162   6e-43    Burkholderia ambifaria
ref|WP_025374662.1|  aminotransferase                                   162   9e-43    Advenella mimigardefordensis
ref|WP_026987379.1|  aminotransferase                                   162   9e-43    Fodinicurvata fenggangensis
ref|WP_032964494.1|  aminotransferase                                   162   1e-42    Bordetella hinzii
ref|WP_034802113.1|  aminotransferase                                   162   1e-42    
gb|AFK64419.1|  aminotransferase                                        163   1e-42    Advenella kashmirensis WT001
ref|WP_043209568.1|  aminotransferase                                   162   1e-42    Bordetella pseudohinzii
ref|WP_029579725.1|  aminotransferase                                   162   1e-42    Bordetella hinzii
ref|WP_041798615.1|  aminotransferase                                   162   1e-42    
gb|ABD06201.1|  aminotransferase                                        162   1e-42    Rhodopseudomonas palustris HaA2
gb|KDP71648.1|  aminotransferase                                        162   1e-42    Ensifer adhaerens
ref|WP_005014723.1|  aminotransferase                                   161   2e-42    Bordetella holmesii
ref|WP_012566210.1|  aminotransferase                                   162   2e-42    Rhodospirillum centenum
ref|WP_043683574.1|  aminotransferase                                   161   2e-42    Castellaniella defragrans
ref|WP_035541932.1|  aminotransferase                                   161   2e-42    Burkholderia sp. UYPR1.413
ref|WP_040121086.1|  aminotransferase                                   161   2e-42    Sinorhizobium meliloti
ref|WP_037458242.1|  aminotransferase                                   161   3e-42    Skermanella stibiiresistens
ref|WP_045229420.1|  aminotransferase                                   160   4e-42    Agrobacterium rubi
ref|WP_009770733.1|  aminotransferase                                   160   4e-42    Paraburkholderia hospita
ref|WP_007733279.1|  aminotransferase                                   160   4e-42    Burkholderia sp. BT03
ref|WP_029742660.1|  aminotransferase                                   160   5e-42    Rhizobiales bacterium
gb|EWM49408.1|  aminotransferase class-III family protein               160   6e-42    Bordetella holmesii 35009
ref|WP_035988183.1|  aminotransferase                                   160   6e-42    Paraburkholderia caribensis
ref|WP_018010394.1|  aminotransferase                                   160   7e-42    Sinorhizobium medicae
ref|WP_028003714.1|  aminotransferase                                   160   7e-42    Sinorhizobium meliloti
ref|WP_018430650.1|  hypothetical protein                               159   8e-42    Hoeflea sp. 108
ref|WP_011969374.1|  aminotransferase                                   159   8e-42    Sinorhizobium medicae
gb|ETF04525.1|  aminotransferase                                        159   1e-41    Advenella kashmirensis W13003
ref|WP_039191434.1|  aminotransferase                                   159   1e-41    Aureimonas altamirensis
ref|WP_020949918.1|  adenosylmethionine-8-amino-7-oxononanoate am...    159   1e-41    Paracoccus aminophilus
ref|WP_025165321.1|  aminotransferase                                   159   1e-41    Pseudomonas taeanensis
ref|WP_036500215.1|  aminotransferase                                   159   1e-41    
gb|EGD57468.1|  aminotransferase                                        159   2e-41    Novosphingobium nitrogenifigens DSM 19370
ref|WP_036995912.1|  aminotransferase                                   159   2e-41    Pseudomonas donghuensis
ref|WP_037131992.1|  aminotransferase                                   159   2e-41    Rhizobium sp. CF097
ref|WP_023663383.1|  aminotransferase                                   158   2e-41    Pseudomonas
ref|WP_036349682.1|  aminotransferase                                   158   3e-41    
ref|WP_018904326.1|  aminotransferase                                   158   3e-41    Variovorax paradoxus
ref|WP_022729947.1|  aminotransferase                                   158   3e-41    Fodinicurvata sediminis
ref|WP_028055523.1|  aminotransferase                                   158   3e-41    Sinorhizobium meliloti
ref|WP_028466856.1|  aminotransferase                                   158   4e-41    Nisaea denitrificans
ref|WP_044033419.1|  aminotransferase                                   157   4e-41    Roseobacter denitrificans
ref|WP_023430501.1|  Aminotransferase, class III                        157   5e-41    Lutibaculum baratangense
gb|ABG31913.1|  aminotransferase                                        157   5e-41    Roseobacter denitrificans OCh 114
ref|WP_016558738.1|  aminotransferase                                   157   7e-41    Rhizobium grahamii
ref|WP_024589111.1|  aminotransferase                                   157   7e-41    Aliihoeflea sp. 2WW
ref|WP_026756592.1|  aminotransferase                                   157   7e-41    Sediminimonas qiaohouensis
ref|WP_033067194.1|  aminotransferase                                   157   7e-41    
ref|WP_025038425.1|  aminotransferase                                   157   7e-41    Bradyrhizobium sp. DOA9
ref|WP_031242205.1|  aminotransferase                                   157   8e-41    
ref|WP_028793896.1|  aminotransferase                                   157   8e-41    Thalassobaculum
emb|CCF21345.1|  Uncharacterized aminotransferase y4uB                  157   8e-41    Rhizobium sp. NT-26
ref|WP_028053780.1|  aminotransferase                                   157   1e-40    Sinorhizobium
ref|WP_003525818.1|  aminotransferase                                   156   1e-40    Sinorhizobium meliloti
ref|WP_046020867.1|  aminotransferase                                   156   1e-40    Magnetospira sp. QH-2
gb|EEE56165.1|  hypothetical protein OsJ_05081                          157   1e-40    Oryza sativa Japonica Group [Japonica rice]
ref|WP_027991581.1|  aminotransferase                                   156   2e-40    Sinorhizobium meliloti
ref|WP_027283997.1|  aminotransferase                                   156   2e-40    Rubritepida flocculans
ref|WP_010975253.1|  aminotransferase                                   156   2e-40    Sinorhizobium meliloti
ref|WP_014193010.1|  aminotransferase                                   156   2e-40    Burkholderia sp. YI23
ref|WP_015008570.1|  aminotransferase                                   156   2e-40    Sinorhizobium meliloti
ref|WP_029043410.1|  aminotransferase                                   156   2e-40    Cupriavidus
ref|WP_017273373.1|  aminotransferase                                   156   2e-40    Sinorhizobium meliloti
gb|KEO56896.1|  aminotransferase                                        156   2e-40    Thalassospira permensis NBRC 106175
ref|WP_013850008.1|  aminotransferase                                   156   2e-40    Sinorhizobium/Ensifer group
ref|WP_017266638.1|  aminotransferase                                   156   2e-40    Sinorhizobium meliloti
ref|WP_025899271.1|  aminotransferase                                   156   2e-40    Sneathiella glossodoripedis
ref|WP_045457824.1|  aminotransferase                                   156   2e-40    Burkholderia sp. RPE67
ref|WP_017277372.1|  aminotransferase                                   156   2e-40    Sinorhizobium meliloti
gb|AJD51480.1|  aminotransferase                                        156   2e-40    Thalassospira xiamenensis M-5 = DSM 17429
ref|WP_040060658.1|  aminotransferase                                   156   2e-40    
ref|WP_037990023.1|  aminotransferase                                   156   2e-40    
ref|WP_019647031.1|  hypothetical protein                               155   2e-40    Novispirillum itersonii
ref|WP_016494812.1|  putative aminotransferase                          155   2e-40    Pseudomonas resinovorans
ref|WP_036993733.1|  aminotransferase                                   155   2e-40    
ref|WP_027517565.1|  aminotransferase                                   155   3e-40    Bradyrhizobium sp. WSM1417
ref|WP_008129949.1|  aminotransferase                                   155   3e-40    Bradyrhizobium sp. YR681
ref|WP_007257253.1|  aminotransferase                                   155   3e-40    Oceanicola granulosus
ref|WP_027569703.1|  aminotransferase                                   155   3e-40    Bradyrhizobium sp. URHA0013
ref|WP_046120078.1|  aminotransferase                                   155   3e-40    Sinorhizobium/Ensifer group
ref|WP_026616781.1|  aminotransferase                                   155   3e-40    Ensifer aridi
ref|WP_023628464.1|  aminotransferase                                   155   3e-40    Pseudomonas
ref|WP_038761742.1|  aminotransferase                                   155   3e-40    
ref|WP_019171585.1|  aminotransferase                                   155   3e-40    Pseudaminobacter salicylatoxidans
ref|WP_015243391.1|  Adenosylmethionine-8-amino-7-oxononanoate am...    155   3e-40    Sinorhizobium meliloti
ref|WP_035675507.1|  aminotransferase                                   155   3e-40    Azospirillum
ref|WP_007591914.1|  aminotransferase                                   155   3e-40    Bradyrhizobium sp. WSM1253
ref|WP_014239351.1|  aminotransferase                                   155   3e-40    Azospirillum brasilense
ref|WP_018456285.1|  aminotransferase                                   155   3e-40    Bradyrhizobium
ref|WP_026226723.1|  aminotransferase                                   155   3e-40    Hoeflea sp. 108
ref|WP_042727875.1|  aminotransferase                                   155   4e-40    Pseudomonas fluorescens
ref|WP_028002805.1|  aminotransferase                                   155   4e-40    Sinorhizobium arboris
ref|WP_021586359.1|  MULTISPECIES: aminotransferase                     155   4e-40    Ochrobactrum
ref|WP_036350477.1|  aminotransferase                                   155   4e-40    Microvirga sp. BSC39
ref|WP_038526098.1|  aminotransferase                                   155   4e-40    Azospirillum brasilense
ref|WP_007609403.1|  aminotransferase                                   155   4e-40    Bradyrhizobium sp. WSM471
gb|EJZ32369.1|  aminotransferase                                        155   4e-40    
ref|WP_028880172.1|  aminotransferase                                   155   5e-40    Terasakiella pusilla
gb|ELS27909.1|  Adenosylmethionine-8-amino-7-oxononanoate aminotr...    155   5e-40    Pseudomonas furukawaii
ref|WP_025035884.1|  aminotransferase                                   155   5e-40    Bradyrhizobium sp. DOA9
ref|WP_027542945.1|  aminotransferase                                   155   5e-40    Bradyrhizobium sp. WSM2254
ref|WP_018317519.1|  aminotransferase                                   154   5e-40    Bradyrhizobium sp. WSM2793
ref|WP_020950496.1|  aminotransferase                                   154   6e-40    Paracoccus aminophilus
ref|WP_025769698.1|  aminotransferase                                   155   6e-40    Thioalkalivibrio sp. HK1
ref|WP_010140242.1|  aminotransferase                                   154   6e-40    Oceanicola sp. S124
ref|WP_040973849.1|  aminotransferase                                   154   6e-40    Mesorhizobium sp. ORS 3324
ref|WP_010658032.1|  aminotransferase                                   154   6e-40    Ochrobactrum anthropi
ref|WP_027557626.1|  MULTISPECIES: aminotransferase                     154   6e-40    Bradyrhizobium
ref|WP_036577631.1|  aminotransferase                                   154   6e-40    Ochrobactrum
ref|WP_036022740.1|  aminotransferase                                   154   6e-40    Bradyrhizobium yuanmingense
ref|WP_036000540.1|  aminotransferase                                   154   6e-40    Bradyrhizobium yuanmingense
ref|WP_007681117.1|  aminotransferase                                   154   6e-40    alpha proteobacterium BAL199
ref|WP_029925894.1|  MULTISPECIES: aminotransferase                     154   6e-40    
ref|WP_011982390.1|  aminotransferase                                   154   6e-40    
ref|WP_035022366.1|  MULTISPECIES: aminotransferase                     154   6e-40    
ref|WP_023002240.1|  MULTISPECIES: aminotransferase                     154   6e-40    
ref|WP_034858533.1|  aminotransferase                                   154   6e-40    
ref|WP_022709596.1|  aminotransferase                                   154   6e-40    
ref|WP_027230049.1|  aminotransferase                                   154   7e-40    
ref|WP_036367910.1|  aminotransferase                                   154   8e-40    
ref|WP_022733433.1|  aminotransferase                                   154   9e-40    
ref|WP_033464289.1|  aminotransferase                                   154   9e-40    
ref|WP_003813182.1|  aminotransferase                                   154   9e-40    
ref|WP_041794682.1|  aminotransferase                                   154   9e-40    
ref|WP_035675727.1|  aminotransferase                                   154   9e-40    
ref|WP_008069788.1|  aminotransferase                                   154   1e-39    
ref|WP_037395619.1|  aminotransferase                                   154   1e-39    
ref|WP_010928538.1|  aminotransferase                                   154   1e-39    
ref|WP_017128138.1|  hypothetical protein                               154   1e-39    
ref|WP_037434041.1|  aminotransferase                                   154   1e-39    
ref|WP_010926321.1|  aminotransferase                                   154   1e-39    
ref|WP_042778065.1|  aminotransferase                                   154   1e-39    
ref|WP_006465915.1|  aminotransferase                                   154   1e-39    
ref|WP_035715448.1|  aminotransferase                                   154   1e-39    
ref|WP_035741142.1|  aminotransferase                                   154   1e-39    
ref|WP_017275479.1|  omega amino acid--pyruvate aminotransferase        154   1e-39    
ref|WP_012317851.1|  MULTISPECIES: aminotransferase                     154   1e-39    
ref|WP_007758462.1|  aminotransferase                                   154   1e-39    
ref|WP_011086907.1|  MULTISPECIES: aminotransferase                     154   1e-39    
ref|WP_028171115.1|  MULTISPECIES: aminotransferase                     154   1e-39    
ref|WP_045390493.1|  aminotransferase                                   154   1e-39    
ref|WP_027535373.1|  aminotransferase                                   154   1e-39    
ref|WP_028136798.1|  aminotransferase                                   154   1e-39    
ref|WP_042133140.1|  aminotransferase                                   153   1e-39    
ref|WP_027551405.1|  aminotransferase                                   153   1e-39    
ref|WP_045000278.1|  aminotransferase                                   153   2e-39    
ref|WP_028181072.1|  aminotransferase                                   153   2e-39    
ref|WP_045009609.1|  aminotransferase                                   153   2e-39    
ref|WP_024338082.1|  aminotransferase                                   153   2e-39    
ref|WP_007564734.1|  aminotransferase                                   153   2e-39    
ref|WP_028144979.1|  MULTISPECIES: aminotransferase                     153   2e-39    
ref|WP_026621810.1|  aminotransferase                                   153   2e-39    
ref|WP_027576286.1|  aminotransferase                                   153   2e-39    
ref|WP_033967567.1|  aminotransferase                                   153   2e-39    
ref|WP_018645424.1|  aminotransferase                                   153   2e-39    
gb|KIY38423.1|  aminotransferase                                        153   2e-39    
ref|WP_038546843.1|  aminotransferase                                   153   2e-39    
ref|WP_035705889.1|  aminotransferase                                   153   2e-39    
ref|WP_010687211.1|  class-III aminotransferase                         153   2e-39    
ref|WP_038591093.1|  aminotransferase                                   153   2e-39    
ref|WP_018389309.1|  aminotransferase                                   153   2e-39    
ref|WP_027300272.1|  aminotransferase                                   153   2e-39    
emb|CCG07898.1|  Aminotransferase                                       154   2e-39    
ref|WP_042671767.1|  aminotransferase                                   153   2e-39    
ref|WP_018701456.1|  hypothetical protein                               153   2e-39    
ref|WP_043352057.1|  aminotransferase                                   153   2e-39    
ref|WP_043388754.1|  aminotransferase                                   153   3e-39    
ref|WP_013962061.1|  aminotransferase                                   153   3e-39    
ref|WP_043755953.1|  aminotransferase                                   153   3e-39    
ref|WP_037014756.1|  aminotransferase                                   153   3e-39    
ref|WP_041006007.1|  aminotransferase                                   152   3e-39    
ref|WP_043948562.1|  aminotransferase                                   152   3e-39    
ref|WP_028754908.1|  aminotransferase                                   152   3e-39    
ref|WP_003576511.1|  aminotransferase                                   152   3e-39    
ref|WP_037156550.1|  aminotransferase                                   152   3e-39    
ref|WP_027523883.1|  aminotransferase                                   152   3e-39    
ref|WP_029003855.1|  aminotransferase                                   152   3e-39    
ref|WP_037081315.1|  aminotransferase                                   152   3e-39    
ref|WP_034103255.1|  aminotransferase                                   152   3e-39    
ref|WP_028958672.1|  aminotransferase                                   152   4e-39    
ref|WP_015686609.1|  aminotransferase                                   152   4e-39    
ref|WP_036487003.1|  aminotransferase                                   152   4e-39    
ref|WP_038313987.1|  aminotransferase                                   152   4e-39    
ref|WP_044417924.1|  aminotransferase                                   152   4e-39    
ref|WP_041006181.1|  aminotransferase                                   152   4e-39    
ref|WP_015343311.1|  aminotransferase class-III                         152   4e-39    
ref|WP_020093654.1|  aminotransferase                                   152   4e-39    
ref|WP_040996134.1|  aminotransferase                                   152   4e-39    
ref|WP_040983804.1|  aminotransferase                                   152   4e-39    
ref|WP_041957850.1|  aminotransferase                                   152   5e-39    
ref|WP_008190932.1|  aminotransferase                                   152   6e-39    
ref|WP_024849370.1|  aminotransferase                                   152   6e-39    
ref|WP_043761730.1|  aminotransferase                                   152   6e-39    
gb|EKX59897.1|  Omega-amino acid--pyruvate aminotransferase             152   6e-39    
ref|WP_035693855.1|  aminotransferase                                   152   6e-39    
gb|ESW84520.1|  aminotransferase                                        151   6e-39    
gb|ENS36263.1|  hypothetical protein C087_00163                         149   6e-39    
ref|WP_011339161.1|  aminotransferase                                   152   6e-39    
ref|WP_017140341.1|  adenosylmethionine-8-amino-7-oxononanoate am...    152   6e-39    
ref|WP_010930858.1|  aminotransferase                                   151   6e-39    
ref|WP_036521510.1|  aminotransferase                                   152   7e-39    
emb|CRD64698.1|  aminotransferase                                       151   7e-39    
gb|ACM03296.1|  Aminotransferase                                        152   7e-39    
ref|WP_041670771.1|  aminotransferase                                   151   7e-39    
ref|WP_020049965.1|  aminotransferase                                   151   7e-39    
ref|WP_035838674.1|  aminotransferase                                   151   8e-39    
ref|WP_025031754.1|  aminotransferase                                   151   8e-39    
ref|XP_003389628.1|  PREDICTED: gamma aminobutyrate transaminase ...    152   8e-39    
ref|WP_037063023.1|  aminotransferase                                   151   8e-39    
ref|WP_031211906.1|  aminotransferase                                   151   8e-39    
ref|WP_023513399.1|  hypothetical protein                               151   9e-39    
ref|WP_036032589.1|  aminotransferase                                   149   9e-39    
ref|WP_037123301.1|  aminotransferase                                   151   9e-39    
ref|WP_046031889.1|  aminotransferase                                   151   9e-39    
ref|WP_027263575.1|  aminotransferase                                   151   1e-38    
gb|AHY51042.1|  hypothetical protein BJS_03890                          151   1e-38    
ref|WP_028157521.1|  aminotransferase                                   151   1e-38    
ref|WP_016733076.1|  aminotransferase                                   151   1e-38    
ref|WP_043754256.1|  aminotransferase                                   151   1e-38    
ref|WP_039149393.1|  aminotransferase                                   151   1e-38    
ref|WP_038957353.1|  aminotransferase                                   151   1e-38    
ref|WP_037088027.1|  aminotransferase                                   151   1e-38    
ref|WP_014495749.1|  aminotransferase                                   151   1e-38    
gb|AAF99609.1|AF247644_1  family II aminotransferase                    151   1e-38    
ref|WP_011842797.1|  aminotransferase                                   151   1e-38    
gb|EGJ19989.1|  aminotransferase                                        151   1e-38    
ref|WP_028147775.1|  aminotransferase                                   151   1e-38    
ref|WP_038688957.1|  aminotransferase                                   151   1e-38    
ref|WP_038376943.1|  aminotransferase                                   150   1e-38    
ref|WP_042694454.1|  aminotransferase                                   151   1e-38    
ref|WP_037210883.1|  aminotransferase                                   150   2e-38    
ref|WP_029349973.1|  aminotransferase                                   150   2e-38    
ref|WP_027165281.1|  aminotransferase                                   150   2e-38    
ref|WP_037138943.1|  aminotransferase                                   150   2e-38    
ref|WP_045019489.1|  aminotransferase                                   150   2e-38    
ref|WP_011425411.1|  aminotransferase                                   150   2e-38    
ref|WP_037114065.1|  aminotransferase                                   150   2e-38    
ref|WP_006934289.1|  aminotransferase                                   150   2e-38    
ref|WP_043774658.1|  aminotransferase                                   150   2e-38    
ref|WP_029617577.1|  aminotransferase                                   150   2e-38    
ref|WP_035633702.1|  aminotransferase                                   150   2e-38    
ref|WP_012483828.1|  aminotransferase                                   150   2e-38    
ref|WP_036639320.1|  aminotransferase                                   150   2e-38    
ref|WP_017227445.1|  hypothetical protein                               150   2e-38    
dbj|GAD54559.1|  omega-amino acid--pyruvate aminotransferase            150   2e-38    
ref|WP_037164468.1|  MULTISPECIES: aminotransferase                     150   2e-38    
ref|WP_037017213.1|  aminotransferase                                   150   2e-38    
ref|WP_029060118.1|  aminotransferase                                   150   2e-38    
dbj|BAQ49040.1|  aminotransferase                                       150   2e-38    
ref|WP_019860204.1|  MULTISPECIES: aminotransferase                     150   2e-38    
ref|WP_013166382.1|  aminotransferase                                   150   2e-38    
ref|WP_007008906.1|  aminotransferase                                   150   2e-38    
gb|EXU84827.1|  aminotransferase                                        150   2e-38    
ref|WP_002967099.1|  MULTISPECIES: aminotransferase                     150   2e-38    
ref|WP_004689415.1|  aminotransferase                                   150   2e-38    
ref|WP_006120346.1|  hypothetical protein                               150   3e-38    
ref|WP_002965440.1|  aminotransferase                                   150   3e-38    
ref|WP_015039513.1|  aminotransferase                                   150   3e-38    
ref|WP_004687895.1|  aminotransferase                                   150   3e-38    
ref|WP_006195177.1|  hypothetical protein                               150   3e-38    
ref|WP_006212579.1|  hypothetical protein                               150   3e-38    
ref|WP_037924369.1|  aminotransferase                                   150   3e-38    
ref|WP_011481392.1|  aminotransferase                                   150   3e-38    
ref|WP_044287138.1|  aminotransferase                                   150   3e-38    
ref|WP_017750300.1|  aminotransferase                                   150   3e-38    
ref|WP_037377324.1|  aminotransferase                                   150   3e-38    
ref|WP_008597642.1|  aminotransferase                                   150   3e-38    
gb|ETX26904.1|  aminotransferase                                        150   3e-38    
ref|WP_008933706.1|  aminotransferase                                   150   3e-38    
ref|WP_028286734.1|  aminotransferase                                   150   3e-38    
ref|WP_040998245.1|  aminotransferase                                   150   3e-38    
ref|WP_015951335.1|  aminotransferase                                   150   3e-38    
emb|CDX33772.1|  Gamma aminobutyrate transaminase 1, mitochondrial      150   3e-38    
ref|WP_034843846.1|  aminotransferase                                   150   3e-38    
ref|WP_007798845.1|  aminotransferase                                   150   3e-38    
emb|CDX30075.1|  Gamma aminobutyrate transaminase 1, mitochondrial      150   4e-38    
ref|WP_006337224.1|  hypothetical protein                               150   4e-38    
ref|WP_027136175.1|  aminotransferase                                   150   4e-38    
ref|WP_007995736.1|  aminotransferase                                   149   4e-38    
ref|WP_038945793.1|  aminotransferase                                   149   4e-38    
ref|WP_045581458.1|  aminotransferase                                   149   4e-38    
ref|WP_042639479.1|  aminotransferase                                   149   4e-38    
ref|WP_015931963.1|  aminotransferase                                   149   4e-38    
ref|WP_029350573.1|  aminotransferase                                   149   4e-38    
ref|WP_017486164.1|  aminotransferase                                   149   4e-38    
ref|WP_008935239.1|  MULTISPECIES: aminotransferase                     149   5e-38    
ref|WP_040701702.1|  aminotransferase                                   149   5e-38    
ref|WP_003599476.1|  aminotransferase                                   149   5e-38    
gb|EDQ03816.1|  aminotransferase                                        149   5e-38    
ref|WP_028096189.1|  aminotransferase                                   149   6e-38    
ref|WP_042508879.1|  aminotransferase                                   149   6e-38    
ref|WP_007924918.1|  aminotransferase                                   149   6e-38    
ref|WP_015823196.1|  aminotransferase                                   149   6e-38    
ref|WP_021132241.1|  aminotransferase                                   149   6e-38    
ref|WP_029062246.1|  aminotransferase                                   149   6e-38    
ref|WP_014249011.1|  aminotransferase                                   149   7e-38    
ref|WP_009758168.1|  aminotransferase                                   149   7e-38    
gb|ABY31297.1|  aminotransferase class-III                              149   7e-38    
gb|KKB85401.1|  aminotransferase                                        149   7e-38    
ref|WP_006191222.1|  MULTISPECIES: aminotransferase                     149   7e-38    
ref|WP_008128903.1|  aminotransferase                                   149   8e-38    
ref|WP_019573261.1|  aminotransferase                                   149   8e-38    
ref|WP_013165113.1|  aminotransferase                                   149   8e-38    
ref|WP_027478674.1|  aminotransferase                                   149   8e-38    
ref|WP_043358048.1|  aminotransferase                                   148   9e-38    
ref|WP_038937402.1|  MULTISPECIES: aminotransferase                     148   9e-38    
ref|WP_009542240.1|  Adenosylmethionine-8-amino-7-oxononanoate am...    148   9e-38    
ref|WP_012783843.1|  aminotransferase                                   148   9e-38    
ref|WP_013533162.1|  aminotransferase                                   149   9e-38    
ref|WP_027163995.1|  aminotransferase                                   148   1e-37    
ref|WP_027036295.1|  aminotransferase                                   148   1e-37    
ref|WP_024502400.1|  aminotransferase                                   148   1e-37    
ref|WP_035681626.1|  aminotransferase                                   148   1e-37    
ref|WP_014498006.1|  MULTISPECIES: aminotransferase                     148   1e-37    
ref|WP_042692198.1|  aminotransferase                                   148   1e-37    
ref|WP_035668747.1|  MULTISPECIES: aminotransferase                     148   1e-37    
gb|AJG22960.1|  Adenosylmethionine-8-amino-7-oxononanoate aminotr...    149   1e-37    
ref|WP_035716738.1|  aminotransferase                                   148   1e-37    
ref|WP_009025487.1|  aminotransferase                                   148   1e-37    
ref|WP_023797840.1|  aminotransferase                                   148   1e-37    
gb|KGJ67633.1|  putative aminotransferase                               148   1e-37    
gb|AHY56964.1|  aminotransferase                                        148   1e-37    
ref|WP_011084499.1|  MULTISPECIES: aminotransferase                     148   1e-37    
ref|WP_007828597.1|  aminotransferase                                   148   1e-37    
ref|WP_028144457.1|  aminotransferase                                   148   1e-37    
ref|WP_026868429.1|  aminotransferase                                   148   1e-37    
ref|WP_023808986.1|  aminotransferase                                   148   1e-37    
ref|WP_028601482.1|  aminotransferase                                   148   1e-37    
ref|WP_008884557.1|  aminotransferase                                   148   1e-37    
ref|WP_020180442.1|  hypothetical protein                               148   1e-37    
ref|WP_009469786.1|  aminotransferase                                   148   1e-37    
emb|CCV15251.1|  Uncharacterized aminotransferase y4uB                  148   1e-37    
ref|WP_043621741.1|  aminotransferase                                   148   1e-37    



>ref|XP_009804950.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial 
[Nicotiana sylvestris]
Length=516

 Score =   335 bits (858),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 181/209 (87%), Gaps = 3/209 (1%)
 Frame = +2

Query  176  VAMINRLLGHTLKRATNQVGS-HVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--ST  346
            +AMI+RLL  T+K A    GS H KH+PAVS     I+R  +  R++S Q S+QND  ST
Sbjct  1    MAMISRLLRSTVKAAITAQGSFHAKHIPAVSSLQEHIVRNSTQARYNSTQASLQNDIPST  60

Query  347  DEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  526
            D +GFKGHDMLAPFTAGWQ+TD+ PL+IEKSEGSYVYDI G+KYLD+LAGLWCTALGGNE
Sbjct  61   DNRGFKGHDMLAPFTAGWQSTDVDPLIIEKSEGSYVYDIKGRKYLDTLAGLWCTALGGNE  120

Query  527  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQ  706
            PRLVDAA KQLNTLPFYHSFWNRTTKPSLDLAKELLD FTANKMAKAFFTNSGSEANDTQ
Sbjct  121  PRLVDAATKQLNTLPFYHSFWNRTTKPSLDLAKELLDMFTANKMAKAFFTNSGSEANDTQ  180

Query  707  VKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            VKLVWYYNNALGRPNKKKFIAR K+YHGS
Sbjct  181  VKLVWYYNNALGRPNKKKFIARAKAYHGS  209



>ref|XP_009592076.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial 
[Nicotiana tomentosiformis]
Length=516

 Score =   330 bits (846),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 181/209 (87%), Gaps = 3/209 (1%)
 Frame = +2

Query  176  VAMINRLLGHTLKRA-TNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--ST  346
            +AMI+RLL  T+K A T Q G H KH+PAVS     I+R  +  R++S + S+QND  +T
Sbjct  1    MAMISRLLRSTIKAAITAQGGFHTKHIPAVSSLQEHIVRNSTQARYNSTEASLQNDIPAT  60

Query  347  DEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  526
            D +GF+GHDMLAPFTAGWQ+TD+ PL+IEKSEGSYVYDI G+KYLD+LAGLWCTALGGNE
Sbjct  61   DNRGFRGHDMLAPFTAGWQSTDVDPLIIEKSEGSYVYDIKGRKYLDTLAGLWCTALGGNE  120

Query  527  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQ  706
            PRLVDAA KQLNTLPFYHSFWNRTTKPSLDLAKELLD FT NKMAKAFFTNSGSEANDTQ
Sbjct  121  PRLVDAATKQLNTLPFYHSFWNRTTKPSLDLAKELLDMFTTNKMAKAFFTNSGSEANDTQ  180

Query  707  VKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            VKLVWYYNNALGRPNKKKFIAR K+YHGS
Sbjct  181  VKLVWYYNNALGRPNKKKFIARAKAYHGS  209



>ref|XP_010313637.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
isoform X1 [Solanum lycopersicum]
Length=516

 Score =   330 bits (845),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 177/208 (85%), Gaps = 2/208 (1%)
 Frame = +2

Query  176  VAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--STD  349
            +A I  L+G  +  ATNQVG HVKH+PAV      I+  +   RWSS + S++ND  +TD
Sbjct  1    MAKITSLIGSGIVAATNQVGPHVKHIPAVGNLQKQIVSDQIQVRWSSTETSLKNDISATD  60

Query  350  EKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEP  529
             +G+KGHDMLAPFTAGW +TDL PLVI+KSEGSYVYD+NGKKYLD+LAGLWCT+LGGNEP
Sbjct  61   VRGYKGHDMLAPFTAGWHSTDLEPLVIQKSEGSYVYDVNGKKYLDALAGLWCTSLGGNEP  120

Query  530  RLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQV  709
            RLV AA KQLN LPFYHSFWNR+TKPSLDLAKELLD FTANKMAKAFFTNSGSEANDTQV
Sbjct  121  RLVAAATKQLNELPFYHSFWNRSTKPSLDLAKELLDLFTANKMAKAFFTNSGSEANDTQV  180

Query  710  KLVWYYNNALGRPNKKKFIAREKSYHGS  793
            KLVWYYNNALGRP+KKKFIAR KSYHGS
Sbjct  181  KLVWYYNNALGRPDKKKFIARTKSYHGS  208



>ref|XP_009789181.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
[Nicotiana sylvestris]
Length=516

 Score =   328 bits (841),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 175/208 (84%), Gaps = 2/208 (1%)
 Frame = +2

Query  176  VAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--STD  349
            +A I  L+G  +  ATNQVGS VKH+P VS     I+      RWSS + S++ND  S D
Sbjct  1    MAKITSLIGSGIIAATNQVGSRVKHIPVVSNLQKQIVCDPKQIRWSSTETSLKNDISSAD  60

Query  350  EKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEP  529
             +G+KGHDMLAPFTAGWQTTD+ PLVI+KSEGSYVYDINGKKYLD+LAGLWCTALGGNEP
Sbjct  61   IRGYKGHDMLAPFTAGWQTTDVDPLVIQKSEGSYVYDINGKKYLDALAGLWCTALGGNEP  120

Query  530  RLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQV  709
            RLV AA KQLN LPFYHSFWNRTTKPSLDLA ELLD FTANKMAKAFFTNSGSEANDTQV
Sbjct  121  RLVAAATKQLNQLPFYHSFWNRTTKPSLDLATELLDLFTANKMAKAFFTNSGSEANDTQV  180

Query  710  KLVWYYNNALGRPNKKKFIAREKSYHGS  793
            KLVWYYNNALGRP+KKKFIAR KSYHGS
Sbjct  181  KLVWYYNNALGRPDKKKFIARIKSYHGS  208



>ref|NP_001233777.1| gamma aminobutyrate transaminase 3, chloroplastic [Solanum lycopersicum]
 sp|Q84P52.1|GATP3_SOLLC RecName: Full=Gamma aminobutyrate transaminase 3, chloroplastic; 
AltName: Full=Gamma-aminobutyrate transaminase isozyme 3; 
Short=LeGABA-TP3; Short=SlGABA-T3; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAO92257.1| gamma-aminobutyrate transaminase subunit precursor isozyme 3 
[Solanum lycopersicum]
 dbj|BAG16484.1| gamma aminobutyrate transaminase isoform3 [Solanum lycopersicum]
Length=520

 Score =   327 bits (837),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 176/208 (85%), Gaps = 2/208 (1%)
 Frame = +2

Query  176  VAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--STD  349
            +A I  L+G  +  ATNQVG HVKH+PAV      I+  +   RWSS + S++ND  +TD
Sbjct  1    MAKITSLIGSGIVAATNQVGPHVKHIPAVGNLQKQIVSDQIQVRWSSTETSLKNDISATD  60

Query  350  EKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEP  529
             +G+KGHDMLAPFTAGW +TDL PLVI+KSEGSYVYD+NGKKYLD+LAGLWCT+LGGNEP
Sbjct  61   VRGYKGHDMLAPFTAGWHSTDLEPLVIQKSEGSYVYDVNGKKYLDALAGLWCTSLGGNEP  120

Query  530  RLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQV  709
            RLV AA KQLN L FYHSFWNR+TKPSLDLAKELLD FTANKMAKAFFTNSGSEANDTQV
Sbjct  121  RLVAAATKQLNELAFYHSFWNRSTKPSLDLAKELLDLFTANKMAKAFFTNSGSEANDTQV  180

Query  710  KLVWYYNNALGRPNKKKFIAREKSYHGS  793
            KLVWYYNNALGRP+KKKFIAR KSYHGS
Sbjct  181  KLVWYYNNALGRPDKKKFIARTKSYHGS  208



>ref|XP_006351982.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
[Solanum tuberosum]
Length=516

 Score =   326 bits (836),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 177/208 (85%), Gaps = 2/208 (1%)
 Frame = +2

Query  176  VAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--STD  349
            +A I  L+G+ +  ATNQVG H+KH+ AVS     I+  +   RWSS + S++ND  +TD
Sbjct  1    MAKITNLIGYGIVAATNQVGPHIKHISAVSNLQKQIVSDQIQVRWSSTETSLKNDISATD  60

Query  350  EKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEP  529
             +G+KGHDMLAPFTAGW TTDL PLVI+KSEGSYVYD+NGKKYLD+LAGLWCT+LGG+EP
Sbjct  61   VRGYKGHDMLAPFTAGWHTTDLEPLVIQKSEGSYVYDVNGKKYLDALAGLWCTSLGGSEP  120

Query  530  RLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQV  709
            RLV AA KQLN LPFYHSFWNR+TKPSLDLAKELLD FTANKMAKAFFTNSGSEANDTQV
Sbjct  121  RLVAAATKQLNELPFYHSFWNRSTKPSLDLAKELLDLFTANKMAKAFFTNSGSEANDTQV  180

Query  710  KLVWYYNNALGRPNKKKFIAREKSYHGS  793
            KLVWYYNNALGRP KKKFIAR KSYHGS
Sbjct  181  KLVWYYNNALGRPEKKKFIARTKSYHGS  208



>ref|XP_006357874.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
[Solanum tuberosum]
Length=515

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/209 (77%), Positives = 178/209 (85%), Gaps = 4/209 (2%)
 Frame = +2

Query  176  VAMINRLLGHTLKRA-TNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--ST  346
            +A I+RL+G T+K A T Q G H K +PAVS     I++   P R+SS Q  ++ND   T
Sbjct  1    MAKISRLIGSTVKAAITAQAGFHAKRIPAVSSLQEHIVKST-PARYSSTQACLENDISGT  59

Query  347  DEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  526
            D KGFKGHDMLAPFTAGWQ+TD+ PL+IEKSEGS+VYD+ G+KYLD+LAGLWCTALGGNE
Sbjct  60   DNKGFKGHDMLAPFTAGWQSTDVDPLIIEKSEGSHVYDMQGRKYLDTLAGLWCTALGGNE  119

Query  527  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQ  706
            PRLVDAA KQLNTLPFYHSFWNRTTKPSLDLAKELLD FTA KMAKAFFTNSGSEANDTQ
Sbjct  120  PRLVDAATKQLNTLPFYHSFWNRTTKPSLDLAKELLDMFTAKKMAKAFFTNSGSEANDTQ  179

Query  707  VKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            VKLVWYYNNALGRPNKKKFIAR K+YHGS
Sbjct  180  VKLVWYYNNALGRPNKKKFIARAKAYHGS  208



>gb|AGX01485.1| mitochondrial gamma aminobutyrate transaminase 1 [Nicotiana tabacum]
Length=512

 Score =   323 bits (827),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 174/208 (84%), Gaps = 5/208 (2%)
 Frame = +2

Query  176  VAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--STD  349
            +A I  L+G  +  ATNQVGSH+    A+S     I+      RWSS + S++ND  S D
Sbjct  1    MAKITSLIGSGIIAATNQVGSHIS---AISNLQKQIVCDPIQVRWSSTETSLKNDISSAD  57

Query  350  EKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEP  529
             +G+KGHDMLAPFTAGWQTTD+ PLVI+KSEGSYVYDINGKKYLD+LAGLWCTALGGNEP
Sbjct  58   IRGYKGHDMLAPFTAGWQTTDVDPLVIQKSEGSYVYDINGKKYLDALAGLWCTALGGNEP  117

Query  530  RLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQV  709
            RLV AA KQLN LPFYHSFWNRTTKPSLDLAKELLD FTANKMAKAFFTNSGSEANDTQV
Sbjct  118  RLVAAATKQLNELPFYHSFWNRTTKPSLDLAKELLDMFTANKMAKAFFTNSGSEANDTQV  177

Query  710  KLVWYYNNALGRPNKKKFIAREKSYHGS  793
            KLVWYYNNALGRPNKKKFIAR K+YHGS
Sbjct  178  KLVWYYNNALGRPNKKKFIARAKAYHGS  205



>ref|NP_001234336.1| gamma aminobutyrate transaminase 1, mitochondrial [Solanum lycopersicum]
 sp|Q84P54.1|GATP1_SOLLC RecName: Full=Gamma aminobutyrate transaminase 1, mitochondrial; 
AltName: Full=Gamma-aminobutyrate transaminase isozyme 1; 
Short=LeGABA-TP1; Short=SlGABA-T1; Flags: Precursor [Solanum 
lycopersicum]
 gb|AAO92255.1| gamma-aminobutyrate transaminase subunit precursor isozyme 1 
[Solanum lycopersicum]
 dbj|BAG16482.1| gamma aminobutyrate transaminase isoform1 [Solanum lycopersicum]
Length=515

 Score =   320 bits (821),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/209 (76%), Positives = 177/209 (85%), Gaps = 4/209 (2%)
 Frame = +2

Query  176  VAMINRLLGHTLKRA-TNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--ST  346
            +A I+RL G T+K A T Q G H K +PAVS     I++   P R++S Q  ++ND   T
Sbjct  1    MAKISRLFGSTVKAAITAQAGFHGKRIPAVSSLQEHIVKST-PARYNSTQACLENDISGT  59

Query  347  DEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  526
            D KGFKGHDMLAPFTAGWQ+TD+ PL+IEKSEGS+VYD+ G+KY+D+LAGLWCTALGGNE
Sbjct  60   DNKGFKGHDMLAPFTAGWQSTDVDPLIIEKSEGSHVYDMQGRKYIDTLAGLWCTALGGNE  119

Query  527  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQ  706
            PRLVDAA KQLNTLPFYHSFWNRTTKPSLDLAKELLD FTA KMAKAFFTNSGSEANDTQ
Sbjct  120  PRLVDAATKQLNTLPFYHSFWNRTTKPSLDLAKELLDMFTAKKMAKAFFTNSGSEANDTQ  179

Query  707  VKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            VKLVWYYNNALGRPNKKKFIAR K+YHGS
Sbjct  180  VKLVWYYNNALGRPNKKKFIARAKAYHGS  208



>ref|XP_009610291.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
isoform X1 [Nicotiana tomentosiformis]
Length=513

 Score =   320 bits (820),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 174/208 (84%), Gaps = 5/208 (2%)
 Frame = +2

Query  176  VAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--STD  349
            +A I  L+G  +  ATNQVGSH+    AVS     I+      RWSS + S++ND  S D
Sbjct  1    MAKITSLIGSGIIAATNQVGSHIS---AVSNLQKQIVCDPIQVRWSSTETSLKNDISSAD  57

Query  350  EKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEP  529
             +G+KGHDMLAPFTAGWQTTD+ PLVI+KSEGSYVYDINGKKYLD+LAGLWCTALGGNEP
Sbjct  58   IRGYKGHDMLAPFTAGWQTTDVDPLVIQKSEGSYVYDINGKKYLDALAGLWCTALGGNEP  117

Query  530  RLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQV  709
            RLV AA KQLN LPFYHSFWNRTTKPSLDLAKELLD FT+NKMAKAFFTNSGSEANDTQV
Sbjct  118  RLVAAATKQLNELPFYHSFWNRTTKPSLDLAKELLDLFTSNKMAKAFFTNSGSEANDTQV  177

Query  710  KLVWYYNNALGRPNKKKFIAREKSYHGS  793
            KLVWYYNNALGRP+KKKFIAR KSYHGS
Sbjct  178  KLVWYYNNALGRPDKKKFIARTKSYHGS  205



>ref|XP_009610292.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
isoform X2 [Nicotiana tomentosiformis]
Length=510

 Score =   310 bits (795),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 168/201 (84%), Gaps = 5/201 (2%)
 Frame = +2

Query  197  LGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--STDEKGFKGH  370
            L +  +   NQVGSH+    AVS     I+      RWSS + S++ND  S D +G+KGH
Sbjct  5    LDNVAQLTVNQVGSHIS---AVSNLQKQIVCDPIQVRWSSTETSLKNDISSADIRGYKGH  61

Query  371  DMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAM  550
            DMLAPFTAGWQTTD+ PLVI+KSEGSYVYDINGKKYLD+LAGLWCTALGGNEPRLV AA 
Sbjct  62   DMLAPFTAGWQTTDVDPLVIQKSEGSYVYDINGKKYLDALAGLWCTALGGNEPRLVAAAT  121

Query  551  KQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYN  730
            KQLN LPFYHSFWNRTTKPSLDLAKELLD FT+NKMAKAFFTNSGSEANDTQVKLVWYYN
Sbjct  122  KQLNELPFYHSFWNRTTKPSLDLAKELLDLFTSNKMAKAFFTNSGSEANDTQVKLVWYYN  181

Query  731  NALGRPNKKKFIAREKSYHGS  793
            NALGRP+KKKFIAR KSYHGS
Sbjct  182  NALGRPDKKKFIARTKSYHGS  202



>ref|XP_011100393.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
isoform X1 [Sesamum indicum]
Length=512

 Score =   310 bits (794),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 173/206 (84%), Gaps = 3/206 (1%)
 Frame = +2

Query  182  MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--STDEK  355
            M++RLL  TL+ A+ Q G +VK + A       +++     +    + S+Q D  STD+K
Sbjct  1    MMHRLLQLTLRNAS-QAGHYVKDISAGKNLQKHLVQASVRAKSYGTEASLQKDVSSTDDK  59

Query  356  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  535
            G+KGHDMLAPFTAGWQTTDL+PLVIEKSEGSYVYD+NGKKYLD+LAGLWCTALGGNEPRL
Sbjct  60   GYKGHDMLAPFTAGWQTTDLNPLVIEKSEGSYVYDVNGKKYLDALAGLWCTALGGNEPRL  119

Query  536  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKL  715
            V AA KQLNTLPFYHSFWNRTTKPSLDLAKEL + FTANKMAK FFTNSGSEAND+QVKL
Sbjct  120  VAAATKQLNTLPFYHSFWNRTTKPSLDLAKELSEMFTANKMAKVFFTNSGSEANDSQVKL  179

Query  716  VWYYNNALGRPNKKKFIAREKSYHGS  793
            VWYYNNALGRPNKKKFIAR+KSYHGS
Sbjct  180  VWYYNNALGRPNKKKFIARQKSYHGS  205



>gb|EYU42835.1| hypothetical protein MIMGU_mgv1a004733mg [Erythranthe guttata]
Length=512

 Score =   308 bits (790),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 172/205 (84%), Gaps = 3/205 (1%)
 Frame = +2

Query  185  INRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--STDEKG  358
            ++RLL  TL+ A+ Q G  VK + A      ++I+     +  S +  +Q D  +TD+KG
Sbjct  1    MHRLLRLTLRNAS-QAGYCVKEISAGKNLPINVIQPPLLAKSYSTEAYLQKDPPTTDDKG  59

Query  359  FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  538
            FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYD NGKKYLDSLAGLWCTALGG+EPRLV
Sbjct  60   FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDTNGKKYLDSLAGLWCTALGGSEPRLV  119

Query  539  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLV  718
            DAA+KQLNTLPFYHSFWNRTTKPSLDLAKELL+ FTA KMAK FFTNSGSEAND+QVKLV
Sbjct  120  DAAIKQLNTLPFYHSFWNRTTKPSLDLAKELLEMFTATKMAKVFFTNSGSEANDSQVKLV  179

Query  719  WYYNNALGRPNKKKFIAREKSYHGS  793
            WYYNNALGRPNKKKFIAR KSYHGS
Sbjct  180  WYYNNALGRPNKKKFIARAKSYHGS  204



>ref|XP_012081034.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
[Jatropha curcas]
 gb|KDP30431.1| hypothetical protein JCGZ_16670 [Jatropha curcas]
Length=517

 Score =   308 bits (790),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 172/209 (82%), Gaps = 8/209 (4%)
 Frame = +2

Query  182  MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQ-----NDST  346
            +IN++L  TLK   NQ+GSH KH+ A   S   +       +    + S+Q      DS 
Sbjct  2    VINKILRSTLK---NQLGSHSKHVAASGSSQKHLASAPCLAKLYGTEASLQKDDSTTDSR  58

Query  347  DEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  526
            D +G+KGHDMLAPFTAGWQ+TDLHPLVI+KSEGSYVYDINGKKYLDSLAGLWCTALGG+E
Sbjct  59   DGRGYKGHDMLAPFTAGWQSTDLHPLVIDKSEGSYVYDINGKKYLDSLAGLWCTALGGSE  118

Query  527  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQ  706
            PRLV AA +QL+ LPFYHSFWNRTTKPSLDLAKELL+TFT++KMAKAFFTNSGSEANDTQ
Sbjct  119  PRLVAAATEQLHKLPFYHSFWNRTTKPSLDLAKELLETFTSSKMAKAFFTNSGSEANDTQ  178

Query  707  VKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            VKLVWYYNNALGRPNKKKFIAR KSYHGS
Sbjct  179  VKLVWYYNNALGRPNKKKFIARAKSYHGS  207



>ref|XP_010941664.1| PREDICTED: probable gamma-aminobutyrate transaminase 3, mitochondrial 
[Elaeis guineensis]
Length=508

 Score =   308 bits (789),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 169/203 (83%), Gaps = 3/203 (1%)
 Frame = +2

Query  194  LLGHTLKR--ATNQVGSHVKHLP-AVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKGFK  364
            ++G +L R  A+++VG  ++H+  A      +     S  R  S++ S+Q D TDE+GFK
Sbjct  1    MIGKSLLRSKASSKVGMLIRHIATAEGLQSHAPPYIASVARLMSSEASLQTDPTDERGFK  60

Query  365  GHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDA  544
            GHDMLAPFTAGWQ+TDLHPLVIEKSEGSYVYDINGKKYLD+LAGLWCTALGG+EPRLV+A
Sbjct  61   GHDMLAPFTAGWQSTDLHPLVIEKSEGSYVYDINGKKYLDALAGLWCTALGGSEPRLVEA  120

Query  545  AMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWY  724
            A  QL  LPFYHSFWNRTTKPSLDLAKELL+TFTA KM K FFTNSGSEAND+QVKLVWY
Sbjct  121  ATAQLKKLPFYHSFWNRTTKPSLDLAKELLETFTARKMGKVFFTNSGSEANDSQVKLVWY  180

Query  725  YNNALGRPNKKKFIAREKSYHGS  793
            YNNALGRPNKKKFIAR KSYHGS
Sbjct  181  YNNALGRPNKKKFIARAKSYHGS  203



>ref|XP_006429770.1| hypothetical protein CICLE_v10011509mg [Citrus clementina]
 ref|XP_006481368.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
[Citrus sinensis]
 gb|ESR43010.1| hypothetical protein CICLE_v10011509mg [Citrus clementina]
Length=514

 Score =   305 bits (782),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 168/207 (81%), Gaps = 3/207 (1%)
 Frame = +2

Query  173  AVAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDE  352
            A  + ++LL  +LK   +Q+GS  KH  A      ++ +     R+     S+Q + +  
Sbjct  4    AKMVTSKLLQSSLK---SQIGSFTKHFSASKSLSENLYQIPLLARFYGTDASLQKEDSTT  60

Query  353  KGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPR  532
             GFKGHDMLAPFTAGWQ+TD+HPLVIEKSEGSYVYDINGKKYLDSL+GLWCTALGG+EPR
Sbjct  61   NGFKGHDMLAPFTAGWQSTDVHPLVIEKSEGSYVYDINGKKYLDSLSGLWCTALGGSEPR  120

Query  533  LVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVK  712
            LV AA  QLNTLPFYHSFWNRTTKPSLDLAKELL+ FTA+KMAK FFTNSGSEANDTQVK
Sbjct  121  LVAAATAQLNTLPFYHSFWNRTTKPSLDLAKELLEMFTASKMAKVFFTNSGSEANDTQVK  180

Query  713  LVWYYNNALGRPNKKKFIAREKSYHGS  793
            LVWYYNNALGRPNKKKFIAR+KSYHGS
Sbjct  181  LVWYYNNALGRPNKKKFIARQKSYHGS  207



>ref|XP_008652021.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
[Zea mays]
 gb|KJB42908.1| hypothetical protein B456_007G173800 [Gossypium raimondii]
Length=515

 Score =   305 bits (781),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 167/205 (81%), Gaps = 6/205 (3%)
 Frame = +2

Query  188  NRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEK---G  358
            N LL  TLK    Q+GS++K+  A   S    ++     R  S + S+Q D +D K   G
Sbjct  4    NSLLRSTLK---TQLGSYIKNAAAYRSSMDHPLKGALLARLYSTEPSLQRDDSDLKDGNG  60

Query  359  FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  538
            FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYD NGKKYLDSLAGLWCTALGGNEPRLV
Sbjct  61   FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDANGKKYLDSLAGLWCTALGGNEPRLV  120

Query  539  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLV  718
            +AA  QLN LPFYHSFWNRTTKPSLDLAK+LL+TFTA KMAK FFTNSGSEANDTQVKLV
Sbjct  121  EAATAQLNKLPFYHSFWNRTTKPSLDLAKDLLETFTATKMAKVFFTNSGSEANDTQVKLV  180

Query  719  WYYNNALGRPNKKKFIAREKSYHGS  793
            WYYNNALGRPNKKKFIAR KSYHGS
Sbjct  181  WYYNNALGRPNKKKFIARAKSYHGS  205



>gb|KDO64363.1| hypothetical protein CISIN_1g010250mg [Citrus sinensis]
Length=514

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 167/207 (81%), Gaps = 3/207 (1%)
 Frame = +2

Query  173  AVAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDE  352
            A  + ++LL  +LK   +Q+GS  KH  A      ++ +     R+     S Q + +  
Sbjct  4    AKMVTSKLLQSSLK---SQIGSFTKHFSASKSLSENLYQIPLLARFYGTDASSQKEDSTT  60

Query  353  KGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPR  532
             GFKGHDMLAPFTAGWQ+TD+HPLVIEKSEGSYVYD+NGKKYLDSLAGLWCTALGG+EPR
Sbjct  61   NGFKGHDMLAPFTAGWQSTDVHPLVIEKSEGSYVYDVNGKKYLDSLAGLWCTALGGSEPR  120

Query  533  LVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVK  712
            LV AA  QLNTLPFYHSFWNRTTKPSLDLAKELL+ FTA+KMAK FFTNSGSEANDTQVK
Sbjct  121  LVAAATAQLNTLPFYHSFWNRTTKPSLDLAKELLEMFTASKMAKVFFTNSGSEANDTQVK  180

Query  713  LVWYYNNALGRPNKKKFIAREKSYHGS  793
            LVWYYNNALGRPNKKKFIAR+KSYHGS
Sbjct  181  LVWYYNNALGRPNKKKFIARQKSYHGS  207



>ref|XP_010036076.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
[Eucalyptus grandis]
 gb|KCW47596.1| hypothetical protein EUGRSUZ_K01341 [Eucalyptus grandis]
Length=509

 Score =   301 bits (770),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/161 (88%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = +2

Query  311  SSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSL  490
            +S Q     +S D  GFKGHDMLAPFTAGWQTTDLHPLVIE+SEGSYVYDINGKKYLDSL
Sbjct  41   ASLQKEESTESKDGLGFKGHDMLAPFTAGWQTTDLHPLVIERSEGSYVYDINGKKYLDSL  100

Query  491  AGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAF  670
            AGLWCTALGGNEPRLV+AA+ QLNTLPFYHSFWNRTTKPSLDLAKELL+TFTA KMAKAF
Sbjct  101  AGLWCTALGGNEPRLVNAAVAQLNTLPFYHSFWNRTTKPSLDLAKELLETFTARKMAKAF  160

Query  671  FTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            FTNSGSEANDTQVKLVWYYNNALGRP KKKFIAR KSYHGS
Sbjct  161  FTNSGSEANDTQVKLVWYYNNALGRPEKKKFIARAKSYHGS  201



>ref|XP_009399251.1| PREDICTED: probable gamma-aminobutyrate transaminase 3, mitochondrial 
[Musa acuminata subsp. malaccensis]
Length=505

 Score =   300 bits (769),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 150/164 (91%), Gaps = 0/164 (0%)
 Frame = +2

Query  302  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  481
            +R  S+   +Q++ST+E+GFKGHDMLAPFTAGWQTTDLHPLVI+KSEGSYVYDINGKKYL
Sbjct  33   SRLMSSTAPLQSESTEERGFKGHDMLAPFTAGWQTTDLHPLVIDKSEGSYVYDINGKKYL  92

Query  482  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  661
            D+LAGLWCTALGGNEPRL+ AA  QLN LPFYHSFWNRTTKPSLDLAKE+L+ FTA KM 
Sbjct  93   DALAGLWCTALGGNEPRLIAAATAQLNKLPFYHSFWNRTTKPSLDLAKEILEIFTARKMG  152

Query  662  KAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            K FFTNSGSEAND+QVKLVWYYNNALGRPNKKKFIAR KSYHGS
Sbjct  153  KVFFTNSGSEANDSQVKLVWYYNNALGRPNKKKFIARSKSYHGS  196



>gb|KHG00607.1| Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Gossypium 
arboreum]
Length=392

 Score =   296 bits (759),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 165/204 (81%), Gaps = 6/204 (3%)
 Frame = +2

Query  188  NRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEK---G  358
            N LL  TLK    Q+GS++K+  A   S    ++     R  S + S+Q D +D K   G
Sbjct  4    NSLLRSTLK---TQLGSYIKNAAAYRSSMDHPLKGALLARLYSTEPSLQRDDSDLKDGNG  60

Query  359  FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  538
            FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYD +GKKYLDSLAGLWCTALGG+EPRLV
Sbjct  61   FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDTHGKKYLDSLAGLWCTALGGSEPRLV  120

Query  539  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLV  718
            +AA  QLN LPFYHSFWNRTTK SLDLAK+LL+TFTA KMAK FFTNSGSEANDTQVKLV
Sbjct  121  EAATAQLNKLPFYHSFWNRTTKLSLDLAKDLLETFTATKMAKVFFTNSGSEANDTQVKLV  180

Query  719  WYYNNALGRPNKKKFIAREKSYHG  790
            WYYNNALGRPNKKKFIAR KSYHG
Sbjct  181  WYYNNALGRPNKKKFIARAKSYHG  204



>ref|XP_011100394.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
isoform X2 [Sesamum indicum]
Length=501

 Score =   300 bits (767),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 151/160 (94%), Gaps = 2/160 (1%)
 Frame = +2

Query  320  QVSVQND--STDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLA  493
            + S+Q D  STD+KG+KGHDMLAPFTAGWQTTDL+PLVIEKSEGSYVYD+NGKKYLD+LA
Sbjct  35   EASLQKDVSSTDDKGYKGHDMLAPFTAGWQTTDLNPLVIEKSEGSYVYDVNGKKYLDALA  94

Query  494  GLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFF  673
            GLWCTALGGNEPRLV AA KQLNTLPFYHSFWNRTTKPSLDLAKEL + FTANKMAK FF
Sbjct  95   GLWCTALGGNEPRLVAAATKQLNTLPFYHSFWNRTTKPSLDLAKELSEMFTANKMAKVFF  154

Query  674  TNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            TNSGSEAND+QVKLVWYYNNALGRPNKKKFIAR+KSYHGS
Sbjct  155  TNSGSEANDSQVKLVWYYNNALGRPNKKKFIARQKSYHGS  194



>ref|XP_008798241.1| PREDICTED: gamma-aminobutyrate transaminase 1, mitochondrial, 
partial [Phoenix dactylifera]
Length=506

 Score =   299 bits (766),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 159/194 (82%), Gaps = 1/194 (1%)
 Frame = +2

Query  215  RATNQVGSHVKHLPAVsgshgsiirrrsP-TRWSSAQVSVQNDSTDEKGFKGHDMLAPFT  391
            +A+++VG  ++H+              +   R   +Q S+  D TDEKGFKGHDMLAPFT
Sbjct  10   KASSKVGMLIRHVATAERFQSHGPPYIASFARLMCSQASLLTDPTDEKGFKGHDMLAPFT  69

Query  392  AGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLP  571
            AGWQ+TDLHPLVIEKSEGSYVYD NGKKYLD+LAGLWCTALGG+EPRLV+AA  QL  LP
Sbjct  70   AGWQSTDLHPLVIEKSEGSYVYDNNGKKYLDTLAGLWCTALGGSEPRLVEAATAQLKKLP  129

Query  572  FYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNALGRPN  751
            FYHSFWNRTTKPSLDLAKELL+TFTA KM K FFTNSGSEAND+QVKLVWYYNNALGRPN
Sbjct  130  FYHSFWNRTTKPSLDLAKELLETFTARKMGKVFFTNSGSEANDSQVKLVWYYNNALGRPN  189

Query  752  KKKFIAREKSYHGS  793
            KKKFIAR KSYHGS
Sbjct  190  KKKFIARAKSYHGS  203



>ref|XP_008229658.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
[Prunus mume]
Length=514

 Score =   299 bits (766),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 166/207 (80%), Gaps = 7/207 (3%)
 Frame = +2

Query  185  INRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDS--TDEK-  355
             NRLLG  L+    Q+ S  K++ A       +      +R  S    +Q +   TDEK 
Sbjct  3    FNRLLGSNLR---TQLRSCTKYIAASRSPQEHLFLVPFLSRSYSTGSPLQKEEPITDEKV  59

Query  356  -GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPR  532
             GFKGHDMLAPFTAGWQ+ DLHPL+IEKSEGSYVYDINGKKYLD+LAGLWCTALGGNEPR
Sbjct  60   LGFKGHDMLAPFTAGWQSADLHPLIIEKSEGSYVYDINGKKYLDALAGLWCTALGGNEPR  119

Query  533  LVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVK  712
            LV AA +QLNTLPFYHSFWNRTTKPSLDLAKELL+TFTA KMAKAFFTNSGSEANDTQVK
Sbjct  120  LVAAATQQLNTLPFYHSFWNRTTKPSLDLAKELLETFTATKMAKAFFTNSGSEANDTQVK  179

Query  713  LVWYYNNALGRPNKKKFIAREKSYHGS  793
            LVWYYNNALGRP+KKKFIAR KSYHGS
Sbjct  180  LVWYYNNALGRPDKKKFIARHKSYHGS  206



>ref|XP_007049029.1| Pyridoxal phosphate-dependent transferases superfamily protein 
[Theobroma cacao]
 gb|EOX93186.1| Pyridoxal phosphate-dependent transferases superfamily protein 
[Theobroma cacao]
Length=525

 Score =   298 bits (763),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 162/205 (79%), Gaps = 6/205 (3%)
 Frame = +2

Query  188  NRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEK---G  358
            N  L  TLK    Q+GS++K+  A         +     R  S + S+Q + +D K   G
Sbjct  14   NSFLRSTLKL---QLGSYIKNAAAYRSFMDQSPKGPVLARLYSTEPSLQKEDSDLKDGNG  70

Query  359  FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  538
            FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYD+NG+KYLD+LAGLWCTALGGNE RLV
Sbjct  71   FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDVNGRKYLDTLAGLWCTALGGNEARLV  130

Query  539  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLV  718
             AA  QLN LPFYHSFWNRTTKPSLDLAKELL TFTA KMAK FFTNSGSEANDTQVKLV
Sbjct  131  AAATDQLNKLPFYHSFWNRTTKPSLDLAKELLGTFTARKMAKVFFTNSGSEANDTQVKLV  190

Query  719  WYYNNALGRPNKKKFIAREKSYHGS  793
            WYYNNALGRPNKKKFIAR KSYHGS
Sbjct  191  WYYNNALGRPNKKKFIARAKSYHGS  215



>ref|XP_007215238.1| hypothetical protein PRUPE_ppa004369mg [Prunus persica]
 gb|EMJ16437.1| hypothetical protein PRUPE_ppa004369mg [Prunus persica]
Length=514

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 166/207 (80%), Gaps = 7/207 (3%)
 Frame = +2

Query  185  INRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDS--TDEK-  355
             NRLLG  L+    Q+ S  K++ A       +      +R  S    +Q +   TDEK 
Sbjct  3    FNRLLGSNLR---TQLRSCTKYVAASRSPQEHLFLVPFLSRSYSTGSPLQKEEPITDEKV  59

Query  356  -GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPR  532
             GFKGH+MLAPFTAGWQ+ DLHPL+IEKSEGSYVYDINGKKYLD+LAGLWCTALGGNEPR
Sbjct  60   LGFKGHEMLAPFTAGWQSADLHPLIIEKSEGSYVYDINGKKYLDALAGLWCTALGGNEPR  119

Query  533  LVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVK  712
            LV AA +QLNTLPFYHSFWNRTTKPSLDLAKELL+TFTA KMAKAFFTNSGSEANDTQVK
Sbjct  120  LVAAATQQLNTLPFYHSFWNRTTKPSLDLAKELLETFTATKMAKAFFTNSGSEANDTQVK  179

Query  713  LVWYYNNALGRPNKKKFIAREKSYHGS  793
            LVWYYNNALGRP+KKKFIAR KSYHGS
Sbjct  180  LVWYYNNALGRPDKKKFIARHKSYHGS  206



>ref|XP_002307913.1| POLLEN-PISTIL INTERACTION 2 family protein [Populus trichocarpa]
 gb|EEE91436.1| POLLEN-PISTIL INTERACTION 2 family protein [Populus trichocarpa]
Length=514

 Score =   296 bits (758),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 171/206 (83%), Gaps = 5/206 (2%)
 Frame = +2

Query  182  MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQ-NDST-DEK  355
            +I++LL  TLK   +Q+ S +K+  A   S    +R     R  S + S+Q  DST D  
Sbjct  2    VISKLLRSTLK---SQLRSCIKNGTASGSSQEHHLRAPFLARLYSTKASLQKEDSTIDGN  58

Query  356  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  535
             FKGHDMLAPFTAGWQ++DL+PLVIEKSEGSYVYDINGKKYLD+LAGLWCTALGGNEPRL
Sbjct  59   SFKGHDMLAPFTAGWQSSDLNPLVIEKSEGSYVYDINGKKYLDALAGLWCTALGGNEPRL  118

Query  536  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKL  715
            V AA +QLN LPFYHSFWNRTTKPSLDLAKELL+TFTA+KMAKAFFTNSGSEANDTQVKL
Sbjct  119  VAAATEQLNKLPFYHSFWNRTTKPSLDLAKELLETFTASKMAKAFFTNSGSEANDTQVKL  178

Query  716  VWYYNNALGRPNKKKFIAREKSYHGS  793
            VWYYNNALGRPNKKKFIAR KSYHGS
Sbjct  179  VWYYNNALGRPNKKKFIARAKSYHGS  204



>ref|XP_002322549.2| hypothetical protein POPTR_0016s02000g [Populus trichocarpa]
 gb|EEF04310.2| hypothetical protein POPTR_0016s02000g [Populus trichocarpa]
Length=514

 Score =   295 bits (754),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 150/206 (73%), Positives = 169/206 (82%), Gaps = 5/206 (2%)
 Frame = +2

Query  182  MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKG-  358
            +I++LL  TLK    Q+GS +K+  A   S   ++R     R    + S+Q + +  +G 
Sbjct  2    VISKLLRSTLKA---QLGSCIKNGTASGSSQEHLLRGPFLARLYGTEASLQKEDSTTEGN  58

Query  359  -FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  535
             FKGHDMLAPFTAGWQ+ DL PLVIEKSEGSYVYDINGKKYLD+LAGLWCT+LGGNEPRL
Sbjct  59   SFKGHDMLAPFTAGWQSNDLDPLVIEKSEGSYVYDINGKKYLDALAGLWCTSLGGNEPRL  118

Query  536  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKL  715
            V AA +QLN LPFYHSFWNRTTKPSLDLAKELL+TFTA+KMAKAFFTNSGSEANDTQVKL
Sbjct  119  VAAATEQLNKLPFYHSFWNRTTKPSLDLAKELLETFTASKMAKAFFTNSGSEANDTQVKL  178

Query  716  VWYYNNALGRPNKKKFIAREKSYHGS  793
            VWYYNNALGRPNKKKFIAR KSYHGS
Sbjct  179  VWYYNNALGRPNKKKFIARAKSYHGS  204



>sp|B8BBZ7.1|GATP3_ORYSI RecName: Full=Probable gamma-aminobutyrate transaminase 3, mitochondrial; 
Flags: Precursor [Oryza sativa Indica Group]
 gb|EEC83087.1| hypothetical protein OsI_28220 [Oryza sativa Indica Group]
Length=510

 Score =   295 bits (754),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 160/204 (78%), Gaps = 2/204 (1%)
 Frame = +2

Query  182  MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKGF  361
            MI R L      A ++  S VKH+ A             P R+ S++ S+Q DST+E GF
Sbjct  1    MICRSLLLLRSNAASKASSIVKHVAATGCLPEYSSEA--PARYFSSESSLQVDSTEENGF  58

Query  362  KGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVD  541
            KGH MLAPFTAGWQ+TDLHPLVI++SEGSYVYDINGKKY+D+LAGLW TALGGNEPRL+ 
Sbjct  59   KGHGMLAPFTAGWQSTDLHPLVIDRSEGSYVYDINGKKYIDALAGLWSTALGGNEPRLIK  118

Query  542  AAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVW  721
            AA  QLN LPFYHSFWNRTTKPSLDLA E+L  FTA +M K FFTNSGSEAND+QVKLVW
Sbjct  119  AATDQLNKLPFYHSFWNRTTKPSLDLANEILSMFTAREMGKIFFTNSGSEANDSQVKLVW  178

Query  722  YYNNALGRPNKKKFIAREKSYHGS  793
            YYNNALGRPNKKKFIAR KSYHGS
Sbjct  179  YYNNALGRPNKKKFIARSKSYHGS  202



>gb|AGF95098.1| 4-aminobutyrate aminotransferase [Prunus persica]
Length=220

 Score =   285 bits (728),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/200 (73%), Positives = 160/200 (80%), Gaps = 7/200 (4%)
 Frame = +2

Query  185  INRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDS--TDEK-  355
             NRLLG  L+    Q+ S  K++ A       +      +R  S    +Q +   TDEK 
Sbjct  3    FNRLLGSNLR---TQLRSCTKYVAASRSPQEHLFLVPFLSRSYSTGSPLQKEEPITDEKV  59

Query  356  -GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPR  532
             GFKGH+MLAPFTAGWQ+ DLHPL+IEKSEGSYVYDINGKKYLD+LAGLWCTALGGNEPR
Sbjct  60   LGFKGHEMLAPFTAGWQSADLHPLIIEKSEGSYVYDINGKKYLDALAGLWCTALGGNEPR  119

Query  533  LVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVK  712
            LV AA +QLNTLPFYHSFWNRTTKPSLDLAKELL+TFTA KMAKAFFTNSGSEANDTQVK
Sbjct  120  LVAAATQQLNTLPFYHSFWNRTTKPSLDLAKELLETFTATKMAKAFFTNSGSEANDTQVK  179

Query  713  LVWYYNNALGRPNKKKFIAR  772
            LVWYYNNALGRP+KKKFIAR
Sbjct  180  LVWYYNNALGRPDKKKFIAR  199



>ref|XP_009349580.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=521

 Score =   294 bits (753),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 151/167 (90%), Gaps = 4/167 (2%)
 Frame = +2

Query  305  RWSSAQVSVQND--STDEKG--FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGK  472
            R  S   SVQ +  +TDEKG  FKGHDMLAPFTAGWQ+TD+HPL+IEKSEGSY YD NGK
Sbjct  47   RSYSTGSSVQKEEPTTDEKGLGFKGHDMLAPFTAGWQSTDVHPLIIEKSEGSYAYDSNGK  106

Query  473  KYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAN  652
            KYLD+LAGLWCTALGGNEPRLV AA KQLNTLPFYHSFWNRTT+PSLDLAKELL+TFTA 
Sbjct  107  KYLDALAGLWCTALGGNEPRLVAAATKQLNTLPFYHSFWNRTTRPSLDLAKELLETFTAT  166

Query  653  KMAKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            KMAKAFFTNSGSEANDTQVKLVWYYNNALGRP+KKKFIAR KSYHGS
Sbjct  167  KMAKAFFTNSGSEANDTQVKLVWYYNNALGRPDKKKFIARHKSYHGS  213



>ref|XP_009349581.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=514

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 142/167 (85%), Positives = 151/167 (90%), Gaps = 4/167 (2%)
 Frame = +2

Query  305  RWSSAQVSVQND--STDEKG--FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGK  472
            R  S   SVQ +  +TDEKG  FKGHDMLAPFTAGWQ+TD+HPL+IEKSEGSY YD NGK
Sbjct  40   RSYSTGSSVQKEEPTTDEKGLGFKGHDMLAPFTAGWQSTDVHPLIIEKSEGSYAYDSNGK  99

Query  473  KYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAN  652
            KYLD+LAGLWCTALGGNEPRLV AA KQLNTLPFYHSFWNRTT+PSLDLAKELL+TFTA 
Sbjct  100  KYLDALAGLWCTALGGNEPRLVAAATKQLNTLPFYHSFWNRTTRPSLDLAKELLETFTAT  159

Query  653  KMAKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            KMAKAFFTNSGSEANDTQVKLVWYYNNALGRP+KKKFIAR KSYHGS
Sbjct  160  KMAKAFFTNSGSEANDTQVKLVWYYNNALGRPDKKKFIARHKSYHGS  206



>ref|XP_006858237.1| PREDICTED: probable gamma-aminobutyrate transaminase 3, mitochondrial 
[Amborella trichopoda]
 gb|ERN19704.1| hypothetical protein AMTR_s00062p00194620 [Amborella trichopoda]
Length=510

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/195 (72%), Positives = 163/195 (84%), Gaps = 3/195 (2%)
 Frame = +2

Query  215  RATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--STDEKGFKGHDMLAPF  388
            R+  Q+G  +KH+ A            +   +SS + S+Q+D   +++KGFKGHDMLAPF
Sbjct  10   RSNLQLGKFIKHVAAARNLKVPPHHCPTFASYSS-EASLQSDVPESNDKGFKGHDMLAPF  68

Query  389  TAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTL  568
            TAGWQ+TDLHPLVI++SEGSYVYD+NGKKYLD+LAGLWCTALGGNEPRLV+AA +QLN L
Sbjct  69   TAGWQSTDLHPLVIDRSEGSYVYDVNGKKYLDALAGLWCTALGGNEPRLVEAATRQLNKL  128

Query  569  PFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNALGRP  748
            PFYHSFWNRTTKPSLDLA ELL+ FTA KM K FFTNSGSEAND+QVKLVWYYNNALGRP
Sbjct  129  PFYHSFWNRTTKPSLDLATELLEMFTARKMGKVFFTNSGSEANDSQVKLVWYYNNALGRP  188

Query  749  NKKKFIAREKSYHGS  793
            +KKKFIAR+KSYHGS
Sbjct  189  DKKKFIARQKSYHGS  203



>ref|XP_011001061.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
[Populus euphratica]
Length=514

 Score =   293 bits (751),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 169/206 (82%), Gaps = 5/206 (2%)
 Frame = +2

Query  182  MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKG-  358
            +I++LL  TLK    Q+ S +K+  A   S   ++R     R+   + S+Q + +  +G 
Sbjct  2    VISKLLRSTLKA---QLSSCIKNGTASGSSQEHLLRAPFLARFYGTKASLQKEDSTTEGN  58

Query  359  -FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  535
             FKGHDMLAPFTAGWQ+ DL PLVIEKSEGSYVYDINGKKYLD+LAGLWCT+LGGNEPRL
Sbjct  59   SFKGHDMLAPFTAGWQSNDLDPLVIEKSEGSYVYDINGKKYLDALAGLWCTSLGGNEPRL  118

Query  536  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKL  715
            V AA +QLN LPFYHSFWNRTTKPSLDLAKELL+TFTA+KMAKAFFTNSGSEANDTQVKL
Sbjct  119  VAAATEQLNKLPFYHSFWNRTTKPSLDLAKELLETFTASKMAKAFFTNSGSEANDTQVKL  178

Query  716  VWYYNNALGRPNKKKFIAREKSYHGS  793
            VWYYNNALGRPNKKKFIAR KSYHGS
Sbjct  179  VWYYNNALGRPNKKKFIARAKSYHGS  204



>ref|XP_009347869.1| PREDICTED: probable gamma-aminobutyrate transaminase 3, mitochondrial 
[Pyrus x bretschneideri]
Length=514

 Score =   293 bits (751),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 147/157 (94%), Gaps = 3/157 (2%)
 Frame = +2

Query  332  QNDSTDEK---GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLW  502
            + +ST E+   GFKGHDMLAPFTAGWQ+TDLHPL+IEKSEGSYVYD NGKKYLD+LAGLW
Sbjct  50   REESTAEEKGLGFKGHDMLAPFTAGWQSTDLHPLIIEKSEGSYVYDSNGKKYLDALAGLW  109

Query  503  CTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNS  682
            CTALGGNEPRLV AA KQLNTLPFYHSFWNRTTKPSLDLAKELL+TFTA+KMAKAFFTNS
Sbjct  110  CTALGGNEPRLVAAATKQLNTLPFYHSFWNRTTKPSLDLAKELLETFTASKMAKAFFTNS  169

Query  683  GSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            GSEANDTQVKLVWYYNNALGRP KKKFIAR KSYHGS
Sbjct  170  GSEANDTQVKLVWYYNNALGRPAKKKFIARHKSYHGS  206



>gb|AFS28620.1| gamma-aminobutyrate transaminase 1 [Malus domestica]
Length=514

 Score =   293 bits (750),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 147/157 (94%), Gaps = 3/157 (2%)
 Frame = +2

Query  332  QNDSTDEK---GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLW  502
            + +ST E+   GFKGHDMLAPFTAGWQ+TDLHPL+IEKSEG YVYD NGKKYLD+LAGLW
Sbjct  50   REESTAEEKGLGFKGHDMLAPFTAGWQSTDLHPLIIEKSEGCYVYDSNGKKYLDALAGLW  109

Query  503  CTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNS  682
            CTALGGNEPRLV AA KQLNTLPFYHSFWNRTTKPSLDLAKELL+TFTA+KMAKAFFTNS
Sbjct  110  CTALGGNEPRLVAAATKQLNTLPFYHSFWNRTTKPSLDLAKELLETFTASKMAKAFFTNS  169

Query  683  GSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            GSEANDTQVKLVWYYNNALGRP+KKKFIAR KSYHGS
Sbjct  170  GSEANDTQVKLVWYYNNALGRPDKKKFIARHKSYHGS  206



>ref|XP_008365554.1| PREDICTED: gamma-aminobutyrate transaminase 1, mitochondrial-like 
[Malus domestica]
Length=514

 Score =   293 bits (750),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 147/157 (94%), Gaps = 3/157 (2%)
 Frame = +2

Query  332  QNDSTDEK---GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLW  502
            + +ST E+   GFKGHDMLAPFTAGWQ+TDLHPL+IEKSEG YVYD NGKKYLD+LAGLW
Sbjct  50   REESTAEEKGLGFKGHDMLAPFTAGWQSTDLHPLIIEKSEGCYVYDSNGKKYLDALAGLW  109

Query  503  CTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNS  682
            CTALGGNEPRLV AA KQLNTLPFYHSFWNRTTKPSLDLAKELL+TFTA+KMAKAFFTNS
Sbjct  110  CTALGGNEPRLVAAATKQLNTLPFYHSFWNRTTKPSLDLAKELLETFTASKMAKAFFTNS  169

Query  683  GSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            GSEANDTQVKLVWYYNNALGRP+KKKFIAR KSYHGS
Sbjct  170  GSEANDTQVKLVWYYNNALGRPDKKKFIARHKSYHGS  206



>ref|NP_001061237.1| Os08g0205900 [Oryza sativa Japonica Group]
 sp|Q6ZCF0.1|GATP3_ORYSJ RecName: Full=Probable gamma-aminobutyrate transaminase 3, mitochondrial; 
Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD05337.1| putative gamma-aminobutyrate transaminase subunit precursor isozyme 
3 [Oryza sativa Japonica Group]
 dbj|BAD11549.1| putative gamma-aminobutyrate transaminase subunit precursor isozyme 
3 [Oryza sativa Japonica Group]
 dbj|BAF23151.1| Os08g0205900 [Oryza sativa Japonica Group]
 gb|EEE68226.1| hypothetical protein OsJ_26408 [Oryza sativa Japonica Group]
Length=510

 Score =   292 bits (748),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 160/204 (78%), Gaps = 2/204 (1%)
 Frame = +2

Query  182  MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKGF  361
            MI R L      A ++  + VKH+ A             P R+ S++ S+Q DST+E GF
Sbjct  1    MICRSLLLLRSNAASKASNIVKHVAATGCLPKYSSEA--PARYFSSEPSLQVDSTEENGF  58

Query  362  KGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVD  541
            KGH MLAPFTAGWQ+TDLHPLVI++SEGSYVYDINGKKY+D+LAGLW TALGGNEPRL+ 
Sbjct  59   KGHGMLAPFTAGWQSTDLHPLVIDRSEGSYVYDINGKKYIDALAGLWSTALGGNEPRLIK  118

Query  542  AAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVW  721
            AA  QLN LPFYHSFWNRTTKPSLDLA E+L  FTA +M K FFTNSGSEAND+QVKLVW
Sbjct  119  AATDQLNKLPFYHSFWNRTTKPSLDLANEILSMFTAREMGKIFFTNSGSEANDSQVKLVW  178

Query  722  YYNNALGRPNKKKFIAREKSYHGS  793
            YYNNALGRPNKKKFIAR KSYHGS
Sbjct  179  YYNNALGRPNKKKFIARSKSYHGS  202



>ref|XP_002268803.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
[Vitis vinifera]
Length=516

 Score =   292 bits (748),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 166/209 (79%), Gaps = 6/209 (3%)
 Frame = +2

Query  182  MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTD----  349
            MI R L  +  R T  V S+  H+ A       ++R     RW+S + S+Q +  +    
Sbjct  1    MIFRNLVRSTLRNTQAV-SYKNHVAAARSLQEHLVRAPVLARWNSTEASMQREDAETELK  59

Query  350  -EKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  526
              K FKGHDMLAPFTAGWQ +D +PLVIEKS+G+YV+DINGKKYLDSLAGLWCTALGG+E
Sbjct  60   NAKEFKGHDMLAPFTAGWQASDTNPLVIEKSKGAYVWDINGKKYLDSLAGLWCTALGGSE  119

Query  527  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQ  706
            PRLV AA+ QLNTLPFYHSFWNRTTKPSLDLAKELL+TFTA KM KAFFTNSGSEANDTQ
Sbjct  120  PRLVAAAIAQLNTLPFYHSFWNRTTKPSLDLAKELLNTFTATKMGKAFFTNSGSEANDTQ  179

Query  707  VKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            VKLVWYYNNALGRPNKKKFIAREKSYHGS
Sbjct  180  VKLVWYYNNALGRPNKKKFIAREKSYHGS  208



>emb|CBI34106.3| unnamed protein product [Vitis vinifera]
Length=522

 Score =   293 bits (749),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 166/209 (79%), Gaps = 6/209 (3%)
 Frame = +2

Query  182  MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTD----  349
            MI R L  +  R T  V S+  H+ A       ++R     RW+S + S+Q +  +    
Sbjct  1    MIFRNLVRSTLRNTQAV-SYKNHVAAARSLQEHLVRAPVLARWNSTEASMQREDAETELK  59

Query  350  -EKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  526
              K FKGHDMLAPFTAGWQ +D +PLVIEKS+G+YV+DINGKKYLDSLAGLWCTALGG+E
Sbjct  60   NAKEFKGHDMLAPFTAGWQASDTNPLVIEKSKGAYVWDINGKKYLDSLAGLWCTALGGSE  119

Query  527  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQ  706
            PRLV AA+ QLNTLPFYHSFWNRTTKPSLDLAKELL+TFTA KM KAFFTNSGSEANDTQ
Sbjct  120  PRLVAAAIAQLNTLPFYHSFWNRTTKPSLDLAKELLNTFTATKMGKAFFTNSGSEANDTQ  179

Query  707  VKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            VKLVWYYNNALGRPNKKKFIAREKSYHGS
Sbjct  180  VKLVWYYNNALGRPNKKKFIAREKSYHGS  208



>emb|CDP16027.1| unnamed protein product [Coffea canephora]
Length=523

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 151/165 (92%), Gaps = 2/165 (1%)
 Frame = +2

Query  305  RWSSAQVSVQND--STDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKY  478
            RW+S + + Q D  + D+KGFKGH+MLAPFTAGWQ+TDL+PLVIE+SEGSYVYD+NGKKY
Sbjct  51   RWNSTEAAAQKDVSAIDDKGFKGHEMLAPFTAGWQSTDLNPLVIERSEGSYVYDVNGKKY  110

Query  479  LDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKM  658
            LD+LAGLW TALGGNEPRL+ AA KQLNTLPFYHSFWNRTTKPSLDLAKEL++ FT + M
Sbjct  111  LDALAGLWSTALGGNEPRLIAAAAKQLNTLPFYHSFWNRTTKPSLDLAKELIELFTPSTM  170

Query  659  AKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            +KAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAR KSYHGS
Sbjct  171  SKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIARSKSYHGS  215



>ref|XP_002445207.1| hypothetical protein SORBIDRAFT_07g005930 [Sorghum bicolor]
 gb|EES14702.1| hypothetical protein SORBIDRAFT_07g005930 [Sorghum bicolor]
Length=509

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 164/203 (81%), Gaps = 5/203 (2%)
 Frame = +2

Query  194  LLGHTLKR---ATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKGFK  364
            ++   L+R   A++QV   VK++ +     G      SP R  S++ S+Q  +T+E GFK
Sbjct  1    MIAQGLRRSSAASSQVSRLVKYIASAGRLQGGHSFSESPARCYSSEPSLQ--ATEENGFK  58

Query  365  GHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDA  544
            GH MLAPFTAGWQ+TDLHPLVIE+SEGSYVYDINGKKY+D+LAGLWCTALGGNEPRLV A
Sbjct  59   GHSMLAPFTAGWQSTDLHPLVIERSEGSYVYDINGKKYIDALAGLWCTALGGNEPRLVKA  118

Query  545  AMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWY  724
            A +QL+ LPFYHSFWNRTTKPSLDLA E+L  FTA +M K FFTNSGSEAND+QVKLVWY
Sbjct  119  ATEQLHKLPFYHSFWNRTTKPSLDLANEILSMFTAREMGKVFFTNSGSEANDSQVKLVWY  178

Query  725  YNNALGRPNKKKFIAREKSYHGS  793
            YNNALGRP+KKKFIAR KSYHGS
Sbjct  179  YNNALGRPDKKKFIARSKSYHGS  201



>ref|XP_010260596.1| PREDICTED: probable gamma-aminobutyrate transaminase 3, mitochondrial 
[Nelumbo nucifera]
Length=517

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/168 (82%), Positives = 147/168 (88%), Gaps = 5/168 (3%)
 Frame = +2

Query  305  RWSSAQVSVQNDST-----DEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDING  469
            RW+S + S+Q +       D KGFKGHDMLAPFTAGWQ+ DLHPLVIEKSEG YVYDING
Sbjct  40   RWNSTEASLQKEGQTPELKDGKGFKGHDMLAPFTAGWQSNDLHPLVIEKSEGCYVYDING  99

Query  470  KKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTA  649
             K+LDSLAGLWCTALGGNEPRLV AA KQL+TLPFYHSFWNRTTKPSLDLAK++L+ FTA
Sbjct  100  NKFLDSLAGLWCTALGGNEPRLVAAATKQLDTLPFYHSFWNRTTKPSLDLAKDILEIFTA  159

Query  650  NKMAKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
             KM K FFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAR KSYHGS
Sbjct  160  RKMGKVFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIARAKSYHGS  207



>ref|XP_006659928.1| PREDICTED: probable gamma-aminobutyrate transaminase 3, mitochondrial-like 
[Oryza brachyantha]
Length=537

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/165 (81%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  299  PTRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKY  478
            P R+ S++ S+Q DST+E GFKGH MLAPFTAGWQ+TDLHPLVIE+SEGSYVYDINGKKY
Sbjct  65   PARYFSSEPSLQVDSTEENGFKGHGMLAPFTAGWQSTDLHPLVIERSEGSYVYDINGKKY  124

Query  479  LDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKM  658
            +D+LAGLW TALGGNEPRL+ AA  QLN LPFYHSFWNRTTKPSLDLA E+L  FTA +M
Sbjct  125  IDALAGLWSTALGGNEPRLIKAATDQLNKLPFYHSFWNRTTKPSLDLANEILMMFTAREM  184

Query  659  AKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
             K FFTNSGSEAND+QVKLVWYYNNALGRPNKKKFIAR KSYHGS
Sbjct  185  GKVFFTNSGSEANDSQVKLVWYYNNALGRPNKKKFIARSKSYHGS  229



>ref|XP_011004456.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
[Populus euphratica]
Length=514

 Score =   290 bits (743),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 170/206 (83%), Gaps = 5/206 (2%)
 Frame = +2

Query  182  MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQ-NDST-DEK  355
            +I++LL  TLK   +Q+ S  K+  A   S   ++R     R  S + S+Q  DST D  
Sbjct  2    VISKLLRSTLK---SQLRSCTKNGTASGSSQEHLLRAPFLARLYSTKASLQKEDSTIDGN  58

Query  356  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  535
             FKGHDMLAPFTAGWQ++DL+PLVIEKSEGSYVYDINGKKYLD+LAGLWCTALGGNEP L
Sbjct  59   SFKGHDMLAPFTAGWQSSDLNPLVIEKSEGSYVYDINGKKYLDALAGLWCTALGGNEPWL  118

Query  536  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKL  715
            V AA +QLN LPFYHSFWNRTTKPSLDLAKELL+TFTA+KMAKAFFTNSGSEANDTQVKL
Sbjct  119  VAAATEQLNKLPFYHSFWNRTTKPSLDLAKELLETFTASKMAKAFFTNSGSEANDTQVKL  178

Query  716  VWYYNNALGRPNKKKFIAREKSYHGS  793
            VWYYNNALGRPNKKKFIAR KSYHGS
Sbjct  179  VWYYNNALGRPNKKKFIARAKSYHGS  204



>ref|XP_004972609.1| PREDICTED: probable gamma-aminobutyrate transaminase 3, mitochondrial-like 
[Setaria italica]
Length=509

 Score =   290 bits (742),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 162/204 (79%), Gaps = 3/204 (1%)
 Frame = +2

Query  182  MINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKGF  361
            MI R L  +   A +Q    VK++ +     G+      P R+ S++ S++   T+E GF
Sbjct  1    MIARGLFRS-NAAASQFSRLVKYVASAGSLQGTHNFAEIPARYYSSEPSLKE--TEENGF  57

Query  362  KGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVD  541
            KGH MLAPFTAGWQ+TDLHPLVIE+SEGSYVYDINGKKY+D+LAGLWCTALGGNEPRL+ 
Sbjct  58   KGHSMLAPFTAGWQSTDLHPLVIERSEGSYVYDINGKKYIDALAGLWCTALGGNEPRLIK  117

Query  542  AAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVW  721
            AA +QLN LPFYHSFWNRTTKPSLDLA E+L  FTA +M K FFTNSGSEAND+QVKLVW
Sbjct  118  AATEQLNKLPFYHSFWNRTTKPSLDLANEILSMFTAREMGKVFFTNSGSEANDSQVKLVW  177

Query  722  YYNNALGRPNKKKFIAREKSYHGS  793
            YYNNALGRPNKKKFIAR KSYHGS
Sbjct  178  YYNNALGRPNKKKFIARSKSYHGS  201



>ref|XP_008378345.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
isoform X1 [Malus domestica]
Length=521

 Score =   290 bits (742),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 149/167 (89%), Gaps = 4/167 (2%)
 Frame = +2

Query  305  RWSSAQVSVQND--STDEKG--FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGK  472
            R  S   SVQ +  +T EKG  FKGHDMLAPFT GWQ+TDLHPL+IEKSEGSY YD NGK
Sbjct  47   RSYSTGSSVQKEEPTTVEKGLGFKGHDMLAPFTPGWQSTDLHPLIIEKSEGSYAYDSNGK  106

Query  473  KYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAN  652
            KYLD+LAGLWCTALGGNEPRLV AA KQLNTLPFYHSFWNRTT+PSLDLAKELL+TFTA 
Sbjct  107  KYLDALAGLWCTALGGNEPRLVAAATKQLNTLPFYHSFWNRTTRPSLDLAKELLETFTAT  166

Query  653  KMAKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            KMAKAFFTNSGSEANDTQVKLVWYYNNALGRP+KKKFIAR KSYHGS
Sbjct  167  KMAKAFFTNSGSEANDTQVKLVWYYNNALGRPDKKKFIARHKSYHGS  213



>ref|NP_001280788.1| gamma aminobutyrate transaminase 3, chloroplastic [Malus domestica]
 gb|AFS28621.1| gamma-aminobutyrate transaminase 2 [Malus domestica]
Length=514

 Score =   290 bits (741),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 141/167 (84%), Positives = 149/167 (89%), Gaps = 4/167 (2%)
 Frame = +2

Query  305  RWSSAQVSVQND--STDEKG--FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGK  472
            R  S   SVQ +  +T EKG  FKGHDMLAPFT GWQ+TDLHPL+IEKSEGSY YD NGK
Sbjct  40   RSYSTGSSVQKEEPTTVEKGLGFKGHDMLAPFTPGWQSTDLHPLIIEKSEGSYAYDSNGK  99

Query  473  KYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTAN  652
            KYLD+LAGLWCTALGGNEPRLV AA KQLNTLPFYHSFWNRTT+PSLDLAKELL+TFTA 
Sbjct  100  KYLDALAGLWCTALGGNEPRLVAAATKQLNTLPFYHSFWNRTTRPSLDLAKELLETFTAT  159

Query  653  KMAKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            KMAKAFFTNSGSEANDTQVKLVWYYNNALGRP+KKKFIAR KSYHGS
Sbjct  160  KMAKAFFTNSGSEANDTQVKLVWYYNNALGRPDKKKFIARHKSYHGS  206



>ref|XP_004303943.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
isoform X1 [Fragaria vesca subsp. vesca]
Length=506

 Score =   289 bits (739),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 165/203 (81%), Gaps = 7/203 (3%)
 Frame = +2

Query  185  INRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKGFK  364
            INRL+   L   T Q+GS +K++ A   S   +    S  R      ++Q+    E GFK
Sbjct  3    INRLVRSNL---TTQLGSCIKYVAASRSSQERLFSAPSIARVYGTSATLQS----EDGFK  55

Query  365  GHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDA  544
            GHDMLAPFT+G  ++D+HPL+IEKSEGSYVYD+NGKKYLD+LAGLWCTALGGNEPRLV+A
Sbjct  56   GHDMLAPFTSGSLSSDVHPLLIEKSEGSYVYDVNGKKYLDALAGLWCTALGGNEPRLVEA  115

Query  545  AMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWY  724
            A +QLNTLPFYHSFWNRTT+PSLDLAK+LL+TFTA KM KAFFTNSGSEANDTQVKLVWY
Sbjct  116  ATRQLNTLPFYHSFWNRTTRPSLDLAKDLLETFTATKMGKAFFTNSGSEANDTQVKLVWY  175

Query  725  YNNALGRPNKKKFIAREKSYHGS  793
            YNNALGRP+KKKFIAR KSYHGS
Sbjct  176  YNNALGRPDKKKFIARLKSYHGS  198



>ref|XP_002521054.1| aminobutyrate aminotransferase, putative [Ricinus communis]
 gb|EEF41338.1| aminobutyrate aminotransferase, putative [Ricinus communis]
Length=528

 Score =   290 bits (741),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 150/209 (72%), Positives = 161/209 (77%), Gaps = 16/209 (8%)
 Frame = +2

Query  215  RATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDST----------------  346
            R   ++GS VKH  A   S   + +  S TR  S++  VQ +S                 
Sbjct  10   RIGFELGSCVKHANASGTSQKHLFQTASLTRLYSSEGFVQRESDNGGSSILRPATVADNF  69

Query  347  DEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  526
            D   +KGHDMLAPFTAGWQ+TDL PLVIEKSEGSYVYDING KYLDSLAGLWCTALGGNE
Sbjct  70   DNCSYKGHDMLAPFTAGWQSTDLDPLVIEKSEGSYVYDINGNKYLDSLAGLWCTALGGNE  129

Query  527  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQ  706
            PRLV AA +QLN LPFYHSFWNRTTKPSLDLAKELL+TFTA KMAKAFFTNSGSEANDTQ
Sbjct  130  PRLVAAATEQLNKLPFYHSFWNRTTKPSLDLAKELLETFTARKMAKAFFTNSGSEANDTQ  189

Query  707  VKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            VKLVWYYNNALGRPNKKKFIAR KSYHGS
Sbjct  190  VKLVWYYNNALGRPNKKKFIARAKSYHGS  218



>ref|XP_010234450.1| PREDICTED: probable gamma-aminobutyrate transaminase 3, mitochondrial 
isoform X1 [Brachypodium distachyon]
Length=519

 Score =   288 bits (737),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  299  PTRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKY  478
            P R+ S++ S+Q DST+E GFKGH MLAPFTAGWQ+TD+HPLVI++SEG+Y YDINGKKY
Sbjct  47   PARYFSSEPSLQPDSTEEIGFKGHSMLAPFTAGWQSTDVHPLVIDRSEGAYAYDINGKKY  106

Query  479  LDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKM  658
            +D+LAGLWCTALGGNEPRLV AA  QLN LPFYHSFWNRTTKPSLDLA ++L+ FTA +M
Sbjct  107  IDALAGLWCTALGGNEPRLVKAATDQLNKLPFYHSFWNRTTKPSLDLANDILNMFTAREM  166

Query  659  AKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
             K FFTNSGSEAND+QVKLVWYYNNALGRP KKKFIAR KSYHGS
Sbjct  167  GKVFFTNSGSEANDSQVKLVWYYNNALGRPKKKKFIARSKSYHGS  211



>ref|XP_003573535.1| PREDICTED: probable gamma-aminobutyrate transaminase 3, mitochondrial 
isoform X2 [Brachypodium distachyon]
Length=515

 Score =   288 bits (736),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 130/165 (79%), Positives = 147/165 (89%), Gaps = 0/165 (0%)
 Frame = +2

Query  299  PTRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKY  478
            P R+ S++ S+Q DST+E GFKGH MLAPFTAGWQ+TD+HPLVI++SEG+Y YDINGKKY
Sbjct  43   PARYFSSEPSLQPDSTEEIGFKGHSMLAPFTAGWQSTDVHPLVIDRSEGAYAYDINGKKY  102

Query  479  LDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKM  658
            +D+LAGLWCTALGGNEPRLV AA  QLN LPFYHSFWNRTTKPSLDLA ++L+ FTA +M
Sbjct  103  IDALAGLWCTALGGNEPRLVKAATDQLNKLPFYHSFWNRTTKPSLDLANDILNMFTAREM  162

Query  659  AKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
             K FFTNSGSEAND+QVKLVWYYNNALGRP KKKFIAR KSYHGS
Sbjct  163  GKVFFTNSGSEANDSQVKLVWYYNNALGRPKKKKFIARSKSYHGS  207



>dbj|BAK05511.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=511

 Score =   287 bits (735),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = +2

Query  302  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  481
             R  S+  S Q +STDE GFKGH MLAPFTAGWQ+ D+HPLVIE+SEGSYVYDING KYL
Sbjct  40   VRHFSSASSPQTNSTDENGFKGHGMLAPFTAGWQSNDVHPLVIERSEGSYVYDINGNKYL  99

Query  482  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  661
            DSLAGLWCTALGG+EPRLV AA  QLN LPFYHSFWNRTTKP+LDLA +LL  FTANKM 
Sbjct  100  DSLAGLWCTALGGSEPRLVKAATDQLNKLPFYHSFWNRTTKPTLDLADDLLSMFTANKMG  159

Query  662  KAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            KAFFTNSGSEAND+QVKLVWYYNNALGRPNKKKFIAR K+YHGS
Sbjct  160  KAFFTNSGSEANDSQVKLVWYYNNALGRPNKKKFIARTKAYHGS  203



>gb|AFW59441.1| putative aminotransferase class III superfamily protein [Zea 
mays]
Length=447

 Score =   285 bits (729),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = +2

Query  302  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  481
             R  S+  S Q+D+T+E GFKGH MLAPFTAGWQ+ DLHPL+IE+SEGSYVYDING KYL
Sbjct  41   VRHFSSAPSAQSDTTEENGFKGHGMLAPFTAGWQSNDLHPLIIERSEGSYVYDINGNKYL  100

Query  482  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  661
            DSLAGLWCTALGG+EPRLV AA +QLN LPFYHSFWNRTTKPSLDLA+E+L  FTA +M 
Sbjct  101  DSLAGLWCTALGGSEPRLVKAATEQLNNLPFYHSFWNRTTKPSLDLAQEILSMFTAREMG  160

Query  662  KAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            K FFTNSGSEAND+QVKLVWYYNNALGRP+KKKFIAR K+YHGS
Sbjct  161  KVFFTNSGSEANDSQVKLVWYYNNALGRPDKKKFIARSKAYHGS  204



>ref|NP_001053863.1| Os04g0614600 [Oryza sativa Japonica Group]
 sp|Q7XN11.2|GATP1_ORYSJ RecName: Full=Gamma-aminobutyrate transaminase 1, mitochondrial; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|AAQ14479.1|AF297651_1 putative aminotransferase [Oryza sativa]
 emb|CAE04333.2| OSJNBa0008M17.4 [Oryza sativa Japonica Group]
 dbj|BAF15777.1| Os04g0614600 [Oryza sativa Japonica Group]
 dbj|BAG95492.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61676.1| hypothetical protein OsJ_16145 [Oryza sativa Japonica Group]
Length=516

 Score =   286 bits (732),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +2

Query  302  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  481
            TR  S+  S Q +ST+E GFKGH MLAPFTAGWQ+TD+HPLVIE+SEGSYVYDI+GKKYL
Sbjct  44   TRHFSSVPSPQYNSTEENGFKGHGMLAPFTAGWQSTDVHPLVIERSEGSYVYDIDGKKYL  103

Query  482  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  661
            DSLAGLWCTALGG+EPRLV AA +QL+ LPFYHSFWNRTTKPSLDLAKELL  FTA +M 
Sbjct  104  DSLAGLWCTALGGSEPRLVKAATEQLHKLPFYHSFWNRTTKPSLDLAKELLSMFTAREMG  163

Query  662  KAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            K FFTNSGSEAND+QVKLVWYYNNALGRP+KKKFIAR KSYHGS
Sbjct  164  KVFFTNSGSEANDSQVKLVWYYNNALGRPDKKKFIARSKSYHGS  207



>gb|EEC77995.1| hypothetical protein OsI_17385 [Oryza sativa Indica Group]
Length=496

 Score =   285 bits (730),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +2

Query  302  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  481
            TR  S+  S Q++ST+E GFKGH MLAPFTAGWQ+TD+HPLVIE+SEGSYVYDI+GKKYL
Sbjct  47   TRHFSSVPSPQSNSTEENGFKGHGMLAPFTAGWQSTDVHPLVIERSEGSYVYDIDGKKYL  106

Query  482  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  661
            DSLAGLWCTALGG+EPRL  AA +QL+ LPFYHSFWNRTTKPSLDLAKELL  FTA +M 
Sbjct  107  DSLAGLWCTALGGSEPRLAKAATEQLHKLPFYHSFWNRTTKPSLDLAKELLSMFTAREMG  166

Query  662  KAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            K FFTNSGSEAND+QVKLVWYYNNALGRP+KKKFIAR KSYHGS
Sbjct  167  KVFFTNSGSEANDSQVKLVWYYNNALGRPDKKKFIARSKSYHGS  210



>ref|XP_004147736.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
[Cucumis sativus]
 gb|KGN53495.1| hypothetical protein Csa_4G056830 [Cucumis sativus]
Length=507

 Score =   285 bits (730),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 166/205 (81%), Gaps = 9/205 (4%)
 Frame = +2

Query  185  INRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsP--TRWSSAQVSVQNDSTDEKG  358
            IN+LL  TL+   +Q+G+  K + + SG         +P  +R  S Q S Q +   + G
Sbjct  3    INQLLRSTLR---SQLGTFAKTVIS-SGRASQEHAILAPFLSRLHSTQASAQKE---DSG  55

Query  359  FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  538
            FKGHDMLAPFTAGWQTTD++PL+IE+SEGSYVYDI+G+KYLDSLAGLWCT+LGGNE RLV
Sbjct  56   FKGHDMLAPFTAGWQTTDVNPLIIERSEGSYVYDIDGRKYLDSLAGLWCTSLGGNESRLV  115

Query  539  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLV  718
             AAMKQLNTLPFYHSFWNRTT+PSLDLAK+LL+ FTA KM K FF NSGSEANDTQVKLV
Sbjct  116  AAAMKQLNTLPFYHSFWNRTTRPSLDLAKDLLEMFTARKMGKVFFVNSGSEANDTQVKLV  175

Query  719  WYYNNALGRPNKKKFIAREKSYHGS  793
            WYYNNALGRP+KKKFIAR KSYHGS
Sbjct  176  WYYNNALGRPDKKKFIARSKSYHGS  200



>ref|NP_001152508.1| aminotransferase y4uB [Zea mays]
 gb|ACG47973.1| aminotransferase y4uB [Zea mays]
Length=514

 Score =   285 bits (730),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = +2

Query  302  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  481
             R  S+  S Q+D+T+E GFKGH MLAPFTAGWQ+ DLHPL+IE+SEGSYVYDING KYL
Sbjct  41   VRHFSSAPSAQSDTTEENGFKGHGMLAPFTAGWQSNDLHPLIIERSEGSYVYDINGNKYL  100

Query  482  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  661
            DSLAGLWCTALGG+EPRLV AA +QLN LPFYHSFWNRTTKPSLDLA+E+L  FTA +M 
Sbjct  101  DSLAGLWCTALGGSEPRLVKAATEQLNNLPFYHSFWNRTTKPSLDLAQEILSMFTAREMG  160

Query  662  KAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            K FFTNSGSEAND+QVKLVWYYNNALGRP+KKKFIAR K+YHGS
Sbjct  161  KVFFTNSGSEANDSQVKLVWYYNNALGRPDKKKFIARSKAYHGS  204



>sp|Q01K11.1|GATP1_ORYSI RecName: Full=Gamma-aminobutyrate transaminase 1, mitochondrial; 
Flags: Precursor [Oryza sativa Indica Group]
 emb|CAH66914.1| OSIGBa0126B18.7 [Oryza sativa Indica Group]
Length=516

 Score =   285 bits (730),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +2

Query  302  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  481
            TR  S+  S Q++ST+E GFKGH MLAPFTAGWQ+TD+HPLVIE+SEGSYVYDI+GKKYL
Sbjct  44   TRHFSSVPSPQSNSTEENGFKGHGMLAPFTAGWQSTDVHPLVIERSEGSYVYDIDGKKYL  103

Query  482  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  661
            DSLAGLWCTALGG+EPRL  AA +QL+ LPFYHSFWNRTTKPSLDLAKELL  FTA +M 
Sbjct  104  DSLAGLWCTALGGSEPRLAKAATEQLHKLPFYHSFWNRTTKPSLDLAKELLSMFTAREMG  163

Query  662  KAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            K FFTNSGSEAND+QVKLVWYYNNALGRP+KKKFIAR KSYHGS
Sbjct  164  KVFFTNSGSEANDSQVKLVWYYNNALGRPDKKKFIARSKSYHGS  207



>gb|ACF87978.1| unknown [Zea mays]
 gb|AFW59440.1| putative aminotransferase class III superfamily protein [Zea 
mays]
Length=514

 Score =   285 bits (730),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = +2

Query  302  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  481
             R  S+  S Q+D+T+E GFKGH MLAPFTAGWQ+ DLHPL+IE+SEGSYVYDING KYL
Sbjct  41   VRHFSSAPSAQSDTTEENGFKGHGMLAPFTAGWQSNDLHPLIIERSEGSYVYDINGNKYL  100

Query  482  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  661
            DSLAGLWCTALGG+EPRLV AA +QLN LPFYHSFWNRTTKPSLDLA+E+L  FTA +M 
Sbjct  101  DSLAGLWCTALGGSEPRLVKAATEQLNNLPFYHSFWNRTTKPSLDLAQEILSMFTAREMG  160

Query  662  KAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            K FFTNSGSEAND+QVKLVWYYNNALGRP+KKKFIAR K+YHGS
Sbjct  161  KVFFTNSGSEANDSQVKLVWYYNNALGRPDKKKFIARSKAYHGS  204



>ref|XP_006652817.1| PREDICTED: gamma-aminobutyrate transaminase 1, mitochondrial-like 
[Oryza brachyantha]
Length=513

 Score =   285 bits (730),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = +2

Query  302  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  481
            +R  S+  S Q++ST+E GFKGH MLAPFTAGWQ+TD+HPLVIE+SEGSYVYDI GKKYL
Sbjct  41   SRHFSSVPSPQSNSTEENGFKGHGMLAPFTAGWQSTDVHPLVIERSEGSYVYDIEGKKYL  100

Query  482  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  661
            DSLAGLWCTALGG+EPRLV AA +QL+ LPFYHSFWNRTTKPSLDLAKE+L  FTA +M 
Sbjct  101  DSLAGLWCTALGGSEPRLVKAATEQLHKLPFYHSFWNRTTKPSLDLAKEMLSIFTAREMG  160

Query  662  KAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            K FFTNSGSEAND+QVKLVWYYNNALGRP+KKKFIAR KSYHGS
Sbjct  161  KVFFTNSGSEANDSQVKLVWYYNNALGRPDKKKFIARSKSYHGS  204



>ref|XP_004976801.1| PREDICTED: gamma-aminobutyrate transaminase 1, mitochondrial-like 
[Setaria italica]
Length=512

 Score =   285 bits (728),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = +2

Query  302  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  481
             R  S+  S Q+DST+E GFKGH MLAPFTAGWQ+ +LHPL+IE+SEGSYVYDING KYL
Sbjct  41   VRHFSSAPSAQSDSTEENGFKGHGMLAPFTAGWQSNELHPLIIERSEGSYVYDINGNKYL  100

Query  482  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  661
            DSLAGLWCTALGG+EPRLV AA  QLN LPFYHSFWNRTT+PSLDLA+E+L  FTA +M 
Sbjct  101  DSLAGLWCTALGGSEPRLVKAATDQLNKLPFYHSFWNRTTRPSLDLAQEILSMFTAREMG  160

Query  662  KAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            K FFTNSGSEAND+QVKLVWYYNNALGRPNKKKFIAR K+YHGS
Sbjct  161  KVFFTNSGSEANDSQVKLVWYYNNALGRPNKKKFIARTKAYHGS  204



>ref|XP_006592029.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
isoform X1 [Glycine max]
Length=513

 Score =   283 bits (725),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = +2

Query  302  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  481
            T  S A+ +  ND  + +GFKGH MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL
Sbjct  42   TEASLAKDTSSNDVKNGQGFKGHSMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  101

Query  482  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  661
            D+LAGLW T+LGG+EPRLVDAA+ QL  LPFYHSFWNRTT PSLDLAKELL+ FTA KM 
Sbjct  102  DALAGLWATSLGGSEPRLVDAAIAQLKKLPFYHSFWNRTTLPSLDLAKELLEMFTARKMG  161

Query  662  KAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            KAFF NSGSEANDTQVKLVWYYNNALGRP+KKKFIAR KSYHGS
Sbjct  162  KAFFVNSGSEANDTQVKLVWYYNNALGRPDKKKFIARAKSYHGS  205



>ref|XP_008677242.1| PREDICTED: aminotransferase y4uB isoform X1 [Zea mays]
Length=484

 Score =   282 bits (722),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 156/192 (81%), Gaps = 2/192 (1%)
 Frame = +2

Query  218  ATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAG  397
            A++QV   VK++ +     G         R  S++ S+Q  +T+E GFKGH MLAPFTAG
Sbjct  12   ASSQVSKLVKYIASAGSLQGGHSLSEPSARHYSSEPSLQ--ATEENGFKGHSMLAPFTAG  69

Query  398  WQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFY  577
            WQ+TD+HPLVIE+SEGSYVYD NGKKY+D+LAGLWCTALGGNEPRLV AA +QLN LPFY
Sbjct  70   WQSTDVHPLVIERSEGSYVYDSNGKKYIDALAGLWCTALGGNEPRLVKAATEQLNKLPFY  129

Query  578  HSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNALGRPNKK  757
            HSFWNRTTKPSLDLA ++L  FTA +M K FFTNSGSEAND+QVKLVWYYNNALGRP+KK
Sbjct  130  HSFWNRTTKPSLDLANDILSMFTAREMGKVFFTNSGSEANDSQVKLVWYYNNALGRPDKK  189

Query  758  KFIAREKSYHGS  793
            KFIAR KSYHGS
Sbjct  190  KFIARSKSYHGS  201



>emb|CDY58748.1| BnaCnng33690D [Brassica napus]
Length=498

 Score =   282 bits (722),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 138/146 (95%), Gaps = 0/146 (0%)
 Frame = +2

Query  356  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  535
            G KGHDMLAPFTAGWQ+ DLHPL+I KSEGSYVYD +GKKYLDSLAGLWCTALGGNEPRL
Sbjct  43   GSKGHDMLAPFTAGWQSADLHPLIIAKSEGSYVYDDHGKKYLDSLAGLWCTALGGNEPRL  102

Query  536  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKL  715
            V AA++QL TLPFYHSFWNRTTKPSLDLAK+LLD FTANKMAKAFFTNSGSEANDTQVKL
Sbjct  103  VSAAVEQLKTLPFYHSFWNRTTKPSLDLAKDLLDMFTANKMAKAFFTNSGSEANDTQVKL  162

Query  716  VWYYNNALGRPNKKKFIAREKSYHGS  793
            VWYYNNALGRP KKKFIAR+KSYHGS
Sbjct  163  VWYYNNALGRPEKKKFIARKKSYHGS  188



>gb|AFW61008.1| putative aminotransferase class III superfamily protein [Zea 
mays]
Length=493

 Score =   282 bits (722),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 156/192 (81%), Gaps = 2/192 (1%)
 Frame = +2

Query  218  ATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAG  397
            A++QV   VK++ +     G         R  S++ S+Q  +T+E GFKGH MLAPFTAG
Sbjct  12   ASSQVSKLVKYIASAGSLQGGHSLSEPSARHYSSEPSLQ--ATEENGFKGHSMLAPFTAG  69

Query  398  WQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFY  577
            WQ+TD+HPLVIE+SEGSYVYD NGKKY+D+LAGLWCTALGGNEPRLV AA +QLN LPFY
Sbjct  70   WQSTDVHPLVIERSEGSYVYDSNGKKYIDALAGLWCTALGGNEPRLVKAATEQLNKLPFY  129

Query  578  HSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNALGRPNKK  757
            HSFWNRTTKPSLDLA ++L  FTA +M K FFTNSGSEAND+QVKLVWYYNNALGRP+KK
Sbjct  130  HSFWNRTTKPSLDLANDILSMFTAREMGKVFFTNSGSEANDSQVKLVWYYNNALGRPDKK  189

Query  758  KFIAREKSYHGS  793
            KFIAR KSYHGS
Sbjct  190  KFIARSKSYHGS  201



>gb|AFW61009.1| putative aminotransferase class III superfamily protein [Zea 
mays]
Length=509

 Score =   283 bits (723),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 156/192 (81%), Gaps = 2/192 (1%)
 Frame = +2

Query  218  ATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAG  397
            A++QV   VK++ +     G         R  S++ S+Q  +T+E GFKGH MLAPFTAG
Sbjct  12   ASSQVSKLVKYIASAGSLQGGHSLSEPSARHYSSEPSLQ--ATEENGFKGHSMLAPFTAG  69

Query  398  WQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFY  577
            WQ+TD+HPLVIE+SEGSYVYD NGKKY+D+LAGLWCTALGGNEPRLV AA +QLN LPFY
Sbjct  70   WQSTDVHPLVIERSEGSYVYDSNGKKYIDALAGLWCTALGGNEPRLVKAATEQLNKLPFY  129

Query  578  HSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNALGRPNKK  757
            HSFWNRTTKPSLDLA ++L  FTA +M K FFTNSGSEAND+QVKLVWYYNNALGRP+KK
Sbjct  130  HSFWNRTTKPSLDLANDILSMFTAREMGKVFFTNSGSEANDSQVKLVWYYNNALGRPDKK  189

Query  758  KFIAREKSYHGS  793
            KFIAR KSYHGS
Sbjct  190  KFIARSKSYHGS  201



>dbj|BAI66419.1| aminotransferase [Triticum aestivum]
Length=511

 Score =   282 bits (721),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = +2

Query  302  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  481
             R  S+  S Q +ST+E GFKGH MLAPFTAGWQ+ D+HPLVIE+SEGSYVYDING KYL
Sbjct  40   VRHFSSASSPQTNSTEENGFKGHGMLAPFTAGWQSNDVHPLVIERSEGSYVYDINGNKYL  99

Query  482  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  661
            DSLAGLWCTALGG+EPRLV AA  QLN LPFYHSFWNRTTKP+LDLA +LL  FTA+KM 
Sbjct  100  DSLAGLWCTALGGSEPRLVKAATDQLNKLPFYHSFWNRTTKPTLDLADDLLSMFTASKMG  159

Query  662  KAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            KAFFTNSGSEAND+ VKLVWYYNNALGRPNKKKFIAR K+YHGS
Sbjct  160  KAFFTNSGSEANDSHVKLVWYYNNALGRPNKKKFIARSKAYHGS  203



>gb|KHN05488.1| Putative aminotransferase y4uB [Glycine soja]
Length=513

 Score =   282 bits (721),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 133/164 (81%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = +2

Query  302  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  481
            T  S A+ +  ND  + +GFKGH MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL
Sbjct  42   TEASLAKDTSSNDVKNGQGFKGHSMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  101

Query  482  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  661
            D+LAGLW T+LGG+EPRLVDAA+ QL  LPFYHSFWNRTT PSLDLAKELL+ FTA KM 
Sbjct  102  DALAGLWATSLGGSEPRLVDAAIAQLKKLPFYHSFWNRTTLPSLDLAKELLEMFTARKMG  161

Query  662  KAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            KAFF NSGS+ANDTQVKLVWYYNNALGRP+KKKFIAR KSYHGS
Sbjct  162  KAFFVNSGSKANDTQVKLVWYYNNALGRPDKKKFIARAKSYHGS  205



>ref|XP_003580544.1| PREDICTED: gamma-aminobutyrate transaminase 1, mitochondrial 
[Brachypodium distachyon]
Length=515

 Score =   281 bits (720),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 144/163 (88%), Gaps = 0/163 (0%)
 Frame = +2

Query  305  RWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLD  484
            R  S+  S Q++ST+E GFKGH MLAPFTAGWQ+ D+HPLVIE+SEGSYVYD NG KYLD
Sbjct  45   RHFSSAPSPQSNSTEENGFKGHGMLAPFTAGWQSNDVHPLVIERSEGSYVYDTNGNKYLD  104

Query  485  SLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAK  664
            SLAGLWCTALGG+EPRLV AA +QLN LPFYHSFWNRTTKP+LDLA +LL  FTA KM K
Sbjct  105  SLAGLWCTALGGSEPRLVKAATEQLNKLPFYHSFWNRTTKPTLDLAGDLLSMFTARKMGK  164

Query  665  AFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            AFFTNSGSEAND+QVKLVWYYNNALGRPNKKKFIAR K+YHGS
Sbjct  165  AFFTNSGSEANDSQVKLVWYYNNALGRPNKKKFIARSKAYHGS  207



>ref|NP_001148620.1| aminotransferase y4uB [Zea mays]
 gb|ACG32262.1| aminotransferase y4uB [Zea mays]
Length=509

 Score =   281 bits (720),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 156/192 (81%), Gaps = 2/192 (1%)
 Frame = +2

Query  218  ATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAG  397
            A++QV   VK++ +     G         R  S++ S+Q  +T+E GFKGH MLAPFTAG
Sbjct  12   ASSQVSKLVKYIASAGSLQGGHSLSEPSARHYSSEPSLQ--ATEENGFKGHSMLAPFTAG  69

Query  398  WQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFY  577
            WQ+TD+HPLVIE+SEGSYVYD NGKKY+D+LAGLWCTALGGNEPRLV AA +QLN LPFY
Sbjct  70   WQSTDVHPLVIERSEGSYVYDSNGKKYIDALAGLWCTALGGNEPRLVKAATEQLNKLPFY  129

Query  578  HSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNALGRPNKK  757
            HSFWNRTTKPSLDLA ++L  FTA +M K FFTNSGSE+ND+QVKLVWYYNNALGRP+KK
Sbjct  130  HSFWNRTTKPSLDLANDILSMFTAREMGKVFFTNSGSESNDSQVKLVWYYNNALGRPDKK  189

Query  758  KFIAREKSYHGS  793
            KFIAR KSYHGS
Sbjct  190  KFIARSKSYHGS  201



>ref|XP_006406200.1| hypothetical protein EUTSA_v10020563mg [Eutrema salsugineum]
 gb|ESQ47653.1| hypothetical protein EUTSA_v10020563mg [Eutrema salsugineum]
Length=503

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +2

Query  356  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  535
            G KGHDMLAPFTAGWQ+ DLHPL+I KSEGSYVYD +G KYLDSLAGLWCTALGGNEPRL
Sbjct  48   GSKGHDMLAPFTAGWQSADLHPLIIAKSEGSYVYDDHGTKYLDSLAGLWCTALGGNEPRL  107

Query  536  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKL  715
            V AAM+QLNTLPFYHSFWNRTTKPSLDLAK+LL  FTANKMAKAFFTNSGSEANDTQVKL
Sbjct  108  VSAAMEQLNTLPFYHSFWNRTTKPSLDLAKDLLGMFTANKMAKAFFTNSGSEANDTQVKL  167

Query  716  VWYYNNALGRPNKKKFIAREKSYHGS  793
            VWYYNNALGRP KKKFIAR KSYHGS
Sbjct  168  VWYYNNALGRPEKKKFIARNKSYHGS  193



>ref|XP_008451896.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
isoform X2 [Cucumis melo]
Length=507

 Score =   280 bits (717),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 144/164 (88%), Gaps = 3/164 (2%)
 Frame = +2

Query  302  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  481
            +R  S Q S Q +   + GFKGHDMLAPFTAGWQTTD++PL+IE+SEGSYVYDI+G+KYL
Sbjct  40   SRLHSTQASAQKE---DSGFKGHDMLAPFTAGWQTTDVNPLIIERSEGSYVYDIDGRKYL  96

Query  482  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  661
            DSLAGLWCT+LGGNE RLV AA  QLNTLPFYHSFWNRTT+PSLDLAKELL+ FTA KM 
Sbjct  97   DSLAGLWCTSLGGNESRLVAAATAQLNTLPFYHSFWNRTTRPSLDLAKELLEMFTARKMG  156

Query  662  KAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            K FF NSGSEANDTQVKLVWYYNNALGRP+KKKFIAR K+YHGS
Sbjct  157  KVFFVNSGSEANDTQVKLVWYYNNALGRPDKKKFIARSKAYHGS  200



>ref|XP_008451895.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
isoform X1 [Cucumis melo]
Length=515

 Score =   280 bits (717),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 144/164 (88%), Gaps = 3/164 (2%)
 Frame = +2

Query  302  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  481
            +R  S Q S Q +   + GFKGHDMLAPFTAGWQTTD++PL+IE+SEGSYVYDI+G+KYL
Sbjct  48   SRLHSTQASAQKE---DSGFKGHDMLAPFTAGWQTTDVNPLIIERSEGSYVYDIDGRKYL  104

Query  482  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  661
            DSLAGLWCT+LGGNE RLV AA  QLNTLPFYHSFWNRTT+PSLDLAKELL+ FTA KM 
Sbjct  105  DSLAGLWCTSLGGNESRLVAAATAQLNTLPFYHSFWNRTTRPSLDLAKELLEMFTARKMG  164

Query  662  KAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            K FF NSGSEANDTQVKLVWYYNNALGRP+KKKFIAR K+YHGS
Sbjct  165  KVFFVNSGSEANDTQVKLVWYYNNALGRPDKKKFIARSKAYHGS  208



>ref|XP_002447091.1| hypothetical protein SORBIDRAFT_06g028440 [Sorghum bicolor]
 gb|EES11419.1| hypothetical protein SORBIDRAFT_06g028440 [Sorghum bicolor]
Length=511

 Score =   280 bits (717),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/150 (85%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +2

Query  344  TDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGN  523
            T+E GFKGH MLAPFTAGWQ+ DLHPL+IE+SEGSYVYDING KYLDSLAGLWCTALGG+
Sbjct  54   TEENGFKGHGMLAPFTAGWQSNDLHPLIIERSEGSYVYDINGNKYLDSLAGLWCTALGGS  113

Query  524  EPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDT  703
            EPRLV AA +QLN LPFYHSFWNRTTKPSLDLA+E+L  FTA KM K FFTNSGSEAND+
Sbjct  114  EPRLVKAATEQLNKLPFYHSFWNRTTKPSLDLAQEILSIFTARKMGKVFFTNSGSEANDS  173

Query  704  QVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            QVKLVWYYNNALGRPNKKKFIAR K+YHGS
Sbjct  174  QVKLVWYYNNALGRPNKKKFIARSKAYHGS  203



>ref|XP_002883348.1| gamma-aminobutyrate transaminase subunit precursor [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH59607.1| gamma-aminobutyrate transaminase subunit precursor [Arabidopsis 
lyrata subsp. lyrata]
Length=504

 Score =   280 bits (716),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +2

Query  338  DSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALG  517
            +  +  G KGHDMLAPFTAGWQ+TDL PLVI KSEGSYVYD NGKKYLDSLAGLWCTALG
Sbjct  43   EKLNSAGSKGHDMLAPFTAGWQSTDLDPLVIAKSEGSYVYDANGKKYLDSLAGLWCTALG  102

Query  518  GNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEAN  697
            GNEPRLV AA+KQLNTLPFYHSFWNRTTKPSLDLAK+LL+ FTANKMAKAFFT+ GS+AN
Sbjct  103  GNEPRLVSAAVKQLNTLPFYHSFWNRTTKPSLDLAKDLLEMFTANKMAKAFFTSGGSDAN  162

Query  698  DTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            DTQVKLVWYYNNALGRP KKKFIAR KSYHGS
Sbjct  163  DTQVKLVWYYNNALGRPEKKKFIARNKSYHGS  194



>ref|XP_010525162.1| PREDICTED: gamma-aminobutyrate transaminase POP2, mitochondrial-like 
[Tarenaya hassleriana]
Length=504

 Score =   279 bits (714),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 144/165 (87%), Gaps = 4/165 (2%)
 Frame = +2

Query  311  SSAQVSVQNDSTDEK----GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKY  478
            SS   S   +++ EK    G+KGHDMLAPFTAGWQT DL PLVIEKSEGSYVYD +GKKY
Sbjct  32   SSTSRSFSTEASQEKKSPVGYKGHDMLAPFTAGWQTADLDPLVIEKSEGSYVYDNHGKKY  91

Query  479  LDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKM  658
            LD+LAGLWCTALGGNEPRLV AA  QL+TLPFYHSFWNRTTKPSLDLAK+LL+TFTA  M
Sbjct  92   LDALAGLWCTALGGNEPRLVAAATAQLDTLPFYHSFWNRTTKPSLDLAKDLLETFTAKNM  151

Query  659  AKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            AKAFFTNSGSEANDTQVKLVWYYNNALGRP KKKFIAR KSYHGS
Sbjct  152  AKAFFTNSGSEANDTQVKLVWYYNNALGRPEKKKFIARAKSYHGS  196



>tpg|DAA59557.1| TPA: putative aminotransferase class III superfamily protein, 
partial [Zea mays]
Length=447

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            MLAPFTAGWQTTDLHPLVIEKSEGSYVYD NGKKYLDSLAGLWCTALGGNEPRLV+AA  
Sbjct  1    MLAPFTAGWQTTDLHPLVIEKSEGSYVYDANGKKYLDSLAGLWCTALGGNEPRLVEAATA  60

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            QLN LPFYHSFWNRTTKPSLDLAK+LL+TFTA KMAK FFTNSGSEANDTQVKLVWYYNN
Sbjct  61   QLNKLPFYHSFWNRTTKPSLDLAKDLLETFTATKMAKVFFTNSGSEANDTQVKLVWYYNN  120

Query  734  ALGRPNKKKFIAREKSYHGS  793
            ALGRPNKKKFIAR KSYHGS
Sbjct  121  ALGRPNKKKFIARAKSYHGS  140



>gb|KDO64364.1| hypothetical protein CISIN_1g010250mg [Citrus sinensis]
 gb|KDO64365.1| hypothetical protein CISIN_1g010250mg [Citrus sinensis]
Length=447

 Score =   276 bits (707),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            MLAPFTAGWQ+TD+HPLVIEKSEGSYVYD+NGKKYLDSLAGLWCTALGG+EPRLV AA  
Sbjct  1    MLAPFTAGWQSTDVHPLVIEKSEGSYVYDVNGKKYLDSLAGLWCTALGGSEPRLVAAATA  60

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            QLNTLPFYHSFWNRTTKPSLDLAKELL+ FTA+KMAK FFTNSGSEANDTQVKLVWYYNN
Sbjct  61   QLNTLPFYHSFWNRTTKPSLDLAKELLEMFTASKMAKVFFTNSGSEANDTQVKLVWYYNN  120

Query  734  ALGRPNKKKFIAREKSYHGS  793
            ALGRPNKKKFIAR+KSYHGS
Sbjct  121  ALGRPNKKKFIARQKSYHGS  140



>ref|XP_010488236.1| PREDICTED: gamma-aminobutyrate transaminase POP2, mitochondrial 
[Camelina sativa]
Length=504

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +2

Query  356  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  535
            G KGHDMLAPFTAGWQ+ D+HPL+I KSEGSYV+D NGKKYLDSLAGLWCTALGGNE RL
Sbjct  49   GSKGHDMLAPFTAGWQSADVHPLIIAKSEGSYVFDDNGKKYLDSLAGLWCTALGGNEQRL  108

Query  536  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKL  715
            V AA++QL TLPFYHSFWNRTTKPSLDLAK+LLD FTANKMAKAFFTNSGSEANDTQVKL
Sbjct  109  VSAAVEQLKTLPFYHSFWNRTTKPSLDLAKDLLDMFTANKMAKAFFTNSGSEANDTQVKL  168

Query  716  VWYYNNALGRPNKKKFIAREKSYHGS  793
            VWYYNNALGRP KKKFIAR+KSYHGS
Sbjct  169  VWYYNNALGRPEKKKFIARKKSYHGS  194



>ref|XP_003537747.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
[Glycine max]
Length=513

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = +2

Query  302  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  481
            T  S A+ +  ND  + +G+KGH MLAPFTAGWQ++DLHPL+IEKSEGSYVYDINGKKYL
Sbjct  42   TEASLAKDNSSNDVKNGQGYKGHSMLAPFTAGWQSSDLHPLIIEKSEGSYVYDINGKKYL  101

Query  482  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  661
            D+LAGLW T+LGG+EPRLVDAA+ QL  LPFYHSFWNRTT PSLDLAKELL+ FTA KM 
Sbjct  102  DALAGLWATSLGGSEPRLVDAAVAQLKKLPFYHSFWNRTTLPSLDLAKELLEMFTARKMG  161

Query  662  KAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            KAFF NSGSEANDTQVKLVWYYNNALGRP+KKKFIAR KSYHGS
Sbjct  162  KAFFVNSGSEANDTQVKLVWYYNNALGRPDKKKFIARAKSYHGS  205



>ref|XP_009145420.1| PREDICTED: gamma-aminobutyrate transaminase POP2, mitochondrial 
[Brassica rapa]
 emb|CDY10619.1| BnaA05g17430D [Brassica napus]
Length=500

 Score =   277 bits (709),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +2

Query  317  AQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAG  496
            +++     S ++ G KGHDMLAPFTAGWQ+ DL PL+I KSEGSYVYD +GKKYLDSLAG
Sbjct  32   SRILTTEASPEKLGSKGHDMLAPFTAGWQSADLDPLIIAKSEGSYVYDDHGKKYLDSLAG  91

Query  497  LWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFT  676
            LWCTALGGNEPRLV AA+ QLNTLPFYHSFWNRTTKPSLDLAK+LL+ FTA KMAKAFFT
Sbjct  92   LWCTALGGNEPRLVSAAVGQLNTLPFYHSFWNRTTKPSLDLAKDLLEMFTAKKMAKAFFT  151

Query  677  NSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            NSGSEANDTQVKLVWYYNNALGRP KKKFIAR+KSYHGS
Sbjct  152  NSGSEANDTQVKLVWYYNNALGRPEKKKFIARKKSYHGS  190



>emb|CDY37389.1| BnaC05g30410D [Brassica napus]
Length=500

 Score =   277 bits (709),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/159 (82%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +2

Query  317  AQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAG  496
            +++     S ++ G KGHDMLAPFTAGWQ+ DL PL+I KSEGSYVYD +GKKYLDSLAG
Sbjct  32   SRIFTTEASPEKLGSKGHDMLAPFTAGWQSADLDPLIIAKSEGSYVYDDHGKKYLDSLAG  91

Query  497  LWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFT  676
            LWCTALGGNEPRLV AA+ QLNTLPFYHSFWNRTTKPSLDLAK+LL+ FTA KMAKAFFT
Sbjct  92   LWCTALGGNEPRLVSAAVGQLNTLPFYHSFWNRTTKPSLDLAKDLLEMFTAKKMAKAFFT  151

Query  677  NSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            NSGSEANDTQVKLVWYYNNALGRP KKKFIAR+KSYHGS
Sbjct  152  NSGSEANDTQVKLVWYYNNALGRPEKKKFIARKKSYHGS  190



>gb|KHN09253.1| Putative aminotransferase y4uB [Glycine soja]
Length=536

 Score =   278 bits (710),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = +2

Query  302  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  481
            T  S A+ +  ND  + +G+KGH MLAPFTAGWQ++DLHPL+IEKSEGSYVYDINGKKYL
Sbjct  58   TEASLAKDNSSNDVKNGQGYKGHSMLAPFTAGWQSSDLHPLIIEKSEGSYVYDINGKKYL  117

Query  482  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  661
            D+LAGLW T+LGG+EPRLVDAA+ QL  LPFYHSFWNRTT PSLDLAKELL+ FTA KM 
Sbjct  118  DALAGLWATSLGGSEPRLVDAAVAQLKKLPFYHSFWNRTTLPSLDLAKELLEMFTARKMG  177

Query  662  KAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            KAFF NSGSEANDTQVKLVWYYNNALGRP+KKKFIAR KSYHGS
Sbjct  178  KAFFVNSGSEANDTQVKLVWYYNNALGRPDKKKFIARAKSYHGS  221



>ref|XP_008668890.1| PREDICTED: gamma-aminobutyrate transaminase 1, mitochondrial-like 
[Zea mays]
 tpg|DAA36030.1| TPA: putative aminotransferase class III superfamily protein 
[Zea mays]
Length=510

 Score =   277 bits (708),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  326  SVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWC  505
            S  +   +E GFKGH MLAPFTAGWQ+ DLHPL+IE+SEGSYVYDING KYLDSLAGLWC
Sbjct  47   SAPSAQPEENGFKGHGMLAPFTAGWQSNDLHPLIIERSEGSYVYDINGNKYLDSLAGLWC  106

Query  506  TALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSG  685
            TALGG+EPRLV AA +QLN LPFYHSFWNRTTKPSLDLA+E+L  FTA +M K FFTNSG
Sbjct  107  TALGGSEPRLVKAATEQLNKLPFYHSFWNRTTKPSLDLAQEILSMFTAREMGKVFFTNSG  166

Query  686  SEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            SEAND+QVKLVWYYNNALGRPNKKKFIAR K+YHGS
Sbjct  167  SEANDSQVKLVWYYNNALGRPNKKKFIARSKAYHGS  202



>ref|XP_009109118.1| PREDICTED: gamma-aminobutyrate transaminase POP2, mitochondrial-like 
[Brassica rapa]
Length=501

 Score =   276 bits (707),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +2

Query  356  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  535
            G KGHDMLAPFTAGWQ+ DLHPL+I KSEGSYVYD +GKKYLDSLAGLWCTALGGNE RL
Sbjct  46   GSKGHDMLAPFTAGWQSADLHPLIIAKSEGSYVYDDHGKKYLDSLAGLWCTALGGNEARL  105

Query  536  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKL  715
            V AA++QL TLPFYHSFWNRTTKPSLDLAK+LL  FTANKMAKAFFTNSGSEANDTQVKL
Sbjct  106  VSAAVEQLKTLPFYHSFWNRTTKPSLDLAKDLLAMFTANKMAKAFFTNSGSEANDTQVKL  165

Query  716  VWYYNNALGRPNKKKFIAREKSYHGS  793
            VWYYNNALGRP KKKFIAR+KSYHGS
Sbjct  166  VWYYNNALGRPEKKKFIARKKSYHGS  191



>ref|XP_006592030.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
isoform X2 [Glycine max]
Length=480

 Score =   276 bits (705),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +2

Query  341  STDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGG  520
            S  E  FKGH MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLD+LAGLW T+LGG
Sbjct  22   SFGESMFKGHSMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDALAGLWATSLGG  81

Query  521  NEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEAND  700
            +EPRLVDAA+ QL  LPFYHSFWNRTT PSLDLAKELL+ FTA KM KAFF NSGSEAND
Sbjct  82   SEPRLVDAAIAQLKKLPFYHSFWNRTTLPSLDLAKELLEMFTARKMGKAFFVNSGSEAND  141

Query  701  TQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            TQVKLVWYYNNALGRP+KKKFIAR KSYHGS
Sbjct  142  TQVKLVWYYNNALGRPDKKKFIARAKSYHGS  172



>ref|XP_004505667.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
[Cicer arietinum]
Length=513

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = +2

Query  335  NDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTAL  514
            +D   ++ FKGHDMLAPFTAGWQTTDL PL+I+KSEGSYVYDI GKKYLD LAGLWCTAL
Sbjct  53   DDVNPDQRFKGHDMLAPFTAGWQTTDLDPLIIDKSEGSYVYDITGKKYLDPLAGLWCTAL  112

Query  515  GGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEA  694
            GGNE RL+DAA  QL  LPFYHSFWNRTTKPSLDLAKELL  FTA KMAKAFF NSGSEA
Sbjct  113  GGNEQRLIDAATAQLKKLPFYHSFWNRTTKPSLDLAKELLQFFTARKMAKAFFVNSGSEA  172

Query  695  NDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            NDTQVK+VWYYNNALGRPNKKKFIAR KSYHGS
Sbjct  173  NDTQVKIVWYYNNALGRPNKKKFIARAKSYHGS  205



>emb|CDY39506.1| BnaA01g24820D [Brassica napus]
Length=506

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +2

Query  356  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  535
            G KGHDMLAPFTAGWQ+ DLHPL+I KSEGSYVYD +GKKYLDSLAGLWCTALGGNE RL
Sbjct  51   GSKGHDMLAPFTAGWQSADLHPLIIAKSEGSYVYDDHGKKYLDSLAGLWCTALGGNEARL  110

Query  536  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKL  715
            V AA++QL TLPFYHSFWNRTTKPSLDLAK+LL  FTANKMAKAFFTNSGSEANDTQVKL
Sbjct  111  VSAAVEQLKTLPFYHSFWNRTTKPSLDLAKDLLAMFTANKMAKAFFTNSGSEANDTQVKL  170

Query  716  VWYYNNALGRPNKKKFIAREKSYHGS  793
            VWYYNNALGRP KKKFIAR+KSYHGS
Sbjct  171  VWYYNNALGRPEKKKFIARKKSYHGS  196



>ref|XP_010511056.1| PREDICTED: gamma-aminobutyrate transaminase POP2, mitochondrial-like 
[Camelina sativa]
Length=547

 Score =   277 bits (709),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/146 (88%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +2

Query  356  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  535
            G KGHDMLAPFTAGWQ+ D+HPL+I KSEGSYV+D NGKKYLDSLAGLWCTALGGNE RL
Sbjct  92   GSKGHDMLAPFTAGWQSADVHPLIIAKSEGSYVFDDNGKKYLDSLAGLWCTALGGNEQRL  151

Query  536  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKL  715
            V AA++QL TLPFYHSFWNRTTKPSLDLAK+LLD FTANKMAKAFFTNSGSEANDTQVKL
Sbjct  152  VSAAVEQLKTLPFYHSFWNRTTKPSLDLAKDLLDMFTANKMAKAFFTNSGSEANDTQVKL  211

Query  716  VWYYNNALGRPNKKKFIAREKSYHGS  793
            VWYYNNALGRP KKKFIAR KSYHGS
Sbjct  212  VWYYNNALGRPEKKKFIARNKSYHGS  237



>gb|KJB22727.1| hypothetical protein B456_004G063100 [Gossypium raimondii]
Length=502

 Score =   275 bits (703),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 154/202 (76%), Gaps = 13/202 (6%)
 Frame = +2

Query  188  NRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKGFKG  367
            N+ L  TLK    Q+GS++K+  A        I+ +   RW S              FKG
Sbjct  4    NKYLRSTLK---TQLGSYIKNAAACKSLLEYPIKGQCEARWCSTNTC----------FKG  50

Query  368  HDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAA  547
            H+MLAPFT GWQ+T+++PLVI KSEGSYVYDIN KKYLD+LAGLWCTALGGNEPRLV AA
Sbjct  51   HNMLAPFTPGWQSTEVNPLVIVKSEGSYVYDINEKKYLDTLAGLWCTALGGNEPRLVAAA  110

Query  548  MKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYY  727
              QLN LPFYHSFWNRTTKPSLDLAKEL +TFTA KMAK FFTNSGSEANDTQVKLVWYY
Sbjct  111  TDQLNKLPFYHSFWNRTTKPSLDLAKELTETFTATKMAKVFFTNSGSEANDTQVKLVWYY  170

Query  728  NNALGRPNKKKFIAREKSYHGS  793
            NNALGRP KKKFIAR K+YHGS
Sbjct  171  NNALGRPKKKKFIARAKAYHGS  192



>ref|XP_010525163.1| PREDICTED: LOW QUALITY PROTEIN: gamma-aminobutyrate transaminase 
POP2, mitochondrial-like [Tarenaya hassleriana]
Length=504

 Score =   275 bits (703),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 157/209 (75%), Gaps = 16/209 (8%)
 Frame = +2

Query  176  VAMINRLLGHTLKRATN---QVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDST  346
            +A+INRL         N   +  + VK +P               +R+ S + S +  S 
Sbjct  1    MAVINRLFRLARSSQVNFYSRNAASVKFIPGSCT-----------SRFFSTEASQEKQSP  49

Query  347  DEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  526
               G+KGHDMLAPFTAGWQT DL PLVIEKSEGSYVYD +GKKYLD+LAGLWCTALGGNE
Sbjct  50   --VGYKGHDMLAPFTAGWQTADLDPLVIEKSEGSYVYDNHGKKYLDALAGLWCTALGGNE  107

Query  527  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQ  706
            PRLV AA  QL+TLPFYHSFWNRTTKPSLDLAK+LL+TFTA KMAKAFFTNSGSEANDTQ
Sbjct  108  PRLVAAATAQLDTLPFYHSFWNRTTKPSLDLAKDLLETFTAKKMAKAFFTNSGSEANDTQ  167

Query  707  VKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            VKLVWYYNN LGRP KKK IAR +SYHGS
Sbjct  168  VKLVWYYNNXLGRPEKKKIIARAESYHGS  196



>ref|XP_007131572.1| hypothetical protein PHAVU_011G024300g [Phaseolus vulgaris]
 gb|ESW03566.1| hypothetical protein PHAVU_011G024300g [Phaseolus vulgaris]
Length=513

 Score =   275 bits (704),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 140/164 (85%), Gaps = 0/164 (0%)
 Frame = +2

Query  302  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  481
            T  S A+    N+  +  GFKGH MLAPFTAGWQTTDLHPLVIEKSEGSYVYD NGKKYL
Sbjct  42   TEASLAKDDSANEGKNGPGFKGHSMLAPFTAGWQTTDLHPLVIEKSEGSYVYDTNGKKYL  101

Query  482  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  661
            D+LAGLW TALGG+E RLVDAAM Q   LPFYHSFWNRTT PSL+LAKELL+ FTA KMA
Sbjct  102  DALAGLWATALGGSESRLVDAAMAQFKKLPFYHSFWNRTTLPSLELAKELLEMFTARKMA  161

Query  662  KAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            KAFF NSGSEANDTQVKLVWYYNNALGRP+KKKFIAR KSYHGS
Sbjct  162  KAFFVNSGSEANDTQVKLVWYYNNALGRPDKKKFIARAKSYHGS  205



>ref|XP_006297475.1| hypothetical protein CARUB_v10013496mg [Capsella rubella]
 gb|EOA30373.1| hypothetical protein CARUB_v10013496mg [Capsella rubella]
Length=505

 Score =   275 bits (702),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +2

Query  356  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  535
            G KGHDMLAPFTAGWQ+ D+ PL+I KSEGSYVYD NGKKYLDSLAGLWCTALGGNE RL
Sbjct  50   GSKGHDMLAPFTAGWQSADVDPLIIAKSEGSYVYDDNGKKYLDSLAGLWCTALGGNEERL  109

Query  536  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKL  715
            V AA++QL  LPFYHSFWNRTTKPSLDLAK+LLD FTANKMAKAFFTNSGSEANDTQVKL
Sbjct  110  VSAAVEQLKILPFYHSFWNRTTKPSLDLAKDLLDMFTANKMAKAFFTNSGSEANDTQVKL  169

Query  716  VWYYNNALGRPNKKKFIAREKSYHGS  793
            VWYYNNALGRP KKKFIAR+KSYHGS
Sbjct  170  VWYYNNALGRPEKKKFIARKKSYHGS  195



>gb|KFK39511.1| hypothetical protein AALP_AA3G253600 [Arabis alpina]
Length=506

 Score =   274 bits (700),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 159/206 (77%), Gaps = 10/206 (5%)
 Frame = +2

Query  176  VAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEK  355
            +AMIN L    L R+T QV  H ++     G+    +     +R  + + S Q  ++   
Sbjct  1    MAMINNL--RRLARST-QVNLHSRY-----GASTKCMSGSFTSRIFTTEASPQKQNS--A  50

Query  356  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  535
            G KGHDMLAPFTAGWQ+ DL PL+I KSEG YVYD  G+KYLDSLAGLWCTALGGNEPRL
Sbjct  51   GSKGHDMLAPFTAGWQSADLDPLIIAKSEGCYVYDDQGRKYLDSLAGLWCTALGGNEPRL  110

Query  536  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKL  715
            V AA+ QLNTLPFYHSFWNRTTKPSLDLAK+LLD FTANKMAKAFFT+ GS+ANDTQVKL
Sbjct  111  VSAALNQLNTLPFYHSFWNRTTKPSLDLAKDLLDMFTANKMAKAFFTSGGSDANDTQVKL  170

Query  716  VWYYNNALGRPNKKKFIAREKSYHGS  793
            VWYYNNALGRP KKKFIAR KSYHGS
Sbjct  171  VWYYNNALGRPEKKKFIARAKSYHGS  196



>ref|XP_009776834.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
[Nicotiana sylvestris]
Length=347

 Score =   268 bits (686),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 135/146 (92%), Gaps = 1/146 (1%)
 Frame = +2

Query  356  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  535
            GF GHDMLAPFTAGWQ+ D+ PL+IEKSEGSYVYDINGKKYLD+L+GLWC  LGGNEPRL
Sbjct  7    GFGGHDMLAPFTAGWQS-DMGPLIIEKSEGSYVYDINGKKYLDTLSGLWCNPLGGNEPRL  65

Query  536  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKL  715
            V+AA KQLNTLPFYHSFWNRTTKPSLDLA+EL+D FTANKMAK FFTNSGSEANDTQVKL
Sbjct  66   VEAATKQLNTLPFYHSFWNRTTKPSLDLARELIDLFTANKMAKVFFTNSGSEANDTQVKL  125

Query  716  VWYYNNALGRPNKKKFIAREKSYHGS  793
            VWYYNNALGRP KKKFIA+  +YHG+
Sbjct  126  VWYYNNALGRPKKKKFIAQANAYHGT  151



>ref|XP_009597725.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=155

 Score =   261 bits (667),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 133/142 (94%), Gaps = 1/142 (1%)
 Frame = +2

Query  359  FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  538
            F GHDMLAPFTAGWQ+ D+ PL+IEKSEGSYVYDINGKKYLD+L+GLWC  LGGNEPRLV
Sbjct  8    FGGHDMLAPFTAGWQS-DMGPLIIEKSEGSYVYDINGKKYLDTLSGLWCNPLGGNEPRLV  66

Query  539  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLV  718
            +AA KQLNTLPFYHSFWNRTTKPSLDLAKEL+D FTANKMAKAFFTNSGSEANDTQVKLV
Sbjct  67   EAANKQLNTLPFYHSFWNRTTKPSLDLAKELIDLFTANKMAKAFFTNSGSEANDTQVKLV  126

Query  719  WYYNNALGRPNKKKFIAREKSY  784
            WYYNNALGRP KKKFIA+ ++Y
Sbjct  127  WYYNNALGRPKKKKFIAQAQAY  148



>ref|NP_566700.1| gamma-aminobutyrate transaminase POP2 [Arabidopsis thaliana]
 sp|Q94CE5.1|GATP_ARATH RecName: Full=Gamma-aminobutyrate transaminase POP2, mitochondrial; 
Short=AtGABA-T; AltName: Full=Protein HEXENAL RESPONSE 
1; AltName: Full=Protein POLLEN-PISTIL INCOMPATIBILITY 2; 
Short=AtPOP2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK59430.1| putative aminotransferase [Arabidopsis thaliana]
 gb|AAN13140.1| putative aminotransferase [Arabidopsis thaliana]
 gb|AEE76602.1| gamma-aminobutyrate transaminase POP2 [Arabidopsis thaliana]
Length=504

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +2

Query  356  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  535
            G KGHDMLAPFTAGWQ+ DL PLVI KSEGSYVYD  GKKYLDSLAGLWCTALGGNEPRL
Sbjct  49   GSKGHDMLAPFTAGWQSADLDPLVIAKSEGSYVYDDTGKKYLDSLAGLWCTALGGNEPRL  108

Query  536  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKL  715
            V AA++QLNTLPFYHSFWNRTTKPSLDLAK LL+ FTANKMAKAFFT+ GS+ANDTQVKL
Sbjct  109  VSAAVEQLNTLPFYHSFWNRTTKPSLDLAKVLLEMFTANKMAKAFFTSGGSDANDTQVKL  168

Query  716  VWYYNNALGRPNKKKFIAREKSYHGS  793
            VWYYNNALGRP KKKFIAR+KSYHGS
Sbjct  169  VWYYNNALGRPEKKKFIARKKSYHGS  194



>gb|AAK52899.1|AF351125_1 gamma-aminobutyrate transaminase subunit precursor [Arabidopsis 
thaliana]
Length=504

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +2

Query  356  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  535
            G KGHDMLAPFTAGWQ+ DL PLVI KSEGSYVYD  GKKYLDSLAGLWCTALGGNEPRL
Sbjct  49   GSKGHDMLAPFTAGWQSADLDPLVIAKSEGSYVYDDTGKKYLDSLAGLWCTALGGNEPRL  108

Query  536  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKL  715
            V AA++QLNTLPFYHSFWNRTTKPSLDLAK LL+ FTANKMAKAFFT+ GS+ANDTQVKL
Sbjct  109  VSAAVEQLNTLPFYHSFWNRTTKPSLDLAKVLLEMFTANKMAKAFFTSGGSDANDTQVKL  168

Query  716  VWYYNNALGRPNKKKFIAREKSYHGS  793
            VWYYNNALGRP KKKFIAR+KSYHGS
Sbjct  169  VWYYNNALGRPEKKKFIARKKSYHGS  194



>ref|XP_010466490.1| PREDICTED: gamma-aminobutyrate transaminase POP2, mitochondrial-like 
[Camelina sativa]
Length=504

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +2

Query  362  KGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVD  541
            KGHDMLAPFTAGWQ+ D+ PL+I KSEGSYV+D NGKKYLDSLAGLWCTALGGNE RLV 
Sbjct  51   KGHDMLAPFTAGWQSADVDPLIIAKSEGSYVFDDNGKKYLDSLAGLWCTALGGNEQRLVS  110

Query  542  AAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVW  721
            AA++QL TLPFYHSFWNRTTKPSLDLAK+LLD FTANKMAKAFFTNSGSEANDTQVKLVW
Sbjct  111  AAVEQLKTLPFYHSFWNRTTKPSLDLAKDLLDMFTANKMAKAFFTNSGSEANDTQVKLVW  170

Query  722  YYNNALGRPNKKKFIAREKSYHGS  793
            YYNNALGRP KKKFIAR KSYHGS
Sbjct  171  YYNNALGRPEKKKFIARNKSYHGS  194



>dbj|BAB03068.1| aminotransferase-like protein [Arabidopsis thaliana]
Length=466

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +2

Query  362  KGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVD  541
            KGHDMLAPFTAGWQ+ DL PLVI KSEGSYVYD  GKKYLDSLAGLWCTALGGNEPRLV 
Sbjct  13   KGHDMLAPFTAGWQSADLDPLVIAKSEGSYVYDDTGKKYLDSLAGLWCTALGGNEPRLVS  72

Query  542  AAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVW  721
            AA++QLNTLPFYHSFWNRTTKPSLDLAK LL+ FTANKMAKAFFT+ GS+ANDTQVKLVW
Sbjct  73   AAVEQLNTLPFYHSFWNRTTKPSLDLAKVLLEMFTANKMAKAFFTSGGSDANDTQVKLVW  132

Query  722  YYNNALGRPNKKKFIAREKSYHGS  793
            YYNNALGRP KKKFIAR+KSYHGS
Sbjct  133  YYNNALGRPEKKKFIARKKSYHGS  156



>ref|XP_010313638.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
isoform X2 [Solanum lycopersicum]
Length=448

 Score =   270 bits (691),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            MLAPFTAGW +TDL PLVI+KSEGSYVYD+NGKKYLD+LAGLWCT+LGGNEPRLV AA K
Sbjct  1    MLAPFTAGWHSTDLEPLVIQKSEGSYVYDVNGKKYLDALAGLWCTSLGGNEPRLVAAATK  60

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            QLN LPFYHSFWNR+TKPSLDLAKELLD FTANKMAKAFFTNSGSEANDTQVKLVWYYNN
Sbjct  61   QLNELPFYHSFWNRSTKPSLDLAKELLDLFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  120

Query  734  ALGRPNKKKFIAREKSYHGS  793
            ALGRP+KKKFIAR KSYHGS
Sbjct  121  ALGRPDKKKFIARTKSYHGS  140



>ref|NP_001189947.1| gamma-aminobutyrate transaminase POP2 [Arabidopsis thaliana]
 gb|AEE76603.1| gamma-aminobutyrate transaminase POP2 [Arabidopsis thaliana]
Length=513

 Score =   272 bits (695),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 135/146 (92%), Gaps = 0/146 (0%)
 Frame = +2

Query  356  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  535
            G KGHDMLAPFTAGWQ+ DL PLVI KSEGSYVYD  GKKYLDSLAGLWCTALGGNEPRL
Sbjct  58   GSKGHDMLAPFTAGWQSADLDPLVIAKSEGSYVYDDTGKKYLDSLAGLWCTALGGNEPRL  117

Query  536  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKL  715
            V AA++QLNTLPFYHSFWNRTTKPSLDLAK LL+ FTANKMAKAFFT+ GS+ANDTQVKL
Sbjct  118  VSAAVEQLNTLPFYHSFWNRTTKPSLDLAKVLLEMFTANKMAKAFFTSGGSDANDTQVKL  177

Query  716  VWYYNNALGRPNKKKFIAREKSYHGS  793
            VWYYNNALGRP KKKFIAR+KSYHGS
Sbjct  178  VWYYNNALGRPEKKKFIARKKSYHGS  203



>ref|XP_010648197.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic-like 
[Vitis vinifera]
Length=514

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 152/192 (79%), Gaps = 3/192 (2%)
 Frame = +2

Query  227  QVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDST---DEKGFKGHDMLAPFTAG  397
            Q G ++ H+         +    +  + SS + S+Q + +   + KGFKGHDML+PFT G
Sbjct  15   QAGFYINHVVTARILMKHLHPAPALAKCSSTETSLQKEDSATKNAKGFKGHDMLSPFTTG  74

Query  398  WQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFY  577
            WQ+T+L PL+IE+SEG YVYD NG+KYLD+LAGLWCTALGG+EPRL+ AA  QLNTLPFY
Sbjct  75   WQSTNLDPLLIERSEGPYVYDSNGRKYLDALAGLWCTALGGSEPRLIAAATAQLNTLPFY  134

Query  578  HSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNALGRPNKK  757
            HSFWN  +KPSLDLAKELL+TFTA KM K FFT+SGSEANDTQVKLVWYYNNALGRPNKK
Sbjct  135  HSFWNHASKPSLDLAKELLNTFTATKMGKVFFTSSGSEANDTQVKLVWYYNNALGRPNKK  194

Query  758  KFIAREKSYHGS  793
            KFIA EKSYHG+
Sbjct  195  KFIALEKSYHGT  206



>emb|CBI34103.3| unnamed protein product [Vitis vinifera]
Length=493

 Score =   269 bits (688),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 144/166 (87%), Gaps = 3/166 (2%)
 Frame = +2

Query  305  RWSSAQVSVQNDST---DEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKK  475
            + SS + S+Q + +   + KGFKGHDML+PFT GWQ+T+L PL+IE+SEG YVYD NG+K
Sbjct  12   KCSSTETSLQKEDSATKNAKGFKGHDMLSPFTTGWQSTNLDPLLIERSEGPYVYDSNGRK  71

Query  476  YLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANK  655
            YLD+LAGLWCTALGG+EPRL+ AA  QLNTLPFYHSFWN  +KPSLDLAKELL+TFTA K
Sbjct  72   YLDALAGLWCTALGGSEPRLIAAATAQLNTLPFYHSFWNHASKPSLDLAKELLNTFTATK  131

Query  656  MAKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            M K FFT+SGSEANDTQVKLVWYYNNALGRPNKKKFIA EKSYHG+
Sbjct  132  MGKVFFTSSGSEANDTQVKLVWYYNNALGRPNKKKFIALEKSYHGT  177



>gb|ADM13673.1| putative aminotransferase [Capsicum annuum]
Length=459

 Score =   268 bits (684),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/145 (87%), Positives = 134/145 (92%), Gaps = 1/145 (1%)
 Frame = +2

Query  359  FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  538
            F GHDMLAPFTAGWQ+ D+ PLVIEKSEGSYVYDINGKKYLD+L+GLWCT LGG+E RLV
Sbjct  8    FMGHDMLAPFTAGWQS-DMEPLVIEKSEGSYVYDINGKKYLDTLSGLWCTTLGGSETRLV  66

Query  539  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLV  718
            +AA KQLNTLPFYHSFWNRTTKPSLDLAKELL+ FTANKMAK FFTNSGSEANDTQVKLV
Sbjct  67   EAANKQLNTLPFYHSFWNRTTKPSLDLAKELLNMFTANKMAKVFFTNSGSEANDTQVKLV  126

Query  719  WYYNNALGRPNKKKFIAREKSYHGS  793
            WYYNNALGRP KKK IAR K+YHGS
Sbjct  127  WYYNNALGRPQKKKIIARAKAYHGS  151



>ref|XP_010680154.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=503

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 137/164 (84%), Gaps = 0/164 (0%)
 Frame = +2

Query  302  TRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYL  481
             R+ S+  S+ + +   + +KGH MLAPFTAGWQTTD HPLVI+KSEG YV+DI G KYL
Sbjct  32   VRYMSSDASLDSTTESNRSYKGHGMLAPFTAGWQTTDTHPLVIDKSEGCYVFDIQGNKYL  91

Query  482  DSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMA  661
            DSLAGLW TALGGNE RL+DAA  QL  LPFYHSFWNRTTK SLDLA+ELL  FTA KMA
Sbjct  92   DSLAGLWSTALGGNESRLIDAATTQLKKLPFYHSFWNRTTKVSLDLAEELLQMFTARKMA  151

Query  662  KAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            KAFF NSGSEANDTQVKLVWYYNNALGRPNKKKFIAR KSYHGS
Sbjct  152  KAFFVNSGSEANDTQVKLVWYYNNALGRPNKKKFIARSKSYHGS  195



>ref|XP_003607298.1| Aminotransferase y4uB [Medicago truncatula]
 gb|AES89495.1| gamma-aminobutyrate transaminase [Medicago truncatula]
Length=513

 Score =   267 bits (683),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +2

Query  317  AQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAG  496
            A+ S  +D+   +GFK HDMLAPFTAGWQT +L+PL+IEKSEGSYVYDINGKKYLD+LAG
Sbjct  47   AKDSSTSDAKTGQGFKSHDMLAPFTAGWQTNELNPLIIEKSEGSYVYDINGKKYLDALAG  106

Query  497  LWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFT  676
            LW TALGG+E RLVDAA  QL  LPFYHSFWNRTT+P+LDLAKELL+ FTA KMAKAFF 
Sbjct  107  LWSTALGGSEQRLVDAATAQLKKLPFYHSFWNRTTRPALDLAKELLELFTARKMAKAFFV  166

Query  677  NSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            NSGSEANDTQVKLVWYY NALG+P+KKKFIAR KSYHGS
Sbjct  167  NSGSEANDTQVKLVWYYYNALGKPDKKKFIARTKSYHGS  205



>gb|AAC78480.1| putative aminotransferase [Capsicum chinense]
Length=459

 Score =   265 bits (678),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 133/145 (92%), Gaps = 1/145 (1%)
 Frame = +2

Query  359  FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  538
            F GHDMLAPFTAGWQ+ D+ PLVIEKSEGSYVYDINGKKYLD+L+GLWC  LGG+E RLV
Sbjct  8    FMGHDMLAPFTAGWQS-DMEPLVIEKSEGSYVYDINGKKYLDTLSGLWCATLGGSETRLV  66

Query  539  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLV  718
            +AA KQLNTLPFYHSFWNRTTKPSLDLAKELL+ FTANKMAK FFTNSGSEANDTQVK+V
Sbjct  67   EAANKQLNTLPFYHSFWNRTTKPSLDLAKELLNMFTANKMAKVFFTNSGSEANDTQVKMV  126

Query  719  WYYNNALGRPNKKKFIAREKSYHGS  793
            WYYNNALGRP KKK IAR K+YHGS
Sbjct  127  WYYNNALGRPQKKKIIARAKAYHGS  151



>ref|XP_004244777.1| PREDICTED: gamma aminobutyrate transaminase 2-like [Solanum lycopersicum]
Length=458

 Score =   265 bits (677),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 134/146 (92%), Gaps = 1/146 (1%)
 Frame = +2

Query  356  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  535
            GF GH+MLAPFTAGWQ  D+ PLVIEK+EGSYVYDINGKKYLDSL+GLWCT+LGG+E RL
Sbjct  6    GFMGHNMLAPFTAGWQI-DMGPLVIEKAEGSYVYDINGKKYLDSLSGLWCTSLGGSEARL  64

Query  536  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKL  715
            ++AA KQLNTLPFYHSFWNRTTKPSLDLAKELLD FTA KMAK FFTNSGSEANDTQVKL
Sbjct  65   IEAANKQLNTLPFYHSFWNRTTKPSLDLAKELLDMFTARKMAKVFFTNSGSEANDTQVKL  124

Query  716  VWYYNNALGRPNKKKFIAREKSYHGS  793
            VWYYNNALGRPNKKK IA+  SYHGS
Sbjct  125  VWYYNNALGRPNKKKIIAQGNSYHGS  150



>ref|XP_011467676.1| PREDICTED: gamma aminobutyrate transaminase 3, chloroplastic 
isoform X2 [Fragaria vesca subsp. vesca]
Length=448

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            MLAPFT+G  ++D+HPL+IEKSEGSYVYD+NGKKYLD+LAGLWCTALGGNEPRLV+AA +
Sbjct  1    MLAPFTSGSLSSDVHPLLIEKSEGSYVYDVNGKKYLDALAGLWCTALGGNEPRLVEAATR  60

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            QLNTLPFYHSFWNRTT+PSLDLAK+LL+TFTA KM KAFFTNSGSEANDTQVKLVWYYNN
Sbjct  61   QLNTLPFYHSFWNRTTRPSLDLAKDLLETFTATKMGKAFFTNSGSEANDTQVKLVWYYNN  120

Query  734  ALGRPNKKKFIAREKSYHGS  793
            ALGRP+KKKFIAR KSYHGS
Sbjct  121  ALGRPDKKKFIARLKSYHGS  140



>gb|ADG65346.1| putative aminotransferase [Capsicum frutescens]
Length=459

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 133/145 (92%), Gaps = 1/145 (1%)
 Frame = +2

Query  359  FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  538
            F GHDMLAPFTAGWQ+ D+ PLVIEKS+GSYVYDINGKKYLD+L+GLWC  LGG+E RLV
Sbjct  8    FMGHDMLAPFTAGWQS-DMEPLVIEKSKGSYVYDINGKKYLDTLSGLWCATLGGSETRLV  66

Query  539  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLV  718
            +AA KQLNTLPFYHSFWNRTTKPSLDLAKELL+ FTANKMAK FFTNSGSEANDTQVKLV
Sbjct  67   EAANKQLNTLPFYHSFWNRTTKPSLDLAKELLNMFTANKMAKVFFTNSGSEANDTQVKLV  126

Query  719  WYYNNALGRPNKKKFIAREKSYHGS  793
            WYYNNALGRP KKK IAR K+YHGS
Sbjct  127  WYYNNALGRPQKKKIIARAKAYHGS  151



>ref|NP_001053862.1| Os04g0614500 [Oryza sativa Japonica Group]
 sp|Q7XN12.2|GATP2_ORYSJ RecName: Full=Probable gamma-aminobutyrate transaminase 2, mitochondrial; 
Flags: Precursor [Oryza sativa Japonica Group]
 sp|Q01K12.1|GATP2_ORYSI RecName: Full=Probable gamma-aminobutyrate transaminase 2, mitochondrial; 
Flags: Precursor [Oryza sativa Indica Group]
 emb|CAE04332.2| OSJNBa0008M17.3 [Oryza sativa Japonica Group]
 dbj|BAF15776.1| Os04g0614500 [Oryza sativa Japonica Group]
 emb|CAH66913.1| OSIGBa0126B18.6 [Oryza sativa Indica Group]
 dbj|BAG94519.1| unnamed protein product [Oryza sativa Japonica Group]
Length=497

 Score =   259 bits (662),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 136/163 (83%), Gaps = 0/163 (0%)
 Frame = +2

Query  305  RWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLD  484
            ++S++  S   DST+  GFKGH MLAPFTAGW +TDL PL+IE+SEGSYVYD  G KYLD
Sbjct  27   KFSTSGSSPLLDSTEGNGFKGHSMLAPFTAGWHSTDLEPLIIERSEGSYVYDSKGNKYLD  86

Query  485  SLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAK  664
            +LAGLWCTALGG+EPRLV AA  QLN LPFYHSFWN T KP LDLA+EL+  FTA +M K
Sbjct  87   TLAGLWCTALGGSEPRLVKAATDQLNKLPFYHSFWNSTAKPPLDLAEELISMFTAKEMGK  146

Query  665  AFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
             FFTNSGSEAND+QVKLVWYYNNALGRPNKKK IA+ ++YHGS
Sbjct  147  VFFTNSGSEANDSQVKLVWYYNNALGRPNKKKIIAQSQAYHGS  189



>ref|XP_006406198.1| hypothetical protein EUTSA_v10020531mg [Eutrema salsugineum]
 gb|ESQ47651.1| hypothetical protein EUTSA_v10020531mg [Eutrema salsugineum]
Length=513

 Score =   259 bits (663),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 130/154 (84%), Gaps = 8/154 (5%)
 Frame = +2

Query  356  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  535
            G+KGH MLAPFTAGWQ+ DL PL+I KSEGSYVYDI+GKKYLDSLAGLWCTALGGNEPRL
Sbjct  51   GYKGHSMLAPFTAGWQSADLDPLIIAKSEGSYVYDIHGKKYLDSLAGLWCTALGGNEPRL  110

Query  536  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKL  715
            V AA+ QLNTLPFYHSFWN TTKPSLDLAKELLD FTANKM KAFFTNSGSEANDTQVKL
Sbjct  111  VSAAVSQLNTLPFYHSFWNFTTKPSLDLAKELLDMFTANKMTKAFFTNSGSEANDTQVKL  170

Query  716  VWYYNNALGRPNKKK--------FIAREKSYHGS  793
            VWYYNNALGRP KKK        F      YHGS
Sbjct  171  VWYYNNALGRPEKKKNYRKKHIYFQVIFHRYHGS  204



>ref|XP_009145417.1| PREDICTED: gamma-aminobutyrate transaminase POP2, mitochondrial-like 
[Brassica rapa]
Length=502

 Score =   259 bits (661),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +2

Query  356  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  535
            G KGH MLAPFTAGWQ++DL P++I KSEG YVYD +GKKYLDSLAGLWCTALGG+E RL
Sbjct  48   GPKGHSMLAPFTAGWQSSDLDPMIIAKSEGCYVYDAHGKKYLDSLAGLWCTALGGSEARL  107

Query  536  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKL  715
            V AA+ QLNTLPFYHSFWN TTKPSLDLA++LLD FTA  MAKAFFTNSGSEANDTQVKL
Sbjct  108  VSAAVSQLNTLPFYHSFWNFTTKPSLDLAQDLLDMFTAKNMAKAFFTNSGSEANDTQVKL  167

Query  716  VWYYNNALGRPNKKKFIAREKSYHGS  793
            VWYYNNALGRP KKK IAR  SYHGS
Sbjct  168  VWYYNNALGRPKKKKIIARSTSYHGS  193



>ref|XP_006652818.1| PREDICTED: probable gamma-aminobutyrate transaminase 2, mitochondrial-like 
[Oryza brachyantha]
Length=496

 Score =   258 bits (659),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 133/163 (82%), Gaps = 1/163 (1%)
 Frame = +2

Query  305  RWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLD  484
            R  S  ++   DS +E GFKGH ML+PFTAGWQ  D HP +IE+SEGSYVYD  G KYLD
Sbjct  26   RQFSTGLAPLPDSPEEAGFKGHSMLSPFTAGWQAKD-HPFIIERSEGSYVYDSKGNKYLD  84

Query  485  SLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAK  664
            +LAGLWCTALGG+EPRLV AA  QLN LPFYHSFWN TTKP LDLAKEL+  FTA +M K
Sbjct  85   ALAGLWCTALGGSEPRLVKAATDQLNKLPFYHSFWNSTTKPPLDLAKELIGMFTAREMGK  144

Query  665  AFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
             FFTNSGSEAND+QVKLVWYYNNALGRPNKKK IAR K+YHGS
Sbjct  145  VFFTNSGSEANDSQVKLVWYYNNALGRPNKKKIIARSKAYHGS  187



>emb|CDY10622.1| BnaA05g17400D [Brassica napus]
Length=472

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +2

Query  362  KGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVD  541
            KGH MLAPFTAGWQ++DL P++I KSEG YVYD +GKKYLDSLAGLWCTALGG+E RLV 
Sbjct  20   KGHSMLAPFTAGWQSSDLDPMIIAKSEGCYVYDAHGKKYLDSLAGLWCTALGGSEARLVS  79

Query  542  AAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVW  721
            AA+ QLNTLPFYHSFWN TTKPSLDLA++LLD FTA  MAKAFFTNSGSEANDTQVKLVW
Sbjct  80   AAVSQLNTLPFYHSFWNFTTKPSLDLAQDLLDMFTAKNMAKAFFTNSGSEANDTQVKLVW  139

Query  722  YYNNALGRPNKKKFIAREKSYHGS  793
            YYNNALGRP KKK IAR  SYHGS
Sbjct  140  YYNNALGRPKKKKIIARSTSYHGS  163



>gb|AFK39370.1| unknown [Lotus japonicus]
Length=447

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/140 (86%), Positives = 129/140 (92%), Gaps = 1/140 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            MLAPFTAGWQT DL PL+IEKSEGSY+YD+NGKKYLD+LAGLW TALGGNEPRLV+AA  
Sbjct  1    MLAPFTAGWQT-DLTPLIIEKSEGSYIYDVNGKKYLDALAGLWSTALGGNEPRLVEAANA  59

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            QL  LPFYHSFWNRTT+PSLDLAKELL+ FTA KMAKAFF NSGSEANDTQVKLVWYYNN
Sbjct  60   QLKKLPFYHSFWNRTTRPSLDLAKELLEMFTARKMAKAFFVNSGSEANDTQVKLVWYYNN  119

Query  734  ALGRPNKKKFIAREKSYHGS  793
            ALGRP+KKKFIAR KSYHGS
Sbjct  120  ALGRPDKKKFIARSKSYHGS  139



>ref|XP_006351980.1| PREDICTED: gamma aminobutyrate transaminase 2-like [Solanum tuberosum]
Length=459

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 132/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  356  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  535
            GFKGHDMLAPFTA W   D+ PLVI+++EGSYVYD+NGKKYLDSL+GLWCT LGG+EPRL
Sbjct  7    GFKGHDMLAPFTAAWMI-DMGPLVIDRAEGSYVYDVNGKKYLDSLSGLWCTVLGGSEPRL  65

Query  536  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKL  715
            ++AA KQLN L FYHSFWNR+TKPSLDLAKEL++ FTANKM K FFTNSGSEANDTQVKL
Sbjct  66   IEAANKQLNKLAFYHSFWNRSTKPSLDLAKELINMFTANKMGKVFFTNSGSEANDTQVKL  125

Query  716  VWYYNNALGRPNKKKFIAREKSYHGS  793
            VWYYNNA+GRPNKKK I+R+ +YHGS
Sbjct  126  VWYYNNAIGRPNKKKIISRKNAYHGS  151



>ref|XP_008464679.1| PREDICTED: LOW QUALITY PROTEIN: gamma aminobutyrate transaminase 
2-like [Cucumis melo]
Length=516

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 153/202 (76%), Gaps = 7/202 (3%)
 Frame = +2

Query  209  LKRATN-QVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND------STDEKGFKG  367
            L+  TN ++GS  K + A   S   +I+ +  ++  S + S+Q D      +   + FKG
Sbjct  7    LRVITNPKLGSCAKDVAAFRTSGERLIQVQLLSQQYSTEASLQRDDNSTIDTRSGQSFKG  66

Query  368  HDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAA  547
            H MLAPFT GWQ  D++PLVIE+SEG+Y+YDINGKKYLDSLAGLW T+LGG+EPRLV AA
Sbjct  67   HGMLAPFTPGWQIADVNPLVIERSEGTYLYDINGKKYLDSLAGLWSTSLGGSEPRLVAAA  126

Query  548  MKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYY  727
             +QL TLPFYHSFWNRTTKPSL+L KE+L+ FTA KM K FF NSGSEAND+QVKLVWYY
Sbjct  127  TEQLKTLPFYHSFWNRTTKPSLELTKEILEIFTARKMGKVFFANSGSEANDSQVKLVWYY  186

Query  728  NNALGRPNKKKFIAREKSYHGS  793
            NNALGRP KKK I+R K YHGS
Sbjct  187  NNALGRPXKKKIISRLKGYHGS  208



>emb|CAD12664.1| viroid RNA-binding protein [Solanum lycopersicum]
Length=476

 Score =   252 bits (643),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 131/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  356  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  535
            GF GHDMLAPFTA W   D+ PLVI+K+EGSYVYD+NGKKYLDSL+GLWC+ LGG+EPRL
Sbjct  16   GFMGHDMLAPFTAAWMI-DMGPLVIDKAEGSYVYDVNGKKYLDSLSGLWCSVLGGSEPRL  74

Query  536  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKL  715
            ++AA KQLN L FYHSFWNRTTKPSLDLAKEL++ FTANKM K FFT+SGSEANDTQVKL
Sbjct  75   IEAANKQLNKLAFYHSFWNRTTKPSLDLAKELINMFTANKMGKVFFTSSGSEANDTQVKL  134

Query  716  VWYYNNALGRPNKKKFIAREKSYHGS  793
            VWYYNNA+GRPNKKK I+R+ +YHGS
Sbjct  135  VWYYNNAIGRPNKKKIISRKNAYHGS  160



>ref|XP_011654001.1| PREDICTED: gamma aminobutyrate transaminase 2 [Cucumis sativus]
 gb|KGN54978.1| hypothetical protein Csa_4G618430 [Cucumis sativus]
Length=516

 Score =   252 bits (643),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 155/202 (77%), Gaps = 7/202 (3%)
 Frame = +2

Query  209  LKRATN-QVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQND--STDEKG----FKG  367
            L+  TN ++GS  K + A+  S   +I+ +  ++  + + S+Q D  ST + G    FKG
Sbjct  7    LRVITNPKLGSCAKDVAALRTSGERLIQVQLLSQQYATEASLQRDDNSTTDTGSGQSFKG  66

Query  368  HDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAA  547
            H MLAPFT GWQ  D++PLVIEKSEG+Y+YDINGKKYLDSLAGLW T+LGG+E RLV AA
Sbjct  67   HGMLAPFTPGWQIADVNPLVIEKSEGTYLYDINGKKYLDSLAGLWSTSLGGSEARLVAAA  126

Query  548  MKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYY  727
             +QL TLPFYHSFWNRTTKPSL+L KE+L+ FTA KM K FF NSGSEAND+QVKLVWYY
Sbjct  127  TEQLKTLPFYHSFWNRTTKPSLELTKEILEMFTARKMGKVFFANSGSEANDSQVKLVWYY  186

Query  728  NNALGRPNKKKFIAREKSYHGS  793
            NNALGRP KKK I+R K YHGS
Sbjct  187  NNALGRPKKKKIISRLKGYHGS  208



>ref|XP_004147774.1| PREDICTED: gamma aminobutyrate transaminase 2-like [Cucumis sativus]
 gb|KGN53496.1| hypothetical protein Csa_4G056840 [Cucumis sativus]
Length=510

 Score =   251 bits (640),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = +2

Query  350  EKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEP  529
            E   KGHDMLAPFT+GW++ ++ P+++ +SEGSYVYD NG+KYLD+LAGLWCTALGGNE 
Sbjct  56   EPKVKGHDMLAPFTSGWESNNVGPMIMARSEGSYVYDNNGRKYLDALAGLWCTALGGNES  115

Query  530  RLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQV  709
            RLV AA KQLNTLPFYHSFWN TT+PSLDLAKELL+ FTA KM K FFTNSGSEANDTQV
Sbjct  116  RLVAAATKQLNTLPFYHSFWNHTTQPSLDLAKELLEMFTARKMGKVFFTNSGSEANDTQV  175

Query  710  KLVWYYNNALGRPNKKKFIAREKSYHGS  793
            K+VWYYNNALGRP KKKFI+  K YHG+
Sbjct  176  KIVWYYNNALGRPKKKKFISHSKGYHGT  203



>ref|NP_001234340.1| gamma aminobutyrate transaminase 2 [Solanum lycopersicum]
 sp|Q84P53.1|GATP2_SOLLC RecName: Full=Gamma aminobutyrate transaminase 2; AltName: Full=Gamma-aminobutyrate 
transaminase isozyme 2; Short=LeGABA-TP2; 
Short=SlGABA-T2 [Solanum lycopersicum]
 gb|AAO92256.1| gamma-aminobutyrate transaminase subunit precursor isozyme 2 
[Solanum lycopersicum]
 dbj|BAG16483.1| gamma aminobutyrate transaminase isoform2 [Solanum lycopersicum]
Length=458

 Score =   249 bits (635),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 129/146 (88%), Gaps = 1/146 (1%)
 Frame = +2

Query  356  GFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRL  535
            GF GHDMLAPFTA W   D+ PLVI+K+EGSYVY +NGKKYLDSL+GLWCT LGG+EPRL
Sbjct  6    GFMGHDMLAPFTAAWMI-DMGPLVIDKAEGSYVYGVNGKKYLDSLSGLWCTVLGGSEPRL  64

Query  536  VDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKL  715
            ++AA KQLN   FYHSFWNRTTKPSLDLAKEL++ FTANKM K FFT+SGSEANDTQVKL
Sbjct  65   IEAASKQLNKSAFYHSFWNRTTKPSLDLAKELINMFTANKMGKVFFTSSGSEANDTQVKL  124

Query  716  VWYYNNALGRPNKKKFIAREKSYHGS  793
            VWYYNNA+GRPNKKK I+R+ +YHGS
Sbjct  125  VWYYNNAIGRPNKKKIISRKNAYHGS  150



>gb|AAK11219.1|AF324485_1 aminotransferase-like protein [Oryza sativa]
Length=483

 Score =   242 bits (617),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 132/166 (80%), Gaps = 3/166 (2%)
 Frame = +2

Query  305  RWSSAQVSVQ---NDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKK  475
            ++SS   S Q   +DS +E G K H MLAPFTA WQT    PLVIE+SEG YVYD+NG K
Sbjct  9    QYSSGAFSDQVPADDSAEEHGVKDHAMLAPFTAAWQTAISPPLVIERSEGCYVYDVNGTK  68

Query  476  YLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANK  655
            YLD+LAGL  TALGG+EPRLV AA +QLN LPFYHSFWN TT+PSLDLAKEL+  FTA +
Sbjct  69   YLDALAGLLSTALGGSEPRLVKAATEQLNKLPFYHSFWNHTTRPSLDLAKELISMFTARE  128

Query  656  MAKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            M K FFTNSGSEAND+QVK+VWYYNNALGRP KK  I+R +SYHG+
Sbjct  129  MGKVFFTNSGSEANDSQVKIVWYYNNALGRPKKKNIISRTQSYHGT  174



>ref|NP_001045660.1| Os02g0112900 [Oryza sativa Japonica Group]
 sp|Q6ZH29.1|GATP4_ORYSJ RecName: Full=Probable gamma-aminobutyrate transaminase 4; Short=OsGABA-T 
[Oryza sativa Japonica Group]
 dbj|BAD07632.1| putative 4-aminobutyrate aminotransferase [Oryza sativa Japonica 
Group]
 dbj|BAF07574.1| Os02g0112900 [Oryza sativa Japonica Group]
Length=483

 Score =   242 bits (617),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 132/166 (80%), Gaps = 3/166 (2%)
 Frame = +2

Query  305  RWSSAQVSVQ---NDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKK  475
            ++SS   S Q   +DS +E G K H MLAPFTA WQT    PLVIE+SEG YVYD+NG K
Sbjct  9    QYSSGAFSDQVPADDSAEEHGVKDHAMLAPFTAAWQTAISPPLVIERSEGCYVYDVNGTK  68

Query  476  YLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANK  655
            YLD+LAGL  TALGG+EPRLV AA +QLN LPFYHSFWN TT+PSLDLAKEL+  FTA +
Sbjct  69   YLDALAGLLSTALGGSEPRLVKAATEQLNKLPFYHSFWNHTTRPSLDLAKELISMFTARE  128

Query  656  MAKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            M K FFTNSGSEAND+QVK+VWYYNNALGRP KK  I+R +SYHG+
Sbjct  129  MGKVFFTNSGSEANDSQVKIVWYYNNALGRPKKKNIISRTQSYHGT  174



>gb|ABF69998.1| gamma-aminobutyrate transaminase, putative [Musa acuminata]
Length=534

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 122/136 (90%), Gaps = 0/136 (0%)
 Frame = +2

Query  305  RWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLD  484
            R  S+   +Q++ST+E+GFKGHDMLAPFTAGWQTTDLHPLVI+KSEGSYVYDINGKKYLD
Sbjct  23   RLMSSTAPLQSESTEERGFKGHDMLAPFTAGWQTTDLHPLVIDKSEGSYVYDINGKKYLD  82

Query  485  SLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAK  664
            +LAGLWCTALGGNEPRLV AA  QLN LPFYHSFWNRTTKPSLDLAKE+L+ FTA KM K
Sbjct  83   ALAGLWCTALGGNEPRLVAAATAQLNKLPFYHSFWNRTTKPSLDLAKEILEIFTARKMGK  142

Query  665  AFFTNSGSEANDTQVK  712
             FFTNSGSEAND+Q K
Sbjct  143  VFFTNSGSEANDSQAK  158



>gb|EEC77994.1| hypothetical protein OsI_17384 [Oryza sativa Indica Group]
Length=493

 Score =   241 bits (615),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +2

Query  359  FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  538
            FKGH MLAPFTAGW +TDL PL+IE+SEGSYVYD  G KYLD+LAGLWCTALGG+EPRLV
Sbjct  54   FKGHSMLAPFTAGWHSTDLEPLIIERSEGSYVYDSKGNKYLDTLAGLWCTALGGSEPRLV  113

Query  539  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLV  718
             AA  QLN LPFYHSFWN T KP LDLA+EL+  FTA +M K FFTNSGSEAND+QVKLV
Sbjct  114  KAATDQLNKLPFYHSFWNSTAKPPLDLAEELISMFTAKEMGKVFFTNSGSEANDSQVKLV  173

Query  719  WYYNNALGRPNKKKFIAREKS  781
            WYYNNALGRPNKKK IA+ ++
Sbjct  174  WYYNNALGRPNKKKIIAQSQA  194



>ref|XP_008451902.1| PREDICTED: LOW QUALITY PROTEIN: gamma aminobutyrate transaminase 
1, mitochondrial-like [Cucumis melo]
Length=447

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            MLAPFT+GW++ ++ P++I +SEG YVYD NG+KYLD+LAGLWCTALGGNE RLV AA K
Sbjct  1    MLAPFTSGWESNNVDPVIIARSEGPYVYDNNGRKYLDALAGLWCTALGGNESRLVAAATK  60

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            QLNTLPFYHSFWN TT+PSLDLAK+LL+ FTA KM K FFTNSGSEANDTQVK+VWYYNN
Sbjct  61   QLNTLPFYHSFWNHTTQPSLDLAKKLLEMFTARKMGKVFFTNSGSEANDTQVKIVWYYNN  120

Query  734  ALGRPNKKKFIAREKSYHGS  793
            ALGRP KKKFI+  K YHG+
Sbjct  121  ALGRPXKKKFISHSKGYHGT  140



>gb|EPS57260.1| hypothetical protein M569_17559, partial [Genlisea aurea]
Length=117

 Score =   225 bits (574),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +2

Query  359  FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  538
            FKGHDMLAPFTAGWQT+DL+PLVIE+SEGSYVYD++GKKYLDSLAGLWCTALGG+EPRLV
Sbjct  1    FKGHDMLAPFTAGWQTSDLNPLVIERSEGSYVYDVHGKKYLDSLAGLWCTALGGSEPRLV  60

Query  539  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQV  709
            DAA KQLN LPFYHSFWNRTTKPSLDLA ELLD FTANKMAK FFTNSGSEAND+QV
Sbjct  61   DAATKQLNKLPFYHSFWNRTTKPSLDLATELLDLFTANKMAKVFFTNSGSEANDSQV  117



>gb|EEE61675.1| hypothetical protein OsJ_16144 [Oryza sativa Japonica Group]
Length=435

 Score =   231 bits (589),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            MLAPFTAGW +TDL PL+IE+SEGSYVYD  G KYLD+LAGLWCTALGG+EPRLV AA  
Sbjct  1    MLAPFTAGWHSTDLEPLIIERSEGSYVYDSKGNKYLDTLAGLWCTALGGSEPRLVKAATD  60

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            QLN LPFYHSFWN T KP LDLA+EL+  FTA +M K FFTNSGSEAND+QVKLVWYYNN
Sbjct  61   QLNKLPFYHSFWNSTAKPPLDLAEELISMFTAKEMGKVFFTNSGSEANDSQVKLVWYYNN  120

Query  734  ALGRPNKKKFIAREKS  781
            ALGRPNKKK IA+ ++
Sbjct  121  ALGRPNKKKIIAQSQA  136



>ref|XP_010093137.1| putative aminotransferase y4uB [Morus notabilis]
 gb|EXB53589.1| putative aminotransferase y4uB [Morus notabilis]
Length=466

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 125/160 (78%), Gaps = 0/160 (0%)
 Frame = +2

Query  230  VGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTT  409
            +GS+ K++ A       I +  S  R  S            +GFKGHDMLAPFTAGWQ+T
Sbjct  23   LGSYAKYVYASRIPQDQIPQVSSLARHYSTATEAAASDPKSRGFKGHDMLAPFTAGWQST  82

Query  410  DLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFW  589
            DLHPLVIEKSEGSYVYDINGKKYLD+LAGLWCTALGGNEPRLV AA  QLNTLPFYHSFW
Sbjct  83   DLHPLVIEKSEGSYVYDINGKKYLDALAGLWCTALGGNEPRLVAAATAQLNTLPFYHSFW  142

Query  590  NRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQV  709
            NRTTKPSLDLAK+L++ FTA KM K FFTNSGS+ANDTQV
Sbjct  143  NRTTKPSLDLAKDLIEMFTARKMGKVFFTNSGSDANDTQV  182



>gb|EMS61591.1| putative aminotransferase y4uB [Triticum urartu]
Length=542

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 126/183 (69%), Gaps = 44/183 (24%)
 Frame = +2

Query  359  FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  538
            FKGH MLAPFTAGWQ+ D+HPL      GSYVYDING KYLDSLAGLWCTALGG+EPRLV
Sbjct  51   FKGHGMLAPFTAGWQSNDVHPL------GSYVYDINGNKYLDSLAGLWCTALGGSEPRLV  104

Query  539  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQ----  706
             AA  QLN LPFYHSFWNRTTKP+LDLA +LL  FTA+KM KAFFTNSGSEAND+     
Sbjct  105  KAATDQLNKLPFYHSFWNRTTKPTLDLADDLLSMFTASKMGKAFFTNSGSEANDSHMLCS  164

Query  707  ----------------------------------VKLVWYYNNALGRPNKKKFIAREKSY  784
                                              VKLVWYYNNALGRPNKKKFIAR K+Y
Sbjct  165  LRRVATIDTIYVALTVIRHSHLQRITKNCFTLCYVKLVWYYNNALGRPNKKKFIARSKAY  224

Query  785  HGS  793
            HGS
Sbjct  225  HGS  227



>ref|XP_002978448.1| hypothetical protein SELMODRAFT_177017 [Selaginella moellendorffii]
 gb|EFJ20434.1| hypothetical protein SELMODRAFT_177017 [Selaginella moellendorffii]
Length=463

 Score =   229 bits (584),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  332  QNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTA  511
            ++ + DE   + H+ML+PFTAGWQ   + PL+IEKSEG YVYD NG KYLD+LAGLW  A
Sbjct  3    KDAAKDEALEQRHNMLSPFTAGWQMVKVEPLIIEKSEGIYVYDTNGNKYLDALAGLWNNA  62

Query  512  LGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSE  691
            LGGNEPRLV+AA KQL+ LP+YHSFWNRTT  +L+LAKEL++ FT  KM++  FTNSGSE
Sbjct  63   LGGNEPRLVEAAKKQLDVLPYYHSFWNRTTPVTLELAKELVEMFTQVKMSRVLFTNSGSE  122

Query  692  ANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            +ND+QV+LVWYY NA+G+P+KKKFIAREK+YHGS
Sbjct  123  SNDSQVRLVWYYYNAIGKPHKKKFIAREKAYHGS  156



>ref|XP_002970285.1| hypothetical protein SELMODRAFT_270846 [Selaginella moellendorffii]
 gb|EFJ28415.1| hypothetical protein SELMODRAFT_270846 [Selaginella moellendorffii]
Length=463

 Score =   229 bits (584),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 104/154 (68%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  332  QNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTA  511
            ++ + DE   + H+ML+PFTAGWQ   + PL+IEKSEG YVYD NG KYLD+LAGLW  A
Sbjct  3    KDAAKDEALEQRHNMLSPFTAGWQMVKVEPLIIEKSEGIYVYDTNGNKYLDALAGLWNNA  62

Query  512  LGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSE  691
            LGGNEPRLV+AA KQL+ LP+YHSFWNRTT  +L+LAKEL++ FT  KM++  FTNSGSE
Sbjct  63   LGGNEPRLVEAAKKQLDVLPYYHSFWNRTTPVTLELAKELVEMFTQVKMSRVLFTNSGSE  122

Query  692  ANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            +ND+QV+LVWYY NA+G+P+KKKFIAREK+YHGS
Sbjct  123  SNDSQVRLVWYYYNAIGKPHKKKFIAREKAYHGS  156



>ref|XP_001783174.1| predicted protein [Physcomitrella patens]
 gb|EDQ52005.1| predicted protein [Physcomitrella patens]
Length=494

 Score =   230 bits (586),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +2

Query  368  HDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAA  547
            H MLAPFTAGWQ     PLVIE+ EG YV+D  G KYLD+LAGLWCTALG +E RLV AA
Sbjct  44   HSMLAPFTAGWQMKAGTPLVIERGEGVYVWDNKGNKYLDALAGLWCTALGFSEKRLVAAA  103

Query  548  MKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYY  727
             KQL+TLPFYH+FWNRT++P+LDLA EL   FTA++M+K FF NSGSEANDTQVKLVWYY
Sbjct  104  EKQLSTLPFYHNFWNRTSQPTLDLASELSKLFTASEMSKVFFCNSGSEANDTQVKLVWYY  163

Query  728  NNALGRPNKKKFIAREKSYHGS  793
            NNA+GRPNKKKFIAR+KSYHGS
Sbjct  164  NNAIGRPNKKKFIARQKSYHGS  185



>ref|XP_008662070.1| PREDICTED: aminotransferase y4uB isoform X1 [Zea mays]
Length=442

 Score =   218 bits (554),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  440  EGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDL  619
            +GSYVYDING KYLDSLAGLWCTALGG+EPRLV AA +QLN LPFYHSFWNRTTKPSLDL
Sbjct  15   QGSYVYDINGNKYLDSLAGLWCTALGGSEPRLVKAATEQLNNLPFYHSFWNRTTKPSLDL  74

Query  620  AKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            A+E+L  FTA +M K FFTNSGSEAND+QVKLVWYYNNALGRP+KKKFIAR K+YHGS
Sbjct  75   AQEILSMFTAREMGKVFFTNSGSEANDSQVKLVWYYNNALGRPDKKKFIARSKAYHGS  132



>gb|EMT11453.1| Putative aminotransferase y4uB [Aegilops tauschii]
Length=516

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 113/138 (82%), Gaps = 6/138 (4%)
 Frame = +2

Query  398  WQTTDLH------PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQL  559
            W  TDL        +++    GSYVYDING KYLDSLAGLWCTALGG+EPRLV AA  QL
Sbjct  72   WLLTDLRLRLSNSSIILHAMVGSYVYDINGNKYLDSLAGLWCTALGGSEPRLVKAATDQL  131

Query  560  NTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNAL  739
            N LPFYHSFWNRTTKP+LDLA +LL  FTA+KM KAFFTNSGSEAND+ VKLVWYYNNAL
Sbjct  132  NKLPFYHSFWNRTTKPTLDLADDLLSMFTASKMGKAFFTNSGSEANDSHVKLVWYYNNAL  191

Query  740  GRPNKKKFIAREKSYHGS  793
            GRPNKKKFIAR K+YHGS
Sbjct  192  GRPNKKKFIARSKAYHGS  209



>ref|XP_001762156.1| predicted protein [Physcomitrella patens]
 gb|EDQ72948.1| predicted protein [Physcomitrella patens]
Length=455

 Score =   211 bits (537),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 113/145 (78%), Gaps = 0/145 (0%)
 Frame = +2

Query  359  FKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLV  538
            + GH MLAPFT+G Q  +  PL+I K EG YV+D NGKKYLD+LAGLWC ++G +E RL+
Sbjct  2    YHGHSMLAPFTSGSQQMETEPLIIAKGEGVYVWDRNGKKYLDALAGLWCASMGFSEKRLM  61

Query  539  DAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLV  718
            +AA  Q+  LPFYHSFWNRT++P LDLAKEL+D F   KM K FF N+GSEANDTQVKL 
Sbjct  62   NAAWNQMTQLPFYHSFWNRTSQPPLDLAKELIDIFKPVKMGKVFFCNTGSEANDTQVKLA  121

Query  719  WYYNNALGRPNKKKFIAREKSYHGS  793
            WYYNNALGR  KKK I+R  SYHGS
Sbjct  122  WYYNNALGREKKKKIISRHSSYHGS  146



>gb|EMT06765.1| Putative aminotransferase y4uB [Aegilops tauschii]
Length=499

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 110/153 (72%), Gaps = 29/153 (19%)
 Frame = +2

Query  353  KGFKGHDMLAPFTAGWQTTDLHPLVIEKSE-----------------------------G  445
            + FKGH MLAPFTAGWQ+TD+HPLVI++SE                             G
Sbjct  54   EAFKGHGMLAPFTAGWQSTDVHPLVIDRSEVLGLNAHLSINCSDFNLKVLSYTLQLILQG  113

Query  446  SYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAK  625
            +YVYDINGKKY+D+LAGLWCTALGG+EPRLV AA +QLN LPFYHSFWNRTTKPSLDLA 
Sbjct  114  AYVYDINGKKYIDALAGLWCTALGGSEPRLVKAATEQLNKLPFYHSFWNRTTKPSLDLAN  173

Query  626  ELLDTFTANKMAKAFFTNSGSEANDTQVKLVWY  724
            ++L+ FTA +M K FF NSGSEAND+Q+  + Y
Sbjct  174  DVLNMFTAREMGKVFFANSGSEANDSQLCNIIY  206



>gb|EEC77996.1| hypothetical protein OsI_17386 [Oryza sativa Indica Group]
Length=2239

 Score =   189 bits (479),  Expect = 6e-50, Method: Composition-based stats.
 Identities = 87/114 (76%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +2

Query  440   EGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDL  619
             +GSYVYD  G KYLD+LAGLWCTALGG+EPRLV AA  QLN LPFYHSFWN T KP LDL
Sbjct  1887  QGSYVYDSKGNKYLDTLAGLWCTALGGSEPRLVKAATDQLNKLPFYHSFWNSTAKPPLDL  1946

Query  620   AKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKS  781
             A+EL+  FTA +M K FFTNSGSEAND+QVKLVWYYNNALGRPNKKK IA+ ++
Sbjct  1947  AEELISMFTAKEMGKVFFTNSGSEANDSQVKLVWYYNNALGRPNKKKIIAQSQA  2000



>ref|WP_041862975.1| aminotransferase [Bordetella petrii]
Length=454

 Score =   174 bits (440),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 104/138 (75%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T         P+VIE+ EG YVYD  G++YL+ +AGLW  A+G  E RLV+AA +Q
Sbjct  16   LHPYTNAVVHQRTGPIVIERGEGVYVYDDQGRRYLEGMAGLWSVAVGFGEQRLVEAATRQ  75

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            L  LP+YH+F +++  P+++LA+ L+  +T  +MAKAFFTNSGSEANDT +KLVWYYNNA
Sbjct  76   LQKLPYYHTFTHKSHAPAIELAERLIG-YTEGRMAKAFFTNSGSEANDTVIKLVWYYNNA  134

Query  737  LGRPNKKKFIAREKSYHG  790
            LGRP+KKK IAR++ YHG
Sbjct  135  LGRPDKKKIIARQRGYHG  152



>emb|CAP43438.1| putative aminotransferase [Bordetella petrii]
Length=456

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 104/138 (75%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T         P+VIE+ EG YVYD  G++YL+ +AGLW  A+G  E RLV+AA +Q
Sbjct  18   LHPYTNAVVHQRTGPIVIERGEGVYVYDDQGRRYLEGMAGLWSVAVGFGEQRLVEAATRQ  77

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            L  LP+YH+F +++  P+++LA+ L+  +T  +MAKAFFTNSGSEANDT +KLVWYYNNA
Sbjct  78   LQKLPYYHTFTHKSHAPAIELAERLIG-YTEGRMAKAFFTNSGSEANDTVIKLVWYYNNA  136

Query  737  LGRPNKKKFIAREKSYHG  790
            LGRP+KKK IAR++ YHG
Sbjct  137  LGRPDKKKIIARQRGYHG  154



>ref|WP_044433671.1| aminotransferase [Skermanella aerolata]
 gb|KJB92497.1| aminotransferase [Skermanella aerolata KACC 11604]
Length=464

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 102/138 (74%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T      D+ PLVIE+ EG +V+D +GK Y++ +AGLWCT+LG  E RLV+AA +Q
Sbjct  18   LHPYTNLKTHEDVGPLVIERGEGVHVFDDSGKAYIEGMAGLWCTSLGFGEERLVEAATRQ  77

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            L  LPFYH+F ++   P +DLA+ L+       M+K FFTNSGSEANDT VKLVWYYNNA
Sbjct  78   LRKLPFYHAFTHKAHDPGIDLAEALIK-IAPVPMSKVFFTNSGSEANDTVVKLVWYYNNA  136

Query  737  LGRPNKKKFIAREKSYHG  790
            LGRP+KKK IAR+K YHG
Sbjct  137  LGRPHKKKIIARQKGYHG  154



>ref|WP_026641250.1| aminotransferase [Bordetella petrii]
Length=455

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 105/138 (76%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T         P+VI++ EG YVYD  G++YL+++AGLW  A+G  E RLVDAA +Q
Sbjct  16   LHPYTNAVVHQRTGPVVIDRGEGIYVYDDQGRQYLEAMAGLWSVAVGFGEQRLVDAATRQ  75

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            +  LP+YH+F +++  P+++LA+ L+  +T  +MAKAFFTNSGSEANDT +KLVWYYNNA
Sbjct  76   MQKLPYYHTFTHKSHTPAIELAERLIG-YTDGRMAKAFFTNSGSEANDTVIKLVWYYNNA  134

Query  737  LGRPNKKKFIAREKSYHG  790
            LGRP+KKK IAR++ YHG
Sbjct  135  LGRPDKKKIIARQRGYHG  152



>ref|XP_011468608.1| PREDICTED: gamma aminobutyrate transaminase 1, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=288

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  515  GGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEA  694
            GGNE RLV+AA +QLNTLPFYHSFWNRTT+PSLDLAK+LL+TFTA KMAK FFTNSGSEA
Sbjct  52   GGNELRLVEAATRQLNTLPFYHSFWNRTTRPSLDLAKDLLETFTARKMAKVFFTNSGSEA  111

Query  695  NDTQVKLVWYYNNALGRPNKKKFIAREKSY  784
            NDTQVKLVWYYNNAL RP KKKFIAR+KSY
Sbjct  112  NDTQVKLVWYYNNALARPEKKKFIARQKSY  141



>ref|WP_018897972.1| aminotransferase [Rhizobium sp. 2MFCol3.1]
Length=458

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 106/138 (77%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T   +  ++ P+VIEK EG YVYD +G +Y++ LAGLW  A+G NEPRLVDAA +Q
Sbjct  18   LHPYTDARRHEEIGPMVIEKGEGIYVYDADGNRYIEGLAGLWSVAVGFNEPRLVDAAAQQ  77

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            +  LP+YH+F ++  +PS+ LA++L++  T + + + F+T+SGSEANDT VK++WY NNA
Sbjct  78   MAKLPYYHTFSHKAHEPSIRLAEKLVE-MTPDNLTRVFYTSSGSEANDTVVKMIWYMNNA  136

Query  737  LGRPNKKKFIAREKSYHG  790
            LGRPNKKKF+AR K YHG
Sbjct  137  LGRPNKKKFLARNKGYHG  154



>ref|XP_008652184.1| PREDICTED: gamma-aminobutyrate transaminase 1, mitochondrial-like 
isoform X1 [Zea mays]
Length=124

 Score =   161 bits (407),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  440  EGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDL  619
            +GSYVYDING KYLDSLAGLWCTALGG+EPRLV AA +QLN LPFYHSFWNRTTKPSLDL
Sbjct  2    QGSYVYDINGNKYLDSLAGLWCTALGGSEPRLVKAATEQLNKLPFYHSFWNRTTKPSLDL  61

Query  620  AKELLDTFTANKMAKAFFTNSGSEANDTQ  706
            A+E+L  FTA +M K FFTNSGSEAND+Q
Sbjct  62   AQEILSMFTAREMGKVFFTNSGSEANDSQ  90



>ref|XP_008652185.1| PREDICTED: gamma-aminobutyrate transaminase 1, mitochondrial-like 
isoform X2 [Zea mays]
Length=120

 Score =   160 bits (406),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  440  EGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDL  619
            +GSYVYDING KYLDSLAGLWCTALGG+EPRLV AA +QLN LPFYHSFWNRTTKPSLDL
Sbjct  2    QGSYVYDINGNKYLDSLAGLWCTALGGSEPRLVKAATEQLNKLPFYHSFWNRTTKPSLDL  61

Query  620  AKELLDTFTANKMAKAFFTNSGSEANDTQ  706
            A+E+L  FTA +M K FFTNSGSEAND+Q
Sbjct  62   AQEILSMFTAREMGKVFFTNSGSEANDSQ  90



>ref|WP_013742690.1| aminotransferase [Pusillimonas sp. T7-7]
 gb|AEC20154.1| aminotransferase [Pusillimonas sp. T7-7]
Length=453

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 102/138 (74%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T   +   + P +IE+ EG YVYD  G+KY++ +AGLW  A+G NE RLVDAA +Q
Sbjct  16   LHPYTNAIKHRQVGPRIIERGEGIYVYDDQGRKYIEGMAGLWSVAVGFNEQRLVDAAQRQ  75

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            +  LPFYH+F ++T  PS++LA+ L+   T  +M+ AFFTNSGSEANDT +K+VWYYNNA
Sbjct  76   MQKLPFYHTFTHKTHTPSIELAERLVQA-TQGQMSTAFFTNSGSEANDTVIKMVWYYNNA  134

Query  737  LGRPNKKKFIAREKSYHG  790
            LGR +KKK IAR + YHG
Sbjct  135  LGRHDKKKIIARNRGYHG  152



>ref|WP_024509951.1| aminotransferase [Bradyrhizobium sp. ARR65]
Length=460

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = +2

Query  419  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  598
            PL++E+ EG YVYD NGK+Y++ LAGLW  A+G +E RL +AAMKQ+  LPFYH F++++
Sbjct  30   PLIMERGEGIYVYDTNGKQYIEGLAGLWSVAVGFSEKRLAEAAMKQMEKLPFYHIFFSKS  89

Query  599  TKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREK  778
             +PS+ L+ +L++     ++++ F+TNSGSEANDT +KLVWY NNALGRP KKKF+AR+K
Sbjct  90   HEPSIRLSDKLIEMAADPRLSRVFYTNSGSEANDTVIKLVWYMNNALGRPRKKKFLARQK  149

Query  779  SYHG  790
            +YHG
Sbjct  150  AYHG  153



>ref|WP_025516482.1| aminotransferase [Bordetella trematum]
Length=455

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 112/157 (71%), Gaps = 8/157 (5%)
 Frame = +2

Query  329  VQNDSTDEKGFKGHDM---LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGL  499
            + N S D++    HD+   L  +T G +  ++ P ++ + EG YVYD  G +YL+ +AGL
Sbjct  1    MSNLSQDQQ----HDIQYQLHSYTNGVKHAEVGPRIMARGEGIYVYDDKGNRYLEGMAGL  56

Query  500  WCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTN  679
            W  A+G  EPRLVDAA +QL  LP+YH+F +++    ++LA+ L+D +T  +MA+AFFTN
Sbjct  57   WSVAVGFGEPRLVDAATRQLQELPYYHTFTHKSHPAVIELAQRLID-YTEGRMARAFFTN  115

Query  680  SGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHG  790
            SGSEANDT VKLVWYY+NALGR +KKK IAR++ YHG
Sbjct  116  SGSEANDTVVKLVWYYHNALGRKDKKKIIARQRGYHG  152



>ref|WP_028355511.1| aminotransferase [Bordetella petrii]
Length=455

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 97/124 (78%), Gaps = 1/124 (1%)
 Frame = +2

Query  419  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  598
            P+VI++ EG YVYD  G++YL+++AGLW  A+G  E RL DAA +QL  LP+YH+F +++
Sbjct  30   PIVIDRGEGVYVYDDQGQRYLEAMAGLWSVAVGFGEQRLADAAARQLQKLPYYHTFTHKS  89

Query  599  TKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREK  778
              P+++LA+ L+  +T  +MAKAFFTNSGSEANDT VKLVWYYNNAL RP KKK IAR +
Sbjct  90   HAPAIELAERLIG-YTGGRMAKAFFTNSGSEANDTVVKLVWYYNNALDRPEKKKIIARLR  148

Query  779  SYHG  790
             YHG
Sbjct  149  GYHG  152



>ref|WP_034191978.1| aminotransferase [Burkholderia cenocepacia]
 gb|KEA55089.1| aminotransferase [Burkholderia cenocepacia]
Length=456

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 105/139 (76%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            +L P+T   +  D+ P+VIE+ EG YVYD  G +Y+++L+GL+C +LG +E RL DAA +
Sbjct  12   VLHPYTNLSRHRDVGPMVIERGEGVYVYDTEGNRYIEALSGLFCASLGFSEQRLADAADR  71

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            Q+  LPFYH+F +++++PS+ LA++L+       M+K FF NSGSEANDT VKL+WYYNN
Sbjct  72   QMRKLPFYHAFGHKSSEPSILLAEKLI-AMAPVPMSKVFFANSGSEANDTAVKLIWYYNN  130

Query  734  ALGRPNKKKFIAREKSYHG  790
            ALGRP KKK IAR ++YHG
Sbjct  131  ALGRPLKKKIIARTRAYHG  149



>ref|WP_017775036.1| aminotransferase [Burkholderia kururiensis]
Length=456

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 106/138 (77%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T      D+ P+VI++ EG YVYD  GK+Y+++L+GL+C +LG +E RL DAA +Q
Sbjct  13   LHPYTNLSLHRDVGPMVIDRGEGVYVYDTEGKRYIEALSGLFCASLGFSEQRLADAADRQ  72

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            +  LPFYH+F +++++PS+ LA++L+ +     M+K FF NSGSEANDT VKL+WYYNNA
Sbjct  73   MRKLPFYHAFGHKSSEPSILLAEKLI-SMAPVPMSKVFFANSGSEANDTAVKLIWYYNNA  131

Query  737  LGRPNKKKFIAREKSYHG  790
            +GRPNKKK I+R ++YHG
Sbjct  132  IGRPNKKKIISRVRAYHG  149



>ref|WP_018898134.1| hypothetical protein [Rhizobium sp. 2MFCol3.1]
Length=457

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 105/139 (76%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            +L P+T         PLVIE+ EG +VYD  GK+Y+++LAGLW  A+G +EPRLVDAA +
Sbjct  17   VLHPYTNARAHEKSGPLVIERGEGIHVYDTAGKQYIEALAGLWSVAVGFDEPRLVDAAAR  76

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            Q+  LP+YH F ++  +PS+ LA++L++   AN + + FFT+SGSEANDT VK+VWY NN
Sbjct  77   QMAKLPYYHIFSHKAHEPSVRLAEKLVEMTPAN-LTRVFFTSSGSEANDTVVKMVWYMNN  135

Query  734  ALGRPNKKKFIAREKSYHG  790
            ALGRP KKKF+AR+K+YHG
Sbjct  136  ALGRPEKKKFLARDKAYHG  154



>ref|WP_037454523.1| aminotransferase [Skermanella stibiiresistens]
 gb|EWY39385.1| aminotransferase [Skermanella stibiiresistens SB22]
Length=463

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 100/138 (72%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T       + PLVIE+  G +V+D +GK Y++ +AGLWCT+LG  E RLV+AA +Q
Sbjct  17   LHPYTNLKTHETVGPLVIERGSGVHVFDDSGKSYIEGMAGLWCTSLGFGEERLVEAAARQ  76

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            +  LPFYHSF ++   P +DLA+ L+       M+K FFT+SGSEANDT VKLVWY+NNA
Sbjct  77   MRKLPFYHSFGHKAHDPGIDLAEALIG-MAPVPMSKVFFTSSGSEANDTVVKLVWYHNNA  135

Query  737  LGRPNKKKFIAREKSYHG  790
            LGRPNKKK IAR+K YHG
Sbjct  136  LGRPNKKKIIARQKGYHG  153



>ref|WP_012417867.1| aminotransferase [Bordetella avium]
 emb|CAJ49815.1| gamma-aminobutyrate transaminase [Bordetella avium 197N]
Length=457

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 103/138 (75%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L  +T G +   + P ++ + EG YVYD  GK+YL+ +AGLW  A+G  EPRLVDAA +Q
Sbjct  16   LHSYTNGVKHAQVGPRIMTRGEGIYVYDDQGKRYLEGMAGLWSVAVGFGEPRLVDAATRQ  75

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            +  LP+YH+F +++    ++LA+ L+  +T  +MA+A+FTNSGSEANDT VKLVWYYNNA
Sbjct  76   MQELPYYHTFTHKSHPSVIELAERLIG-YTDGRMARAYFTNSGSEANDTVVKLVWYYNNA  134

Query  737  LGRPNKKKFIAREKSYHG  790
            LGR NKKK IAR+++YHG
Sbjct  135  LGRSNKKKIIARQRAYHG  152



>ref|WP_029014519.1| aminotransferase [Niveispirillum irakense]
Length=462

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = +2

Query  419  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  598
            PL+I   +G  V D +GK+Y++ +AGLWCT+LG +EPRLV+AA++Q+ TLPFYH+F +++
Sbjct  31   PLIIASGKGVTVTDESGKEYIEGVAGLWCTSLGFDEPRLVEAAIRQMRTLPFYHAFAHKS  90

Query  599  TKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREK  778
             +P++DLA++L+       M+K FF  SGSEANDT VKLVWYYNNALGRP KKK IAR+K
Sbjct  91   HEPAIDLAEQLI-ALAPVPMSKVFFACSGSEANDTAVKLVWYYNNALGRPQKKKIIARQK  149

Query  779  SYHG  790
            +YHG
Sbjct  150  AYHG  153



>ref|WP_039371201.1| aminotransferase [Mumia flava]
 gb|KHL08170.1| aminotransferase [Mumia flava]
Length=456

 Score =   165 bits (417),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 105/139 (76%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            +L P+T   +  D+ P+VIE+ EG YVYD  G +Y+++L+GL+C +LG +E RL DAA +
Sbjct  12   VLHPYTNLSRHRDVGPMVIERGEGVYVYDTEGNRYIEALSGLFCASLGFSESRLADAADR  71

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            Q+  LPFYH+F +++++PS+ LA++L+       M+K FF NSGSEANDT +KL+WYYNN
Sbjct  72   QMRKLPFYHAFGHKSSEPSILLAEKLI-AMAPVPMSKVFFANSGSEANDTAMKLIWYYNN  130

Query  734  ALGRPNKKKFIAREKSYHG  790
            ALGRP KKK IAR ++YHG
Sbjct  131  ALGRPLKKKIIARTRAYHG  149



>ref|WP_024810724.1| aminotransferase [Oceanicola sp. HL-35]
Length=461

 Score =   165 bits (417),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 105/138 (76%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T   +  +  P+VI++ EG +VYD NGKKY+++L+GLW  A+G NE RL DAAM Q
Sbjct  18   LHPYTDARKHEEQGPIVIDRGEGIHVYDSNGKKYIEALSGLWSVAVGFNEQRLCDAAMAQ  77

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            +  LP+YH+F +++ +PS+ LA++L++  T   + + F+T+SGSEANDT VK+VW+YNNA
Sbjct  78   MQKLPYYHTFAHKSHEPSIRLAEKLVE-MTPEHLTRVFYTSSGSEANDTVVKMVWFYNNA  136

Query  737  LGRPNKKKFIAREKSYHG  790
            LGRP KKKF+AR K YHG
Sbjct  137  LGRPEKKKFLARNKGYHG  154



>ref|WP_042300360.1| aminotransferase [Burkholderia kururiensis]
Length=456

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 106/138 (77%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T      D+ P+VI++ EG YVYD  GK+Y+++L+GL+C +LG +E RL DAA +Q
Sbjct  13   LHPYTNLSLHRDVGPMVIDRGEGVYVYDTEGKRYIEALSGLFCASLGFSEQRLADAADRQ  72

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            +  LPFYH+F +++++PS+ LA++L+ +     M+K FF NSGSEANDT VKL+WYYNNA
Sbjct  73   MRKLPFYHAFGHKSSEPSILLAEKLI-SMAPVPMSKVFFANSGSEANDTAVKLIWYYNNA  131

Query  737  LGRPNKKKFIAREKSYHG  790
            +GRP+KKK I+R ++YHG
Sbjct  132  IGRPDKKKIISRVRAYHG  149



>gb|EMS53048.1| putative aminotransferase y4uB [Triticum urartu]
Length=574

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 117/181 (65%), Gaps = 12/181 (7%)
 Frame = +2

Query  167  REAVAMINRLLGHTLKRATNQVGSHVKHLPAVsgshgsiirrrsPTRWSSAQVSVQNDST  346
            R++++   RL   T+     +  S VK++ +    HG      +  R  S++ S+Q DST
Sbjct  129  RDSLSFSYRLPIETVDVGEKEAESLVKYVASAGSWHGLHSFSEASARGFSSEPSLQADST  188

Query  347  DEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  526
            +E G              +     P +I   +G+YVYDINGKKY+D+LAGLWCTALGGNE
Sbjct  189  EEIG----------DCNLKVLSYTPQLI--LQGAYVYDINGKKYIDALAGLWCTALGGNE  236

Query  527  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQ  706
            PRLV AA +QLN LPFYHSFWNRTTKPSLDLA ++L+ FTA +M K FF NSGSEAND+Q
Sbjct  237  PRLVKAATEQLNKLPFYHSFWNRTTKPSLDLANDVLNMFTAREMGKVFFANSGSEANDSQ  296

Query  707  V  709
            +
Sbjct  297  I  297



>ref|WP_031360219.1| aminotransferase [Burkholderia sordidicola]
Length=458

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 102/138 (74%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T      ++ P+VI++ EG YVYD  G +Y++ L GL+C +LG +E RL DAA +Q
Sbjct  16   LHPYTNLSAHREVGPMVIDRGEGVYVYDTEGNRYIEGLGGLFCASLGFSESRLADAADRQ  75

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            +  LPFYH+F +++++PS+ LA++L+D      M+K FF NSGSEANDT +KL+WYYNNA
Sbjct  76   MRKLPFYHAFGHKSSEPSIRLAEKLID-MAPVPMSKVFFANSGSEANDTAIKLIWYYNNA  134

Query  737  LGRPNKKKFIAREKSYHG  790
            LGRP KKK I+R ++YHG
Sbjct  135  LGRPQKKKIISRTRAYHG  152



>ref|WP_043683550.1| aminotransferase [Castellaniella defragrans]
 emb|CDM25042.1| Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Castellaniella 
defragrans 65Phen]
Length=454

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 102/138 (74%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L  +T   Q   + P ++++  G +VYD  GK+Y++ ++GLW  A+G +EPRL   A +Q
Sbjct  16   LHAYTNAVQHQGIGPCIMDRGHGIHVYDTGGKEYIEGMSGLWSVAVGFSEPRLAQVAYEQ  75

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            +  LPFYH+F +++  PS++LA++L+   T  +MA+AFFTNSGSEANDT VK+VWYYNNA
Sbjct  76   MQRLPFYHTFSHKSNVPSIELAEKLIG-LTGGRMAQAFFTNSGSEANDTIVKMVWYYNNA  134

Query  737  LGRPNKKKFIAREKSYHG  790
            LGRP+KKK IAR++ YHG
Sbjct  135  LGRPDKKKIIARQRGYHG  152



>ref|WP_041710497.1| aminotransferase [Advenella kashmirensis]
Length=456

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 105/155 (68%), Gaps = 5/155 (3%)
 Frame = +2

Query  326  SVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWC  505
            S+    +D+  F  H    P+T         PLVI + +G YV D NGKKY++++AGLW 
Sbjct  4    SISQQGSDDIAFHMH----PYTNAITHASQGPLVITRGDGIYVEDENGKKYIEAMAGLWS  59

Query  506  TALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSG  685
             A+G +E RLVDAAM+Q+ TLPFYH F ++T + ++  AK L+D      M+K FFTNSG
Sbjct  60   VAVGFSEQRLVDAAMRQMQTLPFYHLFTHKTHEAAVRFAKTLID-LAPVPMSKVFFTNSG  118

Query  686  SEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHG  790
            SEANDT +KL+WY +NALG+PNKKK IAR K YHG
Sbjct  119  SEANDTVMKLLWYRSNALGQPNKKKLIARHKGYHG  153



>ref|WP_023048105.1| MULTISPECIES: aminotransferase [Pseudomonas]
 gb|ERT17847.1| aminotransferase [Pseudomonas putida SJ3]
 gb|AHC35732.1| aminotransferase [Pseudomonas sp. TKP]
 gb|ETK14138.1| aminotransferase [Pseudomonas sp. FH1]
 gb|EZN87292.1| hypothetical protein AJ67_04667 [Pseudomonas aeruginosa 3580]
 gb|EZN88306.1| hypothetical protein AJ68_04436 [Pseudomonas aeruginosa 3581]
 gb|AIG01262.1| aminotransferase [Pseudomonas fluorescens]
 gb|AIN58561.1| aminotransferase [Pseudomonas mosselii SJ10]
 gb|AJG14397.1| aminotransferase [Pseudomonas plecoglossicida]
Length=455

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 101/138 (73%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T      +L PL+IE+ EG YVYD  GK Y++++AGLW  ALG +  RL+ AA +Q
Sbjct  17   LHPYTNARLHQELGPLIIERGEGIYVYDDQGKGYIEAMAGLWSAALGFSNQRLIKAAEQQ  76

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
             NTLPFYH F +++ +PS++LA++L++      M+K FFTNSGSEANDT VK+VWY NNA
Sbjct  77   FNTLPFYHLFSHKSHRPSIELAEKLIE-MAPVPMSKVFFTNSGSEANDTVVKMVWYLNNA  135

Query  737  LGRPNKKKFIAREKSYHG  790
            LG+P KKKFI+R   YHG
Sbjct  136  LGKPAKKKFISRVNGYHG  153



>ref|WP_012367259.1| aminotransferase [Burkholderia ambifaria]
 gb|ACB69025.1| aminotransferase class-III [Burkholderia ambifaria MC40-6]
Length=456

 Score =   162 bits (411),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 105/139 (76%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            +L P+T      ++ P+VIE+ EG YVYD +G +Y+++L+GL+C +LG +E RL DAA +
Sbjct  12   VLHPYTNLSLHREVGPMVIERGEGVYVYDTDGNRYIEALSGLFCASLGFSESRLADAADR  71

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            Q+  LPFYH+F +++++P + LA++L+ +     M+K FF NSGSEANDT VKL+WYYNN
Sbjct  72   QMRRLPFYHAFGHKSSEPVILLAEKLI-SMAPVPMSKVFFANSGSEANDTAVKLIWYYNN  130

Query  734  ALGRPNKKKFIAREKSYHG  790
            ALGRP+KKK I R ++YHG
Sbjct  131  ALGRPSKKKIIVRTRAYHG  149



>ref|WP_025374662.1| aminotransferase [Advenella mimigardefordensis]
 gb|AHG65965.1| aminotransferase [Advenella mimigardefordensis DPN7]
Length=456

 Score =   162 bits (410),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 103/155 (66%), Gaps = 5/155 (3%)
 Frame = +2

Query  326  SVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWC  505
            S+    +D+  F  H    P+T         PLVI + +G YV D NGKKY++++AGLW 
Sbjct  4    SISQQGSDDIAFHMH----PYTNAITHASQGPLVITRGDGIYVEDENGKKYIEAMAGLWS  59

Query  506  TALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSG  685
             A+G +E RLVDAAM+Q+ TLPFYH F ++T   ++  AK L+D      M+K FFTNSG
Sbjct  60   VAVGFSEQRLVDAAMRQMQTLPFYHLFTHKTHDAAVRFAKTLID-LAPVPMSKVFFTNSG  118

Query  686  SEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHG  790
            SEANDT +KLVWY +NALG PNKKK IAR K YHG
Sbjct  119  SEANDTVMKLVWYRSNALGLPNKKKLIARNKGYHG  153



>ref|WP_026987379.1| aminotransferase [Fodinicurvata fenggangensis]
Length=462

 Score =   162 bits (410),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 99/138 (72%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T   +  +  PL+++  +G +VYD  GK+Y++ + GLWC ALG  E RLV AA +Q
Sbjct  17   LHPYTNARRHEESGPLIVDHGKGVHVYDDQGKEYIEGMGGLWCVALGFGEERLVKAATEQ  76

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            +  LP+YHSF  ++ +PS++L++ LLD     ++ K F+ NSGSEANDT VKLVWYYNNA
Sbjct  77   MQRLPYYHSFAQKSHEPSIELSERLLD-MAPGELGKVFYANSGSEANDTVVKLVWYYNNA  135

Query  737  LGRPNKKKFIAREKSYHG  790
            LGRPNKKK I+R K YHG
Sbjct  136  LGRPNKKKIISRIKGYHG  153



>ref|WP_032964494.1| aminotransferase [Bordetella hinzii]
 gb|KCB21262.1| aminotransferase, class III [Bordetella hinzii OH87 BAL007II]
 gb|KCB33411.1| aminotransferase, class III [Bordetella hinzii CA90 BAL1384]
 gb|KCB43826.1| aminotransferase, class III [Bordetella hinzii 5132]
Length=457

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 100/138 (72%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L  +T   +   + P ++ + EG YVYD  G +YL+ ++GLW  A+G  EPRLVDAA +Q
Sbjct  16   LHSYTNAVKHAQVGPRIMTRGEGIYVYDDKGNRYLEGMSGLWSVAVGFGEPRLVDAAARQ  75

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            L  LP+YH+F +++    ++L++ L+D +T  +MA+AFFTNSGSEANDT VKLVWYYNNA
Sbjct  76   LQELPYYHTFTHKSHPSVIELSQRLID-YTEGRMARAFFTNSGSEANDTVVKLVWYYNNA  134

Query  737  LGRPNKKKFIAREKSYHG  790
            LGR  KKK IAR++ YHG
Sbjct  135  LGREGKKKIIARQRGYHG  152



>ref|WP_034802113.1| aminotransferase [Ensifer adhaerens]
Length=451

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 101/139 (73%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            ++ P+T      ++ P VI   EG YV D  GK+Y++ LAGL+C  LG +EPRLV+AA +
Sbjct  6    LVHPYTNLAVHQEVGPHVITGGEGIYVVDDQGKRYIEGLAGLFCAGLGFSEPRLVEAATR  65

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            QL T+PFYHSF +++T+P + LA++LL+      M+K FF  SGSEANDT +KLVWYYNN
Sbjct  66   QLKTMPFYHSFAHKSTEPGIRLAEKLLE-MAPVPMSKVFFAGSGSEANDTAIKLVWYYNN  124

Query  734  ALGRPNKKKFIAREKSYHG  790
            A+GRP KKK I+R K+YHG
Sbjct  125  AVGRPEKKKIISRRKAYHG  143



>gb|AFK64419.1| aminotransferase [Advenella kashmirensis WT001]
Length=514

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 105/155 (68%), Gaps = 5/155 (3%)
 Frame = +2

Query  326  SVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWC  505
            S+    +D+  F  H    P+T         PLVI + +G YV D NGKKY++++AGLW 
Sbjct  62   SISQQGSDDIAFHMH----PYTNAITHASQGPLVITRGDGIYVEDENGKKYIEAMAGLWS  117

Query  506  TALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSG  685
             A+G +E RLVDAAM+Q+ TLPFYH F ++T + ++  AK L+D      M+K FFTNSG
Sbjct  118  VAVGFSEQRLVDAAMRQMQTLPFYHLFTHKTHEAAVRFAKTLID-LAPVPMSKVFFTNSG  176

Query  686  SEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHG  790
            SEANDT +KL+WY +NALG+PNKKK IAR K YHG
Sbjct  177  SEANDTVMKLLWYRSNALGQPNKKKLIARHKGYHG  211



>ref|WP_043209568.1| aminotransferase [Bordetella hinzii]
 gb|KCB38207.1| aminotransferase, class III [Bordetella hinzii 8-296-03]
Length=457

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 101/138 (73%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L  +T   +   + P ++ + EG YVYD  G +YL+ ++GLW  A+G  EPRLVDAA +Q
Sbjct  16   LHSYTNAVKHAQVGPRIMTRGEGIYVYDDKGNRYLEGMSGLWSVAVGFGEPRLVDAAARQ  75

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            L  LP+YH+F +++    ++L++ L+D +T  +MA+AFFTNSGSEANDT VKLVWYY+NA
Sbjct  76   LQELPYYHTFTHKSHPSVIELSQRLID-YTEGRMARAFFTNSGSEANDTVVKLVWYYSNA  134

Query  737  LGRPNKKKFIAREKSYHG  790
            LGR NKKK IAR++ YHG
Sbjct  135  LGRENKKKIIARQRGYHG  152



>ref|WP_029579725.1| aminotransferase [Bordetella hinzii]
 gb|KCB26803.1| aminotransferase, class III [Bordetella hinzii L60]
 gb|KCB49113.1| aminotransferase, class III [Bordetella hinzii 1277]
 gb|KCB49784.1| aminotransferase, class III [Bordetella hinzii 4161]
Length=457

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 100/138 (72%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L  +T   +   + P ++ + EG YVYD  G +YL+ ++GLW  A+G  EPRLVDAA +Q
Sbjct  16   LHSYTNAVKHAQVGPRIMTRGEGIYVYDDKGNRYLEGMSGLWSVAVGFGEPRLVDAAARQ  75

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            L  LP+YH+F +++    ++L++ L+D +T  +MA+AFFTNSGSEANDT VKLVWYYNNA
Sbjct  76   LQELPYYHTFTHKSHPSVIELSQRLID-YTEGRMARAFFTNSGSEANDTVVKLVWYYNNA  134

Query  737  LGRPNKKKFIAREKSYHG  790
            LGR  KKK IAR++ YHG
Sbjct  135  LGREGKKKIIARQRGYHG  152



>ref|WP_041798615.1| aminotransferase [Rhodopseudomonas palustris]
Length=459

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 100/139 (72%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            +  P+T   Q   + P+VIE+ EG +VYD NG++YL++LAGLW  A+G  EPRLV+AA K
Sbjct  14   LFHPYTNPRQHEQVGPVVIERGEGVFVYDTNGQRYLEALAGLWSVAVGFGEPRLVEAAAK  73

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            Q++ LPFYH F +++  P + LA +L       +++   F+NSGSEAND+ VKLVW+YNN
Sbjct  74   QMSMLPFYHLFAHKSHSPGIRLADKLC-AMAPGQLSHVLFSNSGSEANDSVVKLVWFYNN  132

Query  734  ALGRPNKKKFIAREKSYHG  790
            +LGRP KKKFIAR+  YHG
Sbjct  133  SLGRPEKKKFIARKNGYHG  151



>gb|ABD06201.1| aminotransferase [Rhodopseudomonas palustris HaA2]
Length=463

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 100/139 (72%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            +  P+T   Q   + P+VIE+ EG +VYD NG++YL++LAGLW  A+G  EPRLV+AA K
Sbjct  18   LFHPYTNPRQHEQVGPVVIERGEGVFVYDTNGQRYLEALAGLWSVAVGFGEPRLVEAAAK  77

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            Q++ LPFYH F +++  P + LA +L       +++   F+NSGSEAND+ VKLVW+YNN
Sbjct  78   QMSMLPFYHLFAHKSHSPGIRLADKLC-AMAPGQLSHVLFSNSGSEANDSVVKLVWFYNN  136

Query  734  ALGRPNKKKFIAREKSYHG  790
            +LGRP KKKFIAR+  YHG
Sbjct  137  SLGRPEKKKFIARKNGYHG  155



>gb|KDP71648.1| aminotransferase [Ensifer adhaerens]
Length=461

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 101/139 (73%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            ++ P+T      ++ P VI   EG YV D  GK+Y++ LAGL+C  LG +EPRLV+AA +
Sbjct  16   LVHPYTNLAVHQEVGPHVITGGEGIYVVDDQGKRYIEGLAGLFCAGLGFSEPRLVEAATR  75

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            QL T+PFYHSF +++T+P + LA++LL+      M+K FF  SGSEANDT +KLVWYYNN
Sbjct  76   QLKTMPFYHSFAHKSTEPGIRLAEKLLE-MAPVPMSKVFFAGSGSEANDTAIKLVWYYNN  134

Query  734  ALGRPNKKKFIAREKSYHG  790
            A+GRP KKK I+R K+YHG
Sbjct  135  AVGRPEKKKIISRRKAYHG  153



>ref|WP_005014723.1| aminotransferase [Bordetella holmesii]
 gb|EMD70840.1| aminotransferase [Bordetella holmesii F627]
 gb|EMD74973.1| aminotransferase [Bordetella holmesii H558]
 gb|EWM45293.1| aminotransferase class-III family protein [Bordetella holmesii 
70147]
 gb|EWM48268.1| aminotransferase class-III family protein [Bordetella holmesii 
41130]
 gb|EXF90232.1| aminotransferase class-III family protein [Bordetella holmesii 
30539]
 gb|EXX94595.1| aminotransferase class-III family protein [Bordetella holmesii 
1058]
 gb|AHV94739.1| aminotransferase class-III family protein [Bordetella holmesii 
ATCC 51541]
 gb|KAK82596.1| aminotransferase, class III [Bordetella holmesii CDC-H572-BH]
 gb|KAK83239.1| aminotransferase, class III [Bordetella holmesii CDC-H809-BH]
 gb|KAK85369.1| aminotransferase, class III [Bordetella holmseii H620]
 gb|KAK90974.1| aminotransferase, class III [Bordetella holmesii CDC-H635-BH]
 gb|KAK95337.1| aminotransferase, class III [Bordetella holmesii CDC-H585-BH]
 gb|KCV03716.1| aminotransferase, class III [Bordetella holmesii CDC-H629-BH]
 gb|KCV04775.1| aminotransferase, class III [Bordetella holmesii CDC-H719-BH]
 gb|KCV09448.1| aminotransferase, class III [Bordetella holmesii 04P3421]
 gb|KCV12082.1| aminotransferase, class III [Bordetella holmesii CDC-H785-BH]
 gb|KCV18319.1| aminotransferase, class III [Bordetella holmesii CDC-H643-BH]
 gb|AIT24727.1| aminotransferase class-III family protein [Bordetella holmesii 
44057]
Length=457

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 100/138 (72%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L  +T   +   + P +I + EG YVYD  G +YL+ +AGLW  A+G  EPRLVDAA +Q
Sbjct  16   LHSYTNAIKHAQVGPRIITRGEGIYVYDDKGNRYLEGMAGLWSVAVGFGEPRLVDAATRQ  75

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            L  LP+YH+F +++    ++L++ L+  +T  +MA+AFFTNSGSEANDT VKLVWYYNNA
Sbjct  76   LQELPYYHTFTHKSHPSVIELSERLIG-YTEGRMAQAFFTNSGSEANDTVVKLVWYYNNA  134

Query  737  LGRPNKKKFIAREKSYHG  790
            LGR +KKK IAR++ YHG
Sbjct  135  LGRTDKKKIIARQRGYHG  152



>ref|WP_012566210.1| aminotransferase [Rhodospirillum centenum]
 gb|ACI98421.1| aminotransferase, class III [Rhodospirillum centenum SW]
Length=467

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 101/139 (73%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            +L P+T       + P+VI    G  V D  G++Y++ +AGLWCT+LG +EPRLV+AA++
Sbjct  20   LLHPYTNLKAHESVGPMVITGGRGVTVVDDAGREYIEGVAGLWCTSLGFDEPRLVEAAVR  79

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            QL TLPFYH+F +++ +P ++LA++L+       M+KAFF  SGSEANDT VKLVWYYNN
Sbjct  80   QLRTLPFYHAFAHKSHEPGIELAEKLV-ALAPVPMSKAFFACSGSEANDTAVKLVWYYNN  138

Query  734  ALGRPNKKKFIAREKSYHG  790
            ALGRP KKK I R K+YHG
Sbjct  139  ALGRPQKKKIIGRIKAYHG  157



>ref|WP_043683574.1| aminotransferase [Castellaniella defragrans]
 emb|CDM25054.1| Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Castellaniella 
defragrans 65Phen]
Length=453

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 96/124 (77%), Gaps = 1/124 (1%)
 Frame = +2

Query  419  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  598
            P ++ +  G +VYD  GK+Y++ ++GLW  A+G +EPRL +AA +Q+  LPFYH+F  ++
Sbjct  30   PCIMARGNGIHVYDTEGKEYIEGMSGLWSVAVGFSEPRLAEAARRQMECLPFYHTFSQKS  89

Query  599  TKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREK  778
              PS++LA++L+   T  +MA+AFFTNSGSEANDT VK+VWYYNNALGRP KKK IAR++
Sbjct  90   NVPSIELAEKLIG-LTGGRMAQAFFTNSGSEANDTIVKMVWYYNNALGRPAKKKIIARKR  148

Query  779  SYHG  790
             YHG
Sbjct  149  GYHG  152



>ref|WP_035541932.1| aminotransferase [Burkholderia sp. UYPR1.413]
Length=456

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 102/138 (74%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T      ++ P+VIE+ EG YVYD  GK+YL+ L GL+C +LG +E RL DAA  Q
Sbjct  13   LHPYTNLSLHREVGPMVIERGEGVYVYDSEGKRYLEGLGGLFCASLGFSEHRLADAADGQ  72

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            +  LPFYH+F +++++PS+ LA++L+ +     M+K FF NSGSEANDT VKL+WY+NNA
Sbjct  73   MRKLPFYHAFGHKSSEPSIRLAEKLI-SIAPVPMSKVFFANSGSEANDTAVKLIWYFNNA  131

Query  737  LGRPNKKKFIAREKSYHG  790
            +GRP KKK I+R ++YHG
Sbjct  132  IGRPQKKKIISRTRAYHG  149



>ref|WP_040121086.1| aminotransferase [Sinorhizobium meliloti]
 gb|AIM03675.1| aminotransferase [Sinorhizobium meliloti]
Length=461

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 101/139 (73%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            ++ P+T      +  P VI   +G YV D +GK+Y++ LAGL+C  LG +EPRLV+AA +
Sbjct  16   LVHPYTNLAVHQETGPHVITGGDGIYVVDDHGKRYIEGLAGLFCAGLGFSEPRLVEAATR  75

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            QL T+PFYHSF +++T+P + LA++LL T     M+K FF  SGSEANDT +KL+WYYNN
Sbjct  76   QLKTMPFYHSFAHKSTEPGIRLAEKLL-TIAPVPMSKVFFAGSGSEANDTAIKLIWYYNN  134

Query  734  ALGRPNKKKFIAREKSYHG  790
            ALGRP KKK I+R K+YHG
Sbjct  135  ALGRPGKKKIISRRKAYHG  153



>ref|WP_037458242.1| aminotransferase [Skermanella stibiiresistens]
 gb|EWY37755.1| aminotransferase [Skermanella stibiiresistens SB22]
Length=462

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 102/138 (74%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T   +  ++ P++I++ EG YVYD +GK+Y++++AGLW  A+G  E RLVDAA +Q
Sbjct  18   LHPYTNARRHEEVGPIIIDRGEGVYVYDDSGKQYIEAMAGLWSVAVGFGEKRLVDAAARQ  77

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            +  LP+YH+F  +  +PS+ LA+ L+     N +++ FFTNSGSEANDT VK+VWYYNNA
Sbjct  78   MAKLPYYHTFSGKAHEPSILLAERLVK-MAPNGLSRVFFTNSGSEANDTVVKMVWYYNNA  136

Query  737  LGRPNKKKFIAREKSYHG  790
            +G+P KKKFI+R   YHG
Sbjct  137  IGKPEKKKFISRISGYHG  154



>ref|WP_045229420.1| aminotransferase [Agrobacterium rubi]
 dbj|GAK69890.1| putative aminotransferase [Rhizobium rubi NBRC 13261]
Length=460

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = +2

Query  419  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  598
            PLVIE+ EG  VYD  GK+Y++ LAGLW  A+G +EPRL +AA KQ+  LP+YH+F +++
Sbjct  31   PLVIERGEGIRVYDDRGKEYIEGLAGLWSVAVGFSEPRLAEAAYKQMLKLPYYHTFSSKS  90

Query  599  TKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREK  778
             +PS+ LA++L++   AN + +AFFT+SGSEANDT VK+VWY NNALGRPNKKKF++R K
Sbjct  91   HEPSIRLAEKLVEMTPAN-ITRAFFTSSGSEANDTIVKMVWYMNNALGRPNKKKFLSRIK  149

Query  779  SYHG  790
             YHG
Sbjct  150  GYHG  153



>ref|WP_009770733.1| aminotransferase [Burkholderia terrae]
 gb|EIM94330.1| aminotransferase [Burkholderia terrae BS001]
Length=456

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 102/138 (74%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T      ++ P+VIE+ EG YVYD  G +YL+ L GL+C +LG +E RL DAA +Q
Sbjct  13   LHPYTNLSLHREVGPMVIERGEGVYVYDSEGNRYLEGLGGLFCASLGFSETRLADAADRQ  72

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            +  LPFYH+F +++++PS+ LA++L+ +     M+K FF NSGSEANDT VKL+WY+NNA
Sbjct  73   MRKLPFYHAFGHKSSEPSILLAEKLI-SMAPVPMSKVFFANSGSEANDTAVKLIWYFNNA  131

Query  737  LGRPNKKKFIAREKSYHG  790
            +GRP KKK I+R ++YHG
Sbjct  132  IGRPQKKKIISRTRAYHG  149



>ref|WP_007733279.1| aminotransferase [Burkholderia sp. BT03]
 gb|EUC19086.1| Adenosylmethionine--8-amino-7-oxononanoate transaminase [Burkholderia 
sp. BT03]
Length=456

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 102/138 (74%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T      ++ P+VIE+ EG YVYD  G +YL+ L GL+C +LG +E RL DAA +Q
Sbjct  13   LHPYTNLSLHREVGPMVIERGEGVYVYDSEGNRYLEGLGGLFCASLGFSETRLADAADRQ  72

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            +  LPFYH+F +++++PS+ LA++L+ +     M+K FF NSGSEANDT VKL+WY+NNA
Sbjct  73   MRKLPFYHAFGHKSSEPSILLAEKLI-SMAPVPMSKVFFANSGSEANDTAVKLIWYFNNA  131

Query  737  LGRPNKKKFIAREKSYHG  790
            +GRP KKK I+R ++YHG
Sbjct  132  IGRPQKKKIISRTRAYHG  149



>ref|WP_029742660.1| aminotransferase [Ensifer sp. JGI 0001011-A08]
Length=461

 Score =   160 bits (405),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 100/139 (72%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            ++ P+T      ++ P VI   EG YV D  GK+Y++ LAGL+C  LG +EPRLV+AA +
Sbjct  16   LIHPYTNLAVHQEVGPHVITGGEGIYVVDDQGKRYIEGLAGLFCAGLGFSEPRLVEAATR  75

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            QL T+PFYHSF +++T+P + LA++LL+      M+K F   SGSEANDT +KLVWYYNN
Sbjct  76   QLKTMPFYHSFAHKSTEPGIRLAEKLLE-MAPVPMSKVFLAGSGSEANDTAIKLVWYYNN  134

Query  734  ALGRPNKKKFIAREKSYHG  790
            A+GRP KKK I+R K+YHG
Sbjct  135  AVGRPEKKKIISRRKAYHG  153



>gb|EWM49408.1| aminotransferase class-III family protein [Bordetella holmesii 
35009]
Length=515

 Score =   160 bits (406),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 100/138 (72%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L  +T   +   + P +I + EG YVYD  G +YL+ +AGLW  A+G  EPRLVDAA +Q
Sbjct  16   LHSYTNAIKHAQVGPRIITRGEGIYVYDDKGNRYLEGMAGLWSVAVGFGEPRLVDAATRQ  75

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            L  LP+YH+F +++    ++L++ L+  +T  +MA+AFFTNSGSEANDT VKLVWYYNNA
Sbjct  76   LQELPYYHTFTHKSHPSVIELSERLIG-YTEGRMAQAFFTNSGSEANDTVVKLVWYYNNA  134

Query  737  LGRPNKKKFIAREKSYHG  790
            LGR +KKK IAR++ YHG
Sbjct  135  LGRTDKKKIIARQRGYHG  152



>ref|WP_035988183.1| aminotransferase [Burkholderia caribensis]
 gb|ETY81482.1| Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Burkholderia 
caribensis MBA4]
Length=456

 Score =   160 bits (404),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 101/138 (73%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T      ++ P+VIE+ EG YVYD  G +YL+ L GL+C +LG +E RL DAA +Q
Sbjct  13   LHPYTNLSLHREVGPMVIERGEGVYVYDSEGNRYLEGLGGLFCASLGFSETRLADAADRQ  72

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            +  LPFYH+F +++++PS+ LA++L+       M+K FF NSGSEANDT VKL+WY+NNA
Sbjct  73   MRKLPFYHAFGHKSSEPSILLAEKLI-AMAPVPMSKVFFANSGSEANDTAVKLIWYFNNA  131

Query  737  LGRPNKKKFIAREKSYHG  790
            +GRP KKK I+R ++YHG
Sbjct  132  IGRPQKKKIISRTRAYHG  149



>ref|WP_018010394.1| aminotransferase [Sinorhizobium medicae]
Length=461

 Score =   160 bits (404),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 101/139 (73%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            ++ P+T      +  P VI   +G YV D  GK+Y++ LAGL+C  LG +E RLV+AAM+
Sbjct  16   LVHPYTNLAVHQETGPHVISGGDGIYVVDDEGKRYIEGLAGLFCAGLGFSEQRLVEAAMR  75

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            QL T+PFYHSF +++T+P + LA++LL +     M+K FF  SGSEANDT +KL+WYYNN
Sbjct  76   QLKTMPFYHSFAHKSTEPGIRLAEKLL-SIAPVPMSKVFFAGSGSEANDTAIKLIWYYNN  134

Query  734  ALGRPNKKKFIAREKSYHG  790
            ALGRP+KKK I+R K+YHG
Sbjct  135  ALGRPDKKKIISRRKAYHG  153



>ref|WP_028003714.1| aminotransferase [Sinorhizobium meliloti]
Length=461

 Score =   160 bits (404),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 100/139 (72%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            ++ P+T      +  P VI   +G YV D +GK+Y++ LAGL+C  LG +EPRLV+AA +
Sbjct  16   LVHPYTNLAVHQETGPHVITGGDGIYVVDDDGKRYIEGLAGLFCAGLGFSEPRLVEAATR  75

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            QL  +PFYHSF +++T+P + LA++LL T     M+K FF  SGSEANDT +KL+WYYNN
Sbjct  76   QLKAMPFYHSFAHKSTEPGIRLAEKLL-TIAPVPMSKVFFAGSGSEANDTAIKLIWYYNN  134

Query  734  ALGRPNKKKFIAREKSYHG  790
            ALGRP KKK I+R K+YHG
Sbjct  135  ALGRPGKKKIISRRKAYHG  153



>ref|WP_018430650.1| hypothetical protein [Hoeflea sp. 108]
Length=460

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 101/138 (73%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T   +  ++ P+V+++ EG YV+D  G +Y++ LAGLW  A+G  E RLV AA KQ
Sbjct  16   LHPYTNAVRHAEIGPIVMDRGEGIYVFDDQGNRYIEGLAGLWSVAVGFGEKRLVAAATKQ  75

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            L+ LP+YH+F +++  PS++LA++L +      ++  FFTNSGSEANDT VKLVWYYNNA
Sbjct  76   LDKLPYYHTFAHKSHMPSIELAEKLAE-MAPEGLSHVFFTNSGSEANDTIVKLVWYYNNA  134

Query  737  LGRPNKKKFIAREKSYHG  790
            LGRP KKKF+AR + YHG
Sbjct  135  LGRPAKKKFLARTQGYHG  152



>ref|WP_011969374.1| aminotransferase [Sinorhizobium medicae]
 ref|YP_001312484.1| aminotransferase [Sinorhizobium medicae WSM419]
 gb|ABR62551.1| aminotransferase class-III [Sinorhizobium medicae WSM419]
Length=461

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 101/139 (73%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            ++ P+T      +  P VI   +G YV D  GK+Y++ LAGL+C  LG +E RLV+AAM+
Sbjct  16   LVHPYTNLAVHQETGPHVITGGDGIYVVDDEGKRYIEGLAGLFCAGLGFSEQRLVEAAMR  75

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            QL T+PFYHSF +++T+P + LA++LL +     M+K FF  SGSEANDT +KL+WYYNN
Sbjct  76   QLKTMPFYHSFAHKSTEPGIRLAEKLL-SIAPVPMSKVFFAGSGSEANDTAIKLIWYYNN  134

Query  734  ALGRPNKKKFIAREKSYHG  790
            ALGRP+KKK I+R K+YHG
Sbjct  135  ALGRPDKKKIISRRKAYHG  153



>gb|ETF04525.1| aminotransferase [Advenella kashmirensis W13003]
Length=457

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 102/155 (66%), Gaps = 5/155 (3%)
 Frame = +2

Query  326  SVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWC  505
            S+     D+  F  H    P+T         PLVI + +G YV D NGKKY++++AGLW 
Sbjct  5    SISQQGNDDIAFHMH----PYTNAITHATQGPLVIVRGDGIYVEDENGKKYIEAMAGLWS  60

Query  506  TALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSG  685
             A+G +E RLVDAAM+Q+ TLPFYH F ++T   ++  AK L+D      M+K FFTNSG
Sbjct  61   VAVGFSEQRLVDAAMRQMQTLPFYHLFTHKTHDAAVRFAKTLID-LAPVPMSKVFFTNSG  119

Query  686  SEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHG  790
            SEANDT +KL+WY +NALG PNKKK IAR K YHG
Sbjct  120  SEANDTVMKLLWYRSNALGLPNKKKLIARNKGYHG  154



>ref|WP_039191434.1| aminotransferase [Aureimonas altamirensis]
 gb|KHJ54651.1| aminotransferase [Aureimonas altamirensis]
Length=462

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 101/139 (73%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            +L P T   +  +  P+VI++ EG YV+D  GK+Y++++AGLW  A+G  E R+ DAA  
Sbjct  17   ILHPVTNARRHEETGPIVIDRGEGIYVFDDQGKQYIEAMAGLWSVAVGFGEKRIADAAYA  76

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            QL  LP+YH+F ++T +PS+DLA+ L+   T   + + FFTNSGSEANDT VKL+WYYNN
Sbjct  77   QLQKLPYYHTFSHKTNEPSVDLAETLVK-MTPASVNRVFFTNSGSEANDTVVKLIWYYNN  135

Query  734  ALGRPNKKKFIAREKSYHG  790
            A GRP KKKF++R+ +YHG
Sbjct  136  ARGRPEKKKFLSRQNAYHG  154



>ref|WP_020949918.1| adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Paracoccus 
aminophilus]
 gb|AGT08280.1| adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Paracoccus 
aminophilus JCM 7686]
Length=459

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 98/138 (71%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T   +   + P+V+E+ EG YVYD  G +Y++ LAGLW   +G  E RLV+AA KQ
Sbjct  16   LHPYTNAIRHESVGPIVMERGEGIYVYDDQGNRYIEGLAGLWSVGVGFGEKRLVEAARKQ  75

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            L+ LPFYH+F +++  P+++LA +L +  T   +   FFTNSGSE NDT +K+VWYYNNA
Sbjct  76   LDALPFYHTFAHKSNGPAIELAAKLAE-ITPEGLNHVFFTNSGSEGNDTVIKIVWYYNNA  134

Query  737  LGRPNKKKFIAREKSYHG  790
            LGRP KKKF+AR  +YHG
Sbjct  135  LGRPKKKKFLARTGAYHG  152



>ref|WP_025165321.1| aminotransferase [Pseudomonas taeanensis]
 gb|KFX70067.1| aminotransferase [Pseudomonas taeanensis MS-3]
Length=455

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 100/138 (72%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T      ++ PL+IE+ EG YVYD  GK Y++++AGLW  ALG +  RL+ AA +Q
Sbjct  17   LHPYTNARLHQEVGPLIIERGEGIYVYDDQGKGYIEAMAGLWSAALGFSNQRLIKAAEQQ  76

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            LNTLPFYH F +++ +PS++LA++L++      M+K FFTNSGSEANDT VK+VWY NNA
Sbjct  77   LNTLPFYHLFSHKSHRPSIELAEKLIE-MAPVPMSKVFFTNSGSEANDTVVKMVWYLNNA  135

Query  737  LGRPNKKKFIAREKSYHG  790
             G P KKKFI+R   YHG
Sbjct  136  RGLPAKKKFISRVNGYHG  153



>ref|WP_036500215.1| aminotransferase [Novosphingobium nitrogenifigens]
Length=461

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 98/126 (78%), Gaps = 1/126 (1%)
 Frame = +2

Query  413  LHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWN  592
            + P++I++ EG YVYD  G+ Y++++AGLW  ALG +E RLV+AA  Q+  LPFYHSF +
Sbjct  30   IGPMIIDRGEGVYVYDNEGRPYIEAMAGLWSVALGFSEERLVEAAATQMRRLPFYHSFTH  89

Query  593  RTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAR  772
            ++  P +DLA++L+ T     M+KAFFTNSGSEANDT +K+VWY +NALG+P KKK IAR
Sbjct  90   KSHGPMIDLAEKLV-TMCPGNMSKAFFTNSGSEANDTAMKMVWYRSNALGKPEKKKLIAR  148

Query  773  EKSYHG  790
            +++YHG
Sbjct  149  QRAYHG  154



>gb|EGD57468.1| aminotransferase [Novosphingobium nitrogenifigens DSM 19370]
Length=465

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 98/126 (78%), Gaps = 1/126 (1%)
 Frame = +2

Query  413  LHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWN  592
            + P++I++ EG YVYD  G+ Y++++AGLW  ALG +E RLV+AA  Q+  LPFYHSF +
Sbjct  34   IGPMIIDRGEGVYVYDNEGRPYIEAMAGLWSVALGFSEERLVEAAATQMRRLPFYHSFTH  93

Query  593  RTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAR  772
            ++  P +DLA++L+ T     M+KAFFTNSGSEANDT +K+VWY +NALG+P KKK IAR
Sbjct  94   KSHGPMIDLAEKLV-TMCPGNMSKAFFTNSGSEANDTAMKMVWYRSNALGKPEKKKLIAR  152

Query  773  EKSYHG  790
            +++YHG
Sbjct  153  QRAYHG  158



>ref|WP_036995912.1| aminotransferase [Pseudomonas sp. P482]
 gb|KDN99130.1| aminotransferase class-III family protein [Pseudomonas sp. P482]
Length=457

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 107/152 (70%), Gaps = 3/152 (2%)
 Frame = +2

Query  338  DSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALG  517
            D   +K  K H  L PFT         PL+IE+ EG +VYD   K+Y+++++GLW  ALG
Sbjct  3    DLLAQKDVKNH--LHPFTDARLHEADGPLIIERGEGVHVYDNQNKRYIEAMSGLWSVALG  60

Query  518  GNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEAN  697
             +  RL++AA KQL TLPFYH F ++  +PS++LA++L++      M+K FFTNSGSEAN
Sbjct  61   FSNQRLIEAAEKQLRTLPFYHVFSSKAHRPSIELAEKLVE-MAPVPMSKVFFTNSGSEAN  119

Query  698  DTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            DT VKL+WY NNALG+P KKKFI+R+ +YHG+
Sbjct  120  DTVVKLLWYRNNALGKPAKKKFISRQNAYHGT  151



>ref|WP_037131992.1| aminotransferase [Rhizobium sp. CF097]
Length=461

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 96/125 (77%), Gaps = 1/125 (1%)
 Frame = +2

Query  419  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  598
            PL+IE+  G YVYD NGK+Y++ LAGLW  A+G NEPRLV AA +Q++ LP+YH F ++ 
Sbjct  32   PLIIERGNGIYVYDNNGKEYIEGLAGLWSVAVGFNEPRLVKAASEQMSKLPYYHVFSHKA  91

Query  599  TKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREK  778
             +P + LA++L+D +  + + K  FT+SGSEANDT +K+VWY NNALGRP KKKFIAR +
Sbjct  92   HEPQIRLAEKLVD-WAPDNLTKVHFTSSGSEANDTVIKMVWYMNNALGRPKKKKFIARTR  150

Query  779  SYHGS  793
            SYHG 
Sbjct  151  SYHGC  155



>ref|WP_023663383.1| aminotransferase [Pseudomonas taiwanensis]
 gb|ESW36345.1| aminotransferase [Pseudomonas taiwanensis SJ9]
Length=459

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 101/138 (73%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T      D+ PL+I++ EG YV+D+ GK+Y+++++GLW  ALG +  RLV AA +Q
Sbjct  17   LHPYTDARLHQDVGPLIIDRGEGVYVFDVEGKRYIEAMSGLWSVALGFSNERLVKAAEQQ  76

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            +  LPFYH F ++   PS++LA++L++      M+K FFTNSGSEANDT VK++WY NNA
Sbjct  77   MRKLPFYHIFTHKGHGPSIELAEKLIE-IAPVPMSKVFFTNSGSEANDTVVKMIWYRNNA  135

Query  737  LGRPNKKKFIAREKSYHG  790
            LG+P KKKFI+R  +YHG
Sbjct  136  LGKPEKKKFISRLNAYHG  153



>ref|WP_036349682.1| aminotransferase [Microvirga lupini]
Length=462

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 101/139 (73%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            +L P T      ++ P+VI++ EG YVYD  G +Y+++LAGLW  A+G  E RL DAA +
Sbjct  16   VLHPVTNARNHEEIGPVVIDRGEGIYVYDDQGNRYIEALAGLWSVAVGFGEKRLADAATR  75

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            Q+  LP+YH+F ++T +PS+ LA+ L+   T +++ +AFFTNSGSEAND+ +K+VWYYNN
Sbjct  76   QMAKLPYYHTFSHKTNEPSVLLAERLV-KMTPDRLKRAFFTNSGSEANDSVIKMVWYYNN  134

Query  734  ALGRPNKKKFIAREKSYHG  790
            A G P KKKFIAR  +YHG
Sbjct  135  ARGLPQKKKFIARTNAYHG  153



>ref|WP_018904326.1| aminotransferase [Variovorax paradoxus]
Length=455

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 93/124 (75%), Gaps = 1/124 (1%)
 Frame = +2

Query  419  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  598
            P+VI K EG YVYD  G KYL+++AGL+C +LG +  RL DAA +Q+  LPFYHSF ++ 
Sbjct  30   PMVITKGEGVYVYDDKGNKYLEAMAGLFCASLGFSNSRLADAADRQMRQLPFYHSFGHKA  89

Query  599  TKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREK  778
             +PS+ LA++LL       M+K FF NSGSEANDT VKLVWYYNNA+GRP KKK I+R +
Sbjct  90   NEPSIRLAEKLL-AMAPVPMSKVFFANSGSEANDTAVKLVWYYNNAVGRPQKKKIISRFR  148

Query  779  SYHG  790
            +YHG
Sbjct  149  AYHG  152



>ref|WP_022729947.1| aminotransferase [Fodinicurvata sediminis]
Length=462

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 97/138 (70%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L  +T   +  +  PL+++  +G +VYD  GK Y++ + GLWC ALG  E RLV AA +Q
Sbjct  17   LHAYTNARRHEETGPLIVDHGKGVHVYDDQGKDYIEGMGGLWCVALGFGEERLVKAATEQ  76

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            +  LP+YHSF  ++ +PS++L++ LLD      ++K F+ NSGSEANDT VKLVWYYNNA
Sbjct  77   MQRLPYYHSFAQKSHEPSIELSERLLD-MAPGDLSKVFYANSGSEANDTVVKLVWYYNNA  135

Query  737  LGRPNKKKFIAREKSYHG  790
            LGRPNKKK I+R K YHG
Sbjct  136  LGRPNKKKIISRIKGYHG  153



>ref|WP_028055523.1| aminotransferase [Sinorhizobium meliloti]
Length=463

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 102/138 (74%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T         PL++++ EG YVYDING++Y++S AGLW  A+G +EPRLV+AA KQ
Sbjct  20   LHPYTNARLHETKGPLIMDRGEGIYVYDINGRQYIESFAGLWSVAIGFSEPRLVEAATKQ  79

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            +  LPFYH+F + + +P++ LA++L++  +  ++ +  FTNSGSEANDT VK+VWY NNA
Sbjct  80   MQKLPFYHTFNHMSHEPNIRLAEKLVE-ISPEQITRVSFTNSGSEANDTVVKMVWYVNNA  138

Query  737  LGRPNKKKFIAREKSYHG  790
             G+P KKKF+AR K YHG
Sbjct  139  RGKPKKKKFLARIKGYHG  156



>ref|WP_028466856.1| aminotransferase [Nisaea denitrificans]
Length=462

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 98/139 (71%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            +L P+T      +  P++IE+ EG YVYD  GKKY++ +AGLW T+LG N  RL  AAMK
Sbjct  16   VLHPYTNFEAHEEKGPMIIERGEGIYVYDDAGKKYIEGMAGLWSTSLGFNSERLKQAAMK  75

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            Q +TLP+YH+F ++   PS+DLA++L+       M+K FF NSGSEANDT +K++WYYNN
Sbjct  76   QFDTLPYYHTFAHKAHLPSIDLAEKLISKMPV-PMSKVFFNNSGSEANDTAIKIIWYYNN  134

Query  734  ALGRPNKKKFIAREKSYHG  790
            ALGR +KKK I R   YHG
Sbjct  135  ALGRHHKKKIIGRMNGYHG  153



>ref|WP_044033419.1| aminotransferase [Roseobacter denitrificans]
Length=454

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 95/124 (77%), Gaps = 1/124 (1%)
 Frame = +2

Query  419  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  598
            P+VIE+ EG YV+D  GK+Y++ +AGLW  A+G NE RLVDAA  Q+  LP+YHSF +++
Sbjct  31   PMVIERGEGVYVFDNQGKRYIEGMAGLWSVAVGFNESRLVDAAQNQMRALPYYHSFSHKS  90

Query  599  TKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREK  778
              P++DLA+ L+D     +M+K FFTNSGSEANDT +K++WY +NALG+P KKK I+R +
Sbjct  91   HGPAIDLAERLID-MAPVQMSKVFFTNSGSEANDTILKMIWYRSNALGKPEKKKVISRLR  149

Query  779  SYHG  790
             YHG
Sbjct  150  GYHG  153



>ref|WP_023430501.1| Aminotransferase, class III [Lutibaculum baratangense]
 gb|ESR27081.1| Aminotransferase, class III [Lutibaculum baratangense AMV1]
Length=460

 Score =   157 bits (398),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 100/139 (72%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            ++ P+T   Q  +  PLV+E+ +G  VYD NGK Y++ LAGLWCT+LG     LV+AA  
Sbjct  15   LIHPYTNLAQHRETGPLVLERGQGIRVYDSNGKDYIEGLAGLWCTSLGYGNEELVEAAAA  74

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            Q+  L F H F  ++  P+++LA++L +   A +++K FFT+SGSEANDTQVKLVWYYNN
Sbjct  75   QMRKLSFTHIFGGKSHDPAIELAEKLKEIAPA-EISKVFFTSSGSEANDTQVKLVWYYNN  133

Query  734  ALGRPNKKKFIAREKSYHG  790
            ALGRP KKK IAR++ YHG
Sbjct  134  ALGRPEKKKIIARQRGYHG  152



>gb|ABG31913.1| aminotransferase [Roseobacter denitrificans OCh 114]
Length=452

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 95/124 (77%), Gaps = 1/124 (1%)
 Frame = +2

Query  419  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  598
            P+VIE+ EG YV+D  GK+Y++ +AGLW  A+G NE RLVDAA  Q+  LP+YHSF +++
Sbjct  29   PMVIERGEGVYVFDNQGKRYIEGMAGLWSVAVGFNESRLVDAAQNQMRALPYYHSFSHKS  88

Query  599  TKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREK  778
              P++DLA+ L+D     +M+K FFTNSGSEANDT +K++WY +NALG+P KKK I+R +
Sbjct  89   HGPAIDLAERLID-MAPVQMSKVFFTNSGSEANDTILKMIWYRSNALGKPEKKKVISRLR  147

Query  779  SYHG  790
             YHG
Sbjct  148  GYHG  151



>ref|WP_016558738.1| aminotransferase [Rhizobium grahamii]
 gb|EPE93968.1| aminotransferase [Rhizobium grahamii CCGE 502]
Length=463

 Score =   157 bits (397),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 101/138 (73%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T         PL++E+ EG YVYDI+GK+Y++S AGLW  A+G +EPRLV+AA KQ
Sbjct  20   LHPYTNARLHETKGPLIMERGEGIYVYDISGKQYIESFAGLWSVAIGFSEPRLVEAATKQ  79

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            +  LPFYH+F + + +P++ LA++L++  +  +  +  FTNSGSEANDT +K+VWY NNA
Sbjct  80   MQKLPFYHTFNHISHEPNIRLAEKLVE-ISPEQFTRVSFTNSGSEANDTVIKMVWYVNNA  138

Query  737  LGRPNKKKFIAREKSYHG  790
             G+P KKKF+AR K YHG
Sbjct  139  RGKPEKKKFLARTKGYHG  156



>ref|WP_024589111.1| aminotransferase [Aliihoeflea sp. 2WW]
Length=465

 Score =   157 bits (397),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 98/139 (71%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            +L P+T   +     PLVIE+ EG +VYD  GK Y++ ++GLWC  LG  +  +V+AA +
Sbjct  18   VLHPYTPLHKLKTNGPLVIERGEGVFVYDTQGKDYIEGMSGLWCAGLGFGDEEMVEAATQ  77

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            QL TLP+YH F  +  +P+++LA E L       ++K FFT+SGSEANDTQVKL WY NN
Sbjct  78   QLRTLPYYHLFGAKGMEPAIELA-EKLKEIAPVPISKVFFTSSGSEANDTQVKLAWYMNN  136

Query  734  ALGRPNKKKFIAREKSYHG  790
            ALGRPNKKK I+R+K+YHG
Sbjct  137  ALGRPNKKKIISRQKAYHG  155



>ref|WP_026756592.1| aminotransferase [Sediminimonas qiaohouensis]
Length=460

 Score =   157 bits (397),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 107/164 (65%), Gaps = 13/164 (8%)
 Frame = +2

Query  299  PTRWSSAQVSVQNDSTDEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKY  478
            P   SSAQV +               L P+T         P++I++ +G +VYD  GK+Y
Sbjct  3    PLSNSSAQVDIST------------ALHPYTDARAHEAQGPVIIDRGDGIHVYDQGGKRY  50

Query  479  LDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKM  658
            ++ LAGLW  A+G N+PRL DAA  Q++ LP+YHSF ++  +PS+ L ++L++  T + +
Sbjct  51   IEGLAGLWSVAVGFNQPRLRDAATAQMDRLPYYHSFAHKAHEPSIRLGEKLVE-MTPDNL  109

Query  659  AKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKSYHG  790
             + FFTNSGSEANDT VK++WY NNALG+P KKKF+AR K YHG
Sbjct  110  TRVFFTNSGSEANDTVVKMLWYMNNALGKPEKKKFLARTKGYHG  153



>ref|WP_033067194.1| aminotransferase [Thalassospira australica]
Length=456

 Score =   157 bits (397),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 99/138 (72%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T         P +I   +G YV D  G K ++ +AGLWC +LG +E RLVDAA KQ
Sbjct  19   LHPYTNHAAHEKTGPHIITGGDGIYVTDDQGHKLIEGMAGLWCASLGFSEKRLVDAATKQ  78

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            LNTLP+YH+F +R+T P++DLA++LL+   A  M+K FF NSGSEA D+ VK+VWYY+NA
Sbjct  79   LNTLPYYHTFASRSTNPAIDLAEKLLEIVPA-PMSKVFFANSGSEATDSAVKMVWYYHNA  137

Query  737  LGRPNKKKFIAREKSYHG  790
            +G+P KKK I+R+K YHG
Sbjct  138  IGQPEKKKIISRKKGYHG  155



>ref|WP_025038425.1| aminotransferase [Bradyrhizobium sp. DOA9]
 dbj|GAJ37523.1| probable aminotransferase Y4UB [Bradyrhizobium sp. DOA9]
Length=462

 Score =   157 bits (397),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 101/138 (73%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T         P++I++ EG YVYD  GK+Y++ LAGLW  A+G +EPR+V+ A  Q
Sbjct  19   LHPYTNARAHERQGPVIIDRGEGIYVYDDAGKEYIEGLAGLWSVAIGFDEPRIVEVAAAQ  78

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            +  LP+YH+F +++ +PS+ LA++L+   T   +++ FFT+SGSEANDT +K+VWY NNA
Sbjct  79   MAKLPYYHTFSHKSHEPSIRLAEKLVG-MTPEPLSRVFFTSSGSEANDTMIKMVWYMNNA  137

Query  737  LGRPNKKKFIAREKSYHG  790
            LGRP KKKF+AR ++YHG
Sbjct  138  LGRPKKKKFLARHRAYHG  155



>ref|WP_031242205.1| aminotransferase [Advenella kashmirensis]
Length=452

 Score =   157 bits (396),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 100/148 (68%), Gaps = 5/148 (3%)
 Frame = +2

Query  347  DEKGFKGHDMLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNE  526
            D+  F  H    P+T         PLVI + +G YV D NGKKY++++AGLW  A+G +E
Sbjct  7    DDIAFHMH----PYTNAITHATQGPLVIVRGDGIYVEDENGKKYIEAMAGLWSVAVGFSE  62

Query  527  PRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQ  706
             RLVDAAM+Q+ TLPFYH F ++T   ++  AK L+D      M+K FFTNSGSEANDT 
Sbjct  63   QRLVDAAMRQMQTLPFYHLFTHKTHDAAVRFAKTLID-LAPVPMSKVFFTNSGSEANDTV  121

Query  707  VKLVWYYNNALGRPNKKKFIAREKSYHG  790
            +KL+WY +NALG PNKKK IAR K YHG
Sbjct  122  MKLLWYRSNALGLPNKKKLIARNKGYHG  149



>ref|WP_028793896.1| aminotransferase [Thalassobaculum salexigens]
Length=460

 Score =   157 bits (396),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 98/139 (71%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            +L P+T      +  P++I K +G YVYD  GK+YL+++AGLWC +LG NE RLV AA K
Sbjct  16   VLHPYTNARAHEENGPMIITKGDGVYVYDDGGKQYLEAMAGLWCASLGFNENRLVKAATK  75

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            QL TLP+YH+F ++   P +DLA++L++      M+K FF  SGSEANDT +KLVWYYNN
Sbjct  76   QLETLPYYHTFAHKAHLPGIDLAEKLIN-LAPVPMSKVFFAGSGSEANDTAMKLVWYYNN  134

Query  734  ALGRPNKKKFIAREKSYHG  790
            A GR  KKK I+R K YHG
Sbjct  135  ARGRHAKKKMISRIKGYHG  153



>emb|CCF21345.1| Uncharacterized aminotransferase y4uB [Rhizobium sp.]
Length=452

 Score =   157 bits (396),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 96/123 (78%), Gaps = 1/123 (1%)
 Frame = +2

Query  422  LVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRTT  601
            LVI++ EG YVYD NGK+Y+++++GLW  A+G  E RLVDAA++Q++ LP+YH+F  RT 
Sbjct  32   LVIDRGEGVYVYDNNGKRYIEAMSGLWSVAVGFGEQRLVDAAVRQMSILPYYHTFTGRTH  91

Query  602  KPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREKS  781
             PS+DLA++L+       M+K +FTNSGSEANDT +K+VWY +NALG+P KKK I+R K 
Sbjct  92   GPSVDLAEKLIQ-MAPVPMSKVYFTNSGSEANDTAMKIVWYRSNALGKPEKKKIISRVKG  150

Query  782  YHG  790
            YHG
Sbjct  151  YHG  153



>ref|WP_028053780.1| aminotransferase [Sinorhizobium meliloti]
Length=461

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 100/139 (72%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            ++ P+T      +  P VI   +G YV D  GK+Y++ LAGL+C  LG +E RLV+AA +
Sbjct  16   LVHPYTNLALHQETGPHVITGGDGIYVVDDQGKRYIEGLAGLFCAGLGFSEQRLVEAATR  75

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            QL T+PFYHSF +++T+P + LA++LL +     M+K FF  SGSEANDT +KL+WYYNN
Sbjct  76   QLKTMPFYHSFAHKSTEPGIRLAEKLL-SIAPVPMSKVFFAGSGSEANDTAIKLIWYYNN  134

Query  734  ALGRPNKKKFIAREKSYHG  790
            ALGRP+KKK I+R K+YHG
Sbjct  135  ALGRPDKKKIISRRKAYHG  153



>ref|WP_003525818.1| aminotransferase [Sinorhizobium meliloti]
 gb|EHK79598.1| aminotransferase [Sinorhizobium meliloti CCNWSX0020]
Length=461

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 99/139 (71%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            ++ P+T      +  P VI   +G YV D  GK+Y++ LAGL+C  LG +E RLV+AA +
Sbjct  16   LVHPYTNLAVHQETGPHVITGGDGIYVVDDEGKRYIEGLAGLFCAGLGFSEQRLVEAATR  75

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            QL T+PFYHSF +++T+P + LA++LL +     M+K FF  SGSEANDT +KL+WYYNN
Sbjct  76   QLKTMPFYHSFAHKSTEPGIRLAEKLL-SIAPVSMSKVFFAGSGSEANDTAIKLIWYYNN  134

Query  734  ALGRPNKKKFIAREKSYHG  790
            ALGRP KKK I+R K+YHG
Sbjct  135  ALGRPEKKKIISRRKAYHG  153



>ref|WP_046020867.1| aminotransferase [Magnetospira sp. QH-2]
 emb|CCQ73232.1| Aminotransferase [Magnetospira sp. QH-2]
Length=461

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 98/138 (71%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T      +  PL+IE+ +G  V+D  G+ Y++ L GLWCT+LG +EPRLV+AA K 
Sbjct  17   LHPYTNLKTHQETGPLIIERGQGVRVFDDEGRAYIEGLGGLWCTSLGFSEPRLVEAATKA  76

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            + TLPFYH F ++++  ++DLA++LL +     ++K  F NSGSE+NDT +KL+WY+NNA
Sbjct  77   MQTLPFYHGFGHKSSPATIDLAEKLL-SLAPVPLSKVLFANSGSESNDTAIKLIWYFNNA  135

Query  737  LGRPNKKKFIAREKSYHG  790
             GRP KKK IAR K YHG
Sbjct  136  RGRPEKKKIIARHKGYHG  153



>gb|EEE56165.1| hypothetical protein OsJ_05081 [Oryza sativa Japonica Group]
Length=505

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +2

Query  515  GGNEPRLVDAAMKQLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEA  694
            GG+EPRLV AA +QLN LPFYHSFWN TT+PSLDLAKEL+  FTA +M K FFTNSGSEA
Sbjct  104  GGSEPRLVKAATEQLNKLPFYHSFWNHTTRPSLDLAKELISMFTAREMGKVFFTNSGSEA  163

Query  695  NDTQVKLVWYYNNALGRPNKKKFIAREKSYHGS  793
            ND+QVK+VWYYNNALGRP KK  I+R +SYHG+
Sbjct  164  NDSQVKIVWYYNNALGRPKKKNIISRTQSYHGT  196



>ref|WP_027991581.1| aminotransferase [Sinorhizobium meliloti]
Length=461

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 99/139 (71%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            ++ P+T      +  P VI   +G YV D  GK+Y++ LAGL+C  LG +E RLV+AA +
Sbjct  16   LVHPYTNLAVHQETGPHVITGGDGIYVVDDEGKRYIEGLAGLFCAGLGFSEQRLVEAATR  75

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            QL T+PFYHSF +++T+P + LA++LL +     M+K FF  SGSEANDT +KL+WYYNN
Sbjct  76   QLKTMPFYHSFAHKSTEPGIRLAEKLL-SIAPVPMSKVFFAGSGSEANDTAIKLIWYYNN  134

Query  734  ALGRPNKKKFIAREKSYHG  790
            ALGRP KKK I+R K+YHG
Sbjct  135  ALGRPEKKKIISRRKAYHG  153



>ref|WP_027283997.1| aminotransferase [Rubritepida flocculans]
Length=463

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 96/139 (69%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            +L P+T         PLVI + EG  V+D  GK Y++++AGLWC ALG +  RLV+AA +
Sbjct  16   VLHPYTDARAHQKNGPLVITRGEGVRVFDEQGKGYIETVAGLWCAALGFHNERLVEAAAR  75

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            Q+  LPFYH F  RT +P ++LA+ LL+      M+K FF NSGSEAND+ VK++WY+NN
Sbjct  76   QMRQLPFYHGFTGRTHEPQVELAEMLLER-APVPMSKVFFANSGSEANDSAVKMIWYFNN  134

Query  734  ALGRPNKKKFIAREKSYHG  790
            ALGRP KKK I+R K YHG
Sbjct  135  ALGRPRKKKIISRLKGYHG  153



>ref|WP_010975253.1| aminotransferase [Sinorhizobium meliloti]
 ref|NP_436905.1| aminotransferase [Sinorhizobium meliloti 1021]
 emb|CAC48765.1| adenosylmethionine-8-amino-7-oxononanoatetransaminase [Sinorhizobium 
meliloti 1021]
 gb|AGG71365.1| Putative aminotransferase [Sinorhizobium meliloti 2011]
Length=461

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 99/139 (71%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            ++ P+T      +  P VI   +G YV D  GK+Y++ LAGL+C  LG +E RLV+AA +
Sbjct  16   LVHPYTNLAVHQETGPHVITGGDGIYVVDDEGKRYIEGLAGLFCAGLGFSEQRLVEAATR  75

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            QL T+PFYHSF +++T+P + LA++LL +     M+K FF  SGSEANDT +KL+WYYNN
Sbjct  76   QLKTMPFYHSFAHKSTEPGIRLAEKLL-SIAPVPMSKVFFAGSGSEANDTAIKLIWYYNN  134

Query  734  ALGRPNKKKFIAREKSYHG  790
            ALGRP KKK I+R K+YHG
Sbjct  135  ALGRPEKKKIISRRKAYHG  153



>ref|WP_014193010.1| aminotransferase [Burkholderia sp. YI23]
 gb|AET92368.1| aminotransferase [Burkholderia sp. YI23]
Length=457

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 102/138 (74%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L PFT   +       V+ + EG YV D +G+K++++L+GLWC ALG +E RL+DAA +Q
Sbjct  18   LHPFTNAVKNAHEGGKVMTRGEGIYVIDEHGQKHIEALSGLWCVALGFSEQRLIDAATRQ  77

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            ++ LPFYH+F  R+ +P +DLA++L+       M+K FFTNSGSEANDT +KL+WY+ NA
Sbjct  78   MSVLPFYHAFVQRSHQPLIDLAEKLIG-MAPVPMSKVFFTNSGSEANDTAIKLLWYWANA  136

Query  737  LGRPNKKKFIAREKSYHG  790
            LG+P+KKK I+R+++YHG
Sbjct  137  LGKPDKKKIISRQRAYHG  154



>ref|WP_015008570.1| aminotransferase [Sinorhizobium meliloti]
 emb|CCM72575.1| Gamma aminobutyrate transaminase 3, chloroplastic [Sinorhizobium 
meliloti Rm41]
Length=461

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 100/139 (72%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            ++ P+T      +  P +I   +G YV D  GK+Y++ LAGL+C  LG +E RLV+AA +
Sbjct  16   LVHPYTNLAVHQETGPHMITGGDGIYVVDDEGKRYIEGLAGLFCAGLGFSEQRLVEAATR  75

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            QL T+PFYHSF +++T+P + LA++LL +    +M+K FF  SGSEANDT +KL+WYYNN
Sbjct  76   QLKTMPFYHSFAHKSTEPGIRLAEKLL-SIAPVRMSKVFFAGSGSEANDTAIKLIWYYNN  134

Query  734  ALGRPNKKKFIAREKSYHG  790
            ALGRP KKK I+R K+YHG
Sbjct  135  ALGRPEKKKIISRRKAYHG  153



>ref|WP_029043410.1| aminotransferase [Cupriavidus sp. WS]
Length=461

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 94/124 (76%), Gaps = 1/124 (1%)
 Frame = +2

Query  419  PLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNTLPFYHSFWNRT  598
            P++I + EG YVYD  G +YL+ LAGL+C +LG +  RL DAA +Q+  LPFYH+F ++ 
Sbjct  30   PMIITRGEGVYVYDDKGNRYLEGLAGLFCASLGFSNDRLADAADRQMRKLPFYHAFGHKA  89

Query  599  TKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNALGRPNKKKFIAREK  778
            ++PS+ LA+ L+    A  M+K FF NSGSEANDT +KL WYYNNALGRP+KKK I+R++
Sbjct  90   SEPSIRLAERLIGMAPA-PMSKVFFANSGSEANDTAIKLAWYYNNALGRPDKKKIISRKR  148

Query  779  SYHG  790
            +YHG
Sbjct  149  AYHG  152



>ref|WP_017273373.1| aminotransferase [Sinorhizobium meliloti]
Length=461

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 99/139 (71%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            ++ P+T      +  P VI   +G YV D  GK+Y++ LAGL+C  LG +E RLV+AA +
Sbjct  16   LVHPYTNLAVHQETGPHVITGGDGIYVVDDEGKRYIEGLAGLFCAGLGFSEQRLVEAATR  75

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            QL T+PFYHSF +++T+P + LA++LL +     M+K FF  SGSEANDT +KL+WYYNN
Sbjct  76   QLKTMPFYHSFAHKSTEPGIRLAEKLL-SIAPVPMSKVFFAGSGSEANDTAIKLIWYYNN  134

Query  734  ALGRPNKKKFIAREKSYHG  790
            ALGRP KKK I+R K+YHG
Sbjct  135  ALGRPEKKKIISRRKAYHG  153



>gb|KEO56896.1| aminotransferase [Thalassospira permensis NBRC 106175]
Length=466

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 98/138 (71%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T         P +I K  G YV D NG+ +++ +AGLWC +LG  E RLV+AA KQ
Sbjct  28   LHPYTNFAAHEKTGPHIISKGHGIYVTDDNGRDFIEGMAGLWCASLGFGERRLVEAATKQ  87

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            L TLP+YH+F +R+T P++DLA++LL+      M+K FF NSGSEA D+ VK+VWYY+NA
Sbjct  88   LETLPYYHTFASRSTNPAIDLAEKLLE-LVPVPMSKVFFANSGSEATDSAVKMVWYYHNA  146

Query  737  LGRPNKKKFIAREKSYHG  790
            +G+P KKK I+R+K YHG
Sbjct  147  IGQPEKKKIISRKKGYHG  164



>ref|WP_013850008.1| aminotransferase [Sinorhizobium meliloti]
 gb|AEG08578.1| Adenosylmethionine--8-amino-7-oxononanoate transaminase [Sinorhizobium 
meliloti BL225C]
 gb|AEG55501.1| Adenosylmethionine--8-amino-7-oxononanoate transaminase [Sinorhizobium 
meliloti AK83]
 gb|AEH84066.1| adenosylmethionine-8-amino-7-oxononanoatetransaminase [Sinorhizobium 
meliloti SM11]
 gb|KKA14719.1| aminotransferase [Sinorhizobium meliloti]
Length=461

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 99/139 (71%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            ++ P+T      +  P VI   +G YV D  GK+Y++ LAGL+C  LG +E RLV+AA +
Sbjct  16   LVHPYTNLAVHQETGPHVITGGDGIYVVDDEGKRYIEGLAGLFCAGLGFSEQRLVEAATR  75

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            QL T+PFYHSF +++T+P + LA++LL +     M+K FF  SGSEANDT +KL+WYYNN
Sbjct  76   QLKTMPFYHSFAHKSTEPGIRLAEKLL-SIAPVPMSKVFFAGSGSEANDTAIKLIWYYNN  134

Query  734  ALGRPNKKKFIAREKSYHG  790
            ALGRP KKK I+R K+YHG
Sbjct  135  ALGRPEKKKIISRRKAYHG  153



>ref|WP_017266638.1| aminotransferase [Sinorhizobium meliloti]
Length=461

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 99/139 (71%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            ++ P+T      +  P VI   +G YV D  GK+Y++ LAGL+C  LG +E RLV+AA +
Sbjct  16   LVHPYTNLAVHQETGPHVITGGDGIYVVDDEGKRYIEGLAGLFCAGLGFSEQRLVEAATR  75

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            QL T+PFYHSF +++T+P + LA++LL +     M+K FF  SGSEANDT +KL+WYYNN
Sbjct  76   QLKTMPFYHSFAHKSTEPGIRLAEKLL-SIAPVPMSKVFFAGSGSEANDTAIKLIWYYNN  134

Query  734  ALGRPNKKKFIAREKSYHG  790
            ALGRP KKK I+R K+YHG
Sbjct  135  ALGRPEKKKIISRRKAYHG  153



>ref|WP_025899271.1| aminotransferase [Sneathiella glossodoripedis]
Length=468

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 102/139 (73%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            ++ P+T         PL+IE  +G YVYD +G++Y++ +AGLWCT+ G  E  L+DAA+K
Sbjct  20   LIHPYTNLSTHEKTGPLIIETGKGIYVYDDDGREYIEGMAGLWCTSFGFGEQELIDAAVK  79

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            Q++ LP+YHSF +++T+P + LA++LL+   A+  +K FF NSGSEANDT VKL+WYYNN
Sbjct  80   QMHKLPYYHSFASKSTEPGIVLAEKLLEIAPAD-FSKVFFVNSGSEANDTVVKLIWYYNN  138

Query  734  ALGRPNKKKFIAREKSYHG  790
            +   P KKK I+R+K+YHG
Sbjct  139  SRNLPKKKKIISRQKAYHG  157



>ref|WP_045457824.1| aminotransferase [Burkholderia sp. RPE67]
 dbj|BAO90602.1| aminotransferase [Burkholderia sp. RPE67]
Length=457

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 102/138 (74%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L PFT   +       V+ + EG YV D +G+K++++L+GLWC ALG +E RL+DAA +Q
Sbjct  18   LHPFTNAVKNAHEGGKVMTRGEGIYVIDEHGQKHIEALSGLWCVALGFSEQRLIDAATRQ  77

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            ++ LPFYH+F  R+ +P +DLA++L+       M+K FFTNSGSEANDT +KL+WY+ NA
Sbjct  78   MSVLPFYHAFVQRSHQPLIDLAEKLIG-MAPVPMSKVFFTNSGSEANDTAIKLLWYWANA  136

Query  737  LGRPNKKKFIAREKSYHG  790
            LG+P+KKK I+R+++YHG
Sbjct  137  LGKPDKKKIISRQRAYHG  154



>ref|WP_017277372.1| aminotransferase [Sinorhizobium meliloti]
Length=461

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/139 (53%), Positives = 99/139 (71%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            ++ P+T      +  P VI   +G YV D  GK+Y++ LAGL+C  LG +E RLV+AA +
Sbjct  16   LVHPYTNLAVHQETGPHVITGGDGIYVVDDEGKRYIEGLAGLFCAGLGFSEQRLVEAATR  75

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            QL T+PFYHSF +++T+P + LA++LL +     M+K FF  SGSEANDT +KL+WYYNN
Sbjct  76   QLKTMPFYHSFAHKSTEPGIRLAEKLL-SIAPVPMSKVFFAGSGSEANDTAIKLIWYYNN  134

Query  734  ALGRPNKKKFIAREKSYHG  790
            ALGRP KKK I+R K+YHG
Sbjct  135  ALGRPEKKKIISRRKAYHG  153



>gb|AJD51480.1| aminotransferase [Thalassospira xiamenensis M-5 = DSM 17429]
Length=466

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 98/138 (71%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T         P +I K  G YV D NG+ +++ +AGLWC +LG  E RLV+AA KQ
Sbjct  28   LHPYTNFAAHEKTGPHIISKGHGIYVTDDNGRDFIEGMAGLWCASLGFGERRLVEAATKQ  87

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            L TLP+YH+F +R+T P++DLA++LL+      M+K FF NSGSEA D+ VK+VWYY+NA
Sbjct  88   LETLPYYHTFASRSTNPAIDLAEKLLE-LVPVPMSKVFFANSGSEATDSAVKMVWYYHNA  146

Query  737  LGRPNKKKFIAREKSYHG  790
            +G+P KKK I+R+K YHG
Sbjct  147  IGQPEKKKIISRKKGYHG  164



>ref|WP_040060658.1| aminotransferase [Thalassospira xiamenensis]
Length=460

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 98/138 (71%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T         P +I K  G YV D NG+ +++ +AGLWC +LG  E RLV+AA KQ
Sbjct  22   LHPYTNFAAHEKTGPHIISKGHGIYVTDDNGRDFIEGMAGLWCASLGFGERRLVEAATKQ  81

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            L TLP+YH+F +R+T P++DLA++LL+      M+K FF NSGSEA D+ VK+VWYY+NA
Sbjct  82   LETLPYYHTFASRSTNPAIDLAEKLLE-LVPVPMSKVFFANSGSEATDSAVKMVWYYHNA  140

Query  737  LGRPNKKKFIAREKSYHG  790
            +G+P KKK I+R+K YHG
Sbjct  141  IGQPEKKKIISRKKGYHG  158



>ref|WP_037990023.1| aminotransferase [Thalassospira permensis]
Length=460

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 98/138 (71%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T         P +I K  G YV D NG+ +++ +AGLWC +LG  E RLV+AA KQ
Sbjct  22   LHPYTNFAAHEKTGPHIISKGHGIYVTDDNGRDFIEGMAGLWCASLGFGERRLVEAATKQ  81

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            L TLP+YH+F +R+T P++DLA++LL+      M+K FF NSGSEA D+ VK+VWYY+NA
Sbjct  82   LETLPYYHTFASRSTNPAIDLAEKLLE-LVPVPMSKVFFANSGSEATDSAVKMVWYYHNA  140

Query  737  LGRPNKKKFIAREKSYHG  790
            +G+P KKK I+R+K YHG
Sbjct  141  IGQPEKKKIISRKKGYHG  158



>ref|WP_019647031.1| hypothetical protein [Novispirillum itersonii]
Length=455

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 100/139 (72%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            +L P+T      +  P++  + +G  V+DINGK Y++ +AGLWCT+LG +EPRL +AA++
Sbjct  13   VLHPYTNLAAHEEKGPMIAVRGDGVKVFDINGKDYIEGMAGLWCTSLGFSEPRLREAALR  72

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            Q++ LPF+H F +++  P ++LA+ L+    A  + KAFF NSGSEANDT VK+V Y NN
Sbjct  73   QMDALPFFHQFGHKSHAPGIELAERLIGMAPAG-LTKAFFANSGSEANDTVVKIVRYMNN  131

Query  734  ALGRPNKKKFIAREKSYHG  790
             LGRP KKK IARE++YHG
Sbjct  132  ILGRPQKKKIIARERAYHG  150



>ref|WP_016494812.1| putative aminotransferase [Pseudomonas resinovorans]
 dbj|BAN50684.1| putative aminotransferase [Pseudomonas resinovorans NBRC 106553]
Length=463

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 99/138 (72%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T      ++ PL+IE+ EG YV+D  GK+YL++++GLW  ALG +  RL+ AA +Q
Sbjct  17   LHPYTDARLHQEIGPLIIERGEGVYVFDDQGKRYLEAMSGLWSVALGFSNERLIKAAEQQ  76

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            L  LPFYH F ++   PS++LA +L++      M+K FFTNSGSEANDT VK++WY NNA
Sbjct  77   LRKLPFYHLFSHKAHAPSIELADKLIE-LAPVPMSKVFFTNSGSEANDTVVKMIWYRNNA  135

Query  737  LGRPNKKKFIAREKSYHG  790
            +G+P KKKFI+R  +YHG
Sbjct  136  IGKPAKKKFISRLNAYHG  153



>ref|WP_036993733.1| aminotransferase, partial [Pseudomonas pseudoalcaligenes]
Length=453

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 100/138 (72%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T      ++ PL+IE+ EG YV+D  GK+Y+++++GLW  ALG +  RL+ AA +Q
Sbjct  17   LHPYTDARVHQEVGPLIIERGEGVYVFDDQGKRYVEAMSGLWSVALGFSNERLIKAAEQQ  76

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            L  LPFYH F ++   PS++LA++L++      M+K FFTNSGSEANDT VK++WY NNA
Sbjct  77   LRKLPFYHLFSHKAHSPSIELAEKLIE-IAPVPMSKVFFTNSGSEANDTVVKMIWYRNNA  135

Query  737  LGRPNKKKFIAREKSYHG  790
            +G+P KKKFI+R  +YHG
Sbjct  136  IGKPTKKKFISRLNAYHG  153



>ref|WP_027517565.1| aminotransferase [Bradyrhizobium sp. WSM1417]
Length=460

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 99/138 (72%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARAHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  76

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            +  LPFYH+F  ++  PS+DLA++L+   +   M+K FFTNSGSEANDT +KL+ Y +NA
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALSPVPMSKVFFTNSGSEANDTVLKLIAYRSNA  135

Query  737  LGRPNKKKFIAREKSYHG  790
            LG+P +KK I+R ++YHG
Sbjct  136  LGQPQRKKVISRMRAYHG  153



>ref|WP_008129949.1| aminotransferase [Bradyrhizobium sp. YR681]
 gb|EJN16031.1| adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Bradyrhizobium 
sp. YR681]
Length=460

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 98/138 (71%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLVDAA KQ
Sbjct  17   LHPYTNARAHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVDAAHKQ  76

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            +  LPFYH+F  ++  PS+DLA++L+       M+K FFTNSGSEANDT +KL+ Y +NA
Sbjct  77   MLALPFYHTFSAKSHGPSIDLAEKLV-ALAPVPMSKVFFTNSGSEANDTVLKLIAYRSNA  135

Query  737  LGRPNKKKFIAREKSYHG  790
            LG+P +KK I+R ++YHG
Sbjct  136  LGQPQRKKIISRMRAYHG  153



>ref|WP_007257253.1| aminotransferase [Oceanicola granulosus]
 gb|EAR49723.1| hypothetical protein OG2516_15919 [Oceanicola granulosus HTCC2516]
Length=460

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 99/138 (72%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T   +  +  P+V+ + +G  V D  GK Y+++LAGLW  A+G +EPRLV+AA +Q
Sbjct  17   LHPYTNARRHEEAGPMVMRRGDGVRVEDAQGKTYIEALAGLWSVAVGFSEPRLVEAARRQ  76

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            +  LP+YHSF ++  +P++ L ++L++  T   + + FFTNSGSEANDT VK+VWY NNA
Sbjct  77   MEALPYYHSFAHKAHEPAIRLGEKLVE-MTPEGLDRVFFTNSGSEANDTVVKMVWYMNNA  135

Query  737  LGRPNKKKFIAREKSYHG  790
            LGRP KKKF+AR K YHG
Sbjct  136  LGRPEKKKFLARTKGYHG  153



>ref|WP_027569703.1| aminotransferase [Bradyrhizobium sp. URHA0013]
Length=460

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 99/138 (72%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T         PLVIE+ EG YV+D +GK+Y +++AGLW   LG NE RLV+AA KQ
Sbjct  17   LHPYTNARAHQQAGPLVIERGEGPYVFDASGKRYFEAMAGLWSVGLGFNEKRLVEAAHKQ  76

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            +  LPFYH+F  ++  PS+DLA++L+   +   M+K FFTNSGSEANDT +KL+ Y +NA
Sbjct  77   MQALPFYHTFSAKSHGPSIDLAEKLV-ALSPVPMSKVFFTNSGSEANDTVLKLIAYRSNA  135

Query  737  LGRPNKKKFIAREKSYHG  790
            LG+P +KK I+R ++YHG
Sbjct  136  LGQPQRKKVISRMRAYHG  153



>ref|WP_046120078.1| aminotransferase [Sinorhizobium sp. PC2]
Length=460

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 100/139 (72%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            +L P+T   Q     PLVI K EG Y+ D +G KY++ L GL+C +LG +E RLVDAAM+
Sbjct  16   VLHPYTNASQHLQDGPLVISKGEGIYIIDSDGNKYIEGLGGLFCASLGFSEQRLVDAAMR  75

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            Q+  LPFYHSF  ++ + +++LA++L+       M+K FF NSGSEANDT +KLVWYY+N
Sbjct  76   QMQELPFYHSFGGKSHETAIELAEQLI-RLAPVPMSKVFFANSGSEANDTALKLVWYYHN  134

Query  734  ALGRPNKKKFIAREKSYHG  790
            A+G+P KKK I+R ++YHG
Sbjct  135  AIGKPEKKKVISRWRAYHG  153



>ref|WP_026616781.1| aminotransferase [Ensifer sp. TW10]
Length=460

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 100/139 (72%), Gaps = 1/139 (1%)
 Frame = +2

Query  374  MLAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMK  553
            +L P+T   Q     PLVI K EG Y+ D +G KY++ L GL+C +LG +E RLVDAAM+
Sbjct  16   VLHPYTNASQHLQDGPLVISKGEGIYIIDSDGNKYIEGLGGLFCASLGFSEQRLVDAAMR  75

Query  554  QLNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNN  733
            Q+  LPFYHSF  ++ + +++LA++L+       M+K FF NSGSEANDT +KLVWYY+N
Sbjct  76   QMQELPFYHSFGGKSHETAIELAEQLI-RLAPVPMSKVFFANSGSEANDTALKLVWYYHN  134

Query  734  ALGRPNKKKFIAREKSYHG  790
            A+G+P KKK I+R ++YHG
Sbjct  135  AIGKPEKKKVISRWRAYHG  153



>ref|WP_023628464.1| aminotransferase [Pseudomonas mosselii]
 gb|AIN61261.1| aminotransferase [Pseudomonas mosselii SJ10]
Length=459

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 100/138 (72%), Gaps = 1/138 (1%)
 Frame = +2

Query  377  LAPFTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQ  556
            L P+T      ++ PL+I++ EG YVYD  GK+Y+++++GLW  ALG +  RL+ AA +Q
Sbjct  17   LHPYTDARLHQEVGPLIIDRGEGVYVYDDRGKRYIEAMSGLWSVALGFSNERLIKAAEQQ  76

Query  557  LNTLPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNA  736
            L  LPFYH F ++   PS++LA++L++      M+K FFTNSGSEANDT VKL+WY NNA
Sbjct  77   LRKLPFYHIFTHKAHAPSIELAEKLVE-LAPVPMSKVFFTNSGSEANDTVVKLIWYRNNA  135

Query  737  LGRPNKKKFIAREKSYHG  790
            +G+P KKKFI+R  +YHG
Sbjct  136  IGKPAKKKFISRLNAYHG  153



>ref|WP_038761742.1| aminotransferase [Burkholderia pseudomallei]
 gb|AJX93966.1| aminotransferase class-III family protein [Burkholderia pseudomallei 
PB08298010]
Length=459

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 99/135 (73%), Gaps = 1/135 (1%)
 Frame = +2

Query  386  FTAGWQTTDLHPLVIEKSEGSYVYDINGKKYLDSLAGLWCTALGGNEPRLVDAAMKQLNT  565
            +T   Q     PLVI++ EG YV+D  G++Y++++AGLW  A+G NEPRLV AA +Q+  
Sbjct  24   YTDAAQNVKTGPLVIDRGEGVYVFDNQGRRYIEAMAGLWSAAVGFNEPRLVRAATRQMEK  83

Query  566  LPFYHSFWNRTTKPSLDLAKELLDTFTANKMAKAFFTNSGSEANDTQVKLVWYYNNALGR  745
            LPFYH+F +++  P +DLA++L+ +     M+K FFTNSGSEANDT +KL+WY +NALG+
Sbjct  84   LPFYHTFSHKSHGPLVDLAEKLV-SMAPVPMSKVFFTNSGSEANDTALKLIWYRSNALGQ  142

Query  746  PNKKKFIAREKSYHG  790
            P +KK I+R + YHG
Sbjct  143  PKRKKVISRIRGYHG  157



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1614230233668