BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13565

Length=720
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008461868.1|  PREDICTED: alanine--tRNA ligase-like               266   1e-83   Cucumis melo [Oriental melon]
ref|XP_011084638.1|  PREDICTED: LOW QUALITY PROTEIN: alanine--tRN...    278   4e-83   
gb|EPS72880.1|  hypothetical protein M569_01869                         276   1e-82   Genlisea aurea
ref|XP_009351710.1|  PREDICTED: alanine--tRNA ligase                    273   2e-81   
ref|XP_003619276.1|  Alanyl-tRNA synthetase                             271   4e-81   
ref|XP_003607217.1|  Alanyl-tRNA synthetase                             272   5e-81   
ref|XP_011022066.1|  PREDICTED: alanine--tRNA ligase                    272   6e-81   Populus euphratica
ref|XP_002277341.1|  PREDICTED: alanine--tRNA ligase                    272   7e-81   Vitis vinifera
ref|XP_008340455.1|  PREDICTED: alanine--tRNA ligase                    272   1e-80   Malus domestica [apple tree]
ref|XP_002307181.2|  alanyl-tRNA synthetase family protein              271   1e-80   
gb|KDO52986.1|  hypothetical protein CISIN_1g001826mg                   269   2e-80   Citrus sinensis [apfelsine]
gb|KDO52987.1|  hypothetical protein CISIN_1g001826mg                   268   3e-80   Citrus sinensis [apfelsine]
gb|KDO52985.1|  hypothetical protein CISIN_1g001826mg                   270   3e-80   Citrus sinensis [apfelsine]
ref|XP_002531134.1|  alanyl-tRNA synthetase, putative                   271   3e-80   
gb|KDO52982.1|  hypothetical protein CISIN_1g001826mg                   270   3e-80   Citrus sinensis [apfelsine]
gb|KDO52980.1|  hypothetical protein CISIN_1g001826mg                   270   3e-80   Citrus sinensis [apfelsine]
gb|KDO52981.1|  hypothetical protein CISIN_1g001826mg                   270   3e-80   Citrus sinensis [apfelsine]
ref|XP_006437524.1|  hypothetical protein CICLE_v10030624mg             270   3e-80   Citrus clementina [clementine]
ref|XP_009601820.1|  PREDICTED: alanine--tRNA ligase {ECO:0000255...    270   5e-80   Nicotiana tomentosiformis
gb|KDO52984.1|  hypothetical protein CISIN_1g001826mg                   270   5e-80   Citrus sinensis [apfelsine]
ref|XP_010273668.1|  PREDICTED: alanine--tRNA ligase                    270   6e-80   Nelumbo nucifera [Indian lotus]
gb|KDO52983.1|  hypothetical protein CISIN_1g001826mg                   270   6e-80   Citrus sinensis [apfelsine]
ref|XP_004505726.1|  PREDICTED: alanine--tRNA ligase-like               269   1e-79   Cicer arietinum [garbanzo]
ref|XP_009802310.1|  PREDICTED: alanine--tRNA ligase                    269   1e-79   Nicotiana sylvestris
ref|XP_004148575.2|  PREDICTED: alanine--tRNA ligase                    269   1e-79   Cucumis sativus [cucumbers]
ref|XP_008221037.1|  PREDICTED: alanine--tRNA ligase                    268   2e-79   Prunus mume [ume]
ref|XP_012065800.1|  PREDICTED: alanine--tRNA ligase                    268   3e-79   Jatropha curcas
ref|XP_003607220.1|  Alanyl-tRNA synthetase                             261   4e-79   
gb|AES89417.2|  alanyl-tRNA synthetase                                  261   4e-79   Medicago truncatula
ref|XP_004235270.1|  PREDICTED: alanine--tRNA ligase                    266   8e-79   Solanum lycopersicum
ref|XP_010683781.1|  PREDICTED: alanine--tRNA ligase                    266   8e-79   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007043323.1|  Alanyl-tRNA synthetase, putative                   266   1e-78   
ref|XP_010523577.1|  PREDICTED: alanine--tRNA ligase-like isoform X1    266   1e-78   Tarenaya hassleriana [spider flower]
ref|XP_010662077.1|  PREDICTED: alanine--tRNA ligase-like               265   2e-78   Vitis vinifera
ref|XP_006484669.1|  PREDICTED: alanine--tRNA ligase-like isoform X2    266   2e-78   Citrus sinensis [apfelsine]
emb|CBI27126.3|  unnamed protein product                                266   2e-78   Vitis vinifera
ref|XP_006347609.1|  PREDICTED: alanine--tRNA ligase-like               265   3e-78   Solanum tuberosum [potatoes]
ref|XP_003537781.2|  PREDICTED: alanine--tRNA ligase-like isoform X1    265   3e-78   Glycine max [soybeans]
ref|XP_006484668.1|  PREDICTED: alanine--tRNA ligase-like isoform X1    265   3e-78   
gb|KJB50035.1|  hypothetical protein B456_008G149700                    263   7e-78   Gossypium raimondii
gb|AAK70626.1|AC091238_4  Putative cytosolic tRNA-Ala synthetase        250   7e-78   Oryza sativa Japonica Group [Japonica rice]
gb|KJB50034.1|  hypothetical protein B456_008G149700                    263   7e-78   Gossypium raimondii
gb|KJB50036.1|  hypothetical protein B456_008G149700                    264   9e-78   Gossypium raimondii
gb|KJB50038.1|  hypothetical protein B456_008G149700                    263   9e-78   Gossypium raimondii
gb|KJB50037.1|  hypothetical protein B456_008G149700                    264   1e-77   Gossypium raimondii
ref|XP_010031895.1|  PREDICTED: alanine--tRNA ligase                    264   1e-77   Eucalyptus grandis [rose gum]
gb|KJB50041.1|  hypothetical protein B456_008G149700                    263   1e-77   Gossypium raimondii
gb|KJB50039.1|  hypothetical protein B456_008G149700                    263   1e-77   Gossypium raimondii
ref|XP_004297751.1|  PREDICTED: alanine--tRNA ligase                    263   1e-77   Fragaria vesca subsp. vesca
ref|XP_009386816.1|  PREDICTED: alanine--tRNA ligase {ECO:0000255...    262   3e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008778009.1|  PREDICTED: alanine--tRNA ligase-like               262   4e-77   
ref|XP_007131657.1|  hypothetical protein PHAVU_011G031100g             261   6e-77   Phaseolus vulgaris [French bean]
ref|XP_006826671.1|  PREDICTED: alanine--tRNA ligase                    261   6e-77   Amborella trichopoda
ref|XP_010541854.1|  PREDICTED: alanine--tRNA ligase-like               261   7e-77   Tarenaya hassleriana [spider flower]
emb|CDY45055.1|  BnaA08g02200D                                          260   1e-76   Brassica napus [oilseed rape]
ref|XP_009107233.1|  PREDICTED: alanine--tRNA ligase                    260   1e-76   Brassica rapa
gb|KJB31825.1|  hypothetical protein B456_005G210000                    260   1e-76   Gossypium raimondii
gb|KJB31826.1|  hypothetical protein B456_005G210000                    260   1e-76   Gossypium raimondii
emb|CBI26461.3|  unnamed protein product                                259   3e-76   Vitis vinifera
ref|XP_010904628.1|  PREDICTED: LOW QUALITY PROTEIN: alanine--tRN...    259   5e-76   Elaeis guineensis
gb|KHN32273.1|  Alanine--tRNA ligase                                    258   5e-76   Glycine soja [wild soybean]
ref|XP_006305941.1|  hypothetical protein CARUB_v10011180mg             258   7e-76   Capsella rubella
ref|XP_002894237.1|  cytosolic tRNA-Ala synthetase                      257   1e-75   
ref|XP_010927937.1|  PREDICTED: alanine--tRNA ligase-like               258   1e-75   Elaeis guineensis
ref|NP_001185186.1|  Alanyl-tRNA synthetase                             257   1e-75   
gb|AAD50044.1|AC007980_9  cytosolic tRNA-Ala synthetase                 257   1e-75   Arabidopsis thaliana [mouse-ear cress]
ref|NP_175439.2|  Alanyl-tRNA synthetase                                257   2e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008810668.1|  PREDICTED: alanine--tRNA ligase-like isoform X1    257   2e-75   Phoenix dactylifera
ref|XP_008810673.1|  PREDICTED: alanine--tRNA ligase-like isoform X2    257   2e-75   
ref|XP_006393173.1|  hypothetical protein EUTSA_v10011205mg             257   3e-75   
emb|CDY29328.1|  BnaA05g15950D                                          256   3e-75   Brassica napus [oilseed rape]
gb|EEC66648.1|  hypothetical protein OsI_32912                          256   3e-75   Oryza sativa Indica Group [Indian rice]
ref|XP_006393171.1|  hypothetical protein EUTSA_v10011205mg             256   3e-75   
ref|XP_006393172.1|  hypothetical protein EUTSA_v10011205mg             256   4e-75   Eutrema salsugineum [saltwater cress]
gb|KHN05437.1|  Alanine--tRNA ligase                                    242   4e-75   Glycine soja [wild soybean]
ref|XP_001773539.1|  predicted protein                                  256   4e-75   
ref|XP_010463338.1|  PREDICTED: alanine--tRNA ligase-like               256   7e-75   Camelina sativa [gold-of-pleasure]
ref|XP_009147848.1|  PREDICTED: alanine--tRNA ligase-like               255   8e-75   Brassica rapa
emb|CDY22784.1|  BnaA06g02930D                                          255   8e-75   Brassica napus [oilseed rape]
ref|XP_010479473.1|  PREDICTED: alanine--tRNA ligase                    255   8e-75   Camelina sativa [gold-of-pleasure]
emb|CDY42520.1|  BnaC06g03380D                                          254   1e-74   Brassica napus [oilseed rape]
ref|NP_001064254.1|  Os10g0182000                                       255   1e-74   
gb|KDD75735.1|  class II (A) tRNA synthetase                            251   2e-74   Helicosporidium sp. ATCC 50920
ref|XP_010500574.1|  PREDICTED: alanine--tRNA ligase-like               254   2e-74   Camelina sativa [gold-of-pleasure]
emb|CAA80381.1|  cytosolic tRNA-Ala synthetase                          254   2e-74   Arabidopsis thaliana [mouse-ear cress]
emb|CAA80380.1|  mitochondrial tRNA-Ala synthetase                      254   2e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003571715.1|  PREDICTED: LOW QUALITY PROTEIN: alanine--tRN...    254   2e-74   
gb|AFW56405.1|  hypothetical protein ZEAMMB73_266824                    243   2e-74   
pir||S32671  alanine-tRNA ligase (EC 6.1.1.7) - Arabidopsis thali...    254   3e-74
ref|XP_004983350.1|  PREDICTED: alanine--tRNA ligase-like isoform X3    254   3e-74   
ref|XP_004983349.1|  PREDICTED: alanine--tRNA ligase-like isoform X2    254   3e-74   Setaria italica
ref|XP_004983348.1|  PREDICTED: alanine--tRNA ligase-like isoform X1    253   5e-74   
ref|XP_007225354.1|  hypothetical protein PRUPE_ppa000923mg             252   1e-73   
ref|XP_011396133.1|  Alanine-tRNA ligase                                250   3e-73   Auxenochlorella protothecoides
emb|CEG77795.1|  Putative Alanyl-tRNA synthetase                        237   3e-72   Rhizopus microsporus
emb|CBK21983.2|  unnamed protein product                                247   7e-72   Blastocystis hominis
ref|XP_008662576.1|  PREDICTED: alanine--tRNA ligase                    247   9e-72   Zea mays [maize]
ref|XP_005645178.1|  hypothetical protein COCSUDRAFT_67160              247   2e-71   Coccomyxa subellipsoidea C-169
ref|XP_002443089.1|  hypothetical protein SORBIDRAFT_08g008230          246   2e-71   Sorghum bicolor [broomcorn]
gb|KIH58709.1|  alanine--tRNA ligase                                    230   2e-71   Ancylostoma duodenale
dbj|BAJ96541.1|  predicted protein                                      245   3e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ98134.1|  predicted protein                                      245   3e-71   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KIZ04229.1|  alanyl-tRNA synthetase                                  245   4e-71   Monoraphidium neglectum
emb|CDP04914.1|  unnamed protein product                                225   4e-71   Coffea canephora [robusta coffee]
gb|EMT18589.1|  Alanyl-tRNA synthetase, mitochondrial                   244   8e-71   
ref|XP_002504833.1|  alanyl-tRNA synthetase                             243   1e-70   Micromonas commoda
emb|CEI92968.1|  Putative Alanyl-tRNA synthetase                        242   4e-70   Rhizopus microsporus
emb|CEG71324.1|  Putative Alanyl-tRNA synthetase                        241   9e-70   Rhizopus microsporus
emb|CDP16859.1|  unnamed protein product                                224   2e-69   Coffea canephora [robusta coffee]
gb|EMS67609.1|  Alanyl-tRNA synthetase                                  243   2e-69   Triticum urartu
emb|CEP13586.1|  hypothetical protein                                   239   3e-69   Parasitella parasitica
emb|CEF97732.1|  Thioredoxin-like fold                                  240   4e-69   Ostreococcus tauri
ref|XP_003079014.1|  SYA_ARATH Alanyl-tRNA synthetase, mitochondr...    240   5e-69   
gb|KHJ91121.1|  alanine--tRNA ligase                                    232   8e-69   Oesophagostomum dentatum [nodule worm]
gb|EIE82853.1|  alanyl-tRNA synthetase                                  238   8e-69   Rhizopus delemar RA 99-880
ref|XP_001524092.1|  alanyl-tRNA synthetase                             229   8e-69   Lodderomyces elongisporus NRRL YB-4239
gb|KIY74247.1|  hypothetical protein CYLTODRAFT_427840                  238   9e-69   Cylindrobasidium torrendii FP15055 ss-10
emb|CEL61027.1|  alanyl-tRNA synthetase                                 238   1e-68   Rhizoctonia solani AG-1 IB
gb|KDQ21195.1|  hypothetical protein BOTBODRAFT_25615                   238   2e-68   Botryobasidium botryosum FD-172 SS1
gb|EPX70595.1|  cytoplasmic alanine-tRNA ligase Ala1                    238   2e-68   Schizosaccharomyces octosporus yFS286
emb|CDK27200.1|  unnamed protein product                                237   2e-68   Kuraishia capsulata CBS 1993
gb|EPB88726.1|  alanyl-tRNA synthetase                                  236   3e-68   Mucor circinelloides f. circinelloides 1006PhL
gb|KEP53395.1|  alanyl-tRNA synthetase                                  236   3e-68   Rhizoctonia solani 123E
dbj|GAN03494.1|  alanyl-tRNA synthetase                                 236   3e-68   Mucor ambiguus
gb|EUC64360.1|  alanyl-tRNA synthetase                                  236   3e-68   Rhizoctonia solani AG-3 Rhs1AP
ref|XP_001731546.1|  hypothetical protein MGL_1729                      236   5e-68   Malassezia globosa CBS 7966
gb|EJU04465.1|  hypothetical protein DACRYDRAFT_20988                   236   5e-68   Dacryopinax primogenitus
gb|AFR32145.1|  alanyl-tRNA synthetase                                  236   5e-68   Geotrichum candidum
gb|AFR32153.1|  alanyl-tRNA synthetase                                  236   5e-68   Geotrichum candidum
ref|XP_456501.2|  DEHA2A03652p                                          236   8e-68   Debaryomyces hansenii CBS767
gb|EPY51753.1|  cytoplasmic alanine-tRNA ligase Ala1                    235   1e-67   Schizosaccharomyces cryophilus OY26
gb|KGK39868.1|  hypothetical protein JL09_g980                          237   2e-67   Pichia kudriavzevii
emb|CCV00729.1|  unnamed protein product                                234   2e-67   Malassezia sympodialis ATCC 42132
ref|XP_011111424.1|  hypothetical protein H072_5555                     235   2e-67   
gb|AFR32146.1|  alanyl-tRNA synthetase                                  234   2e-67   Geotrichum candidum
ref|XP_665905.1|  cytosolic tRNA-Ala synthetase                         234   2e-67   Cryptosporidium hominis TU502
ref|XP_627438.1|  alanyl-tRNA synthetase (with HxxxH domain)            234   2e-67   Cryptosporidium parvum Iowa II
gb|KHN71931.1|  Alanine--tRNA ligase, cytoplasmic                       220   2e-67   Toxocara canis
gb|AAA84420.1|  AlaRS A                                                 221   2e-67   Caenorhabditis elegans [roundworm]
gb|EYB99703.1|  hypothetical protein Y032_0120g894                      234   3e-67   Ancylostoma ceylanicum
gb|EPB76393.1|  alanine--tRNA ligase                                    234   3e-67   Ancylostoma ceylanicum
ref|XP_004335848.1|  alanine-tRNA ligase                                233   4e-67   Acanthamoeba castellanii str. Neff
gb|EKF39507.1|  alanyl-tRNA synthetase, putative                        234   4e-67   Trypanosoma cruzi marinkellei
gb|KIM31429.1|  hypothetical protein M408DRAFT_327641                   233   5e-67   Serendipita vermifera MAFF 305830
emb|CDJ84213.1|  Alanyl-tRNA synthetase and Threonyl alanyl tRNA ...    233   6e-67   Haemonchus contortus [red stomach worm]
gb|EKG06983.1|  alanyl-tRNA synthetase, putative                        233   7e-67   Trypanosoma cruzi
dbj|BAP72231.1|  alanyl-tRNA synthetase                                 233   7e-67   Kluyveromyces marxianus
ref|XP_816499.1|  alanyl-tRNA synthetase                                233   7e-67   Trypanosoma cruzi strain CL Brener
dbj|BAO40758.1|  alanyl-tRNA synthetase                                 233   7e-67   Kluyveromyces marxianus DMKU3-1042
ref|XP_810193.1|  alanyl-tRNA synthetase                                233   8e-67   Trypanosoma cruzi strain CL Brener
ref|XP_455190.1|  hypothetical protein                                  233   9e-67   Kluyveromyces lactis
emb|CDJ87289.1|  Alanyl-tRNA synthetase and Threonyl alanyl tRNA ...    233   9e-67   Haemonchus contortus [red stomach worm]
ref|XP_006676752.1|  hypothetical protein BATDEDRAFT_32863              232   1e-66   Batrachochytrium dendrobatidis JAM81
gb|ESS63542.1|  alanyl-tRNA synthetase                                  232   1e-66   Trypanosoma cruzi Dm28c
emb|CBQ72435.1|  probable ALA1-alanyl-tRNA synthetase, cytosolic        232   1e-66   Sporisorium reilianum SRZ2
ref|XP_005537171.1|  alanine--tRNA ligase cytoplasmic                   233   1e-66   Cyanidioschyzon merolae strain 10D
ref|XP_001417607.1|  predicted protein                                  232   1e-66   Ostreococcus lucimarinus CCE9901
ref|XP_007377582.1|  alanyl-tRNA synthetase, cytoplasmic                232   2e-66   Spathaspora passalidarum NRRL Y-27907
ref|XP_500483.1|  YALI0B04180p                                          232   2e-66   Yarrowia lipolytica CLIB122
ref|XP_004198838.1|  Piso0_002228                                       231   2e-66   
gb|KIW00804.1|  alanine-tRNA ligase                                     232   2e-66   Verruconis gallopava
gb|EJK71470.1|  hypothetical protein THAOC_07085                        232   2e-66   Thalassiosira oceanica
ref|XP_003030369.1|  hypothetical protein SCHCODRAFT_82606              231   3e-66   Schizophyllum commune H4-8
ref|XP_001643652.1|  hypothetical protein Kpol_1040p7                   231   3e-66   Vanderwaltozyma polyspora DSM 70294
ref|XP_002615762.1|  hypothetical protein CLUG_04644                    231   3e-66   Clavispora lusitaniae ATCC 42720
gb|EPS99866.1|  hypothetical protein FOMPIDRAFT_1024013                 231   3e-66   Fomitopsis pinicola FP-58527 SS1
emb|CDO95315.1|  unnamed protein product                                231   3e-66   Kluyveromyces dobzhanskii CBS 2104
ref|XP_001486846.1|  hypothetical protein PGUG_00223                    231   3e-66   Meyerozyma guilliermondii ATCC 6260
ref|XP_007511747.1|  alanyl-tRNA synthetase                             232   4e-66   Bathycoccus prasinos
ref|XP_009493046.1|  alanyl-tRNA synthetase                             231   4e-66   Fonticula alba
ref|XP_005710836.1|  Alanine--tRNA ligase                               231   5e-66   Chondrus crispus [carageen]
ref|XP_003060777.1|  alanyl-tRNA synthetase                             230   5e-66   Micromonas pusilla CCMP1545
ref|XP_001683305.1|  putative alanyl-tRNA synthetase                    230   5e-66   Leishmania major strain Friedlin
ref|XP_007847723.1|  alanyl-trna synthetase                             230   5e-66   
ref|XP_001465654.1|  putative alanyl-tRNA synthetase                    230   5e-66   Leishmania infantum JPCM5
gb|EST08427.1|  alanyl-tRNA synthetase                                  230   6e-66   Kalmanozyma brasiliensis GHG001
ref|XP_004199688.1|  Piso0_002228                                       230   6e-66   
gb|EGA72819.1|  Ala1p                                                   227   6e-66   Saccharomyces cerevisiae AWRI796
ref|XP_009547440.1|  hypothetical protein HETIRDRAFT_476425             230   6e-66   Heterobasidion irregulare TC 32-1
ref|XP_011121665.1|  hypothetical protein AOL_s00078g100                230   7e-66   Arthrobotrys oligospora ATCC 24927
ref|XP_011388270.1|  putative alanine--tRNA ligase                      230   8e-66   Ustilago maydis 521
emb|CBJ30506.1|  Alanyl-tRNA Synthetase                                 229   1e-65   Ectocarpus siliculosus
emb|CDS09810.1|  hypothetical protein LRAMOSA02487                      213   1e-65   Lichtheimia ramosa
ref|XP_001877691.1|  predicted protein                                  229   1e-65   Laccaria bicolor S238N-H82
ref|XP_845193.1|  alanyl-tRNA synthetase                                229   1e-65   Trypanosoma brucei brucei TREU927
gb|EFW22234.1|  alanyl-tRNA synthetase                                  229   1e-65   Coccidioides posadasii str. Silveira
ref|XP_002548433.1|  alanyl-tRNA synthetase                             227   1e-65   Candida tropicalis MYA-3404
ref|XP_003870578.1|  Ala1 alanyl-tRNA synthetase                        229   1e-65   Candida orthopsilosis Co 90-125
gb|EIF48501.1|  cytoplasmic alanyl-trna synthetase                      229   1e-65   Brettanomyces bruxellensis AWRI1499
ref|XP_007317881.1|  hypothetical protein SERLADRAFT_361256             229   2e-65   Serpula lacrymans var. lacrymans S7.9
ref|XP_718082.1|  hypothetical protein CaO19.5746                       229   2e-65   Candida albicans SC5314
gb|KHC63511.1|  alanyl-tRNA synthetase                                  229   2e-65   Candida albicans P75016
gb|KGQ88605.1|  alanyl-tRNA synthetase                                  229   2e-65   Candida albicans GC75
ref|XP_002421135.1|  alanyl-tRNA synthetase, putative                   229   2e-65   Candida dubliniensis CD36
gb|KGR08732.1|  alanyl-tRNA synthetase                                  229   2e-65   Candida albicans P57072
gb|EEQ46641.1|  alanyl-tRNA synthetase                                  229   2e-65   Candida albicans WO-1
ref|XP_002173036.1|  cytoplasmic alanine-tRNA ligase Ala1               229   2e-65   Schizosaccharomyces japonicus yFS275
dbj|GAC93028.1|  alanyl-tRNA synthetase                                 231   2e-65   Pseudozyma hubeiensis SY62
gb|KGU04317.1|  alanyl-tRNA synthetase                                  229   2e-65   Candida albicans P87
gb|KGQ84359.1|  alanyl-tRNA synthetase                                  229   2e-65   Candida albicans P94015
ref|XP_001248510.1|  alanyl-tRNA synthetase, cytoplasmic                229   2e-65   Coccidioides immitis RS
gb|KHC33201.1|  alanyl-tRNA synthetase                                  229   2e-65   Candida albicans Ca6
ref|XP_003070819.1|  Alanyl-tRNA synthetase, cytoplasmic , putative     229   2e-65   Coccidioides posadasii C735 delta SOWgp
ref|XP_003053770.1|  predicted protein                                  229   2e-65   [Nectria] haematococca mpVI 77-13-4
ref|XP_002552804.1|  KLTH0D01848p                                       228   2e-65   Lachancea thermotolerans CBS 6340
gb|KFG64908.1|  cytosolic tRNA-Ala synthetase                           220   2e-65   Toxoplasma gondii RUB
emb|CDO74931.1|  hypothetical protein BN946_scf184945.g3                228   3e-65   Trametes cinnabarina
gb|EGD95966.1|  alanyl-tRNA synthetase                                  228   3e-65   Trichophyton tonsurans CBS 112818
gb|EXX57273.1|  alanine--tRNA ligase                                    227   3e-65   Rhizophagus irregularis DAOM 197198w
gb|EGE01186.1|  alanyl-tRNA synthetase                                  228   3e-65   Trichophyton equinum CBS 127.97
gb|EZF33517.1|  alanyl-tRNA synthetase                                  228   3e-65   Trichophyton interdigitale H6
gb|ERZ95099.1|  hypothetical protein GLOINDRAFT_341419                  228   3e-65   
gb|AJU04002.1|  Ala1p                                                   228   3e-65   Saccharomyces cerevisiae YJM1402
gb|AJU00572.1|  Ala1p                                                   228   3e-65   Saccharomyces cerevisiae YJM1386
gb|EGA60508.1|  Ala1p                                                   228   3e-65   Saccharomyces cerevisiae FostersO
sp|P40825.3|SYA_YEAST  RecName: Full=Alanine--tRNA ligase, mitoch...    228   3e-65   Saccharomyces cerevisiae S288C
gb|AJT75159.1|  Ala1p                                                   228   3e-65   Saccharomyces cerevisiae YJM326
ref|NP_593640.1|  mitochondrial and cytoplasmic alanine-tRNA liga...    228   3e-65   Schizosaccharomyces pombe
emb|CCF49697.1|  probable ALA1-alanyl-tRNA synthetase, cytosolic        228   3e-65   Ustilago hordei
gb|AJT94197.1|  Ala1p                                                   228   3e-65   Saccharomyces cerevisiae YJM1307
gb|EWH16115.1|  Ala1p                                                   228   3e-65   Saccharomyces cerevisiae P283
ref|XP_005849315.1|  hypothetical protein CHLNCDRAFT_143654             222   3e-65   Chlorella variabilis
gb|EGA56826.1|  Ala1p                                                   227   3e-65   Saccharomyces cerevisiae FostersB
gb|AJT78594.1|  Ala1p                                                   228   3e-65   Saccharomyces cerevisiae YJM541
emb|CDJ43006.1|  alanyl-tRNA synthetase, putative                       228   3e-65   Eimeria tenella
gb|AJT76134.1|  Ala1p                                                   228   3e-65   Saccharomyces cerevisiae YJM450
gb|AJT97628.1|  Ala1p                                                   228   4e-65   Saccharomyces cerevisiae YJM1342
dbj|GAA26640.1|  K7_Ala1p                                               228   4e-65   Saccharomyces cerevisiae Kyokai no. 7
gb|AJU01059.1|  Ala1p                                                   228   4e-65   Saccharomyces cerevisiae YJM1387
gb|AJT87923.1|  Ala1p                                                   228   4e-65   Saccharomyces cerevisiae YJM1129
gb|AJT73685.1|  Ala1p                                                   228   4e-65   Saccharomyces cerevisiae YJM270
gb|AJT72237.1|  Ala1p                                                   228   4e-65   Saccharomyces cerevisiae YJM195
gb|AJP41837.1|  Ala1p                                                   228   4e-65   Saccharomyces cerevisiae YJM1078
ref|NP_014980.3|  alanine--tRNA ligase                                  228   4e-65   Saccharomyces cerevisiae S288C
gb|AJT74669.1|  Ala1p                                                   228   4e-65   Saccharomyces cerevisiae YJM320
ref|XP_005709097.1|  alanyl-tRNA synthetase                             228   4e-65   Galdieria sulphuraria
gb|EMG50125.1|  Alanyl-tRNA synthetase, putative                        228   4e-65   Candida maltosa Xu316
gb|EDV10897.1|  alanyl-tRNA synthetase                                  228   4e-65   Saccharomyces cerevisiae RM11-1a
gb|EEU07514.1|  Ala1p                                                   228   4e-65   Saccharomyces cerevisiae JAY291
gb|EGA76661.1|  Ala1p                                                   228   4e-65   Saccharomyces cerevisiae Vin13
ref|XP_002843973.1|  alanyl-tRNA synthetase                             228   4e-65   Microsporum canis CBS 113480
gb|AJU00089.1|  Ala1p                                                   228   4e-65   Saccharomyces cerevisiae YJM1385
ref|XP_003676658.1|  hypothetical protein NCAS_0E02290                  228   4e-65   Naumovozyma castellii CBS 4309
gb|KFG38414.1|  cytosolic tRNA-Ala synthetase                           220   4e-65   Toxoplasma gondii p89
emb|CDJ65254.1|  alanyl-tRNA synthetase, putative                       228   4e-65   Eimeria necatrix
ref|XP_003172403.1|  alanyl-tRNA synthetase                             228   5e-65   Nannizzia gypsea CBS 118893
gb|EJT44225.1|  ALA1-like protein                                       228   5e-65   Saccharomyces kudriavzevii IFO 1802
gb|EHN00072.1|  Ala1p                                                   228   5e-65   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
emb|CCE39704.1|  hypothetical protein CPAR2_601240                      228   5e-65   Candida parapsilosis
emb|CDI53029.1|  probable ALA1-alanyl-tRNA synthetase, cytosolic        228   5e-65   Melanopsichium pennsylvanicum 4
ref|XP_007291338.1|  tRNA synthetase class II                           228   5e-65   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
ref|XP_003875608.1|  putative alanyl-tRNA synthetase                    228   5e-65   Leishmania mexicana MHOM/GT/2001/U1103
gb|KIW56168.1|  alanine-tRNA ligase                                     228   6e-65   Exophiala xenobiotica
gb|KDQ57564.1|  hypothetical protein JAAARDRAFT_35260                   227   6e-65   Jaapia argillacea MUCL 33604
gb|EWM22315.1|  alanyl-trna synthetase                                  226   6e-65   Nannochloropsis gaditana
ref|XP_008720639.1|  alanyl-tRNA synthetase                             227   7e-65   Cyphellophora europaea CBS 101466
emb|CCW66342.1|  unnamed protein product                                227   7e-65   Phytomonas sp. isolate Hart1
ref|XP_007724363.1|  alanyl-tRNA synthetase                             227   8e-65   Capronia coronata CBS 617.96
emb|CDJ57403.1|  alanyl-tRNA synthetase, putative                       227   9e-65   Eimeria maxima
gb|KKA26224.1|  hypothetical protein TD95_000035                        227   9e-65   Thielaviopsis punctulata
ref|XP_003957527.1|  hypothetical protein KAFR_0E02390                  227   9e-65   Kazachstania africana CBS 2517
ref|XP_007582290.1|  putative alanyl-trna synthetase protein            227   1e-64   
gb|AJU08879.1|  Ala1p                                                   227   1e-64   Saccharomyces cerevisiae YJM1447
ref|XP_009309736.1|  putative alanyl-tRNA synthetase                    227   1e-64   Trypanosoma grayi
emb|CCD81172.1|  putative alanyl-tRNA synthetase                        227   1e-64   Schistosoma mansoni
ref|XP_009159895.1|  alanyl-tRNA synthetase                             228   1e-64   Exophiala dermatitidis NIH/UT8656
dbj|GAK63909.1|  alanyl-tRNA synthetase                                 227   1e-64   Moesziomyces antarcticus
emb|CCW61998.1|  unnamed protein product                                226   1e-64   Phytomonas sp. isolate EM1
ref|XP_001565061.2|  putative alanyl-tRNA synthetase                    226   1e-64   Leishmania braziliensis MHOM/BR/75/M2904
ref|XP_010699144.1|  alanyl-tRNA synthetase, putative                   226   1e-64   Leishmania panamensis
emb|CCC48230.1|  putative alanyl-tRNA synthetase                        226   1e-64   Trypanosoma vivax Y486
gb|KIW23162.1|  alanine-tRNA ligase                                     227   1e-64   Cladophialophora immunda
gb|KIW48370.1|  alanine-tRNA ligase                                     227   1e-64   Exophiala oligosperma
gb|EKG22385.1|  Alanyl-tRNA synthetase class IIc                        226   1e-64   Macrophomina phaseolina MS6
gb|EDN63655.1|  alanyl-tRNA synthetase                                  226   1e-64   Saccharomyces cerevisiae YJM789
dbj|GAC71363.1|  alanyl-trna synthetase                                 227   1e-64   Moesziomyces antarcticus T-34
gb|KFH69574.1|  alanyl-tRNA synthetase                                  226   2e-64   Mortierella verticillata NRRL 6337
gb|ETS61722.1|  hypothetical protein PaG_04227                          227   2e-64   Moesziomyces aphidis DSM 70725
gb|KDR75441.1|  hypothetical protein GALMADRAFT_249500                  226   2e-64   Galerina marginata CBS 339.88
ref|XP_002839828.1|  hypothetical protein                               226   2e-64   
gb|EGT52396.1|  hypothetical protein CAEBREN_18885                      226   2e-64   
gb|EGT32559.1|  hypothetical protein CAEBREN_22812                      226   2e-64   
ref|NP_491281.1|  Protein AARS-2                                        226   2e-64   
gb|KDQ33558.1|  hypothetical protein PLEOSDRAFT_1091537                 226   2e-64   
gb|KIP06586.1|  hypothetical protein PHLGIDRAFT_128168                  226   2e-64   
gb|ESL08568.1|  alanyl-tRNA synthetase                                  226   2e-64   
ref|XP_445923.1|  hypothetical protein                                  226   2e-64   
ref|XP_002646367.1|  C. briggsae CBR-ARS-2 protein                      226   2e-64   
gb|EWC45240.1|  alanine--tRNA ligase                                    226   2e-64   
ref|XP_011105656.1|  ala1p                                              226   2e-64   
ref|XP_009262152.1|  hypothetical protein FPSE_10760                    226   2e-64   
ref|XP_011316641.1|  alanyl-tRNA synthetase                             226   2e-64   
gb|AAC49007.1|  cytoplasmic alanyl-tRNA synthetase                      226   2e-64   
gb|KIK03536.1|  hypothetical protein K443DRAFT_676709                   226   2e-64   
gb|KIW83490.1|  alanine-tRNA ligase                                     225   3e-64   
gb|KIV89764.1|  alanine-tRNA ligase                                     226   3e-64   
gb|KIY44323.1|  hypothetical protein FISHEDRAFT_77527                   225   3e-64   
ref|XP_011556212.1|  PREDICTED: alanine--tRNA ligase, cytoplasmic       225   3e-64   
gb|KIV89765.1|  alanine-tRNA ligase, variant 1                          226   3e-64   
emb|CDJ53239.1|  alanyl-tRNA synthetase, putative                       225   3e-64   
ref|XP_007759596.1|  alanyl-tRNA synthetase                             225   3e-64   
emb|CDI78985.1|  alanyl-tRNA synthetase, putative                       226   3e-64   
emb|CCT62693.1|  probable alanine--tRNA ligase, cytosolic               225   3e-64   
emb|CBN75498.1|  Alanyl-tRNA Synthetase                                 226   3e-64   
gb|KIL68962.1|  hypothetical protein M378DRAFT_71103                    225   3e-64   
gb|KIL94735.1|  hypothetical protein FAVG1_01666                        225   4e-64   
gb|ETN73632.1|  alanine--tRNA ligase                                    226   4e-64   
ref|XP_001642960.1|  hypothetical protein Kpol_1071p9                   225   4e-64   
ref|XP_003104792.1|  CRE-AARS-2 protein                                 225   4e-64   
gb|KJH51087.1|  alanine--tRNA ligase                                    226   4e-64   
gb|KIX01548.1|  alanine-tRNA ligase                                     225   4e-64   
gb|EJW87808.1|  alanyl-tRNA synthetase                                  225   4e-64   
gb|KIX98796.1|  alanine-tRNA ligase                                     225   4e-64   
emb|CDH13133.1|  probable ALA1-Alanyl-tRNA synthetase,cytosolic         225   4e-64   
emb|CDH15032.1|  probable ALA1-Alanyl-tRNA synthetase,cytosolic         225   4e-64   
gb|EGU79625.1|  hypothetical protein FOXB_09908                         225   4e-64   
emb|CDR44690.1|  CYFA0S15e01530g1_1                                     225   5e-64   
gb|KIW20001.1|  alanine-tRNA ligase                                     225   5e-64   
emb|CDF90599.1|  ZYBA0S07-04786g1_1                                     225   5e-64   
emb|CCK70315.1|  hypothetical protein KNAG_0E00470                      224   5e-64   
gb|EMT61526.1|  Alanyl-tRNA synthetase                                  224   5e-64   
ref|XP_002675895.1|  alanyl-tRNA synthetase                             224   5e-64   
ref|XP_001899825.1|  Alanyl-tRNA synthetase                             224   5e-64   
ref|XP_006687556.1|  hypothetical protein CANTEDRAFT_109802             224   5e-64   
ref|XP_008725247.1|  alanyl-tRNA synthetase                             224   6e-64   
gb|EFQ25498.1|  tRNA synthetase class II                                224   6e-64   
ref|XP_003137715.1|  alanyl-tRNA synthetase                             224   6e-64   
ref|XP_003670443.1|  hypothetical protein NDAI_0E03830                  224   7e-64   
ref|XP_011270692.1|  alanyl-tRNA synthetase                             224   7e-64   
dbj|GAA89407.1|  alanyl-tRNA synthetase                                 224   7e-64   
emb|CCA72755.1|  probable ALA1-alanyl-tRNA synthetase, cytosolic        224   7e-64   
ref|XP_002496623.1|  ZYRO0D04378p                                       224   7e-64   
emb|CDS33215.1|  alanyl tRNA synthetase, cytoplasmic                    224   8e-64   
ref|XP_002492690.1|  Cytoplasmic alanyl-tRNA synthetase                 224   8e-64   
emb|CCA39700.1|  alanyl-tRNA synthetase                                 224   8e-64   
gb|KIW65631.1|  alanine-tRNA ligase                                     225   9e-64   
gb|EWG36790.1|  alanyl-tRNA synthetase                                  225   9e-64   
gb|KJZ77450.1|  Alanine--tRNA ligase                                    224   9e-64   
ref|XP_007797550.1|  putative alanyl-trna synthetase protein            224   1e-63   
gb|KIK68832.1|  hypothetical protein GYMLUDRAFT_152556                  224   1e-63   
gb|ERG86277.1|  alanine--trna cytoplasmic                               224   1e-63   
ref|XP_007833565.1|  Alanine--tRNA ligase                               224   1e-63   
ref|XP_002296928.1|  alanine-trna ligase                                224   1e-63   
ref|XP_007741222.1|  alanyl-tRNA synthetase                             224   1e-63   
ref|XP_007803265.1|  Alanine--tRNA ligase                               224   1e-63   
ref|XP_007878798.1|  hypothetical protein PFL1_03091                    224   1e-63   
emb|CEP64837.1|  LALA0S14e00408g1_1                                     223   1e-63   
gb|KIW91962.1|  alanine-tRNA ligase                                     224   1e-63   
ref|XP_007380880.1|  hypothetical protein PUNSTDRAFT_141744             223   1e-63   
gb|EWY93089.1|  alanyl-tRNA synthetase                                  224   1e-63   
ref|XP_001383420.2|  Alanyl-tRNA synthetase, cytoplasmic (Alanine...    223   1e-63   
ref|XP_001830532.2|  tRNA synthetase class II                           223   1e-63   
gb|EXA52140.1|  alanyl-tRNA synthetase                                  224   1e-63   
gb|EWZ90926.1|  alanyl-tRNA synthetase                                  224   1e-63   
ref|XP_001950431.1|  PREDICTED: alanine--tRNA ligase, cytoplasmic       223   1e-63   
gb|EXM30177.1|  alanyl-tRNA synthetase                                  224   1e-63   
gb|EXM11972.1|  alanyl-tRNA synthetase                                  224   1e-63   
gb|KFM75814.1|  Alanine--tRNA ligase, cytoplasmic                       209   1e-63   
sp|Q5AQL1.2|SYA_EMENI  RecName: Full=Alanine--tRNA ligase; AltNam...    223   1e-63   
gb|EWZ51596.1|  alanyl-tRNA synthetase                                  224   1e-63   
ref|XP_007353910.1|  hypothetical protein AURDEDRAFT_116636             223   2e-63   
gb|KFH05082.1|  cytosolic tRNA-Ala synthetase                           221   2e-63   
ref|XP_004223054.1|  alanyl-tRNA synthetase                             223   2e-63   
ref|XP_007397053.1|  hypothetical protein PHACADRAFT_258158             223   2e-63   
ref|XP_007308256.1|  hypothetical protein STEHIDRAFT_149395             223   2e-63   
ref|XP_007737759.1|  alanyl-tRNA synthetase                             223   3e-63   
ref|XP_007286070.1|  alanyl-trna synthetase                             223   3e-63   
ref|XP_003683463.1|  hypothetical protein TDEL_0H03930                  223   3e-63   
ref|XP_007409403.1|  hypothetical protein MELLADRAFT_48072              223   3e-63   
gb|AAF05592.1|AF188717_1  alanyl-tRNA synthetase                        223   3e-63   
ref|XP_004360351.1|  alanyl-tRNA synthetase                             223   3e-63   
ref|XP_642382.1|  alanyl-tRNA synthetase                                223   3e-63   
ref|XP_007872286.1|  alanyl-tRNA synthetase                             223   3e-63   
ref|XP_003686912.1|  hypothetical protein TPHA_0H02750                  223   3e-63   
gb|KHJ35999.1|  putative alanyl-trna synthetase                         223   3e-63   
ref|XP_003328904.2|  alanyl-tRNA synthetase                             223   3e-63   
ref|NP_984459.1|  ADR363Cp                                              222   3e-63   
ref|XP_002370708.1|  alanyl-tRNA synthetase, putative                   223   4e-63   
gb|KIV86028.1|  alanine-tRNA ligase                                     223   4e-63   
ref|XP_007266315.1|  hypothetical protein FOMMEDRAFT_167809             222   4e-63   
gb|KDN40606.1|  hypothetical protein K437DRAFT_258595                   222   4e-63   
ref|XP_679250.1|  alanine--tRNA ligase                                  223   4e-63   
gb|EMT07345.1|  Alanyl-tRNA synthetase, mitochondrial                   222   4e-63   
ref|XP_002950616.1|  hypothetical protein VOLCADRAFT_120886             223   5e-63   
ref|XP_007328463.1|  hypothetical protein AGABI1DRAFT_112599            222   5e-63   
gb|EME44029.1|  hypothetical protein DOTSEDRAFT_44310                   222   5e-63   
ref|XP_006461020.1|  hypothetical protein AGABI2DRAFT_192563            222   5e-63   
gb|KDN64543.1|  putative tRNA synthetase class II                       222   5e-63   
emb|CDO66456.1|  alanine--tRNA ligase, putative                         224   5e-63   
emb|CCJ30352.1|  unnamed protein product                                222   6e-63   
gb|KIJ21967.1|  hypothetical protein PAXINDRAFT_165291                  222   6e-63   
emb|CCA14233.1|  unnamed protein product                                222   6e-63   
gb|KDE06114.1|  alanyl-tRNA synthetase                                  221   7e-63   
emb|CAK47129.1|  unnamed protein product                                221   7e-63   
emb|CDR14283.1|  alanine--tRNA ligase, putative                         223   7e-63   
gb|KJJ25100.1|  Alanine-tRNA ligase class IIc                           221   7e-63   
gb|EUD73548.1|  alanyl-tRNA synthetase                                  223   7e-63   
ref|XP_731046.1|  alanyl-tRNA synthetase                                223   7e-63   
gb|ETB61123.1|  alanine-tRNA ligase                                     223   7e-63   
ref|XP_002290312.1|  alanine-trna ligase                                221   8e-63   
emb|CEJ88871.1|  Putative Alanyl-tRNA synthetase                        221   8e-63   
dbj|GAM82706.1|  hypothetical protein ANO11243_006900                   221   8e-63   
gb|EFX00948.1|  alanyl-tRNA synthetase                                  223   9e-63   
ref|XP_007779583.1|  alanyl-tRNA synthetase                             221   9e-63   
gb|KDO26418.1|  alanyl-tRNA synthetase                                  221   9e-63   
dbj|GAD98516.1|  alanyl-tRNA synthetase, cytoplasmic                    221   9e-63   
emb|CCX13711.1|  Similar to Alanine--tRNA ligase; acc. no. Q5AQL1       221   9e-63   
emb|CDS48859.1|  alanine--tRNA ligase, putative                         223   1e-62   
gb|AGO12026.1|  AaceriADR363Cp                                          221   1e-62   
gb|KII92325.1|  hypothetical protein PLICRDRAFT_37088                   221   1e-62   
gb|EMD37438.1|  hypothetical protein CERSUDRAFT_83193                   221   1e-62   
ref|XP_008624155.1|  alanyl-tRNA synthetase                             223   1e-62   
ref|XP_008608777.1|  alanyl-tRNA synthetase                             221   1e-62   
ref|XP_001398230.2|  alanyl-tRNA synthetase, cytoplasmic                221   1e-62   
ref|XP_008889427.1|  cytosolic tRNA-Ala synthetase                      223   1e-62   
ref|XP_003885707.1|  hypothetical protein NCLIV_061050                  221   1e-62   
ref|XP_002111584.1|  hypothetical protein TRIADDRAFT_23916              221   1e-62   
emb|CCC90799.1|  putative alanyl-tRNA synthetase                        221   1e-62   
emb|CCF32573.1|  alanyl-tRNA synthetase                                 221   1e-62   
gb|KIK96545.1|  hypothetical protein PAXRUDRAFT_825820                  221   1e-62   
ref|XP_009856724.1|  hypothetical protein NEUTE1DRAFT_126487            221   1e-62   
gb|EPR63933.1|  cytosolic tRNA-Ala synthetase                           223   1e-62   
gb|EGZ77942.1|  cytosolic probable alanine--tRNA ligase                 221   1e-62   
emb|CEF67938.1|  Alanine--tRNA ligase, mitochondrial                    221   1e-62   
ref|XP_003652306.1|  hypothetical protein THITE_2113640                 221   1e-62   
ref|XP_007590082.1|  tRNA synthetase class II                           222   2e-62   
ref|XP_003346257.1|  hypothetical protein SMAC_05794                    221   2e-62   
gb|ENH77318.1|  alanyl-trna synthetase                                  220   2e-62   
gb|EPT24601.1|  cytosolic tRNA-Ala synthetase                           223   2e-62   
gb|EWC74253.1|  alanine-tRNA ligase                                     223   2e-62   
gb|ETW27678.1|  alanine-tRNA ligase                                     223   2e-62   
ref|XP_001350388.1|  alanine--tRNA ligase, putative                     223   2e-62   
gb|ETW55467.1|  alanine-tRNA ligase                                     223   2e-62   
gb|ETW34419.1|  alanine-tRNA ligase                                     223   2e-62   
gb|EUR65385.1|  alanine-tRNA ligase                                     223   2e-62   
gb|ESW96567.1|  Alanine--tRNA ligase                                    221   2e-62   
gb|ESS28921.1|  cytosolic tRNA-Ala synthetase                           223   2e-62   
gb|EUB62782.1|  Alanyl-tRNA synthetase, cytoplasmic                     220   2e-62   
gb|ETW40451.1|  alanine-tRNA ligase                                     223   2e-62   
gb|ETW16520.1|  alanine-tRNA ligase                                     223   2e-62   
gb|ETW47135.1|  alanine-tRNA ligase                                     223   2e-62   
emb|CAX69310.1|  Alanyl-tRNA synthetase                                 209   2e-62   
gb|EPE10223.1|  alanyl-trna synthetase                                  220   2e-62   
ref|XP_011061291.1|  PREDICTED: alanine--tRNA ligase, cytoplasmic...    220   2e-62   
ref|XP_008545550.1|  PREDICTED: alanine--tRNA ligase, cytoplasmic       220   2e-62   
ref|XP_002796769.1|  alanyl-tRNA synthetase                             220   2e-62   
ref|XP_001261933.1|  alanyl-tRNA synthetase, putative                   220   2e-62   
gb|KEQ98971.1|  hypothetical protein AUEXF2481DRAFT_62459               220   2e-62   
ref|XP_002183027.1|  predicted protein                                  220   2e-62   
gb|EKV04967.1|  Alanyl-tRNA synthetase, putative                        220   2e-62   
ref|XP_002565032.1|  Pc22g10240                                         220   2e-62   
ref|XP_003285278.1|  alanyl-tRNA synthetase                             220   2e-62   
gb|KGO43717.1|  Translation elongation/initiation factor/Ribosoma...    220   3e-62   
ref|XP_008818617.1|  alanyl-tRNA synthetase                             221   3e-62   
gb|KDR10980.1|  Alanyl-tRNA synthetase, cytoplasmic                     220   3e-62   
gb|EFN72738.1|  Alanyl-tRNA synthetase, cytoplasmic                     219   3e-62   
ref|XP_009021139.1|  hypothetical protein HELRODRAFT_100946             220   3e-62   
emb|CDH55480.1|  alanyl-trna synthetase                                 219   3e-62   
gb|KIM70344.1|  hypothetical protein SCLCIDRAFT_19240                   219   3e-62   
ref|XP_005830058.1|  hypothetical protein GUITHDRAFT_163919             219   3e-62   
ref|XP_006966474.1|  predicted protein                                  219   4e-62   
gb|EDP48921.1|  alanyl-tRNA synthetase, putative                        220   4e-62   
ref|XP_011689776.1|  PREDICTED: alanine--tRNA ligase, cytoplasmic...    219   4e-62   
ref|XP_747195.1|  alanyl-tRNA synthetase                                219   4e-62   
gb|KIK48384.1|  hypothetical protein CY34DRAFT_71989                    219   4e-62   
emb|CCI40732.1|  unnamed protein product                                221   4e-62   
gb|KJP87971.1|  alanine-tRNA ligase                                     221   5e-62   
gb|EHK25247.1|  hypothetical protein TRIVIDRAFT_72371                   219   5e-62   
ref|XP_965697.3|  alanyl-tRNA synthetase                                220   5e-62   
emb|CDM36177.1|  Alanyl-tRNA synthetase                                 219   5e-62   
gb|KHE90003.1|  hypothetical protein GE21DRAFT_743                      220   5e-62   
gb|EEH39315.2|  alanyl-tRNA synthetase                                  219   5e-62   
ref|XP_010755650.1|  alanyl-tRNA synthetase                             219   5e-62   
gb|EFA82800.1|  alanyl-tRNA synthetase                                  219   6e-62   
gb|EEH21600.2|  alanyl-tRNA synthetase                                  219   6e-62   
gb|KFX85693.1|  hypothetical protein V490_09480                         219   6e-62   
ref|XP_001276490.1|  alanyl-tRNA synthetase, putative                   219   6e-62   
gb|KGQ12010.1|  Alanine--tRNA ligase                                    219   7e-62   
gb|EMS24060.1|  alanine-tRNA synthetase                                 219   7e-62   
ref|XP_009216994.1|  alanyl-tRNA synthetase                             219   7e-62   
ref|XP_008593589.1|  tRNA synthetase class II                           219   7e-62   
ref|XP_011300406.1|  PREDICTED: alanine--tRNA ligase, cytoplasmic       219   7e-62   
ref|XP_006670682.1|  alanyl-tRNA synthetase                             218   8e-62   
ref|XP_318757.4|  AGAP009701-PA                                         218   8e-62   
emb|CDI99859.1|  alanyl tRNA synthetase, cytoplasmic                    219   8e-62   
ref|XP_011348264.1|  PREDICTED: alanine--tRNA ligase, cytoplasmic...    219   8e-62   
gb|EGU11988.1|  hypothetical protein RTG_01868                          218   8e-62   
ref|XP_004533955.1|  PREDICTED: alanine--tRNA ligase, cytoplasmic...    218   8e-62   
ref|XP_009843450.1|  alanine-tRNA ligase                                219   8e-62   
ref|XP_011061293.1|  PREDICTED: alanine--tRNA ligase, cytoplasmic...    220   9e-62   
gb|KIM78966.1|  hypothetical protein PILCRDRAFT_824096                  218   9e-62   
gb|EHK40392.1|  hypothetical protein TRIATDRAFT_153342                  218   9e-62   
ref|XP_008915192.1|  alanine-tRNA ligase                                218   9e-62   
gb|ETP28900.1|  alanine-tRNA ligase                                     218   1e-61   
gb|ETI30952.1|  alanine-tRNA ligase                                     218   1e-61   
gb|ENN77299.1|  hypothetical protein YQE_06125                          218   1e-61   
gb|ERL91554.1|  hypothetical protein D910_08884                         218   1e-61   
ref|XP_002018701.1|  GL25810                                            218   1e-61   
gb|KFG77953.1|  alanyl-tRNA synthetase                                  218   1e-61   
gb|EPS26059.1|  hypothetical protein PDE_00995                          218   1e-61   



>ref|XP_008461868.1| PREDICTED: alanine--tRNA ligase-like [Cucumis melo]
Length=364

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/145 (85%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +3

Query  252  GLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  431
            G+EWP+ +VRDTF +FFE K H   KSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT
Sbjct  82   GVEWPAERVRDTFFRFFEEKNHVYWKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  141

Query  432  ELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWEL  611
             LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWEL
Sbjct  142  SLSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAITWAWEL  201

Query  612  LTEVYKLPAIRIYATYFGGDEKMAF  686
            LT+VYKLP  RIYATYFGGDEK   
Sbjct  202  LTQVYKLPTDRIYATYFGGDEKAGL  226



>ref|XP_011084638.1| PREDICTED: LOW QUALITY PROTEIN: alanine--tRNA ligase [Sesamum 
indicum]
Length=1012

 Score =   278 bits (712),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            EWP+++VR+TFIKFF+ KAH   KSSPVVP NDPTLLFANAGMNQFKPIFLGT DPNTEL
Sbjct  84   EWPATRVRETFIKFFQDKAHVNWKSSPVVPYNDPTLLFANAGMNQFKPIFLGTADPNTEL  143

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
            SKL+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAIQWAWELLT
Sbjct  144  SKLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIQWAWELLT  203

Query  618  EVYKLPAIRIYATYFGGDEKMAFHLI  695
            EVYKLP+ RIYATYFGGDEK+A  ++
Sbjct  204  EVYKLPSDRIYATYFGGDEKLANRVL  229



>gb|EPS72880.1| hypothetical protein M569_01869, partial [Genlisea aurea]
Length=950

 Score =   276 bits (706),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            EWP+++VRDTFIKFFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT DPNTEL
Sbjct  10   EWPANRVRDTFIKFFEGKGHVDWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTADPNTEL  69

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
            SKLKRAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELLT
Sbjct  70   SKLKRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIEWAWELLT  129

Query  618  EVYKLPAIRIYATYFGGDEKMAF  686
            EVYKLP+ RIYATYFGGDE++  
Sbjct  130  EVYKLPSDRIYATYFGGDERLGL  152



>ref|XP_009351710.1| PREDICTED: alanine--tRNA ligase [Pyrus x bretschneideri]
Length=952

 Score =   273 bits (699),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +3

Query  243  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            E  GLEWP+ +VRDTF+KFFE KAH   KSSPVVP NDPTLLFANAGMNQFKPIFLGT D
Sbjct  5    ESQGLEWPAKRVRDTFVKFFEEKAHVFWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTAD  64

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            PNT+LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WA
Sbjct  65   PNTQLSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIGWA  124

Query  603  WELLTEVYKLPAIRIYATYFGGDEKMAF  686
            WELLT+VYKLP  RIYATYFGGDEK   
Sbjct  125  WELLTKVYKLPEDRIYATYFGGDEKAGL  152



>ref|XP_003619276.1| Alanyl-tRNA synthetase, partial [Medicago truncatula]
Length=900

 Score =   271 bits (694),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP+++VRDTF+KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGTVDPNT 
Sbjct  9    IEWPANRVRDTFVKFFEEKNHVYWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTVDPNTA  68

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELL
Sbjct  69   LSKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAISWAWELL  128

Query  615  TEVYKLPAIRIYATYFGGDEKMAF  686
            T+VYKLP+ RIYATYFGGDEK   
Sbjct  129  TKVYKLPSDRIYATYFGGDEKAGL  152



>ref|XP_003607217.1| Alanyl-tRNA synthetase [Medicago truncatula]
 gb|AES89414.1| alanine-tRNA ligase [Medicago truncatula]
Length=950

 Score =   272 bits (695),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP+++VRDTF+KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGTVDPNT 
Sbjct  9    IEWPANRVRDTFVKFFEEKNHVYWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTVDPNTA  68

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELL
Sbjct  69   LSKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAISWAWELL  128

Query  615  TEVYKLPAIRIYATYFGGDEKMAF  686
            T+VYKLP+ RIYATYFGGDEK   
Sbjct  129  TKVYKLPSDRIYATYFGGDEKAGL  152



>ref|XP_011022066.1| PREDICTED: alanine--tRNA ligase [Populus euphratica]
Length=1008

 Score =   272 bits (696),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            ++WP+++VRDTFIKFFE K H   KSSPVVPVNDPTLLFANAGMNQFKPIFLGT DPNT 
Sbjct  62   VDWPANRVRDTFIKFFEEKKHVDWKSSPVVPVNDPTLLFANAGMNQFKPIFLGTADPNTA  121

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  122  LSKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELL  181

Query  615  TEVYKLPAIRIYATYFGGDEKMAF  686
            T+VYKLPA RIYATYFGGDEK   
Sbjct  182  TKVYKLPADRIYATYFGGDEKAGL  205



>ref|XP_002277341.1| PREDICTED: alanine--tRNA ligase [Vitis vinifera]
Length=1002

 Score =   272 bits (696),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 143/174 (82%), Gaps = 3/174 (2%)
 Frame = +3

Query  156  PPLDTLLRRRHFspspstsipsvvsqqqqEMAGLEWPSSKVRDTFIKFFESKAHTCVKSS  335
            PPL   +R   F+ S   ++  +  +   E   +EWP++KVRDTFI FFESK H   KSS
Sbjct  26   PPLPPPIRVSFFTYSSEAAVIGMAQKAVSE---VEWPANKVRDTFINFFESKNHVDWKSS  82

Query  336  PVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELSKLKRACDTQKCIRAGGKHNDLDDVG  515
            PVVPVNDPTLLFANAGMNQFKPIFLGT DPNT LSKL RAC+TQKCIRAGGKHNDLDDVG
Sbjct  83   PVVPVNDPTLLFANAGMNQFKPIFLGTADPNTALSKLTRACNTQKCIRAGGKHNDLDDVG  142

Query  516  KDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTEVYKLPAIRIYATYFGGDEK  677
            KDTYHHTFFEMLGNWSFGDYFK EAI+WAWELLT+VYKLP  RIYATYFGGDEK
Sbjct  143  KDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELLTKVYKLPTDRIYATYFGGDEK  196



>ref|XP_008340455.1| PREDICTED: alanine--tRNA ligase [Malus domestica]
Length=1015

 Score =   272 bits (695),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +3

Query  243  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            E  GLEWP+ +VRDTF+KFFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT D
Sbjct  68   ESQGLEWPAKRVRDTFVKFFEEKGHVFWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTAD  127

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            PNT+LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WA
Sbjct  128  PNTQLSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIGWA  187

Query  603  WELLTEVYKLPAIRIYATYFGGDEKMAF  686
            WELLT+VYKLP  RIYATYFGGDEK   
Sbjct  188  WELLTKVYKLPEDRIYATYFGGDEKAGL  215



>ref|XP_002307181.2| alanyl-tRNA synthetase family protein [Populus trichocarpa]
 gb|EEE94177.2| alanyl-tRNA synthetase family protein [Populus trichocarpa]
Length=967

 Score =   271 bits (693),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            ++WP+++VRDTFIKFFE K H   KSSPVVPVNDPTLLFANAGMNQFKPIFLGT DPNT 
Sbjct  12   VDWPANRVRDTFIKFFEEKNHVDWKSSPVVPVNDPTLLFANAGMNQFKPIFLGTADPNTA  71

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  72   LSKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELL  131

Query  615  TEVYKLPAIRIYATYFGGDEKMAF  686
            T+VYKLPA RIYATYFGGDEK   
Sbjct  132  TKVYKLPADRIYATYFGGDEKAGL  155



>gb|KDO52986.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=844

 Score =   269 bits (687),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIEWAWELL  175

Query  615  TEVYKLPAIRIYATYFGGDEKMAF  686
            T+VY+LPA R+YATYFGGDEK   
Sbjct  176  TKVYRLPADRLYATYFGGDEKAGL  199



>gb|KDO52987.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=787

 Score =   268 bits (684),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIEWAWELL  175

Query  615  TEVYKLPAIRIYATYFGGDEKMAF  686
            T+VY+LPA R+YATYFGGDEK   
Sbjct  176  TKVYRLPADRLYATYFGGDEKAGL  199



>gb|KDO52985.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=936

 Score =   270 bits (690),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIEWAWELL  175

Query  615  TEVYKLPAIRIYATYFGGDEKMAF  686
            T+VY+LPA R+YATYFGGDEK   
Sbjct  176  TKVYRLPADRLYATYFGGDEKAGL  199



>ref|XP_002531134.1| alanyl-tRNA synthetase, putative [Ricinus communis]
 gb|EEF31254.1| alanyl-tRNA synthetase, putative [Ricinus communis]
Length=1025

 Score =   271 bits (692),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP+ KVRDTFI FFE K H   KSSPVVPVNDPTLLFANAGMNQFKPIFLGT DPNT 
Sbjct  79   MEWPAKKVRDTFISFFEDKKHVHWKSSPVVPVNDPTLLFANAGMNQFKPIFLGTADPNTA  138

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELL
Sbjct  139  LSKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKREAIGWAWELL  198

Query  615  TEVYKLPAIRIYATYFGGDEKMAF  686
            T++YKLPA RIYATYFGGDEK   
Sbjct  199  TKIYKLPADRIYATYFGGDEKAGL  222



>gb|KDO52982.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=995

 Score =   270 bits (691),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIEWAWELL  175

Query  615  TEVYKLPAIRIYATYFGGDEKMAF  686
            T+VY+LPA R+YATYFGGDEK   
Sbjct  176  TKVYRLPADRLYATYFGGDEKAGL  199



>gb|KDO52980.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=1002

 Score =   270 bits (691),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIEWAWELL  175

Query  615  TEVYKLPAIRIYATYFGGDEKMAF  686
            T+VY+LPA R+YATYFGGDEK   
Sbjct  176  TKVYRLPADRLYATYFGGDEKAGL  199



>gb|KDO52981.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=972

 Score =   270 bits (690),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIEWAWELL  175

Query  615  TEVYKLPAIRIYATYFGGDEKMAF  686
            T+VY+LPA R+YATYFGGDEK   
Sbjct  176  TKVYRLPADRLYATYFGGDEKAGL  199



>ref|XP_006437524.1| hypothetical protein CICLE_v10030624mg [Citrus clementina]
 gb|ESR50764.1| hypothetical protein CICLE_v10030624mg [Citrus clementina]
Length=1001

 Score =   270 bits (691),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIEWAWELL  175

Query  615  TEVYKLPAIRIYATYFGGDEKMAF  686
            T+VY+LPA R+YATYFGGDEK   
Sbjct  176  TKVYRLPADRLYATYFGGDEKAGL  199



>ref|XP_009601820.1| PREDICTED: alanine--tRNA ligase {ECO:0000255|HAMAP-Rule:MF_03133} 
[Nicotiana tomentosiformis]
Length=1027

 Score =   270 bits (691),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/145 (84%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = +3

Query  243  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            + A LEWP++KVR TFI FF+ K H  V+SSPVVP NDPTLLFANAGMNQFKPIFLG VD
Sbjct  77   QSAELEWPANKVRQTFINFFQGKGHEQVESSPVVPHNDPTLLFANAGMNQFKPIFLGIVD  136

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            PN+ LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WA
Sbjct  137  PNSPLSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWA  196

Query  603  WELLTEVYKLPAIRIYATYFGGDEK  677
            WELLT+VY+LP  RIYATYFGGDEK
Sbjct  197  WELLTQVYRLPGDRIYATYFGGDEK  221



>gb|KDO52984.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=957

 Score =   270 bits (689),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIEWAWELL  175

Query  615  TEVYKLPAIRIYATYFGGDEKMAF  686
            T+VY+LPA R+YATYFGGDEK   
Sbjct  176  TKVYRLPADRLYATYFGGDEKAGL  199



>ref|XP_010273668.1| PREDICTED: alanine--tRNA ligase [Nelumbo nucifera]
Length=1038

 Score =   270 bits (690),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 122/141 (87%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP+S+VRDTF+ FFE K H    SSPVVP+NDPTLLFANAGMNQFKPIFLGTVDPNT 
Sbjct  89   VEWPASRVRDTFLSFFEGKGHVNWNSSPVVPLNDPTLLFANAGMNQFKPIFLGTVDPNTS  148

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELL
Sbjct  149  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKREAIGWAWELL  208

Query  615  TEVYKLPAIRIYATYFGGDEK  677
            T+VYKLPA RIYATYFGGDEK
Sbjct  209  TQVYKLPADRIYATYFGGDEK  229



>gb|KDO52983.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=1009

 Score =   270 bits (689),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  116  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIEWAWELL  175

Query  615  TEVYKLPAIRIYATYFGGDEKMAF  686
            T+VY+LPA R+YATYFGGDEK   
Sbjct  176  TKVYRLPADRLYATYFGGDEKAGL  199



>ref|XP_004505726.1| PREDICTED: alanine--tRNA ligase-like [Cicer arietinum]
Length=990

 Score =   269 bits (687),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +WP+ +VRDT+IKFF+ K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT DPNT L
Sbjct  50   DWPAKRVRDTYIKFFQEKNHVNWKSSPVVPFNDPTLLFANAGMNQFKPIFLGTADPNTSL  109

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELLT
Sbjct  110  SKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKVEAISWAWELLT  169

Query  618  EVYKLPAIRIYATYFGGDEKMAF  686
            EVYKLP+ RIYATYFGGDEK+  
Sbjct  170  EVYKLPSDRIYATYFGGDEKLGL  192



>ref|XP_009802310.1| PREDICTED: alanine--tRNA ligase [Nicotiana sylvestris]
Length=1014

 Score =   269 bits (687),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            LEWP++KVR TFI FF+ K H  V+SSPVVP NDPTLLFANAGMNQFKPIFLG VDPN+ 
Sbjct  81   LEWPANKVRQTFINFFQGKGHEQVESSPVVPHNDPTLLFANAGMNQFKPIFLGIVDPNSP  140

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  141  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELL  200

Query  615  TEVYKLPAIRIYATYFGGDEKMAF  686
            T+VY+LP  RIYATYFGGDEK   
Sbjct  201  TQVYRLPGDRIYATYFGGDEKTGL  224



>ref|XP_004148575.2| PREDICTED: alanine--tRNA ligase [Cucumis sativus]
 gb|KGN58521.1| hypothetical protein Csa_3G656490 [Cucumis sativus]
Length=1030

 Score =   269 bits (687),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = +3

Query  252  GLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  431
            G+EWP+ ++RDTF +FFE K H    SSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT
Sbjct  82   GVEWPADRIRDTFFRFFEEKNHVYWNSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  141

Query  432  ELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWEL  611
             LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWEL
Sbjct  142  SLSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAITWAWEL  201

Query  612  LTEVYKLPAIRIYATYFGGDEKMAF  686
            LT+VYKLP  RIYATYFGGDEK   
Sbjct  202  LTQVYKLPKDRIYATYFGGDEKAGL  226



>ref|XP_008221037.1| PREDICTED: alanine--tRNA ligase [Prunus mume]
Length=1025

 Score =   268 bits (686),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +3

Query  243  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            E  G+EWP+ +VRDTF++FFE K+H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT D
Sbjct  78   ESMGVEWPAKRVRDTFMRFFEEKSHVYWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTAD  137

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            PNT+LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WA
Sbjct  138  PNTQLSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIGWA  197

Query  603  WELLTEVYKLPAIRIYATYFGGDEKMAF  686
            WELLT+VYKLP  RIYATYFGGD+K   
Sbjct  198  WELLTQVYKLPEDRIYATYFGGDDKAGL  225



>ref|XP_012065800.1| PREDICTED: alanine--tRNA ligase [Jatropha curcas]
 gb|KDP43289.1| hypothetical protein JCGZ_24210 [Jatropha curcas]
Length=1019

 Score =   268 bits (684),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP+ KVRDTFI FFE K H   KSSPVVPVNDPTLLFANAGMNQFKPIFLGT DPNT 
Sbjct  73   VEWPAKKVRDTFISFFEDKNHVHWKSSPVVPVNDPTLLFANAGMNQFKPIFLGTADPNTA  132

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  133  LSKLIRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELL  192

Query  615  TEVYKLPAIRIYATYFGGDEKMAF  686
            T+VYKLP  RIYATYFGGD+K   
Sbjct  193  TKVYKLPTDRIYATYFGGDDKAGL  216



>ref|XP_003607220.1| Alanyl-tRNA synthetase [Medicago truncatula]
Length=635

 Score =   261 bits (667),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +3

Query  243  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            E   +EWP+ +VRDTF KFFE K H   KSS VVP+NDPTLLFANAGMNQFKPIFLGTVD
Sbjct  5    ESIDIEWPAKRVRDTFAKFFEEKNHVHWKSSAVVPLNDPTLLFANAGMNQFKPIFLGTVD  64

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            PNT LSKL RAC+ QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WA
Sbjct  65   PNTALSKLTRACNIQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAISWA  124

Query  603  WELLTEVYKLPAIRIYATYFGGDEKMAF  686
            WELLTEVY LP+ RIY TYFGGDEK   
Sbjct  125  WELLTEVYNLPSDRIYVTYFGGDEKTGL  152



>gb|AES89417.2| alanyl-tRNA synthetase [Medicago truncatula]
Length=635

 Score =   261 bits (667),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +3

Query  243  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            E   +EWP+ +VRDTF KFFE K H   KSS VVP+NDPTLLFANAGMNQFKPIFLGTVD
Sbjct  5    ESIDIEWPAKRVRDTFAKFFEEKNHVHWKSSAVVPLNDPTLLFANAGMNQFKPIFLGTVD  64

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            PNT LSKL RAC+ QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WA
Sbjct  65   PNTALSKLTRACNIQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAISWA  124

Query  603  WELLTEVYKLPAIRIYATYFGGDEKMAF  686
            WELLTEVY LP+ RIY TYFGGDEK   
Sbjct  125  WELLTEVYNLPSDRIYVTYFGGDEKTGL  152



>ref|XP_004235270.1| PREDICTED: alanine--tRNA ligase [Solanum lycopersicum]
Length=1010

 Score =   266 bits (681),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            L+WP++KVR TFI FF+ K H  V+SSPVVP NDPTLLFANAGMNQFKPIFLG VDPN+ 
Sbjct  64   LDWPANKVRQTFISFFQGKDHKEVQSSPVVPHNDPTLLFANAGMNQFKPIFLGIVDPNSP  123

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELL
Sbjct  124  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIGWAWELL  183

Query  615  TEVYKLPAIRIYATYFGGDEK  677
            T+VYKLP+ RIYATYFGGDEK
Sbjct  184  TQVYKLPSERIYATYFGGDEK  204



>ref|XP_010683781.1| PREDICTED: alanine--tRNA ligase [Beta vulgaris subsp. vulgaris]
Length=1007

 Score =   266 bits (681),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            ++W ++KVRDTFIKFFE K+HT  KSSPVVP NDPTLLFANAGMNQ+KPIFLGT+DPN+ 
Sbjct  61   VDWSATKVRDTFIKFFEGKSHTFWKSSPVVPHNDPTLLFANAGMNQYKPIFLGTIDPNSP  120

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            LS +KRAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  121  LSVMKRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELL  180

Query  615  TEVYKLPAIRIYATYFGGDEKMAF  686
            T+VYKLPA RIYATYFGGDEK   
Sbjct  181  TKVYKLPADRIYATYFGGDEKAGL  204



>ref|XP_007043323.1| Alanyl-tRNA synthetase, putative [Theobroma cacao]
 gb|EOX99154.1| Alanyl-tRNA synthetase, putative [Theobroma cacao]
Length=1015

 Score =   266 bits (680),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP+ KVRDTF KFFE K H   KSSPVVP+NDPTLLFANAGMNQFKPIFLGTVDPNT 
Sbjct  65   MEWPAKKVRDTFFKFFEGKNHVNWKSSPVVPLNDPTLLFANAGMNQFKPIFLGTVDPNTA  124

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK +AI+WAWELL
Sbjct  125  MSKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKDAIEWAWELL  184

Query  615  TEVYKLPAIRIYATYFGGDEKMAF  686
            T+VY LP  RIYATYFGGDEK   
Sbjct  185  TKVYGLPTERIYATYFGGDEKAGL  208



>ref|XP_010523577.1| PREDICTED: alanine--tRNA ligase-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010523578.1| PREDICTED: alanine--tRNA ligase-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010523579.1| PREDICTED: alanine--tRNA ligase-like isoform X2 [Tarenaya hassleriana]
Length=1003

 Score =   266 bits (679),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +3

Query  243  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            E + ++WP+ +VRDTFIKFFE K H   KSSPVVP +DPTLLFANAGMNQFKPIFLGTVD
Sbjct  56   ESSEIQWPARRVRDTFIKFFEGKGHVNWKSSPVVPHSDPTLLFANAGMNQFKPIFLGTVD  115

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            PNT LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WA
Sbjct  116  PNTALSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKQEAIEWA  175

Query  603  WELLTEVYKLPAIRIYATYFGGDEKMAF  686
            WELLT+VY LP  RIYATYFGGDEK   
Sbjct  176  WELLTKVYGLPTDRIYATYFGGDEKAGL  203



>ref|XP_010662077.1| PREDICTED: alanine--tRNA ligase-like [Vitis vinifera]
Length=955

 Score =   265 bits (678),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            EWP++KVRDTFI FFE+K H    SSPVVP+NDPTLLFANAGMNQFKPIFLGT DPNT L
Sbjct  10   EWPAAKVRDTFISFFEAKEHVNWVSSPVVPLNDPTLLFANAGMNQFKPIFLGTADPNTPL  69

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELLT
Sbjct  70   SKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKREAIEWAWELLT  129

Query  618  EVYKLPAIRIYATYFGGDEKMAF  686
            EVYKLP  R YATYFGGDE++  
Sbjct  130  EVYKLPTDRFYATYFGGDEQLGL  152



>ref|XP_006484669.1| PREDICTED: alanine--tRNA ligase-like isoform X2 [Citrus sinensis]
Length=1002

 Score =   266 bits (679),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            LSKL RA +TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  116  LSKLTRAFNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIEWAWELL  175

Query  615  TEVYKLPAIRIYATYFGGDEKMAF  686
            T+VY+LPA R+YATYFGGDEK   
Sbjct  176  TKVYRLPADRLYATYFGGDEKAGL  199



>emb|CBI27126.3| unnamed protein product [Vitis vinifera]
Length=1026

 Score =   266 bits (679),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 130/145 (90%), Gaps = 4/145 (3%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP++KVRDTFI FFESK H   KSSPVVPVNDPTLLFANAGMNQFKPIFLGT DPNT 
Sbjct  9    VEWPANKVRDTFINFFESKNHVDWKSSPVVPVNDPTLLFANAGMNQFKPIFLGTADPNTA  68

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  69   LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELL  128

Query  615  TE----VYKLPAIRIYATYFGGDEK  677
            T+    VYKLP  RIYATYFGGDEK
Sbjct  129  TKAKNLVYKLPTDRIYATYFGGDEK  153



>ref|XP_006347609.1| PREDICTED: alanine--tRNA ligase-like [Solanum tuberosum]
Length=1009

 Score =   265 bits (677),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/141 (84%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            L+WP++KVR+TFI FF+ K H  V+SSPVVP NDPTLLFANAGMNQFKPIFLG VDPN+ 
Sbjct  63   LDWPANKVRETFISFFQGKDHKEVQSSPVVPHNDPTLLFANAGMNQFKPIFLGIVDPNSP  122

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELL
Sbjct  123  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIGWAWELL  182

Query  615  TEVYKLPAIRIYATYFGGDEK  677
            T+VY+LP+ RIYA+YFGGDEK
Sbjct  183  TQVYRLPSERIYASYFGGDEK  203



>ref|XP_003537781.2| PREDICTED: alanine--tRNA ligase-like isoform X1 [Glycine max]
Length=999

 Score =   265 bits (677),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = +3

Query  243  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            E   +EWP+ +VRDTFI FF+ K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT D
Sbjct  54   ETHDVEWPAKRVRDTFISFFQDKNHVNWKSSPVVPFNDPTLLFANAGMNQFKPIFLGTAD  113

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            PNT LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WA
Sbjct  114  PNTALSKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKVEAISWA  173

Query  603  WELLTEVYKLPAIRIYATYFGGDEK  677
            WELLT+VYKLP+ RIYATYFGGD+K
Sbjct  174  WELLTKVYKLPSDRIYATYFGGDDK  198



>ref|XP_006484668.1| PREDICTED: alanine--tRNA ligase-like isoform X1 [Citrus sinensis]
Length=1009

 Score =   265 bits (677),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP++KVRDTF KFFE K H   KSSPVVPVNDPTLLFANAGMNQ+KPIFLGT DPNT+
Sbjct  56   VEWPATKVRDTFFKFFEDKNHVNWKSSPVVPVNDPTLLFANAGMNQYKPIFLGTADPNTQ  115

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            LSKL RA +TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  116  LSKLTRAFNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIEWAWELL  175

Query  615  TEVYKLPAIRIYATYFGGDEKMAF  686
            T+VY+LPA R+YATYFGGDEK   
Sbjct  176  TKVYRLPADRLYATYFGGDEKAGL  199



>gb|KJB50035.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=930

 Score =   263 bits (672),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP+ KVRDTFIKFFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT+DPNT 
Sbjct  60   MEWPAKKVRDTFIKFFEGKNHVNWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTIDPNTA  119

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFG+YFK +AI+WAWELL
Sbjct  120  MSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGNYFKKDAIEWAWELL  179

Query  615  TEVYKLPAIRIYATYFGGDEKMAF  686
            T+VY LP  RIYATYFGGD+K   
Sbjct  180  TKVYSLPTDRIYATYFGGDDKAGL  203



>gb|AAK70626.1|AC091238_4 Putative cytosolic tRNA-Ala synthetase [Oryza sativa Japonica 
Group]
Length=351

 Score =   250 bits (639),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = +3

Query  249  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  428
            A  EWP+S+VR+TFI FFESK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P+
Sbjct  3    ASTEWPASRVRETFISFFESKSHTRWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPD  62

Query  429  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWE  608
              L +L+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI +AWE
Sbjct  63   APLGRLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAIGFAWE  122

Query  609  LLTEVYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            LLT+VYKLP  RIYATYFGGDEK       + +N+
Sbjct  123  LLTQVYKLPTDRIYATYFGGDEKFGLAPDTESKNI  157



>gb|KJB50034.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=927

 Score =   263 bits (672),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP+ KVRDTFIKFFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT+DPNT 
Sbjct  60   MEWPAKKVRDTFIKFFEGKNHVNWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTIDPNTA  119

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFG+YFK +AI+WAWELL
Sbjct  120  MSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGNYFKKDAIEWAWELL  179

Query  615  TEVYKLPAIRIYATYFGGDEKMAF  686
            T+VY LP  RIYATYFGGD+K   
Sbjct  180  TKVYSLPTDRIYATYFGGDDKAGL  203



>gb|KJB50036.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=1010

 Score =   264 bits (674),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP+ KVRDTFIKFFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT+DPNT 
Sbjct  60   MEWPAKKVRDTFIKFFEGKNHVNWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTIDPNTA  119

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFG+YFK +AI+WAWELL
Sbjct  120  MSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGNYFKKDAIEWAWELL  179

Query  615  TEVYKLPAIRIYATYFGGDEKMAF  686
            T+VY LP  RIYATYFGGD+K   
Sbjct  180  TKVYSLPTDRIYATYFGGDDKAGL  203



>gb|KJB50038.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
 gb|KJB50040.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=941

 Score =   263 bits (672),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP+ KVRDTFIKFFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT+DPNT 
Sbjct  60   MEWPAKKVRDTFIKFFEGKNHVNWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTIDPNTA  119

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFG+YFK +AI+WAWELL
Sbjct  120  MSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGNYFKKDAIEWAWELL  179

Query  615  TEVYKLPAIRIYATYFGGDEKMAF  686
            T+VY LP  RIYATYFGGD+K   
Sbjct  180  TKVYSLPTDRIYATYFGGDDKAGL  203



>gb|KJB50037.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=1070

 Score =   264 bits (674),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP+ KVRDTFIKFFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT+DPNT 
Sbjct  60   MEWPAKKVRDTFIKFFEGKNHVNWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTIDPNTA  119

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFG+YFK +AI+WAWELL
Sbjct  120  MSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGNYFKKDAIEWAWELL  179

Query  615  TEVYKLPAIRIYATYFGGDEKMAF  686
            T+VY LP  RIYATYFGGD+K   
Sbjct  180  TKVYSLPTDRIYATYFGGDDKAGL  203



>ref|XP_010031895.1| PREDICTED: alanine--tRNA ligase [Eucalyptus grandis]
 gb|KCW51291.1| hypothetical protein EUGRSUZ_J00856 [Eucalyptus grandis]
Length=1046

 Score =   264 bits (674),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +WP+S+VRDTFIKFFE K H    SSPVVPVNDPTLLFANAGMNQ+KPIFLGTVDP+  L
Sbjct  101  KWPASRVRDTFIKFFEGKRHVNWPSSPVVPVNDPTLLFANAGMNQYKPIFLGTVDPSNPL  160

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
             KL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELLT
Sbjct  161  GKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELLT  220

Query  618  EVYKLPAIRIYATYFGGDEKMAF  686
            EVYKLP  RIYATYFGGDEK   
Sbjct  221  EVYKLPKDRIYATYFGGDEKAGL  243



>gb|KJB50041.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=997

 Score =   263 bits (673),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP+ KVRDTFIKFFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT+DPNT 
Sbjct  60   MEWPAKKVRDTFIKFFEGKNHVNWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTIDPNTA  119

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFG+YFK +AI+WAWELL
Sbjct  120  MSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGNYFKKDAIEWAWELL  179

Query  615  TEVYKLPAIRIYATYFGGDEKMAF  686
            T+VY LP  RIYATYFGGD+K   
Sbjct  180  TKVYSLPTDRIYATYFGGDDKAGL  203



>gb|KJB50039.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=1001

 Score =   263 bits (673),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP+ KVRDTFIKFFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT+DPNT 
Sbjct  60   MEWPAKKVRDTFIKFFEGKNHVNWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTIDPNTA  119

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFG+YFK +AI+WAWELL
Sbjct  120  MSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGNYFKKDAIEWAWELL  179

Query  615  TEVYKLPAIRIYATYFGGDEKMAF  686
            T+VY LP  RIYATYFGGD+K   
Sbjct  180  TKVYSLPTDRIYATYFGGDDKAGL  203



>ref|XP_004297751.1| PREDICTED: alanine--tRNA ligase [Fragaria vesca subsp. vesca]
Length=1002

 Score =   263 bits (673),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 141/178 (79%), Gaps = 0/178 (0%)
 Frame = +3

Query  153  VPPLDTLLRRRHFspspstsipsvvsqqqqEMAGLEWPSSKVRDTFIKFFESKAHTCVKS  332
            +PP   L R R  S   +TS    +   + +  G+EWP+++VRDTF  +F  K H   KS
Sbjct  25   LPPPSHLTRNRSLSAIATTSFHPKMPGLESQAVGVEWPANRVRDTFFSYFMEKEHKNYKS  84

Query  333  SPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELSKLKRACDTQKCIRAGGKHNDLDDV  512
            SPVVP NDPTLLFANAGMNQFKPIFLGT DPNT+LSKL RAC+TQKCIRAGGKHNDL+DV
Sbjct  85   SPVVPHNDPTLLFANAGMNQFKPIFLGTADPNTDLSKLTRACNTQKCIRAGGKHNDLEDV  144

Query  513  GKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTEVYKLPAIRIYATYFGGDEKMAF  686
            GKDTYHHTFFEMLGNWSFGDYFK+EAI+WAW LLT+VYKLP  R YATYFGGDEK+  
Sbjct  145  GKDTYHHTFFEMLGNWSFGDYFKSEAIEWAWVLLTQVYKLPEDRFYATYFGGDEKLGL  202



>ref|XP_009386816.1| PREDICTED: alanine--tRNA ligase {ECO:0000255|HAMAP-Rule:MF_03133} 
[Musa acuminata subsp. malaccensis]
Length=990

 Score =   262 bits (670),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +3

Query  243  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            E   +EWP++KVR+TFI+FFE K H   +SSPVVP++DPTLLFANAGMNQFKPIFLGTV+
Sbjct  41   EATPVEWPATKVRETFIRFFEGKEHVDWRSSPVVPLDDPTLLFANAGMNQFKPIFLGTVN  100

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            P T L +L+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WA
Sbjct  101  PTTPLGRLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKAEAITWA  160

Query  603  WELLTEVYKLPAIRIYATYFGGDEKMAF  686
            WELLTEVY+LP  RIYATYFGGDEK+  
Sbjct  161  WELLTEVYELPKDRIYATYFGGDEKLGL  188



>ref|XP_008778009.1| PREDICTED: alanine--tRNA ligase-like [Phoenix dactylifera]
 ref|XP_008778010.1| PREDICTED: alanine--tRNA ligase-like [Phoenix dactylifera]
 ref|XP_008778012.1| PREDICTED: alanine--tRNA ligase-like [Phoenix dactylifera]
 ref|XP_008778013.1| PREDICTED: alanine--tRNA ligase-like [Phoenix dactylifera]
 ref|XP_008778014.1| PREDICTED: alanine--tRNA ligase-like [Phoenix dactylifera]
Length=991

 Score =   262 bits (669),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  249  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  428
            A +EWP+SKVR+TFI+FFE K H   +SSPVVP++DPTLLFANAGMNQFKPIFLGTV+P 
Sbjct  45   AAMEWPASKVRETFIRFFEGKGHVNWRSSPVVPLDDPTLLFANAGMNQFKPIFLGTVNPA  104

Query  429  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWE  608
              L KL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWE
Sbjct  105  NPLGKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKREAISWAWE  164

Query  609  LLTEVYKLPAIRIYATYFGGDEKMAF  686
            LLT+VYKLP  RIYATYFGGDEK   
Sbjct  165  LLTKVYKLPTDRIYATYFGGDEKAGL  190



>ref|XP_007131657.1| hypothetical protein PHAVU_011G031100g [Phaseolus vulgaris]
 gb|ESW03651.1| hypothetical protein PHAVU_011G031100g [Phaseolus vulgaris]
Length=996

 Score =   261 bits (668),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = +3

Query  243  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            E + +EWP+ +VRDTF+ FFE K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT D
Sbjct  51   ETSDVEWPAKRVRDTFMSFFEGKNHVNWKSSPVVPFNDPTLLFANAGMNQFKPIFLGTAD  110

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            PNT LSKL RA +TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WA
Sbjct  111  PNTGLSKLSRAYNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKPEAISWA  170

Query  603  WELLTEVYKLPAIRIYATYFGGDEKMAF  686
            WELLTEVYKLP+ R+YATYFGGD+K   
Sbjct  171  WELLTEVYKLPSDRLYATYFGGDDKAGL  198



>ref|XP_006826671.1| PREDICTED: alanine--tRNA ligase [Amborella trichopoda]
 gb|ERM93908.1| hypothetical protein AMTR_s00137p00047050 [Amborella trichopoda]
Length=996

 Score =   261 bits (667),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = +3

Query  246  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  425
             A ++WP+++VR+TFI FFE K H   KSSPVVPV+DPTLLFANAGMNQFKPIFLGTV P
Sbjct  48   QAAMDWPANRVRETFITFFEQKGHVNWKSSPVVPVDDPTLLFANAGMNQFKPIFLGTVHP  107

Query  426  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAW  605
             T L KLKR C+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAW
Sbjct  108  GTPLGKLKRVCNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIGWAW  167

Query  606  ELLTEVYKLPAIRIYATYFGGDEKMAF  686
            ELLT+VYKLP  RIYATYFGGDEK+  
Sbjct  168  ELLTQVYKLPTDRIYATYFGGDEKLGL  194



>ref|XP_010541854.1| PREDICTED: alanine--tRNA ligase-like [Tarenaya hassleriana]
Length=1003

 Score =   261 bits (667),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +WP+ +VRDTFI+FF+ K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT DPNT L
Sbjct  61   QWPARRVRDTFIEFFQGKGHVDWKSSPVVPHNDPTLLFANAGMNQFKPIFLGTADPNTAL  120

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELLT
Sbjct  121  SKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELLT  180

Query  618  EVYKLPAIRIYATYFGGDEKMAF  686
            +VY LP  RIYATYFGGDEK   
Sbjct  181  KVYGLPTDRIYATYFGGDEKAGL  203



>emb|CDY45055.1| BnaA08g02200D [Brassica napus]
Length=993

 Score =   260 bits (665),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 134/170 (79%), Gaps = 0/170 (0%)
 Frame = +3

Query  180  RRHFspspstsipsvvsqqqqEMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDP  359
            RRHF      S  SV      E + ++WP+ +VRDT+  FF+ K H    SSPVVP NDP
Sbjct  26   RRHFLSHFRFSSSSVAVMPGSEPSEIQWPARRVRDTYFDFFKGKGHKFWPSSPVVPHNDP  85

Query  360  TLLFANAGMNQFKPIFLGTVDPNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTF  539
            TLLFANAGMNQ+KPIFLGT DPNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTF
Sbjct  86   TLLFANAGMNQYKPIFLGTADPNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTF  145

Query  540  FEMLGNWSFGDYFKTEAIQWAWELLTEVYKLPAIRIYATYFGGDEKMAFH  689
            FEMLGNWSFGDYFK EAI+WAWELLT+VY LP  RIYATYFGGDEK    
Sbjct  146  FEMLGNWSFGDYFKKEAIEWAWELLTKVYGLPTDRIYATYFGGDEKAGLQ  195



>ref|XP_009107233.1| PREDICTED: alanine--tRNA ligase [Brassica rapa]
Length=997

 Score =   260 bits (665),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 134/170 (79%), Gaps = 0/170 (0%)
 Frame = +3

Query  180  RRHFspspstsipsvvsqqqqEMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDP  359
            RRHF      S  SV      E + ++WP+ +VRDT+  FF+ K H    SSPVVP NDP
Sbjct  26   RRHFLSHFRFSSSSVAVMPGSEPSEIQWPARRVRDTYFDFFKGKGHKFWPSSPVVPHNDP  85

Query  360  TLLFANAGMNQFKPIFLGTVDPNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTF  539
            TLLFANAGMNQ+KPIFLGT DPNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTF
Sbjct  86   TLLFANAGMNQYKPIFLGTADPNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTF  145

Query  540  FEMLGNWSFGDYFKTEAIQWAWELLTEVYKLPAIRIYATYFGGDEKMAFH  689
            FEMLGNWSFGDYFK EAI+WAWELLT+VY LP  RIYATYFGGDEK    
Sbjct  146  FEMLGNWSFGDYFKKEAIEWAWELLTKVYGLPTDRIYATYFGGDEKAGLQ  195



>gb|KJB31825.1| hypothetical protein B456_005G210000 [Gossypium raimondii]
Length=1015

 Score =   260 bits (665),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  252  GLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  431
             +EWP+ KVRDTFIKFFE K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGTVDPNT
Sbjct  64   AVEWPAKKVRDTFIKFFEGKNHVYWNSSPVVPHNDPTLLFANAGMNQYKPIFLGTVDPNT  123

Query  432  ELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWEL  611
             +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWEL
Sbjct  124  AMSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWEL  183

Query  612  LTEVYKLPAIRIYATYFGGD  671
            LT+VY LP  RIYATYFGGD
Sbjct  184  LTKVYGLPTDRIYATYFGGD  203



>gb|KJB31826.1| hypothetical protein B456_005G210000 [Gossypium raimondii]
Length=974

 Score =   260 bits (664),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  252  GLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  431
             +EWP+ KVRDTFIKFFE K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGTVDPNT
Sbjct  64   AVEWPAKKVRDTFIKFFEGKNHVYWNSSPVVPHNDPTLLFANAGMNQYKPIFLGTVDPNT  123

Query  432  ELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWEL  611
             +SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWEL
Sbjct  124  AMSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWEL  183

Query  612  LTEVYKLPAIRIYATYFGGD  671
            LT+VY LP  RIYATYFGGD
Sbjct  184  LTKVYGLPTDRIYATYFGGD  203



>emb|CBI26461.3| unnamed protein product [Vitis vinifera]
Length=960

 Score =   259 bits (661),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 128/148 (86%), Gaps = 5/148 (3%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            EWP++KVRDTFI FFE+K H    SSPVVP+NDPTLLFANAGMNQFKPIFLGT DPNT L
Sbjct  10   EWPAAKVRDTFISFFEAKEHVNWVSSPVVPLNDPTLLFANAGMNQFKPIFLGTADPNTPL  69

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELLT
Sbjct  70   SKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKREAIEWAWELLT  129

Query  618  E-----VYKLPAIRIYATYFGGDEKMAF  686
            E     VYKLP  R YATYFGGDE++  
Sbjct  130  EAICNKVYKLPTDRFYATYFGGDEQLGL  157



>ref|XP_010904628.1| PREDICTED: LOW QUALITY PROTEIN: alanine--tRNA ligase-like [Elaeis 
guineensis]
Length=995

 Score =   259 bits (661),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  249  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  428
            A +EWP SKVR+TFI FFE K H   +SSPVVP++DPTLLFANAGMNQFKPIFLGTV+P 
Sbjct  49   ATMEWPGSKVRETFISFFEGKEHVNWRSSPVVPLDDPTLLFANAGMNQFKPIFLGTVNPA  108

Query  429  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWE  608
              L KL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EA+ WAWE
Sbjct  109  NPLGKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKREAVSWAWE  168

Query  609  LLTEVYKLPAIRIYATYFGGDEKMAF  686
            LLT+VYKLP  RIYATYFGGDEK   
Sbjct  169  LLTQVYKLPTDRIYATYFGGDEKAGL  194



>gb|KHN32273.1| Alanine--tRNA ligase, partial [Glycine soja]
Length=919

 Score =   258 bits (659),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +3

Query  264  PSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELSK  443
            P+ +VRDTFI FF+ K H   KSSPVVP NDPTLLFANAGMNQFKPIFLGT DPNT LSK
Sbjct  1    PAKRVRDTFISFFQDKNHVNWKSSPVVPFNDPTLLFANAGMNQFKPIFLGTADPNTALSK  60

Query  444  LKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTEV  623
            L RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELLT+V
Sbjct  61   LSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKVEAISWAWELLTKV  120

Query  624  YKLPAIRIYATYFGGDEK  677
            YKLP+ RIYATYFGGD+K
Sbjct  121  YKLPSDRIYATYFGGDDK  138



>ref|XP_006305941.1| hypothetical protein CARUB_v10011180mg [Capsella rubella]
 gb|EOA38839.1| hypothetical protein CARUB_v10011180mg [Capsella rubella]
Length=1003

 Score =   258 bits (660),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = +3

Query  243  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            E + ++WP+ +VRDT+  FF+ K+H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT D
Sbjct  53   EPSEIQWPAKRVRDTYFDFFKGKSHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTAD  112

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAI WA
Sbjct  113  PNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIGWA  172

Query  603  WELLTEVYKLPAIRIYATYFGGDEKMAFH  689
            WELLT+VY LP  RIYATYFGGDEK    
Sbjct  173  WELLTKVYGLPTDRIYATYFGGDEKAGLQ  201



>ref|XP_002894237.1| cytosolic tRNA-Ala synthetase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70496.1| cytosolic tRNA-Ala synthetase [Arabidopsis lyrata subsp. lyrata]
Length=955

 Score =   257 bits (657),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +3

Query  243  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            E +  +WP+ +VRDT++ FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT D
Sbjct  5    EPSETQWPARRVRDTYVDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTAD  64

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WA
Sbjct  65   PNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWA  124

Query  603  WELLTEVYKLPAIRIYATYFGGDEKMAFH  689
            WELLT+VY LP  RIYATYFGGDEK    
Sbjct  125  WELLTKVYGLPTDRIYATYFGGDEKAGLQ  153



>ref|XP_010927937.1| PREDICTED: alanine--tRNA ligase-like [Elaeis guineensis]
Length=995

 Score =   258 bits (658),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP+SKVR+TF +FFE K H   +SSPVVP++DPTLLFANAGMNQFKPIFLGTV+P   
Sbjct  51   MEWPASKVRETFFRFFEGKEHVNWRSSPVVPLDDPTLLFANAGMNQFKPIFLGTVNPANP  110

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            L KL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELL
Sbjct  111  LGKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKREAISWAWELL  170

Query  615  TEVYKLPAIRIYATYFGGDEK  677
            T+VYKLP  RIYATYFGGDEK
Sbjct  171  TKVYKLPTDRIYATYFGGDEK  191



>ref|NP_001185186.1| Alanyl-tRNA synthetase [Arabidopsis thaliana]
 gb|AEE32525.1| Alanyl-tRNA synthetase [Arabidopsis thaliana]
Length=963

 Score =   257 bits (657),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = +3

Query  243  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            E +  +WP+ +VRDT++ FF  K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT D
Sbjct  5    EPSETQWPAKRVRDTYVDFFRGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTAD  64

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WA
Sbjct  65   PNTELSKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWA  124

Query  603  WELLTEVYKLPAIRIYATYFGGDEKMAFH  689
            WELLT+VY LP  RIYATYFGGDEK    
Sbjct  125  WELLTKVYGLPTDRIYATYFGGDEKAGLQ  153



>gb|AAD50044.1|AC007980_9 cytosolic tRNA-Ala synthetase [Arabidopsis thaliana]
 gb|AAO00886.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP68246.1| At1g50200 [Arabidopsis thaliana]
Length=955

 Score =   257 bits (657),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = +3

Query  243  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            E +  +WP+ +VRDT++ FF  K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT D
Sbjct  5    EPSETQWPAKRVRDTYVDFFRGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTAD  64

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WA
Sbjct  65   PNTELSKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWA  124

Query  603  WELLTEVYKLPAIRIYATYFGGDEKMAFH  689
            WELLT+VY LP  RIYATYFGGDEK    
Sbjct  125  WELLTKVYGLPTDRIYATYFGGDEKAGLQ  153



>ref|NP_175439.2| Alanyl-tRNA synthetase [Arabidopsis thaliana]
 sp|P36428.3|SYA_ARATH RecName: Full=Alanine--tRNA ligase; AltName: Full=Alanyl-tRNA 
synthetase; Short=AlaRS; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE32524.1| Alanyl-tRNA synthetase [Arabidopsis thaliana]
Length=1003

 Score =   257 bits (657),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = +3

Query  243  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            E +  +WP+ +VRDT++ FF  K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT D
Sbjct  53   EPSETQWPAKRVRDTYVDFFRGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTAD  112

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WA
Sbjct  113  PNTELSKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWA  172

Query  603  WELLTEVYKLPAIRIYATYFGGDEKMAFH  689
            WELLT+VY LP  RIYATYFGGDEK    
Sbjct  173  WELLTKVYGLPTDRIYATYFGGDEKAGLQ  201



>ref|XP_008810668.1| PREDICTED: alanine--tRNA ligase-like isoform X1 [Phoenix dactylifera]
Length=993

 Score =   257 bits (656),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  249  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  428
            A +EW  +KVR+TFI FFE K H   +SSPVVP++DPTLLFANAGMNQFKPIFLGTV+P 
Sbjct  47   AAMEWSGNKVRETFISFFERKEHVNWRSSPVVPLDDPTLLFANAGMNQFKPIFLGTVNPA  106

Query  429  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWE  608
              L KL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWE
Sbjct  107  NPLGKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKREAISWAWE  166

Query  609  LLTEVYKLPAIRIYATYFGGDEKMAF  686
            LLT+VYKLPA RIYATYFGGDEK   
Sbjct  167  LLTQVYKLPADRIYATYFGGDEKAGL  192



>ref|XP_008810673.1| PREDICTED: alanine--tRNA ligase-like isoform X2 [Phoenix dactylifera]
Length=983

 Score =   257 bits (656),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/146 (80%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  249  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  428
            A +EW  +KVR+TFI FFE K H   +SSPVVP++DPTLLFANAGMNQFKPIFLGTV+P 
Sbjct  47   AAMEWSGNKVRETFISFFERKEHVNWRSSPVVPLDDPTLLFANAGMNQFKPIFLGTVNPA  106

Query  429  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWE  608
              L KL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWE
Sbjct  107  NPLGKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKREAISWAWE  166

Query  609  LLTEVYKLPAIRIYATYFGGDEKMAF  686
            LLT+VYKLPA RIYATYFGGDEK   
Sbjct  167  LLTQVYKLPADRIYATYFGGDEKAGL  192



>ref|XP_006393173.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
 gb|ESQ30459.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
Length=1005

 Score =   257 bits (656),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +3

Query  243  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            E + ++WP+ +VRDT+  FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT D
Sbjct  51   EPSEIQWPARRVRDTYFDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTAD  110

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WA
Sbjct  111  PNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWA  170

Query  603  WELLTEVYKLPAIRIYATYFGGDEKMAFH  689
            WELLT+VY LP  RIYATYFGGDEK    
Sbjct  171  WELLTKVYGLPTDRIYATYFGGDEKAGLQ  199



>emb|CDY29328.1| BnaA05g15950D [Brassica napus]
Length=928

 Score =   256 bits (654),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +3

Query  243  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            E + ++WP+ +VRDT+  FF+ K H    SSPVVP NDP+L FANAGMNQ+KPIFLGT D
Sbjct  5    EPSEIKWPAKRVRDTYFDFFKGKGHKFWASSPVVPHNDPSLFFANAGMNQYKPIFLGTAD  64

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WA
Sbjct  65   PNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWA  124

Query  603  WELLTEVYKLPAIRIYATYFGGDEKMAFH  689
            WELLT+VY LP  RIYATYFGGDEK   H
Sbjct  125  WELLTKVYGLPVDRIYATYFGGDEKAGLH  153



>gb|EEC66648.1| hypothetical protein OsI_32912 [Oryza sativa Indica Group]
Length=953

 Score =   256 bits (655),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +3

Query  249  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  428
            A  EWP+S+VR+TFI FFESK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P+
Sbjct  3    ASTEWPASRVRETFISFFESKSHTRWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPD  62

Query  429  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWE  608
              L +L+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI +AWE
Sbjct  63   APLGRLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAIGFAWE  122

Query  609  LLTEVYKLPAIRIYATYFGGDEKMAF  686
            LLT+VYKLP  RIYATYFGGDEK   
Sbjct  123  LLTQVYKLPTDRIYATYFGGDEKFGL  148



>ref|XP_006393171.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
 gb|ESQ30457.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
Length=994

 Score =   256 bits (655),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +3

Query  243  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            E + ++WP+ +VRDT+  FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT D
Sbjct  51   EPSEIQWPARRVRDTYFDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTAD  110

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WA
Sbjct  111  PNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWA  170

Query  603  WELLTEVYKLPAIRIYATYFGGDEKMAFH  689
            WELLT+VY LP  RIYATYFGGDEK    
Sbjct  171  WELLTKVYGLPTDRIYATYFGGDEKAGLQ  199



>ref|XP_006393172.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
 gb|ESQ30458.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
Length=1001

 Score =   256 bits (655),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +3

Query  243  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            E + ++WP+ +VRDT+  FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT D
Sbjct  51   EPSEIQWPARRVRDTYFDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTAD  110

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WA
Sbjct  111  PNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWA  170

Query  603  WELLTEVYKLPAIRIYATYFGGDEKMAFH  689
            WELLT+VY LP  RIYATYFGGDEK    
Sbjct  171  WELLTKVYGLPTDRIYATYFGGDEKAGLQ  199



>gb|KHN05437.1| Alanine--tRNA ligase [Glycine soja]
Length=324

 Score =   242 bits (618),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +3

Query  243  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            E   +EWP+ +VRDTF  FF+ K H   KSSPVVP NDPTLLF N GMNQFKPIFLGT D
Sbjct  5    ETHDVEWPAKRVRDTFFIFFQDKNHVNWKSSPVVPFNDPTLLFVNPGMNQFKPIFLGTAD  64

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            PNT LSKL RA +TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WA
Sbjct  65   PNTGLSKLSRAFNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKVEAISWA  124

Query  603  WELLTEVYKLPAIRIYATYFGGDEK  677
            W+LLT+VYKLP+  IYATYFGGD+K
Sbjct  125  WDLLTKVYKLPSDCIYATYFGGDDK  149



>ref|XP_001773539.1| predicted protein [Physcomitrella patens]
 gb|EDQ61577.1| predicted protein [Physcomitrella patens]
Length=937

 Score =   256 bits (653),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            WP+++VR+TF  FFESK HT V SSPVVPV+DPTLLFANAGMNQFKPIFLGTVDP +   
Sbjct  7    WPANRVRETFNSFFESKNHTFVPSSPVVPVDDPTLLFANAGMNQFKPIFLGTVDPRSARG  66

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
             LKRAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELLT 
Sbjct  67   NLKRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIAWAWELLTS  126

Query  621  VYKLPAIRIYATYFGGDEKMAF  686
            VYKLP  R+YATYFGGDE +  
Sbjct  127  VYKLPKDRLYATYFGGDENLGL  148



>ref|XP_010463338.1| PREDICTED: alanine--tRNA ligase-like [Camelina sativa]
Length=1050

 Score =   256 bits (653),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = +3

Query  243  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            E + ++WP+ +VRDT+  FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT D
Sbjct  57   EPSEIQWPARRVRDTYFDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTAD  116

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WA
Sbjct  117  PNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIGWA  176

Query  603  WELLTEVYKLPAIRIYATYFGGDEKMAFH  689
            WELLT+VY LP  RIYATYFGGDEK    
Sbjct  177  WELLTKVYGLPTDRIYATYFGGDEKAGLQ  205



>ref|XP_009147848.1| PREDICTED: alanine--tRNA ligase-like [Brassica rapa]
Length=999

 Score =   255 bits (652),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            ++WP+  VRDT+  FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT DPNTE
Sbjct  53   IQWPAKTVRDTYFDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTADPNTE  112

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  113  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELL  172

Query  615  TEVYKLPAIRIYATYFGGDEKMAFH  689
            T+VY LP  RIYATYFGGDEK    
Sbjct  173  TKVYGLPTDRIYATYFGGDEKAGLQ  197



>emb|CDY22784.1| BnaA06g02930D [Brassica napus]
Length=999

 Score =   255 bits (652),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            ++WP+  VRDT+  FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT DPNTE
Sbjct  53   IQWPAKTVRDTYFDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTADPNTE  112

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  113  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELL  172

Query  615  TEVYKLPAIRIYATYFGGDEKMAFH  689
            T+VY LP  RIYATYFGGDEK    
Sbjct  173  TKVYGLPTDRIYATYFGGDEKAGLQ  197



>ref|XP_010479473.1| PREDICTED: alanine--tRNA ligase [Camelina sativa]
Length=1006

 Score =   255 bits (652),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = +3

Query  243  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            E + ++WP+ +VRDT+  FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT D
Sbjct  56   EPSEIQWPARRVRDTYFDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTAD  115

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WA
Sbjct  116  PNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIGWA  175

Query  603  WELLTEVYKLPAIRIYATYFGGDEKMAFH  689
            WELLT+VY LP  RIYATYFGGDEK    
Sbjct  176  WELLTKVYGLPTDRIYATYFGGDEKAGLQ  204



>emb|CDY42520.1| BnaC06g03380D [Brassica napus]
Length=947

 Score =   254 bits (650),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            ++WP+  VRDT+  FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT DPNTE
Sbjct  51   IQWPAKTVRDTYFDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTADPNTE  110

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WAWELL
Sbjct  111  LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELL  170

Query  615  TEVYKLPAIRIYATYFGGDEKMAFH  689
            T+VY LP  RIYATYFGGDEK    
Sbjct  171  TKVYGLPTDRIYATYFGGDEKAGLQ  195



>ref|NP_001064254.1| Os10g0182000 [Oryza sativa Japonica Group]
 gb|ABG65948.1| Alanyl-tRNA synthetase, mitochondrial precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26168.1| Os10g0182000 [Oryza sativa Japonica Group]
 dbj|BAG89937.1| unnamed protein product [Oryza sativa Japonica Group]
Length=999

 Score =   255 bits (651),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            EWP+S+VR+TFI FFESK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P+  L
Sbjct  52   EWPASRVRETFISFFESKSHTRWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPDAPL  111

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
             +L+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI +AWELLT
Sbjct  112  GRLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAIGFAWELLT  171

Query  618  EVYKLPAIRIYATYFGGDEKMAF  686
            +VYKLP  RIYATYFGGDEK   
Sbjct  172  QVYKLPTDRIYATYFGGDEKFGL  194



>gb|KDD75735.1| class II (A) tRNA synthetase, partial [Helicosporidium sp. ATCC 
50920]
Length=721

 Score =   251 bits (641),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = +3

Query  246  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  425
            M+  EWP+++VR TF+ FF SK HT V SS VVP+NDPTLLF NAGMNQFKP+FLGT DP
Sbjct  1    MSAAEWPAARVRSTFLDFFRSKEHTIVPSSAVVPLNDPTLLFTNAGMNQFKPLFLGTADP  60

Query  426  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAW  605
             +++ KLKRA DTQKCIRAGGKHNDLDDVGKD YHHTFFEMLGNWSFGDYFK EAI WAW
Sbjct  61   KSDMGKLKRAADTQKCIRAGGKHNDLDDVGKDNYHHTFFEMLGNWSFGDYFKEEAISWAW  120

Query  606  ELLTEVYKLPAIRIYATYFGGDEKMAF  686
            ELLT+VYKLPA R+YATYFGGD     
Sbjct  121  ELLTQVYKLPADRLYATYFGGDASQGL  147



>ref|XP_010500574.1| PREDICTED: alanine--tRNA ligase-like [Camelina sativa]
Length=1006

 Score =   254 bits (650),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = +3

Query  243  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            E + ++WP+ +VRDT+  FF+ K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT D
Sbjct  56   EPSEIQWPARRVRDTYFDFFKGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTAD  115

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WA
Sbjct  116  PNTELSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKNEAIGWA  175

Query  603  WELLTEVYKLPAIRIYATYFGGDEKMAFH  689
            WELLT+VY LP  RIYATYFGGDE+    
Sbjct  176  WELLTKVYGLPTDRIYATYFGGDERAGLQ  204



>emb|CAA80381.1| cytosolic tRNA-Ala synthetase [Arabidopsis thaliana]
Length=955

 Score =   254 bits (649),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = +3

Query  243  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            E +  +WP+ +VRDT++ FF  K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT D
Sbjct  5    EPSETQWPAKRVRDTYVDFFRGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTAD  64

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WA
Sbjct  65   PNTELSKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWA  124

Query  603  WELLTEVYKLPAIRIYATYFGGDEKMAFH  689
            WELLT+VY LP  RIYATYFG DEK    
Sbjct  125  WELLTKVYGLPTDRIYATYFGRDEKAGLQ  153



>emb|CAA80380.1| mitochondrial tRNA-Ala synthetase [Arabidopsis thaliana]
Length=1003

 Score =   254 bits (649),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = +3

Query  243  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            E +  +WP+ +VRDT++ FF  K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT D
Sbjct  53   EPSETQWPAKRVRDTYVDFFRGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTAD  112

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WA
Sbjct  113  PNTELSKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWA  172

Query  603  WELLTEVYKLPAIRIYATYFGGDEKMAFH  689
            WELLT+VY LP  RIYATYFG DEK    
Sbjct  173  WELLTKVYGLPTDRIYATYFGRDEKAGLQ  201



>ref|XP_003571715.1| PREDICTED: LOW QUALITY PROTEIN: alanine--tRNA ligase [Brachypodium 
distachyon]
Length=993

 Score =   254 bits (649),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 134/155 (86%), Gaps = 0/155 (0%)
 Frame = +3

Query  249  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  428
            A  EWP+ +VR+TFI+++ESK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P+
Sbjct  40   ASPEWPARRVRETFIQYYESKSHTRWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPD  99

Query  429  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWE  608
            ++L +L RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI +AWE
Sbjct  100  SQLGRLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAIGYAWE  159

Query  609  LLTEVYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            LLT+VYKLP  RIYATYFGGDEK      ++ +N+
Sbjct  160  LLTQVYKLPTDRIYATYFGGDEKAGLAPDIESKNI  194



>gb|AFW56405.1| hypothetical protein ZEAMMB73_266824 [Zea mays]
Length=399

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            WPS ++R  F+ FFESKAHT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P++ L 
Sbjct  55   WPSRRIRQEFLTFFESKAHTRWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPDSPLG  114

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
            +L RAC+TQKCIRAGGKHNDLDDVG DTYHHTFFEMLGNWSFGDYFK EAI+WAWELLT+
Sbjct  115  RLHRACNTQKCIRAGGKHNDLDDVGNDTYHHTFFEMLGNWSFGDYFKEEAIRWAWELLTQ  174

Query  621  VYKLPAIRIYATYFGGDEK  677
            VYKLP  RIYATYFGGD K
Sbjct  175  VYKLPTDRIYATYFGGDVK  193



>pir||S32671 alanine-tRNA ligase (EC 6.1.1.7) - Arabidopsis thaliana  (fragment)
Length=989

 Score =   254 bits (648),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = +3

Query  243  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            E +  +WP+ +VRDT++ FF  K H    SSPVVP NDPTLLFANAGMNQ+KPIFLGT D
Sbjct  39   EPSETQWPAKRVRDTYVDFFRGKGHKFWPSSPVVPHNDPTLLFANAGMNQYKPIFLGTAD  98

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            PNTELSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+WA
Sbjct  99   PNTELSKLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWA  158

Query  603  WELLTEVYKLPAIRIYATYFGGDEKMAFH  689
            WELLT+VY LP  RIYATYFG DEK    
Sbjct  159  WELLTKVYGLPTDRIYATYFGRDEKAGLQ  187



>ref|XP_004983350.1| PREDICTED: alanine--tRNA ligase-like isoform X3 [Setaria italica]
Length=1005

 Score =   254 bits (648),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            EWP+++VR TF+ +FESK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P++ L
Sbjct  57   EWPANRVRKTFVDYFESKSHTRWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPDSPL  116

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
             +L+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELLT
Sbjct  117  GRLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAIGWAWELLT  176

Query  618  EVYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            +VYKLP  RIYATYFGGDEK       + +N+
Sbjct  177  KVYKLPTDRIYATYFGGDEKSGLAADNESKNI  208



>ref|XP_004983349.1| PREDICTED: alanine--tRNA ligase-like isoform X2 [Setaria italica]
Length=1005

 Score =   254 bits (648),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            EWP+++VR TF+ +FESK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P++ L
Sbjct  57   EWPANRVRKTFVDYFESKSHTRWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPDSPL  116

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
             +L+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELLT
Sbjct  117  GRLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAIGWAWELLT  176

Query  618  EVYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            +VYKLP  RIYATYFGGDEK       + +N+
Sbjct  177  KVYKLPTDRIYATYFGGDEKSGLAADNESKNI  208



>ref|XP_004983348.1| PREDICTED: alanine--tRNA ligase-like isoform X1 [Setaria italica]
Length=1022

 Score =   253 bits (646),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            EWP+++VR TF+ +FESK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P++ L
Sbjct  57   EWPANRVRKTFVDYFESKSHTRWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPDSPL  116

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
             +L+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELLT
Sbjct  117  GRLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAIGWAWELLT  176

Query  618  EVYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            +VYKLP  RIYATYFGGDEK       + +N+
Sbjct  177  KVYKLPTDRIYATYFGGDEKSGLAADNESKNI  208



>ref|XP_007225354.1| hypothetical protein PRUPE_ppa000923mg [Prunus persica]
 gb|EMJ26553.1| hypothetical protein PRUPE_ppa000923mg [Prunus persica]
Length=960

 Score =   252 bits (643),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 127/155 (82%), Gaps = 7/155 (5%)
 Frame = +3

Query  243  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            E  G+EWP+ +VRDTF++FFE K+H   KSSPVVP NDPTLLFANAGMNQFKPIFLG  D
Sbjct  5    ESKGVEWPAKRVRDTFMRFFEEKSHVYWKSSPVVPHNDPTLLFANAGMNQFKPIFLGAAD  64

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            PNT+LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WA
Sbjct  65   PNTQLSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIGWA  124

Query  603  WELLTEVYKLPAI-------RIYATYFGGDEKMAF  686
            WELLT+  +   +       RIYATYFGGDEK   
Sbjct  125  WELLTQASRFDPMHSFITEDRIYATYFGGDEKAGL  159



>ref|XP_011396133.1| Alanine-tRNA ligase [Auxenochlorella protothecoides]
 gb|KFM23263.1| Alanine-tRNA ligase [Auxenochlorella protothecoides]
Length=926

 Score =   250 bits (639),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +WP S VR TFI FF+SK HT   SSPVVPVNDPTLLF+NAGMNQ+KPIFLGTVDP ++L
Sbjct  6    DWPGSVVRSTFIDFFKSKGHTFNPSSPVVPVNDPTLLFSNAGMNQYKPIFLGTVDPASDL  65

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
             KLKRA + QKCIRAGGKHNDLDDVGKD YHHTFFEMLGNWSFGDYFK EAI WAWELLT
Sbjct  66   GKLKRATNAQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAIGWAWELLT  125

Query  618  EVYKLPAIRIYATYFGGDEKMAF  686
            +VY LPA R+YATYFGGDE+   
Sbjct  126  KVYSLPADRLYATYFGGDERQGL  148



>emb|CEG77795.1| Putative Alanyl-tRNA synthetase [Rhizopus microsporus]
Length=401

 Score =   237 bits (605),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 125/156 (80%), Gaps = 0/156 (0%)
 Frame = +3

Query  246  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  425
            M   EWP +KVR TFIKFFE   HT V SS  +P +DPTLLFANAGMNQFKP+FLGT+DP
Sbjct  1    MTEQEWPVNKVRSTFIKFFEENGHTFVPSSSTIPHDDPTLLFANAGMNQFKPMFLGTLDP  60

Query  426  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAW  605
            N+ L+ +KRAC++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EA + AW
Sbjct  61   NSPLANVKRACNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEATKLAW  120

Query  606  ELLTEVYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            E LT+V  LP  R+Y TYFGGDEKM     ++ + L
Sbjct  121  EFLTKVISLPEDRLYVTYFGGDEKMGLPADLEAKQL  156



>emb|CBK21983.2| unnamed protein product [Blastocystis hominis]
Length=935

 Score =   247 bits (630),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            LEWPS+KVR TFI+FFE + HT VKSSPVVP++DPTLLFANAGMNQ+KPIFLG VDP++ 
Sbjct  7    LEWPSAKVRQTFIEFFEERGHTFVKSSPVVPLDDPTLLFANAGMNQYKPIFLGQVDPSSP  66

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            L+KLKRAC++QKCIRAGGKHNDLDDVGKD YHHTFFEMLGNWSFGDYFK  AI +AWELL
Sbjct  67   LAKLKRACNSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKEGAINFAWELL  126

Query  615  TEVYKLPAIRIYATYFGGDEK  677
            T+VYKL   R+YATYF G E+
Sbjct  127  TKVYKLDPSRLYATYFEGSEE  147



>ref|XP_008662576.1| PREDICTED: alanine--tRNA ligase [Zea mays]
 gb|AFW56406.1| hypothetical protein ZEAMMB73_266824 [Zea mays]
Length=1002

 Score =   247 bits (630),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            WPS ++R  F+ FFESKAHT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P++ L 
Sbjct  55   WPSRRIRQEFLTFFESKAHTRWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPDSPLG  114

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
            +L RAC+TQKCIRAGGKHNDLDDVG DTYHHTFFEMLGNWSFGDYFK EAI+WAWELLT+
Sbjct  115  RLHRACNTQKCIRAGGKHNDLDDVGNDTYHHTFFEMLGNWSFGDYFKEEAIRWAWELLTQ  174

Query  621  VYKLPAIRIYATYFGGDEK  677
            VYKLP  RIYATYFGGD K
Sbjct  175  VYKLPTDRIYATYFGGDVK  193



>ref|XP_005645178.1| hypothetical protein COCSUDRAFT_67160 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20634.1| hypothetical protein COCSUDRAFT_67160 [Coccomyxa subellipsoidea 
C-169]
Length=1151

 Score =   247 bits (630),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            W   +VR TF++FFE+K HT V SS VVP NDPTLLFANAGMNQFKPIFLGTVDPN++ +
Sbjct  211  WSGDRVRATFVEFFETKGHTAVPSSSVVPHNDPTLLFANAGMNQFKPIFLGTVDPNSDFA  270

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
            +L RACD+QKCIRAGGKHNDLDDVGKD YHHTFFEMLGNWSFGDYFK EAI WAWELLT+
Sbjct  271  RLSRACDSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAIAWAWELLTQ  330

Query  621  VYKLPAIRIYATYFGGDEKMAFH  689
            VYKL   R+YATYFGGD      
Sbjct  331  VYKLDPARLYATYFGGDSAQGLE  353



>ref|XP_002443089.1| hypothetical protein SORBIDRAFT_08g008230 [Sorghum bicolor]
 gb|EES16927.1| hypothetical protein SORBIDRAFT_08g008230 [Sorghum bicolor]
Length=1006

 Score =   246 bits (627),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            EW + +VR+ +I FF SK HT   SSPVVPV+DPTLLFANAGMNQ+KP+FLGT  P++ L
Sbjct  58   EWTARRVREQYISFFVSKEHTRWPSSPVVPVDDPTLLFANAGMNQYKPVFLGTAAPDSPL  117

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
             +L+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELLT
Sbjct  118  GRLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAIGWAWELLT  177

Query  618  EVYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            +VYKLP  R+YATYFGGDEK      ++ +N+
Sbjct  178  QVYKLPTDRVYATYFGGDEKSGLAADVESKNI  209



>gb|KIH58709.1| alanine--tRNA ligase [Ancylostoma duodenale]
Length=259

 Score =   230 bits (587),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 120/137 (88%), Gaps = 1/137 (1%)
 Frame = +3

Query  270  SKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELSKL  446
            ++VR TFI+FF + KAHT V SS V+P +DPTLLFANAGMNQFKP+FLG  DPN++L+KL
Sbjct  106  NEVRSTFIEFFKQKKAHTYVHSSSVIPHDDPTLLFANAGMNQFKPLFLGIADPNSDLAKL  165

Query  447  KRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTEVY  626
            KRA +TQKCIRAGGKHNDLDDVGKD YHHTFFEMLGNWSFGDYFK E I WAWELLTEVY
Sbjct  166  KRAVNTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEIITWAWELLTEVY  225

Query  627  KLPAIRIYATYFGGDEK  677
             +PA R+Y +YFGGDEK
Sbjct  226  GIPAERLYVSYFGGDEK  242



>dbj|BAJ96541.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1008

 Score =   245 bits (626),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W +++VR+ FI FF+SK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P+++L
Sbjct  58   DWTAARVREVFIDFFKSKSHTPWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTASPDSQL  117

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
             +L RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK  AI +AWELLT
Sbjct  118  GRLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEGAIGYAWELLT  177

Query  618  EVYKLPAIRIYATYFGGDEKMAF  686
            +VYKLP  RIYATYFGGDEK   
Sbjct  178  QVYKLPTDRIYATYFGGDEKAGL  200



>dbj|BAJ98134.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1004

 Score =   245 bits (626),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 124/148 (84%), Gaps = 0/148 (0%)
 Frame = +3

Query  243  EMAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            E A  +WPS+ VR  FI FF S+AHT   SSPVVP  DPTLLFANAGMNQ+KP+FLG  D
Sbjct  49   EEAAPDWPSALVRQVFIDFFRSRAHTPWPSSPVVPFEDPTLLFANAGMNQYKPVFLGAAD  108

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            P++ L +L+RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK +AI +A
Sbjct  109  PDSPLGRLRRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKDQAIAYA  168

Query  603  WELLTEVYKLPAIRIYATYFGGDEKMAF  686
            WELLT+VYKLP  RIYATYFGGD+K   
Sbjct  169  WELLTQVYKLPTDRIYATYFGGDDKAGL  196



>gb|KIZ04229.1| alanyl-tRNA synthetase [Monoraphidium neglectum]
Length=965

 Score =   245 bits (625),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            EWP + VR  F  FF SK HT   S+ VVP+NDPTLLF NAGMNQFKP+FLGTVDPN+E+
Sbjct  4    EWPGAVVRKAFNDFFVSKGHTYWPSNAVVPLNDPTLLFTNAGMNQFKPVFLGTVDPNSEM  63

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
             +LK AC++QKCIRAGGKHNDLDDVGKD YHHTFFEMLGNWSFGDYFK EAI WAWELLT
Sbjct  64   GRLKSACNSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKEEAISWAWELLT  123

Query  618  EVYKLPAIRIYATYFGGDEKMAF  686
            +VYKLP  R+YATYFGGDEK   
Sbjct  124  QVYKLPGERLYATYFGGDEKQGL  146



>emb|CDP04914.1| unnamed protein product [Coffea canephora]
Length=129

 Score =   225 bits (574),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 112/123 (91%), Gaps = 0/123 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            ++WP+S+VR+TF+ FFE K H   KSSPVVP+NDPTLLFANAGMNQFKPIFLGTVDPNT 
Sbjct  1    MDWPASRVRETFVNFFEGKGHFNWKSSPVVPLNDPTLLFANAGMNQFKPIFLGTVDPNTP  60

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            LSKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAIQWAWELL
Sbjct  61   LSKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKGEAIQWAWELL  120

Query  615  TEV  623
             + 
Sbjct  121  IKA  123



>gb|EMT18589.1| Alanyl-tRNA synthetase, mitochondrial [Aegilops tauschii]
Length=1012

 Score =   244 bits (623),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W +++VR+ FI FF+SK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P+++L
Sbjct  6    DWTAARVREVFIDFFKSKSHTPWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPDSQL  65

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
             +L RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK  AI +AWELLT
Sbjct  66   GRLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEGAIGYAWELLT  125

Query  618  EVYKLPAIRIYATYFGGDEKMAF  686
            +VYKLP  RIYATYFGGDEK   
Sbjct  126  QVYKLPTDRIYATYFGGDEKAGL  148



>ref|XP_002504833.1| alanyl-tRNA synthetase [Micromonas sp. RCC299]
 gb|ACO66091.1| alanyl-tRNA synthetase [Micromonas sp. RCC299]
Length=945

 Score =   243 bits (620),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            EWP+ ++R TF+ FFE K HT V SSPVVP +DPTLLFANAGMNQFKP FLGT DP   L
Sbjct  6    EWPAQRIRQTFLDFFEGKEHTVVPSSPVVPHDDPTLLFANAGMNQFKPCFLGTADPKGPL  65

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
            +KLKRA DTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGD+FK EAI WAWELLT
Sbjct  66   AKLKRATDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDFFKEEAIGWAWELLT  125

Query  618  EVYKLPAIRIYATYFGGD  671
            +VY LP  R+YATYFGGD
Sbjct  126  KVYMLPEDRLYATYFGGD  143



>emb|CEI92968.1| Putative Alanyl-tRNA synthetase [Rhizopus microsporus]
Length=956

 Score =   242 bits (617),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 126/156 (81%), Gaps = 0/156 (0%)
 Frame = +3

Query  246  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  425
            M   EWP +KVR TFIKFFE   HT V SS  +P +DPTLLFANAGMNQFKP+FLGT+DP
Sbjct  1    MTEQEWPVNKVRSTFIKFFEENGHTFVPSSSTIPHDDPTLLFANAGMNQFKPMFLGTLDP  60

Query  426  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAW  605
            N+ L+ +KRAC++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EA + AW
Sbjct  61   NSPLANVKRACNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEATKLAW  120

Query  606  ELLTEVYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            E LT+V +LP  R+Y TYFGGDEKM     ++ + L
Sbjct  121  EFLTKVIRLPEDRLYVTYFGGDEKMGLPADLEAKQL  156



>emb|CEG71324.1| Putative Alanyl-tRNA synthetase [Rhizopus microsporus]
Length=956

 Score =   241 bits (614),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 125/156 (80%), Gaps = 0/156 (0%)
 Frame = +3

Query  246  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  425
            M   EWP +KVR TFIKFFE   HT V SS  +P +DPTLLFANAGMNQFKP+FLGT+DP
Sbjct  1    MTEQEWPVNKVRSTFIKFFEENGHTFVPSSSTIPHDDPTLLFANAGMNQFKPMFLGTLDP  60

Query  426  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAW  605
            N+ L+ +KRAC++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EA + AW
Sbjct  61   NSPLANVKRACNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEATKLAW  120

Query  606  ELLTEVYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            E LT+V  LP  R+Y TYFGGDEKM     ++ + L
Sbjct  121  EFLTKVISLPKDRLYVTYFGGDEKMGLPADLEAKQL  156



>emb|CDP16859.1| unnamed protein product [Coffea canephora]
Length=219

 Score =   224 bits (571),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +WP+S+VR+TF  FFE K H   KSS VVP+NDPTLLF NAGMNQFKPIFLGTVDPNT L
Sbjct  81   DWPASRVRETFFNFFEGKNHVNWKSSAVVPLNDPTLLFVNAGMNQFKPIFLGTVDPNTPL  140

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
            SKL RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAI+WAWELLT
Sbjct  141  SKLTRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIEWAWELLT  200

Query  618  EV  623
            + 
Sbjct  201  KA  202



>gb|EMS67609.1| Alanyl-tRNA synthetase [Triticum urartu]
Length=1858

 Score =   243 bits (621),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W +++VR+ FI FF+SK+HT   SSPVVPV+DPTLLFANAGMNQFKP+FLGT  P+++L
Sbjct  6    DWTAARVREVFIDFFKSKSHTPWPSSPVVPVDDPTLLFANAGMNQFKPVFLGTAAPDSQL  65

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
             +L RAC+TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK  AI +AWELLT
Sbjct  66   GRLSRACNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEGAIGYAWELLT  125

Query  618  EVYKLPAIRIYATYFGGDEKMAF  686
            +VYKLP  RIYATYFGGDEK   
Sbjct  126  QVYKLPTDRIYATYFGGDEKAGL  148



>emb|CEP13586.1| hypothetical protein [Parasitella parasitica]
Length=959

 Score =   239 bits (611),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            EWP++KVR TFIK+FE   H  V SS  +P +DPTLLFANAGMNQ+KPIFLGTVDPN+ L
Sbjct  7    EWPANKVRSTFIKYFEDNGHVFVPSSSTIPHDDPTLLFANAGMNQYKPIFLGTVDPNSPL  66

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
            + +KRAC++QKCIRAGGKHNDLDDVG+DTYHHTFFEMLGNWSFGDYFK EA ++ WE LT
Sbjct  67   ANVKRACNSQKCIRAGGKHNDLDDVGRDTYHHTFFEMLGNWSFGDYFKLEATKFGWEFLT  126

Query  618  EVYKLPAIRIYATYFGGDEKMAF  686
            +V KLP  R+Y TYFGGDEKM  
Sbjct  127  KVIKLPEDRLYVTYFGGDEKMGL  149



>emb|CEF97732.1| Thioredoxin-like fold [Ostreococcus tauri]
Length=1183

 Score =   240 bits (613),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 120/145 (83%), Gaps = 1/145 (1%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            EWPS +VRDTFI +F E + HT   SSP VPV+DPTLLFANAGMNQ+KPIFLG  DP T 
Sbjct  243  EWPSKRVRDTFINYFIEKQNHTPWPSSPAVPVDDPTLLFANAGMNQYKPIFLGKADPKTA  302

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            L+KL RA +TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELL
Sbjct  303  LAKLSRATNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAIGWAWELL  362

Query  615  TEVYKLPAIRIYATYFGGDEKMAFH  689
            T+VY LP  R+YATYFGGDE     
Sbjct  363  TKVYCLPEDRLYATYFGGDESQGLE  387



>ref|XP_003079014.1| SYA_ARATH Alanyl-tRNA synthetase, mitochondrial precursor (ISS) 
[Ostreococcus tauri]
Length=1170

 Score =   240 bits (612),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 120/145 (83%), Gaps = 1/145 (1%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            EWPS +VRDTFI +F E + HT   SSP VPV+DPTLLFANAGMNQ+KPIFLG  DP T 
Sbjct  243  EWPSKRVRDTFINYFIEKQNHTPWPSSPAVPVDDPTLLFANAGMNQYKPIFLGKADPKTA  302

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            L+KL RA +TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI WAWELL
Sbjct  303  LAKLSRATNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAIGWAWELL  362

Query  615  TEVYKLPAIRIYATYFGGDEKMAFH  689
            T+VY LP  R+YATYFGGDE     
Sbjct  363  TKVYCLPEDRLYATYFGGDESQGLE  387



>gb|KHJ91121.1| alanine--tRNA ligase [Oesophagostomum dentatum]
Length=519

 Score =   232 bits (591),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 119/136 (88%), Gaps = 1/136 (1%)
 Frame = +3

Query  273  KVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELSKLK  449
            KVR TFI+FF + KAHT V SS V+P +DPTLLFANAGMNQFKP+FLG  DPN++L+KLK
Sbjct  117  KVRSTFIEFFRQKKAHTYVHSSSVIPHDDPTLLFANAGMNQFKPLFLGVADPNSDLAKLK  176

Query  450  RACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTEVYK  629
            RA +TQKCIRAGGKHNDLDDVGKD YHHTFFEMLGNWSFGDYFK E I WAWELLTEVY 
Sbjct  177  RAVNTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKREIITWAWELLTEVYG  236

Query  630  LPAIRIYATYFGGDEK  677
            +PA R+Y +YFGGDEK
Sbjct  237  IPADRLYVSYFGGDEK  252



>gb|EIE82853.1| alanyl-tRNA synthetase [Rhizopus delemar RA 99-880]
Length=955

 Score =   238 bits (608),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 124/152 (82%), Gaps = 0/152 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            EWP++KVR TF+KFFE   H  V SS  +P +DPTLLFANAGMNQFKP+FLGT+DPN+ L
Sbjct  3    EWPANKVRSTFVKFFEDNGHVFVPSSSTIPHDDPTLLFANAGMNQFKPMFLGTLDPNSPL  62

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
            + +KRAC++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EA ++ WE LT
Sbjct  63   ANVKRACNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEATKFGWEFLT  122

Query  618  EVYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            +V  LP  R+Y TYFGGDEKM     ++ + L
Sbjct  123  KVINLPEDRLYVTYFGGDEKMGLPADLEAKQL  154



>ref|XP_001524092.1| alanyl-tRNA synthetase [Lodderomyces elongisporus NRRL YB-4239]
 gb|EDK46724.1| alanyl-tRNA synthetase [Lodderomyces elongisporus NRRL YB-4239]
Length=436

 Score =   229 bits (585),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 126/155 (81%), Gaps = 1/155 (1%)
 Frame = +3

Query  252  GLEWPSSKVRDTFIKFFESKA-HTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  428
            G +W +S VR TF+ +F+SK  HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP+
Sbjct  19   GQKWTASTVRSTFLDYFKSKRDHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPS  78

Query  429  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWE  608
            ++ +KLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI W+WE
Sbjct  79   SDFAKLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIGWSWE  138

Query  609  LLTEVYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            LLTEVY L   R+Y TYF GDEK      M+ +N 
Sbjct  139  LLTEVYGLEKDRLYVTYFEGDEKQGLEPDMEAKNF  173



>gb|KIY74247.1| hypothetical protein CYLTODRAFT_427840 [Cylindrobasidium torrendii 
FP15055 ss-10]
Length=953

 Score =   238 bits (607),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            WPS+ VRD F KFF+SK HT V SSP +P  DPTLLFANAGMNQ+K IFLGTVDP++E++
Sbjct  10   WPSATVRDEFFKFFKSKGHTYVASSPTIPYEDPTLLFANAGMNQYKSIFLGTVDPHSEMA  69

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
            KLKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++WELLTE
Sbjct  70   KLKRAFNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAIGYSWELLTE  129

Query  621  VYKLPAIRIYATYFGGDEKMAFH  689
            VYKLP  R+Y TYF GD K    
Sbjct  130  VYKLPKDRLYVTYFEGDAKAGLE  152



>emb|CEL61027.1| alanyl-tRNA synthetase [Rhizoctonia solani AG-1 IB]
Length=991

 Score =   238 bits (607),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            EWP+++VR  FI FFE++ H    SS  +P +DPTLLFANAGMNQ+K IFLGTVDPN+EL
Sbjct  44   EWPANRVRKEFIDFFEARGHKFWASSSTIPYDDPTLLFANAGMNQYKAIFLGTVDPNSEL  103

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
            SKLKRA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFG+YFK EAI WAWELLT
Sbjct  104  SKLKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGEYFKKEAITWAWELLT  163

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVYKLP  R+Y TYF GD K    
Sbjct  164  EVYKLPKDRLYVTYFEGDSKQGLE  187



>gb|KDQ21195.1| hypothetical protein BOTBODRAFT_25615 [Botryobasidium botryosum 
FD-172 SS1]
Length=956

 Score =   238 bits (606),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 123/152 (81%), Gaps = 0/152 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            EWP++KVR  FI FF++K HT V SS  +P  DPTLLFANAGMNQ+K IFLGTVDPN++ 
Sbjct  8    EWPAAKVRQVFIDFFKNKGHTFVPSSSTIPYEDPTLLFANAGMNQYKSIFLGTVDPNSDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
            +KLKRA ++QKCIRAGGKHNDL+DVGKDTYHHT FEMLGNWSFGDYFK EAI WAWELLT
Sbjct  68   AKLKRAVNSQKCIRAGGKHNDLEDVGKDTYHHTMFEMLGNWSFGDYFKKEAILWAWELLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            EVYKLP  R+Y TYF GD K      ++ + L
Sbjct  128  EVYKLPKDRLYVTYFEGDAKQGLSPDLEAKQL  159



>gb|EPX70595.1| cytoplasmic alanine-tRNA ligase Ala1 [Schizosaccharomyces octosporus 
yFS286]
Length=1019

 Score =   238 bits (606),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            L+WP+SKVR TF+KFFE + HT V SS VVP +DP+LLFANAGMNQFKPIFLGTVDP+ E
Sbjct  68   LKWPASKVRSTFLKFFEERGHTIVPSSSVVPYDDPSLLFANAGMNQFKPIFLGTVDPSHE  127

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
             SKLKRA D+QKCIRAGGKHNDL+DVG+D YHHT FEMLGNWSFGDYFK EAIQ AWELL
Sbjct  128  YSKLKRAVDSQKCIRAGGKHNDLEDVGRDNYHHTMFEMLGNWSFGDYFKKEAIQMAWELL  187

Query  615  TEVYKLPAIRIYATYFGGDEK  677
            TEVY L   ++Y TYFGG E+
Sbjct  188  TEVYGLEKDQLYVTYFGGHEE  208



>emb|CDK27200.1| unnamed protein product [Kuraishia capsulata CBS 1993]
Length=989

 Score =   237 bits (605),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++KVR TF+KFFES+ HT V SS V+P +DPTLLFANAGMNQ+KPIFLGTVDP+++ 
Sbjct  39   DWTAAKVRSTFLKFFESRGHTFVPSSSVIPYDDPTLLFANAGMNQYKPIFLGTVDPSSDF  98

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
            + LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAIQW+WELLT
Sbjct  99   ATLKRAVNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAIQWSWELLT  158

Query  618  EVYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
             VY +PA R+Y TYF GD K      ++ ++L
Sbjct  159  VVYGIPADRLYVTYFEGDAKNGLEPDLEAKDL  190



>gb|EPB88726.1| alanyl-tRNA synthetase [Mucor circinelloides f. circinelloides 
1006PhL]
Length=958

 Score =   236 bits (603),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = +3

Query  246  MAG-LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            MAG  EWP++KVR TF+K+FE   H  V SS  +P +DPTLLFANAGMNQ+KPIFLGT+D
Sbjct  1    MAGQTEWPANKVRSTFVKYFEDNGHVFVPSSSTIPHDDPTLLFANAGMNQYKPIFLGTLD  60

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            PN+ L+ +KRAC++QKCIRAGGKHNDLDDVG+DTYHHTFFEMLGNWSFGDYFK EA ++ 
Sbjct  61   PNSPLANVKRACNSQKCIRAGGKHNDLDDVGRDTYHHTFFEMLGNWSFGDYFKLEATKFG  120

Query  603  WELLTEVYKLPAIRIYATYFGGDEKMAF  686
            WE LT+V  LP  R+Y TYFGGDEKM  
Sbjct  121  WEFLTKVINLPEDRLYVTYFGGDEKMGL  148



>gb|KEP53395.1| alanyl-tRNA synthetase [Rhizoctonia solani 123E]
Length=953

 Score =   236 bits (603),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            EWP+ +VR  FI FFE++ H    SS  +P +DPTLLFANAGMNQ+K IFLGTVDPN+EL
Sbjct  7    EWPAQRVRKEFIDFFEARGHKFWPSSSTIPYDDPTLLFANAGMNQYKAIFLGTVDPNSEL  66

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
            SKLKRA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFG+YFK EAI WAWELLT
Sbjct  67   SKLKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGEYFKKEAITWAWELLT  126

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVYKLP  R+Y TYF GD K    
Sbjct  127  EVYKLPKDRLYVTYFEGDLKQGLE  150



>dbj|GAN03494.1| alanyl-tRNA synthetase [Mucor ambiguus]
Length=958

 Score =   236 bits (603),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 123/148 (83%), Gaps = 1/148 (1%)
 Frame = +3

Query  246  MAGL-EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            MAG  EWP++KVR TFIK+FE   H  V SS  +P +DPTLLFANAGMNQ+KPIFLGT+D
Sbjct  1    MAGQSEWPANKVRATFIKYFEDNGHVFVPSSSTIPHDDPTLLFANAGMNQYKPIFLGTLD  60

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            PN+ L+ +KRAC++QKCIRAGGKHNDLDDVG+DTYHHTFFEMLGNWSFGDYFK EA ++ 
Sbjct  61   PNSPLANVKRACNSQKCIRAGGKHNDLDDVGRDTYHHTFFEMLGNWSFGDYFKLEATKFG  120

Query  603  WELLTEVYKLPAIRIYATYFGGDEKMAF  686
            WE LT+V  LP  R+Y TYFGGDEKM  
Sbjct  121  WEFLTKVINLPEDRLYVTYFGGDEKMGL  148



>gb|EUC64360.1| alanyl-tRNA synthetase, partial [Rhizoctonia solani AG-3 Rhs1AP]
Length=934

 Score =   236 bits (603),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            EWP+ +VR  FI FFE++ H    SS  +P +DPTLLFANAGMNQ+K IFLGTVDPN+EL
Sbjct  7    EWPAQRVRKEFIDFFEARGHKFWPSSSTIPYDDPTLLFANAGMNQYKAIFLGTVDPNSEL  66

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
            SKLKRA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFG+YFK EAI WAWELLT
Sbjct  67   SKLKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGEYFKKEAITWAWELLT  126

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVYKLP  R+Y TYF GD K    
Sbjct  127  EVYKLPKDRLYVTYFEGDLKQGLE  150



>ref|XP_001731546.1| hypothetical protein MGL_1729 [Malassezia globosa CBS 7966]
 gb|EDP44332.1| hypothetical protein MGL_1729 [Malassezia globosa CBS 7966]
Length=963

 Score =   236 bits (602),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            EWP++KVR TF+ FF  K HT V SS  VP +DPTLLFANAGMNQ+K IFLGTVDP++E 
Sbjct  11   EWPAAKVRSTFLDFFREKEHTFVPSSSTVPYDDPTLLFANAGMNQYKSIFLGTVDPSSEF  70

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
            SKL+RA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI +AW+LLT
Sbjct  71   SKLRRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAISFAWKLLT  130

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVY LP+ R+Y TYF GD K    
Sbjct  131  EVYGLPSDRLYVTYFEGDPKQGLE  154



>gb|EJU04465.1| hypothetical protein DACRYDRAFT_20988 [Dacryopinax sp. DJM-731 
SS1]
Length=960

 Score =   236 bits (602),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            WP+ KVR TFI +F+++ HT   SS  +P  DPTLLFANAGMNQ+K IFLGTVDP +EL+
Sbjct  14   WPADKVRQTFIDYFKARGHTFWPSSSTIPYEDPTLLFANAGMNQYKAIFLGTVDPQSELA  73

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
            KLKRA ++QKCIRAGGKHNDL+DVGKDTYHHTFFEMLGNWSFGDYFK EAIQW+WELLTE
Sbjct  74   KLKRAVNSQKCIRAGGKHNDLEDVGKDTYHHTFFEMLGNWSFGDYFKKEAIQWSWELLTE  133

Query  621  VYKLPAIRIYATYFGGDEKMAF  686
            VYKLP  R+Y TYF GD K   
Sbjct  134  VYKLPKDRLYVTYFEGDSKQGL  155



>gb|AFR32145.1| alanyl-tRNA synthetase, partial [Galactomyces candidum]
Length=971

 Score =   236 bits (602),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            WP+SKVR+TF+ +F+SK HT V SS V+P +DPTLLFANAGMNQ+KPIFLGTVDP++ L 
Sbjct  21   WPASKVRNTFLDYFKSKEHTFVPSSSVIPYDDPTLLFANAGMNQYKPIFLGTVDPSSPLF  80

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
            KLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI + WELLT+
Sbjct  81   KLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIAFGWELLTK  140

Query  621  VYKLPAIRIYATYFGGDEKMAFH  689
            VY +PA R+Y +YFGG+EK+   
Sbjct  141  VYGIPADRLYVSYFGGEEKLGLE  163



>gb|AFR32153.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32155.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32157.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32161.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32162.1| alanyl-tRNA synthetase [Galactomyces candidum]
Length=979

 Score =   236 bits (602),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            WP+SKVR+TF+ +F+SK HT V SS V+P +DPTLLFANAGMNQ+KPIFLGTVDP++ L 
Sbjct  29   WPASKVRNTFLDYFKSKEHTFVPSSSVIPYDDPTLLFANAGMNQYKPIFLGTVDPSSPLF  88

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
            KLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI + WELLT+
Sbjct  89   KLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIAFGWELLTK  148

Query  621  VYKLPAIRIYATYFGGDEKMAFH  689
            VY +PA R+Y +YFGG+EK+   
Sbjct  149  VYGIPADRLYVSYFGGEEKLGLE  171



>ref|XP_456501.2| DEHA2A03652p [Debaryomyces hansenii CBS767]
 emb|CAG84453.2| DEHA2A03652p [Debaryomyces hansenii CBS767]
Length=1021

 Score =   236 bits (601),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 125/151 (83%), Gaps = 1/151 (1%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKA-HTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            WP+S+VR TF+ +F+ K  HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  77   WPASRVRSTFLDYFKVKQNHTFVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASDF  136

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
            S LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI W+WELLT
Sbjct  137  STLKRAVNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAISWSWELLT  196

Query  618  EVYKLPAIRIYATYFGGDEKMAFHLIMKLEN  710
            EVYKL   R+Y TYFGGDEK      ++ +N
Sbjct  197  EVYKLEQDRLYVTYFGGDEKQGLQPDLEAKN  227



>gb|EPY51753.1| cytoplasmic alanine-tRNA ligase Ala1 [Schizosaccharomyces cryophilus 
OY26]
Length=1019

 Score =   235 bits (599),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP++KVR TF+KFFE + HT V SS VVP +DPTLLFANAGMNQFKPIFLGTVDP+ E
Sbjct  68   IEWPANKVRSTFLKFFEERGHTVVPSSSVVPYDDPTLLFANAGMNQFKPIFLGTVDPSHE  127

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
             SKLKRA D+QKCIRAGGKHNDL+DVG+D YHHT FEMLGNWSFGDYFK EAIQ AW LL
Sbjct  128  YSKLKRAVDSQKCIRAGGKHNDLEDVGRDNYHHTMFEMLGNWSFGDYFKKEAIQMAWVLL  187

Query  615  TEVYKLPAIRIYATYFGGDEK  677
            TEVY L   ++Y TYFGG E+
Sbjct  188  TEVYGLERDQLYVTYFGGHEE  208



>gb|KGK39868.1| hypothetical protein JL09_g980 [Pichia kudriavzevii]
Length=1474

 Score =   237 bits (605),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            EWP++KVRDTF+ +F+SK HT V SS V+P +DPTLLFANAGMNQ+KPIFLGTVDP++  
Sbjct  15   EWPAAKVRDTFLNYFKSKGHTFVPSSSVIPHDDPTLLFANAGMNQYKPIFLGTVDPSSSF  74

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
            + LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK  AI+++WELLT
Sbjct  75   ANLKRAVNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKEGAIKYSWELLT  134

Query  618  EVYKLPAIRIYATYFGGDEKMAFHLIMKLENLAQ  719
            EVY +P  R+Y TYFGGDEK      ++ + L Q
Sbjct  135  EVYGIPKDRLYVTYFGGDEKTGLEPDLEAKGLWQ  168



>emb|CCV00729.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
Length=966

 Score =   234 bits (598),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = +3

Query  249  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  428
            A   WP++KVR TF+ FF+ +AHT V SS  VP +DPTLLFANAGMNQ+K IFLGTVDP+
Sbjct  8    ASTAWPAAKVRSTFLDFFKEQAHTNVPSSSTVPYDDPTLLFANAGMNQYKSIFLGTVDPS  67

Query  429  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWE  608
            ++ SKL+RA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFG+YFK EAI +AW+
Sbjct  68   SDFSKLRRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGNYFKEEAISYAWK  127

Query  609  LLTEVYKLPAIRIYATYFGGDEKMAFH  689
            LLTEVY LPA R+Y TYF GD K    
Sbjct  128  LLTEVYGLPADRLYVTYFEGDAKQGLE  154



>ref|XP_011111424.1| hypothetical protein H072_5555 [Dactylellina haptotyla CBS 200.50]
 gb|EPS40594.1| hypothetical protein H072_5555 [Dactylellina haptotyla CBS 200.50]
Length=1063

 Score =   235 bits (599),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            EWP++KVR+TF K+FESK H  VKSSP VPV+D TLLFANAGMNQ+K IFLGTVDPN++ 
Sbjct  106  EWPAAKVRETFFKYFESKGHEYVKSSPCVPVDDKTLLFANAGMNQYKSIFLGTVDPNSKF  165

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
             KLKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++WELLT
Sbjct  166  GKLKRAHNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAIAYSWELLT  225

Query  618  EVYKLPAIRIYATYFGGD  671
            +V+KL   R+Y TYFGGD
Sbjct  226  QVFKLNPDRLYVTYFGGD  243



>gb|AFR32146.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32147.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32148.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32149.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32150.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32151.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32152.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32154.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32156.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32158.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32159.1| alanyl-tRNA synthetase [Galactomyces candidum]
 gb|AFR32160.1| alanyl-tRNA synthetase [Galactomyces candidum]
Length=979

 Score =   234 bits (598),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            WP+SKVR+TF+ +F+S  HT V SS V+P +DPTLLFANAGMNQ+KPIFLGTVDP++ L 
Sbjct  29   WPASKVRNTFLDYFKSNEHTFVPSSSVIPYDDPTLLFANAGMNQYKPIFLGTVDPSSPLF  88

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
            KLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI + WELLT+
Sbjct  89   KLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIAFGWELLTK  148

Query  621  VYKLPAIRIYATYFGGDEKMAFH  689
            VY +PA R+Y +YFGG+EK+   
Sbjct  149  VYGIPADRLYVSYFGGEEKLGLE  171



>ref|XP_665905.1| cytosolic tRNA-Ala synthetase [Cryptosporidium hominis TU502]
Length=989

 Score =   234 bits (597),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 100/140 (71%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            W   +VR  F+K+FE   HT  +SSPV+P+NDPT+LF NAGMNQFK IFLGTV+PN+ELS
Sbjct  9    WTGDEVRRQFVKYFEGLDHTFYRSSPVIPLNDPTILFINAGMNQFKSIFLGTVEPNSELS  68

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
            KL R  ++QKCIRAGGKHNDLDDVGKD YHHTFFEMLG+WSFGDYFK EAI+WA++LLT+
Sbjct  69   KLVRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKEEAIEWAFKLLTQ  128

Query  621  VYKLPAIRIYATYFGGDEKM  680
            VY +P  R+YATYFGGD K+
Sbjct  129  VYGIPKDRLYATYFGGDPKL  148



>ref|XP_627438.1| alanyl-tRNA synthetase (with HxxxH domain) [Cryptosporidium parvum 
Iowa II]
 gb|EAK90114.1| alanyl-tRNA synthetase (with HxxxH domain) [Cryptosporidium parvum 
Iowa II]
Length=1003

 Score =   234 bits (597),  Expect = 2e-67, Method: Composition-based stats.
 Identities = 100/140 (71%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            W   +VR  F+K+FE   HT  +SSPV+P+NDPT+LF NAGMNQFK IFLGTV+PN+ELS
Sbjct  21   WTGDEVRRQFVKYFEGLDHTFYRSSPVIPLNDPTILFINAGMNQFKSIFLGTVEPNSELS  80

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
            KL R  ++QKCIRAGGKHNDLDDVGKD YHHTFFEMLG+WSFGDYFK EAI+WA++LLT+
Sbjct  81   KLVRVANSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKEEAIEWAFKLLTQ  140

Query  621  VYKLPAIRIYATYFGGDEKM  680
            VY +P  R+YATYFGGD K+
Sbjct  141  VYGIPKDRLYATYFGGDPKL  160



>gb|KHN71931.1| Alanine--tRNA ligase, cytoplasmic [Toxocara canis]
Length=246

 Score =   220 bits (560),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = +3

Query  267  SSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELSKL  446
            + +VR TFI+FF  + HT V SS V+P  DPTLLFANAGMNQFKPIFLGTV+P +EL++L
Sbjct  7    ADEVRSTFIRFFAEREHTYVHSSSVIPFEDPTLLFANAGMNQFKPIFLGTVEPCSELARL  66

Query  447  KRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTEVY  626
            +RA +TQKCIRAGGKHNDLDDVGKD YHHTFFEMLGNWSFGDYFK E   WAWELLT+  
Sbjct  67   RRAVNTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEVCSWAWELLTKEL  126

Query  627  KLPAIRIYATYFGGDEKMAF  686
             +PA ++Y +YFGGDEK   
Sbjct  127  SIPADQLYVSYFGGDEKAGL  146



>gb|AAA84420.1| AlaRS A [Caenorhabditis elegans]
Length=272

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 116/137 (85%), Gaps = 1/137 (1%)
 Frame = +3

Query  267  SSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELSK  443
            +S+VR TFI FF E K HT V SS V+P +DPTLLFANAGMNQFKP+FLG  DPN++L+K
Sbjct  6    ASEVRSTFINFFREKKEHTYVHSSSVIPHDDPTLLFANAGMNQFKPLFLGIADPNSDLAK  65

Query  444  LKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTEV  623
            LKRA +TQKCIRAGGKHNDLDDVGKD YHHT+FEMLGNWSFGDYFK E I WAWELLT V
Sbjct  66   LKRAVNTQKCIRAGGKHNDLDDVGKDVYHHTYFEMLGNWSFGDYFKKEIITWAWELLTTV  125

Query  624  YKLPAIRIYATYFGGDE  674
            Y +PA R+Y + FGGDE
Sbjct  126  YGIPAERLYVSVFGGDE  142



>gb|EYB99703.1| hypothetical protein Y032_0120g894 [Ancylostoma ceylanicum]
Length=968

 Score =   234 bits (596),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 122/141 (87%), Gaps = 1/141 (1%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +  +++VR TFI+FF + KAHT V SS V+P +DPTLLFANAGMNQFKP+FLG  DPN++
Sbjct  3    QLTANEVRSTFIEFFKQKKAHTYVHSSSVIPHDDPTLLFANAGMNQFKPLFLGIADPNSD  62

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            L+KLKRA +TQKCIRAGGKHNDLDDVGKD YHHTFFEMLGNWSFGDYFK E I WAWELL
Sbjct  63   LAKLKRAVNTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEIITWAWELL  122

Query  615  TEVYKLPAIRIYATYFGGDEK  677
            TEVY +PA R+Y +YFGGDEK
Sbjct  123  TEVYGIPAERLYVSYFGGDEK  143



>gb|EPB76393.1| alanine--tRNA ligase [Ancylostoma ceylanicum]
Length=954

 Score =   234 bits (596),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 122/141 (87%), Gaps = 1/141 (1%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +  +++VR TFI+FF + KAHT V SS V+P +DPTLLFANAGMNQFKP+FLG  DPN++
Sbjct  3    QLTANEVRSTFIEFFKQKKAHTYVHSSSVIPHDDPTLLFANAGMNQFKPLFLGIADPNSD  62

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            L+KLKRA +TQKCIRAGGKHNDLDDVGKD YHHTFFEMLGNWSFGDYFK E I WAWELL
Sbjct  63   LAKLKRAVNTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEIITWAWELL  122

Query  615  TEVYKLPAIRIYATYFGGDEK  677
            TEVY +PA R+Y +YFGGDEK
Sbjct  123  TEVYGIPAERLYVSYFGGDEK  143



>ref|XP_004335848.1| alanine-tRNA ligase [Acanthamoeba castellanii str. Neff]
 gb|ELR13835.1| alanine-tRNA ligase [Acanthamoeba castellanii str. Neff]
Length=954

 Score =   233 bits (595),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 121/144 (84%), Gaps = 1/144 (1%)
 Frame = +3

Query  249  AGLEWPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  425
            A +EWP S+VR TF+ +F E + H  V+SS VVP +DPTLLFANAGMNQFKPIFLG VDP
Sbjct  8    ASIEWPVSRVRQTFVDYFVEKQQHLHVRSSSVVPHDDPTLLFANAGMNQFKPIFLGQVDP  67

Query  426  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAW  605
             +E +  KRA ++QKCIRAGGKHNDL+DVGKDTYHHTFFEMLGNWSFGDYFK EAI WAW
Sbjct  68   KSEQATWKRAANSQKCIRAGGKHNDLEDVGKDTYHHTFFEMLGNWSFGDYFKEEAISWAW  127

Query  606  ELLTEVYKLPAIRIYATYFGGDEK  677
            +LLT VY LPA R+YATYF GDE+
Sbjct  128  DLLTNVYGLPAERLYATYFRGDEE  151



>gb|EKF39507.1| alanyl-tRNA synthetase, putative, partial [Trypanosoma cruzi 
marinkellei]
Length=1007

 Score =   234 bits (596),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            EWP ++VR  F+KFFE + H  V SSPVVP NDPTLLF NAGMNQFK IFLGT DPNTE 
Sbjct  51   EWPVNRVRQEFLKFFEQRGHKFVPSSPVVPNNDPTLLFINAGMNQFKNIFLGTADPNTEF  110

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
             +L RA ++Q CIRAGGKHNDLDDVG+DTYHHTFFEMLG+WSFGDYFK +AI+WAWELLT
Sbjct  111  GRLTRAANSQLCIRAGGKHNDLDDVGRDTYHHTFFEMLGSWSFGDYFKRDAIRWAWELLT  170

Query  618  EVYKLPAIRIYATYFGGD  671
            EVYKLP  R+Y TYF GD
Sbjct  171  EVYKLPKDRLYVTYFEGD  188



>gb|KIM31429.1| hypothetical protein M408DRAFT_327641 [Serendipita vermifera 
MAFF 305830]
Length=960

 Score =   233 bits (595),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            W +SKVR+T+I FF+SK HT   SS  +P  DPTLLFANAGMNQ+K +FLGTVDPN+++S
Sbjct  10   WTASKVRETYIDFFKSKGHTFWPSSSTIPYEDPTLLFANAGMNQYKAVFLGTVDPNSDMS  69

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
            KLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EA+ WAWELLTE
Sbjct  70   KLKRAVNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKREALSWAWELLTE  129

Query  621  VYKLPAIRIYATYFGGDEKMAF  686
            VYKLPA R+Y +YF GD K   
Sbjct  130  VYKLPADRLYVSYFEGDPKQGL  151



>emb|CDJ84213.1| Alanyl-tRNA synthetase and Threonyl alanyl tRNA synthetase and 
Phosphoesterase domain containing protein [Haemonchus contortus]
Length=934

 Score =   233 bits (594),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 122/141 (87%), Gaps = 1/141 (1%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +  +++VR TFI+FF + KAHT V SS V+P +DPTLLFANAGMNQFKP+FLG  DPN++
Sbjct  20   QLTANEVRSTFIEFFKQKKAHTYVHSSSVIPHDDPTLLFANAGMNQFKPLFLGIADPNSD  79

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            L+KLKRA +TQKCIRAGGKHNDLDDVGKD YHHTFFEMLGNWSFGDYFK E I WAWELL
Sbjct  80   LAKLKRAVNTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEVITWAWELL  139

Query  615  TEVYKLPAIRIYATYFGGDEK  677
            TEVY++PA R+Y +YFGGD K
Sbjct  140  TEVYEIPADRLYVSYFGGDTK  160



>gb|EKG06983.1| alanyl-tRNA synthetase, putative [Trypanosoma cruzi]
Length=959

 Score =   233 bits (594),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            EWP ++VR  F+KFFE + H  V SSPVVP NDPTLLF NAGMNQFK +FLGT DPNTE 
Sbjct  3    EWPVNRVRQEFLKFFEQRGHKFVPSSPVVPNNDPTLLFINAGMNQFKNLFLGTADPNTEF  62

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
             +L RA ++Q CIRAGGKHNDLDDVG+DTYHHTFFEMLG+WSFGDYFK +AI+WAWELLT
Sbjct  63   GRLTRAANSQLCIRAGGKHNDLDDVGRDTYHHTFFEMLGSWSFGDYFKRDAIRWAWELLT  122

Query  618  EVYKLPAIRIYATYFGGD  671
            EVYKLP  R+Y TYF GD
Sbjct  123  EVYKLPKDRLYVTYFEGD  140



>dbj|BAP72231.1| alanyl-tRNA synthetase [Kluyveromyces marxianus]
Length=956

 Score =   233 bits (594),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR TF+ +F+SK HT V SSPV+P +DPTLLFANAGMNQ+KPIFLGTVDP+++ 
Sbjct  8    KWTATNVRSTFLDYFKSKGHTFVPSSPVIPYDDPTLLFANAGMNQYKPIFLGTVDPSSDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
             KLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI+++WELLT
Sbjct  68   YKLKRATNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIEYSWELLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            +VY +P  R+Y TYF GDEK+   
Sbjct  128  KVYGIPGDRLYVTYFEGDEKLGLE  151



>ref|XP_816499.1| alanyl-tRNA synthetase [Trypanosoma cruzi strain CL Brener]
 gb|EAN94648.1| alanyl-tRNA synthetase, putative [Trypanosoma cruzi]
Length=959

 Score =   233 bits (593),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            EWP ++VR  F+KFFE + H  V SSPVVP NDPTLLF NAGMNQFK +FLGT DPNTE 
Sbjct  3    EWPVNRVRQEFLKFFEQRGHKFVPSSPVVPNNDPTLLFINAGMNQFKNLFLGTADPNTEF  62

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
             +L RA ++Q CIRAGGKHNDLDDVG+DTYHHTFFEMLG+WSFGDYFK +AI+WAWELLT
Sbjct  63   GRLTRAANSQLCIRAGGKHNDLDDVGRDTYHHTFFEMLGSWSFGDYFKRDAIRWAWELLT  122

Query  618  EVYKLPAIRIYATYFGGD  671
            EVYKLP  R+Y TYF GD
Sbjct  123  EVYKLPKDRLYVTYFEGD  140



>dbj|BAO40758.1| alanyl-tRNA synthetase [Kluyveromyces marxianus DMKU3-1042]
Length=956

 Score =   233 bits (593),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR TF+ +F+SK HT V SSPV+P +DPTLLFANAGMNQ+KPIFLGTVDP+++ 
Sbjct  8    KWTATNVRSTFLDYFKSKGHTFVPSSPVIPYDDPTLLFANAGMNQYKPIFLGTVDPSSDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
             KLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI+++WELLT
Sbjct  68   YKLKRATNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIEYSWELLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            +VY +P  R+Y TYF GDEK+   
Sbjct  128  KVYGIPGDRLYVTYFEGDEKLGLE  151



>ref|XP_810193.1| alanyl-tRNA synthetase [Trypanosoma cruzi strain CL Brener]
 gb|EAN88342.1| alanyl-tRNA synthetase, putative [Trypanosoma cruzi]
Length=959

 Score =   233 bits (593),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            EWP ++VR  F+KFFE + H  V SSPVVP NDPTLLF NAGMNQFK +FLGT DPNTE 
Sbjct  3    EWPVNRVRQEFLKFFEQRGHKFVPSSPVVPNNDPTLLFINAGMNQFKNLFLGTADPNTEF  62

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
             +L RA ++Q CIRAGGKHNDLDDVG+DTYHHTFFEMLG+WSFGDYFK +AI+WAWELLT
Sbjct  63   GRLTRAANSQLCIRAGGKHNDLDDVGRDTYHHTFFEMLGSWSFGDYFKRDAIRWAWELLT  122

Query  618  EVYKLPAIRIYATYFGGD  671
            EVYKLP  R+Y TYF GD
Sbjct  123  EVYKLPKDRLYVTYFEGD  140



>ref|XP_455190.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 emb|CAG97897.1| KLLA0F02431p [Kluyveromyces lactis]
Length=956

 Score =   233 bits (593),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR TF+ +F+SK HT V SSPV+P +DPTLLFANAGMNQ+KPIFLGTVDP+++ 
Sbjct  8    KWTAANVRSTFLDYFKSKGHTFVPSSPVIPFDDPTLLFANAGMNQYKPIFLGTVDPSSDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
             KLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI+++WELLT
Sbjct  68   YKLKRATNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIEYSWELLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            +VY +P  R+Y TYF GDEK+   
Sbjct  128  KVYGIPGDRLYVTYFEGDEKLGLE  151



>emb|CDJ87289.1| Alanyl-tRNA synthetase and Threonyl alanyl tRNA synthetase and 
Phosphoesterase domain containing protein [Haemonchus contortus]
Length=986

 Score =   233 bits (593),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 122/141 (87%), Gaps = 1/141 (1%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +  +++VR TFI+FF + KAHT V SS V+P +DPTLLFANAGMNQFKP+FLG  DPN++
Sbjct  21   QLTANEVRSTFIEFFKQKKAHTYVHSSSVIPHDDPTLLFANAGMNQFKPLFLGIADPNSD  80

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            L+KLKRA +TQKCIRAGGKHNDLDDVGKD YHHTFFEMLGNWSFGDYFK E I WAWELL
Sbjct  81   LAKLKRAVNTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEVITWAWELL  140

Query  615  TEVYKLPAIRIYATYFGGDEK  677
            TEVY++PA R+Y +YFGGD K
Sbjct  141  TEVYEIPADRLYVSYFGGDTK  161



>ref|XP_006676752.1| hypothetical protein BATDEDRAFT_32863 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF82402.1| hypothetical protein BATDEDRAFT_32863 [Batrachochytrium dendrobatidis 
JAM81]
Length=965

 Score =   232 bits (592),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +WP SKVR TFI +FE   HT V SS  +P  DPTL+FAN+GMNQFKPIFLGTVDPN++L
Sbjct  4    KWPLSKVRKTFIDYFEQHGHTHVVSSSTIPHGDPTLMFANSGMNQFKPIFLGTVDPNSDL  63

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
            ++L RA ++QKCIRAGGKHNDL+DVG+DTYHHTFFEMLGNWSFG+YFKTEAI+ AWE+LT
Sbjct  64   ARLSRAANSQKCIRAGGKHNDLEDVGRDTYHHTFFEMLGNWSFGNYFKTEAIEMAWEILT  123

Query  618  EVYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            +VY LP  R+Y TYFGGD+ +     ++ ++L
Sbjct  124  KVYGLPKDRLYITYFGGDKSLGLESDIEAKHL  155



>gb|ESS63542.1| alanyl-tRNA synthetase [Trypanosoma cruzi Dm28c]
Length=900

 Score =   232 bits (592),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            EWP ++VR  F+KFFE + H  V SSPVVP NDPTLLF NAGMNQFK +FLGT DPNTE 
Sbjct  3    EWPVNRVRQEFLKFFEQRGHKFVPSSPVVPNNDPTLLFINAGMNQFKNLFLGTADPNTEF  62

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
             +L RA ++Q CIRAGGKHNDLDDVG+DTYHHTFFEMLG+WSFGDYFK +AI+WAWELLT
Sbjct  63   GRLTRAANSQLCIRAGGKHNDLDDVGRDTYHHTFFEMLGSWSFGDYFKRDAIRWAWELLT  122

Query  618  EVYKLPAIRIYATYFGGD  671
            EVYKLP  R+Y TYF GD
Sbjct  123  EVYKLPKDRLYVTYFEGD  140



>emb|CBQ72435.1| probable ALA1-alanyl-tRNA synthetase, cytosolic [Sporisorium 
reilianum SRZ2]
Length=990

 Score =   232 bits (592),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +WP++KVR+TF  +FE +AHT V SS  +P +DPTLLFANAGMNQ+KPIFLG  DPN+  
Sbjct  21   DWPATKVRNTFTGYFEERAHTFVPSSSTIPYDDPTLLFANAGMNQYKPIFLGIADPNSSF  80

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              +KRA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAIQ AWELLT
Sbjct  81   GSMKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIQMAWELLT  140

Query  618  EVYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            +VY LP  R+Y TYF GD K      ++  +L
Sbjct  141  KVYGLPKDRLYVTYFEGDAKQGLEPDLEARDL  172



>ref|XP_005537171.1| alanine--tRNA ligase cytoplasmic [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81135.1| alanine--tRNA ligase cytoplasmic [Cyanidioschyzon merolae strain 
10D]
Length=1061

 Score =   233 bits (593),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            WPSS+VR TFI +F  + HT V+SSPVVP +DPTLLF NAGMNQFKP+FLG VDP + L 
Sbjct  23   WPSSRVRQTFIDYFIDRGHTFVESSPVVPFDDPTLLFTNAGMNQFKPLFLGRVDPTSPLF  82

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
             LKRAC+TQKC+RAGGKHNDLDDVG+DTYHHTFFEMLGNWSFGDYF  EAI WAW+LLT 
Sbjct  83   GLKRACNTQKCVRAGGKHNDLDDVGRDTYHHTFFEMLGNWSFGDYFNAEAINWAWDLLTR  142

Query  621  VYKLPAIRIYATYFGGD  671
            VY L   ++YATYFGGD
Sbjct  143  VYGLDPDQLYATYFGGD  159



>ref|XP_001417607.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95900.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=967

 Score =   232 bits (591),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 116/145 (80%), Gaps = 1/145 (1%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            EWPSS+VRDTF+ +F E + H    SSP VPVNDPTLLFANAGMNQ+KPIFLG  DP T 
Sbjct  27   EWPSSRVRDTFVNYFIEKQGHVNWPSSPAVPVNDPTLLFANAGMNQYKPIFLGKADPKTA  86

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
             +KL RA +TQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI  AW+LL
Sbjct  87   FAKLTRATNTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEEAIGMAWDLL  146

Query  615  TEVYKLPAIRIYATYFGGDEKMAFH  689
            T VY L   R+YATYFGGDE     
Sbjct  147  TNVYGLAPDRLYATYFGGDESQGLQ  171



>ref|XP_007377582.1| alanyl-tRNA synthetase, cytoplasmic [Spathaspora passalidarum 
NRRL Y-27907]
 gb|EGW30611.1| alanyl-tRNA synthetase, cytoplasmic [Spathaspora passalidarum 
NRRL Y-27907]
Length=959

 Score =   232 bits (591),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 120/145 (83%), Gaps = 1/145 (1%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            EW +SKVR TF+ FF + K HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP ++
Sbjct  13   EWTASKVRSTFLDFFTKKKGHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASD  72

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
             + LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI W+WELL
Sbjct  73   FASLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIDWSWELL  132

Query  615  TEVYKLPAIRIYATYFGGDEKMAFH  689
            T+VY L   R+Y TYFGGDEK    
Sbjct  133  TQVYGLDKDRLYVTYFGGDEKQGLQ  157



>ref|XP_500483.1| YALI0B04180p [Yarrowia lipolytica]
 emb|CAG82710.1| YALI0B04180p [Yarrowia lipolytica CLIB122]
Length=960

 Score =   232 bits (591),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 122/144 (85%), Gaps = 1/144 (1%)
 Frame = +3

Query  261  WPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            WP++KVR TF+ +F E +AH+ V SS V+P +DPTLLFANAGMNQ+KPIFLGT DP++ L
Sbjct  8    WPATKVRKTFLDYFGEKRAHSFVPSSSVIPYDDPTLLFANAGMNQYKPIFLGTCDPSSPL  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
            SKL RA ++QKCIRAGGKHNDLDDVG+D+YHHTFFEMLGNWSFGDYFK EA  WAWELLT
Sbjct  68   SKLNRAANSQKCIRAGGKHNDLDDVGRDSYHHTFFEMLGNWSFGDYFKAEACAWAWELLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            +VY L A R+Y +YFGGD+K+   
Sbjct  128  QVYGLDADRLYVSYFGGDDKLGLQ  151



>ref|XP_004198838.1| Piso0_002228 [Millerozyma farinosa CBS 7064]
 emb|CCE82501.1| Piso0_002228 [Millerozyma farinosa CBS 7064]
Length=960

 Score =   231 bits (590),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            W +SKVR TF+ FF++K HT V SS VVP NDP+LLFANAGMNQ+KPIFLGTVDP +E +
Sbjct  18   WTASKVRSTFLDFFKNKNHTFVPSSSVVPHNDPSLLFANAGMNQYKPIFLGTVDPGSEFA  77

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK +AI WAWELLTE
Sbjct  78   TLKRAVNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKDAIAWAWELLTE  137

Query  621  VYKLPAIRIYATYFGGDEK  677
             YKL   R+Y TYF GDEK
Sbjct  138  EYKLEKDRLYVTYFEGDEK  156



>gb|KIW00804.1| alanine-tRNA ligase [Verruconis gallopava]
Length=998

 Score =   232 bits (591),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 117/144 (81%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            EW ++ VR  FI +FE + HT V SSPVVP+NDPTLLF NAGMNQFK IFLGTVDPN+  
Sbjct  49   EWTANSVRKQFIDYFEQRGHTYVPSSPVVPLNDPTLLFTNAGMNQFKSIFLGTVDPNSNF  108

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
            +KLKRA +TQKCIRAGGKHNDLDDVGKD+YHHT+FEMLGNWSFGDYFK EAI W+WELLT
Sbjct  109  AKLKRAVNTQKCIRAGGKHNDLDDVGKDSYHHTYFEMLGNWSFGDYFKKEAIAWSWELLT  168

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            +VY L   R+Y TYF GD  +   
Sbjct  169  KVYGLEPDRLYVTYFEGDPSLGLE  192



>gb|EJK71470.1| hypothetical protein THAOC_07085 [Thalassiosira oceanica]
Length=1072

 Score =   232 bits (592),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            EWP  KVR TFI FFE   HT  +SSP VP +DPTLLF NAGMNQ+KP+FLGTVDPN E+
Sbjct  118  EWPMDKVRSTFISFFERNGHTFWRSSPCVPYDDPTLLFTNAGMNQYKPLFLGTVDPNVEM  177

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
            + LKRAC++QKCIRAGGKHNDLDDVGKD YHHTFFEMLGNWSFGDYFK EAI+ AW+ LT
Sbjct  178  AGLKRACNSQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGNWSFGDYFKKEAIEMAWKCLT  237

Query  618  EVYKLPAIRIYATYFGGDE  674
            E + L   R+YATYFGGDE
Sbjct  238  EEFGLDPERLYATYFGGDE  256



>ref|XP_003030369.1| hypothetical protein SCHCODRAFT_82606 [Schizophyllum commune 
H4-8]
 gb|EFI95466.1| hypothetical protein SCHCODRAFT_82606 [Schizophyllum commune 
H4-8]
Length=949

 Score =   231 bits (589),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 124/145 (86%), Gaps = 1/145 (1%)
 Frame = +3

Query  246  MAGLEWPSSK-VRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVD  422
            MA +   SS+ VR  F  +F+SK HT V+SSP VP +DPTLLFANAGMNQFKP+FLGTVD
Sbjct  1    MAAIPHRSSRQVRQDFFDYFQSKGHTFVRSSPTVPYDDPTLLFANAGMNQFKPLFLGTVD  60

Query  423  PNTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWA  602
            P+++LSKLKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI ++
Sbjct  61   PHSDLSKLKRAYNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIAYS  120

Query  603  WELLTEVYKLPAIRIYATYFGGDEK  677
            WELLTEVYKLP  R+Y +YF GD K
Sbjct  121  WELLTEVYKLPKDRLYVSYFEGDPK  145



>ref|XP_001643652.1| hypothetical protein Kpol_1040p7 [Vanderwaltozyma polyspora DSM 
70294]
 gb|EDO15794.1| hypothetical protein Kpol_1040p7 [Vanderwaltozyma polyspora DSM 
70294]
Length=956

 Score =   231 bits (589),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            W ++ VR+TF+ +F+SK H  V+SSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP++E  
Sbjct  9    WTAAVVRNTFLDYFKSKEHKFVRSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPSSEFY  68

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EA++++WELLT+
Sbjct  69   TLKRAYNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAVEYSWELLTQ  128

Query  621  VYKLPAIRIYATYFGGDEKMAFH  689
            VY +PA R+Y TYF GDEK    
Sbjct  129  VYSIPADRLYVTYFEGDEKQGLE  151



>ref|XP_002615762.1| hypothetical protein CLUG_04644 [Clavispora lusitaniae ATCC 42720]
 gb|EEQ40516.1| hypothetical protein CLUG_04644 [Clavispora lusitaniae ATCC 42720]
Length=964

 Score =   231 bits (589),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            W +S VR TF+ +F++K+HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP +E +
Sbjct  18   WSASTVRSTFLDYFKNKSHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPTSEFA  77

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI ++WELLTE
Sbjct  78   TLKRAVNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIAYSWELLTE  137

Query  621  VYKLPAIRIYATYFGGDEK  677
            VYKL   R+Y TYF GDEK
Sbjct  138  VYKLDKDRLYVTYFEGDEK  156



>gb|EPS99866.1| hypothetical protein FOMPIDRAFT_1024013 [Fomitopsis pinicola 
FP-58527 SS1]
Length=958

 Score =   231 bits (588),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            L WP++KVR  F  +F+SK HT V SS  +P +DPTLLFANAGMNQFK IFLGTVDP ++
Sbjct  7    LNWPAAKVRQEFFNYFQSKGHTLVPSSSTIPHDDPTLLFANAGMNQFKAIFLGTVDPQSD  66

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            L++L RA +TQKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI ++WELL
Sbjct  67   LARLNRAFNTQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKEEAIAYSWELL  126

Query  615  TEVYKLPAIRIYATYFGGDEK  677
            TEVYKLP  ++Y TYF GD K
Sbjct  127  TEVYKLPKEQLYVTYFEGDPK  147



>emb|CDO95315.1| unnamed protein product [Kluyveromyces dobzhanskii CBS 2104]
Length=956

 Score =   231 bits (588),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR TF+ FF+SK HT V SSPV+P  DPTLLFANAGMNQ+KPIFLGTVDP+++ 
Sbjct  8    KWTATNVRTTFLDFFKSKGHTFVPSSPVIPYEDPTLLFANAGMNQYKPIFLGTVDPSSDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
             KLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI+++WELLT
Sbjct  68   YKLKRATNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIEYSWELLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            +VY +P  R+Y TYF GDE +   
Sbjct  128  KVYGIPGDRLYVTYFEGDESLGLE  151



>ref|XP_001486846.1| hypothetical protein PGUG_00223 [Meyerozyma guilliermondii ATCC 
6260]
 gb|EDK36125.1| hypothetical protein PGUG_00223 [Meyerozyma guilliermondii ATCC 
6260]
Length=964

 Score =   231 bits (588),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESK-AHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            WP+SKVR TF+ +F+ K  H  V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP +E+
Sbjct  20   WPASKVRSTFLDYFKEKHGHQFVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASEM  79

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
            S  KRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI+WAWELLT
Sbjct  80   STWKRAVNSQKCIRAGGKHNDLEDVGQDSYHHTFFEMLGNWSFGDYFKKEAIEWAWELLT  139

Query  618  EVYKLPAIRIYATYFGGDEKMAF  686
            +VYKL   R+Y TYF GDEK+  
Sbjct  140  DVYKLDPDRLYVTYFEGDEKLGL  162



>ref|XP_007511747.1| alanyl-tRNA synthetase [Bathycoccus prasinos]
 emb|CCO17868.1| alanyl-tRNA synthetase [Bathycoccus prasinos]
Length=1194

 Score =   232 bits (592),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESK-AHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            W ++KVR+TF  FFESK AHT V SSPVVP +DPTLLFANAGMNQFKPIFLGT DP + L
Sbjct  247  WSAAKVRNTFTSFFESKHAHTIVPSSPVVPHDDPTLLFANAGMNQFKPIFLGTCDPKSPL  306

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKR  D+QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK  AI  AWELLT
Sbjct  307  YTLKRVTDSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKEGAISMAWELLT  366

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVYK+   R+YATYFGGD K    
Sbjct  367  EVYKIDPDRLYATYFGGDPKQGLE  390



>ref|XP_009493046.1| alanyl-tRNA synthetase [Fonticula alba]
 gb|KCV73345.1| alanyl-tRNA synthetase [Fonticula alba]
Length=957

 Score =   231 bits (588),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            W   KVR TFI FFE + H+ V SS  +P +DPTLLF NAGMNQFKPIF GTVDPN+E S
Sbjct  11   WTGDKVRQTFISFFEERGHSFVPSSSTIPHDDPTLLFTNAGMNQFKPIFQGTVDPNSEFS  70

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
            +LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK +AI WAWELLTE
Sbjct  71   RLKRAANSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKVDAINWAWELLTE  130

Query  621  VYKLPAIRIYATYFGGD  671
            V+ L   R+Y +YFGGD
Sbjct  131  VFGLDKDRLYVSYFGGD  147



>ref|XP_005710836.1| Alanine--tRNA ligase [Chondrus crispus]
 emb|CDF40542.1| Alanine--tRNA ligase [Chondrus crispus]
Length=965

 Score =   231 bits (588),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 119/146 (82%), Gaps = 1/146 (1%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  431
            L WP+S+VR TFI FF +S AHT V SSPVVP +DPTLLFANAGMNQ+KPIFLG   P++
Sbjct  13   LAWPASRVRSTFIDFFSQSHAHTFVPSSPVVPHDDPTLLFANAGMNQYKPIFLGVAPPDS  72

Query  432  ELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWEL  611
             LS LKRAC++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK  AI  A EL
Sbjct  73   FLSTLKRACNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKAGAIDMAMEL  132

Query  612  LTEVYKLPAIRIYATYFGGDEKMAFH  689
            LT  Y LPA RIYATYFGGD K    
Sbjct  133  LTGKYGLPAERIYATYFGGDGKQGLE  158



>ref|XP_003060777.1| alanyl-tRNA synthetase [Micromonas pusilla CCMP1545]
 gb|EEH55546.1| alanyl-tRNA synthetase [Micromonas pusilla CCMP1545]
Length=972

 Score =   230 bits (587),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 117/144 (81%), Gaps = 2/144 (1%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            WP++K+R TF+ FFESK H  V SSPVVP +DPTLLFANAGMNQFK IFLG  DP   L+
Sbjct  11   WPANKIRQTFLDFFESKEHAVVPSSPVVPHDDPTLLFANAGMNQFKSIFLGKADPKGPLA  70

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT-  617
            KLKRA DTQKCIRAGGKHNDLDDVGKDTYHHT+FEMLGNWSFGD+FK EAI WAWELLT 
Sbjct  71   KLKRATDTQKCIRAGGKHNDLDDVGKDTYHHTYFEMLGNWSFGDFFKREAIHWAWELLTS  130

Query  618  -EVYKLPAIRIYATYFGGDEKMAF  686
             E Y L   R+YA+YFGGDE    
Sbjct  131  KEHYGLDESRLYASYFGGDESQGL  154



>ref|XP_001683305.1| putative alanyl-tRNA synthetase [Leishmania major strain Friedlin]
 emb|CAJ04856.1| putative alanyl-tRNA synthetase [Leishmania major strain Friedlin]
Length=962

 Score =   230 bits (587),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  246  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  425
            M+  EWP S+VR  F+ +F+ + HT V SSPV P +DPTLLF NAGMNQFK +FLGT DP
Sbjct  1    MSFTEWPVSRVRQEFVDYFKKQGHTFVPSSPVCPHDDPTLLFINAGMNQFKALFLGTADP  60

Query  426  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAW  605
            NT+  +LKRA ++Q CIRAGGKHNDL+DVG+DTYHHTFFEMLG+WSFGDYFK EAIQWAW
Sbjct  61   NTDFGRLKRAANSQMCIRAGGKHNDLEDVGRDTYHHTFFEMLGSWSFGDYFKKEAIQWAW  120

Query  606  ELLTEVYKLPAIRIYATYFGGDE  674
            ELLTEVYKLP  ++Y TYF GDE
Sbjct  121  ELLTEVYKLPKDQLYVTYFEGDE  143



>ref|XP_007847723.1| alanyl-trna synthetase [Moniliophthora roreri MCA 2997]
 gb|ESK92985.1| alanyl-trna synthetase [Moniliophthora roreri MCA 2997]
Length=946

 Score =   230 bits (587),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            W +SKVRD F  +F S+ HT V SS  +P +DPTLLFANAGMNQ+K IFLGTVDPN++L+
Sbjct  5    WTASKVRDEFFNYFRSREHTFVPSSSTIPYDDPTLLFANAGMNQYKAIFLGTVDPNSDLA  64

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
            KLKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI ++WELLT+
Sbjct  65   KLKRAFNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIAYSWELLTQ  124

Query  621  VYKLPAIRIYATYFGGDEK  677
            VYKLP  R+Y TYF GD K
Sbjct  125  VYKLPQDRLYVTYFEGDPK  143



>ref|XP_001465654.1| putative alanyl-tRNA synthetase [Leishmania infantum JPCM5]
 ref|XP_003860885.1| alanyl-tRNA synthetase, putative [Leishmania donovani]
 emb|CAM68079.1| putative alanyl-tRNA synthetase [Leishmania infantum JPCM5]
 emb|CBZ34180.1| alanyl-tRNA synthetase, putative [Leishmania donovani]
Length=962

 Score =   230 bits (587),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  246  MAGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDP  425
            M+  EWP S+VR  F+ +F+ + HT V SSPV P +DPTLLF NAGMNQFK +FLGT DP
Sbjct  1    MSFTEWPVSRVRQEFVDYFKKQGHTFVPSSPVCPHDDPTLLFINAGMNQFKALFLGTADP  60

Query  426  NTELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAW  605
            NT+  +LKRA ++Q CIRAGGKHNDL+DVG+DTYHHTFFEMLG+WSFGDYFK EAIQWAW
Sbjct  61   NTDFGRLKRAANSQMCIRAGGKHNDLEDVGRDTYHHTFFEMLGSWSFGDYFKKEAIQWAW  120

Query  606  ELLTEVYKLPAIRIYATYFGGDE  674
            ELLTEVYKLP  ++Y TYF GDE
Sbjct  121  ELLTEVYKLPKDQLYVTYFEGDE  143



>gb|EST08427.1| alanyl-tRNA synthetase [Pseudozyma brasiliensis GHG001]
Length=986

 Score =   230 bits (587),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +WP++KVRDTF  +F+ +AHT V SS  +P +DPTLLFANAGMNQ+KPIFLG  DPN+  
Sbjct  17   DWPATKVRDTFTGYFKERAHTFVPSSSTIPYDDPTLLFANAGMNQYKPIFLGVADPNSSF  76

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              +KRA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+ AWELLT
Sbjct  77   GSMKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEMAWELLT  136

Query  618  EVYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
             VY LP  R+Y TYF GD K      ++  +L
Sbjct  137  VVYGLPKDRLYVTYFEGDAKQGLEPDLEARDL  168



>ref|XP_004199688.1| Piso0_002228 [Millerozyma farinosa CBS 7064]
 emb|CCE81569.1| Piso0_002228 [Millerozyma farinosa CBS 7064]
Length=960

 Score =   230 bits (587),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            W +SKVR TF+ FF++K HT V SS VVP NDP+LLFANAGMNQ+KPIFLGTVDP++E +
Sbjct  18   WTASKVRSTFLDFFKNKNHTFVPSSSVVPHNDPSLLFANAGMNQYKPIFLGTVDPSSEFA  77

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK +AI WAW+LLTE
Sbjct  78   TLKRAVNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKDAIAWAWKLLTE  137

Query  621  VYKLPAIRIYATYFGGDEK  677
             YKL   R+Y TYF GDEK
Sbjct  138  EYKLEKDRLYVTYFEGDEK  156



>gb|EGA72819.1| Ala1p [Saccharomyces cerevisiae AWRI796]
Length=648

 Score =   227 bits (578),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++W LLT
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWTLLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVY +P  R+Y TYF GDEK+   
Sbjct  128  EVYGIPKDRLYVTYFEGDEKLGLE  151



>ref|XP_009547440.1| hypothetical protein HETIRDRAFT_476425 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW80724.1| hypothetical protein HETIRDRAFT_476425 [Heterobasidion irregulare 
TC 32-1]
Length=959

 Score =   230 bits (587),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            W +S++R  F  +F++K HT V SS  +P  DPTLLFANAGMNQ+KPIFLGTVDP+++LS
Sbjct  13   WTASRIRQEFFDYFQAKEHTFVPSSSTIPYEDPTLLFANAGMNQYKPIFLGTVDPHSDLS  72

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
            KLKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EA+ ++WELLTE
Sbjct  73   KLKRAYNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAVHYSWELLTE  132

Query  621  VYKLPAIRIYATYFGGDEK  677
            VYKLP  R+Y TYF GD K
Sbjct  133  VYKLPKDRLYVTYFEGDAK  151



>ref|XP_011121665.1| hypothetical protein AOL_s00078g100 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX49611.1| hypothetical protein AOL_s00078g100 [Arthrobotrys oligospora 
ATCC 24927]
Length=940

 Score =   230 bits (586),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +3

Query  249  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  428
            A  +WP++KVR TFI+FFE K H   KSSP VP++D TLLFANAGMNQFKPIFLGTVD  
Sbjct  18   AEQKWPATKVRQTFIEFFEKKGHVFYKSSPCVPLDDKTLLFANAGMNQFKPIFLGTVDET  77

Query  429  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWE  608
            ++  KLKRAC+TQKCIRAGGKHNDL+DVG D+YHHTFFEMLGNWSFGDYFKTEA+ ++WE
Sbjct  78   SDFGKLKRACNTQKCIRAGGKHNDLEDVGSDSYHHTFFEMLGNWSFGDYFKTEAVAYSWE  137

Query  609  LLTEVYKLPAIRIYATYFGGD  671
            LLT+VY L   R+Y TYF GD
Sbjct  138  LLTKVYGLDPARLYVTYFEGD  158



>ref|XP_011388270.1| putative alanine--tRNA ligase [Ustilago maydis 521]
 gb|KIS70162.1| putative alanine--tRNA ligase [Ustilago maydis 521]
Length=990

 Score =   230 bits (586),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +WP++KVRDTF  +F+ + HT V SS  +P +DPTLLFANAGMNQ+KPIFLG  DPN+  
Sbjct  21   DWPATKVRDTFTGYFQERKHTFVPSSSTIPYDDPTLLFANAGMNQYKPIFLGIADPNSSF  80

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              +KRA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+ AWELLT
Sbjct  81   GSMKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEMAWELLT  140

Query  618  EVYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            +VY LP  R+Y TYF GD K      ++  +L
Sbjct  141  KVYGLPKDRLYVTYFEGDAKQGLEPDLEARDL  172



>emb|CBJ30506.1| Alanyl-tRNA Synthetase [Ectocarpus siliculosus]
Length=992

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = +3

Query  261  WPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            WP+S+VRD+FI FF E   HT  KSSPVVP +DPTLLFANAGMNQFKP+FLGT DP   L
Sbjct  31   WPASRVRDSFISFFTEKHDHTFWKSSPVVPHDDPTLLFANAGMNQFKPLFLGTADPALPL  90

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
            SKL RA ++QKCIRAGGKHNDLDDVGKD YHHTFFEMLGNWSFG YFK EAI +AWE LT
Sbjct  91   SKLTRATNSQKCIRAGGKHNDLDDVGKDLYHHTFFEMLGNWSFGSYFKEEAIGYAWECLT  150

Query  618  EVYKLPAIRIYATYFGGDEKM  680
             VYKL   R+YATYFGGDEK+
Sbjct  151  TVYKLDPSRLYATYFGGDEKL  171



>emb|CDS09810.1| hypothetical protein LRAMOSA02487 [Absidia idahoensis var. thermophila]
Length=184

 Score =   213 bits (543),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 118/154 (77%), Gaps = 1/154 (1%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNT  431
            LEWP ++VR  FI +F +   HT V SS  +P +DPTLLFANAGMNQ+K +FLGTVDPN+
Sbjct  7    LEWPVNRVRSAFIDYFVKENQHTFVPSSSTIPHDDPTLLFANAGMNQYKSVFLGTVDPNS  66

Query  432  ELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWEL  611
             L+ LK A ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKT A +  W  
Sbjct  67   PLAGLKSATNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTGAAKMCWTF  126

Query  612  LTEVYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            LT+V  LP  R+Y TYFGGDEKM     ++ + +
Sbjct  127  LTQVLNLPTDRLYVTYFGGDEKMGLEADLEAKQI  160



>ref|XP_001877691.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR11794.1| predicted protein [Laccaria bicolor S238N-H82]
Length=955

 Score =   229 bits (584),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            + W S++VR+ F  FF SK HT V SSP +P +DPTLLFANAGMNQ+K IFLGTVDPN++
Sbjct  8    VSWSSARVREEFFNFFRSKNHTFVPSSPTIPFDDPTLLFANAGMNQYKSIFLGTVDPNSD  67

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            +S+LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++WELL
Sbjct  68   MSRLKRAFNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAIAYSWELL  127

Query  615  TEVYKLPAIRIYATYFGGD  671
            T+VYKLP  R+Y TYF GD
Sbjct  128  TDVYKLPKDRLYVTYFEGD  146



>ref|XP_845193.1| alanyl-tRNA synthetase [Trypanosoma brucei brucei TREU927]
 ref|XP_011773844.1| alanyl-tRNA synthetase, putative [Trypanosoma brucei gambiense 
DAL972]
 gb|AAX80474.1| alanyl-tRNA synthetase, putative [Trypanosoma brucei]
 gb|AAZ11634.1| alanyl-tRNA synthetase, putative [Trypanosoma brucei brucei TREU927]
 emb|CBH11559.1| alanyl-tRNA synthetase, putative [Trypanosoma brucei gambiense 
DAL972]
Length=966

 Score =   229 bits (584),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            EWP ++VR  F+ FFE + HT V SS VVP NDPTLLF NAGMNQFK +FLGT DPNT+ 
Sbjct  7    EWPVNRVRQEFVSFFEQRGHTFVPSSAVVPHNDPTLLFTNAGMNQFKNLFLGTADPNTDF  66

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
             +L RA ++Q CIRAGGKHNDLDDVG+DTYHHTFFEMLG+WSFGDYFK EAI W+WELLT
Sbjct  67   GRLTRAVNSQLCIRAGGKHNDLDDVGRDTYHHTFFEMLGSWSFGDYFKREAILWSWELLT  126

Query  618  EVYKLPAIRIYATYFGGD  671
            EVYKLP  R+YATYF GD
Sbjct  127  EVYKLPKDRLYATYFEGD  144



>gb|EFW22234.1| alanyl-tRNA synthetase [Coccidioides posadasii str. Silveira]
Length=964

 Score =   229 bits (584),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP+ KVRDTF+ FF+   HT V SS VVP++DPTLLFANAGMNQ+K IFLGTVDPN++
Sbjct  13   VEWPAIKVRDTFLDFFKKNGHTFVPSSSVVPLSDPTLLFANAGMNQYKSIFLGTVDPNSD  72

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
             ++LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI+++WELL
Sbjct  73   FAQLKRAHNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIEYSWELL  132

Query  615  TEVYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            T+VY L   R+Y TYF G++       ++ ++L
Sbjct  133  TKVYGLEPDRLYVTYFEGNKDAGIEPDLETKDL  165



>ref|XP_002548433.1| alanyl-tRNA synthetase [Candida tropicalis MYA-3404]
 gb|EER33912.1| alanyl-tRNA synthetase [Candida tropicalis MYA-3404]
Length=700

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            W ++KVR TF+ +F+   HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP ++ +
Sbjct  25   WTAAKVRSTFLDYFKQNKHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASDFA  84

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI ++WELLT+
Sbjct  85   TLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIDFSWELLTK  144

Query  621  VYKLPAIRIYATYFGGDEKMAFH  689
            VY LP  R+Y TYFGGDEK    
Sbjct  145  VYGLPEDRLYVTYFGGDEKQGLE  167



>ref|XP_003870578.1| Ala1 alanyl-tRNA synthetase [Candida orthopsilosis Co 90-125]
 emb|CCG24449.1| Ala1 alanyl-tRNA synthetase [Candida orthopsilosis]
Length=968

 Score =   229 bits (584),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 120/145 (83%), Gaps = 1/145 (1%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFF-ESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +W + KVR TF+ FF + K HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP ++
Sbjct  21   KWTAPKVRSTFLDFFKDKKQHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASD  80

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
             +KLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI W+WELL
Sbjct  81   FAKLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIAWSWELL  140

Query  615  TEVYKLPAIRIYATYFGGDEKMAFH  689
            TEVY L   R+Y TYFGGD+K    
Sbjct  141  TEVYGLEKDRLYVTYFGGDDKQGLE  165



>gb|EIF48501.1| cytoplasmic alanyl-trna synthetase [Brettanomyces bruxellensis 
AWRI1499]
Length=993

 Score =   229 bits (584),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            WP+SKVRDTF+ FF+ + HT V SS V+P +DPTLLFANAGMNQ+KPIFLGT+DP++ L+
Sbjct  44   WPASKVRDTFLNFFKERGHTFVPSSSVIPHDDPTLLFANAGMNQYKPIFLGTIDPSSPLA  103

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
             +KRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK  A+ ++WELLT+
Sbjct  104  HIKRATNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKEGAVGFSWELLTK  163

Query  621  VYKLPAIRIYATYFGGDEKMAFH  689
            VYKL   R+Y TYFGGD+K    
Sbjct  164  VYKLDPSRLYVTYFGGDKKAGLQ  186



>ref|XP_007317881.1| hypothetical protein SERLADRAFT_361256 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO00200.1| hypothetical protein SERLA73DRAFT_107224 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO25759.1| hypothetical protein SERLADRAFT_361256 [Serpula lacrymans var. 
lacrymans S7.9]
Length=956

 Score =   229 bits (583),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            W + KVRD F  +F SK HT V SS  +P  DPTLLFANAGMNQ+K IFLGTVDPN++++
Sbjct  9    WTAHKVRDEFFNYFRSKGHTFVPSSATIPYEDPTLLFANAGMNQYKSIFLGTVDPNSDMA  68

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
            KLKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI+++WELLTE
Sbjct  69   KLKRAFNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIEYSWELLTE  128

Query  621  VYKLPAIRIYATYFGGDEKMAFH  689
            VY LP  R+Y TYF GD K    
Sbjct  129  VYGLPKDRLYVTYFEGDSKNGLQ  151



>ref|XP_718082.1| hypothetical protein CaO19.5746 [Candida albicans SC5314]
 ref|XP_718016.1| hypothetical protein CaO19.13169 [Candida albicans SC5314]
 sp|Q5A8K2.1|SYA_CANAL RecName: Full=Alanine--tRNA ligase; AltName: Full=Alanyl-tRNA 
synthetase; Short=AlaRS; Flags: Precursor [Candida albicans 
SC5314]
 gb|EAK99075.1| hypothetical protein CaO19.13169 [Candida albicans SC5314]
 gb|EAK99149.1| hypothetical protein CaO19.5746 [Candida albicans SC5314]
 gb|KGQ86242.1| alanyl-tRNA synthetase [Candida albicans P37005]
 gb|KGR06506.1| alanyl-tRNA synthetase [Candida albicans P78048]
 gb|KGR09932.1| alanyl-tRNA synthetase [Candida albicans P37037]
 gb|KGT65856.1| alanyl-tRNA synthetase [Candida albicans 12C]
 gb|KGU05658.1| alanyl-tRNA synthetase [Candida albicans 19F]
 gb|KGU06133.1| alanyl-tRNA synthetase [Candida albicans L26]
 gb|KHC47879.1| alanyl-tRNA synthetase [Candida albicans P60002]
 gb|KHC50537.1| alanyl-tRNA synthetase [Candida albicans P37039]
 gb|KHC73506.1| alanyl-tRNA synthetase [Candida albicans SC5314]
 gb|KHC82774.1| alanyl-tRNA synthetase [Candida albicans SC5314]
Length=969

 Score =   229 bits (584),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            W +SKVR TF+ +F+ + HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP ++ +
Sbjct  24   WTASKVRSTFLDYFKKQQHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASDFA  83

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI ++WELLT+
Sbjct  84   SLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIDYSWELLTK  143

Query  621  VYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            VY L   R+Y TYFGGDEK      ++ +N 
Sbjct  144  VYGLQEDRLYVTYFGGDEKQGLEPDLEAKNF  174



>gb|KHC63511.1| alanyl-tRNA synthetase [Candida albicans P75016]
Length=969

 Score =   229 bits (583),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            W +SKVR TF+ +F+ + HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP ++ +
Sbjct  24   WTASKVRSTFLDYFKKQQHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASDFA  83

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI ++WELLT+
Sbjct  84   SLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIDYSWELLTK  143

Query  621  VYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            VY L   R+Y TYFGGDEK      ++ +N 
Sbjct  144  VYGLQEDRLYVTYFGGDEKQGLEPDLEAKNF  174



>gb|KGQ88605.1| alanyl-tRNA synthetase [Candida albicans GC75]
Length=969

 Score =   229 bits (583),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            W +SKVR TF+ +F+ + HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP ++ +
Sbjct  24   WTASKVRSTFLDYFKKQQHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASDFA  83

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI ++WELLT+
Sbjct  84   SLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIDYSWELLTK  143

Query  621  VYKLPAIRIYATYFGGDEKMAFHLIMKLEN  710
            VY L   R+Y TYFGGDEK      ++ +N
Sbjct  144  VYGLQEDRLYVTYFGGDEKQGLEPDLEAKN  173



>ref|XP_002421135.1| alanyl-tRNA synthetase, putative [Candida dubliniensis CD36]
 emb|CAX41294.1| alanyl-tRNA synthetase, putative [Candida dubliniensis CD36]
Length=969

 Score =   229 bits (583),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            W +SKVR TF+ +F+ + HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP ++ +
Sbjct  24   WTASKVRSTFLDYFKQQQHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASDFA  83

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI ++WELLT+
Sbjct  84   SLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIDYSWELLTK  143

Query  621  VYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            VY L   R+Y TYFGGDEK      ++ +N 
Sbjct  144  VYGLKEDRLYVTYFGGDEKQGLEPDLEAKNF  174



>gb|KGR08732.1| alanyl-tRNA synthetase [Candida albicans P57072]
 gb|KHC31556.1| alanyl-tRNA synthetase [Candida albicans P76067]
Length=969

 Score =   229 bits (583),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            W +SKVR TF+ +F+ + HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP ++ +
Sbjct  24   WTASKVRSTFLDYFKKQQHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASDFA  83

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI ++WELLT+
Sbjct  84   SLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIDYSWELLTK  143

Query  621  VYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            VY L   R+Y TYFGGDEK      ++ +N 
Sbjct  144  VYGLQEDRLYVTYFGGDEKQGLEPDLEAKNF  174



>gb|EEQ46641.1| alanyl-tRNA synthetase [Candida albicans WO-1]
 gb|KGU21757.1| alanyl-tRNA synthetase [Candida albicans P34048]
 gb|KGU24863.1| alanyl-tRNA synthetase [Candida albicans P57055]
 gb|KHC31357.1| alanyl-tRNA synthetase [Candida albicans P76055]
 gb|KHC58491.1| alanyl-tRNA synthetase [Candida albicans P75010]
 gb|KHC70962.1| alanyl-tRNA synthetase [Candida albicans P78042]
Length=969

 Score =   229 bits (583),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            W +SKVR TF+ +F+ + HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP ++ +
Sbjct  24   WTASKVRSTFLDYFKKQQHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASDFA  83

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI ++WELLT+
Sbjct  84   SLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIDYSWELLTK  143

Query  621  VYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            VY L   R+Y TYFGGDEK      ++ +N 
Sbjct  144  VYGLQEDRLYVTYFGGDEKQGLEPDLEAKNF  174



>ref|XP_002173036.1| cytoplasmic alanine-tRNA ligase Ala1 [Schizosaccharomyces japonicus 
yFS275]
 gb|EEB06743.1| cytoplasmic alanine-tRNA ligase Ala1 [Schizosaccharomyces japonicus 
yFS275]
Length=961

 Score =   229 bits (583),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 124/153 (81%), Gaps = 0/153 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            LEWP++KVR TFI +F+   HT V SS V+P  DPTLLFANAGMNQ+KPIFLGTVDP++ 
Sbjct  7    LEWPANKVRSTFIDYFKEHGHTFVPSSSVIPFEDPTLLFANAGMNQYKPIFLGTVDPSSS  66

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
             +KLKRAC++QKCIRAGGKHNDL+DVGKD YHHT FEMLGNWSFGDYFK EAI  AW+LL
Sbjct  67   FAKLKRACNSQKCIRAGGKHNDLEDVGKDNYHHTMFEMLGNWSFGDYFKKEAIPLAWKLL  126

Query  615  TEVYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            TEV+KL   ++Y TYFGG E+      ++ +N+
Sbjct  127  TEVFKLNPDQLYVTYFGGHEESGLGPDLEAKNI  159



>dbj|GAC93028.1| alanyl-tRNA synthetase [Pseudozyma hubeiensis SY62]
Length=1296

 Score =   231 bits (589),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +WP++KVRDTF  +F+ +AHT V SS  +P +DPTLLFANAGMNQ+KPIFLG  DPN+  
Sbjct  327  DWPATKVRDTFTGYFKERAHTFVPSSSTIPYDDPTLLFANAGMNQYKPIFLGIADPNSSF  386

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              +KRA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+ AWELLT
Sbjct  387  GSMKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEMAWELLT  446

Query  618  EVYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            +VY LP  R+Y TYF GD K      ++  +L
Sbjct  447  KVYGLPKDRLYVTYFEGDAKQGLEPDLEARDL  478



>gb|KGU04317.1| alanyl-tRNA synthetase [Candida albicans P87]
 gb|KGU25257.1| alanyl-tRNA synthetase [Candida albicans P75063]
Length=969

 Score =   229 bits (583),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            W +SKVR TF+ +F+ + HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP ++ +
Sbjct  24   WTASKVRSTFLDYFKKQQHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASDFA  83

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI ++WELLT+
Sbjct  84   SLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIDYSWELLTK  143

Query  621  VYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            VY L   R+Y TYFGGDEK      ++ +N 
Sbjct  144  VYGLQEDRLYVTYFGGDEKQGLEPDLEAKNF  174



>gb|KGQ84359.1| alanyl-tRNA synthetase [Candida albicans P94015]
Length=969

 Score =   229 bits (583),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            W +SKVR TF+ +F+ + HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP ++ +
Sbjct  24   WTASKVRSTFLDYFKKQQHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASDFA  83

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI ++WELLT+
Sbjct  84   SLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIDYSWELLTK  143

Query  621  VYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            VY L   R+Y TYFGGDEK      ++ +N 
Sbjct  144  VYGLQEDRLYVTYFGGDEKQGLEPDLEAKNF  174



>ref|XP_001248510.1| alanyl-tRNA synthetase, cytoplasmic [Coccidioides immitis RS]
 gb|EAS36927.3| alanine-tRNA ligase [Coccidioides immitis RS]
Length=1023

 Score =   229 bits (584),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP+ KVRDTF+ FF+   HT V SS VVP++DPTLLFANAGMNQ+K IFLGTVDPN++
Sbjct  72   VEWPAIKVRDTFLDFFKKNGHTFVPSSSVVPLSDPTLLFANAGMNQYKSIFLGTVDPNSD  131

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
             ++LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI+++WELL
Sbjct  132  FAQLKRAHNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIEYSWELL  191

Query  615  TEVYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            T+VY L   R+Y TYF G++       ++ ++L
Sbjct  192  TKVYGLEPDRLYVTYFEGNKDAGIEPDLETKDL  224



>gb|KHC33201.1| alanyl-tRNA synthetase [Candida albicans Ca6]
Length=969

 Score =   229 bits (583),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 123/151 (81%), Gaps = 0/151 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            W +SKVR TF+ +F+ + HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP ++ +
Sbjct  24   WTASKVRSTFLDYFKKQQHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASDFA  83

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI ++WELLT+
Sbjct  84   SLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIDYSWELLTK  143

Query  621  VYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            VY L   R+Y TYFGGDEK      ++ +N 
Sbjct  144  VYGLQEDRLYVTYFGGDEKQGLEPDLEAKNF  174



>ref|XP_003070819.1| Alanyl-tRNA synthetase, cytoplasmic , putative [Coccidioides 
posadasii C735 delta SOWgp]
 gb|EER28674.1| Alanyl-tRNA synthetase, cytoplasmic , putative [Coccidioides 
posadasii C735 delta SOWgp]
Length=1023

 Score =   229 bits (584),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP+ KVRDTF+ FF+   HT V SS VVP++DPTLLFANAGMNQ+K IFLGTVDPN++
Sbjct  72   VEWPAIKVRDTFLDFFKKNGHTFVPSSSVVPLSDPTLLFANAGMNQYKSIFLGTVDPNSD  131

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
             ++LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAI+++WELL
Sbjct  132  FAQLKRAHNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIEYSWELL  191

Query  615  TEVYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            T+VY L   R+Y TYF G++       ++ ++L
Sbjct  192  TKVYGLEPDRLYVTYFEGNKDAGIEPDLETKDL  224



>ref|XP_003053770.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEU48057.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=956

 Score =   229 bits (583),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 124/153 (81%), Gaps = 0/153 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            L+WP+++VR TF+++FE + HT V SS VVP NDPTLLF NAGMNQFKPIFLGT+     
Sbjct  6    LKWPAARVRQTFLEYFEQRGHTIVPSSSVVPHNDPTLLFTNAGMNQFKPIFLGTIGKTDP  65

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
            ++ LK A D+QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EA+Q++WELL
Sbjct  66   MAGLKAAVDSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAVQYSWELL  125

Query  615  TEVYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
            T+VY L   R+Y TYF GDEK+     ++ ++L
Sbjct  126  TKVYGLDPARLYVTYFEGDEKLKLEPDLEAKDL  158



>ref|XP_002552804.1| KLTH0D01848p [Lachancea thermotolerans]
 emb|CAR22366.1| KLTH0D01848p [Lachancea thermotolerans CBS 6340]
Length=955

 Score =   228 bits (582),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W +S VR TF++FF+ + HT V SSPV+P +DPTLLFANAGMNQ+KPIFLGTVDP+++ 
Sbjct  8    KWTASNVRSTFMEFFKQREHTFVASSPVIPYDDPTLLFANAGMNQYKPIFLGTVDPSSDY  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK +AIQ++WELLT
Sbjct  68   YSLKRAMNSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKDAIQYSWELLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            +VY +P+ R+Y TYF GD+K    
Sbjct  128  KVYGIPSERLYVTYFEGDQKQGLE  151



>gb|KFG64908.1| cytosolic tRNA-Ala synthetase [Toxoplasma gondii RUB]
Length=417

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 114/140 (81%), Gaps = 0/140 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            W    VR  +++FFE++ H    SSPV+P  D TLLF NAGMNQFKPIFLG +D ++ LS
Sbjct  24   WSGEAVRGAYLEFFEAQGHLIYPSSPVIPRGDNTLLFINAGMNQFKPIFLGQIDRSSPLS  83

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
            KL+R  DTQKCIRAGGKHNDL+DVGKD YHHTFFEMLGNWSFGDYFK EAI WAW+LLTE
Sbjct  84   KLRRVADTQKCIRAGGKHNDLEDVGKDVYHHTFFEMLGNWSFGDYFKREAIAWAWQLLTE  143

Query  621  VYKLPAIRIYATYFGGDEKM  680
            VYK+P  R+YA+YFGGD ++
Sbjct  144  VYKIPKDRLYASYFGGDPRL  163



>emb|CDO74931.1| hypothetical protein BN946_scf184945.g3 [Trametes cinnabarina]
Length=956

 Score =   228 bits (582),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            WP++KVR+ F  +F+SK HT V SS  +P  DPTLLFANAGMNQFK IFLGTVDP +EL+
Sbjct  7    WPAAKVREEFFNYFKSKDHTYVPSSSTIPYEDPTLLFANAGMNQFKSIFLGTVDPQSELA  66

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
            +LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++WELLTE
Sbjct  67   RLKRAFNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAIVYSWELLTE  126

Query  621  VYKLPAIRIYATYFGGDEKMAFH  689
            VYKLP  ++Y TYF GD K    
Sbjct  127  VYKLPKEQLYVTYFEGDPKAGLE  149



>gb|EGD95966.1| alanyl-tRNA synthetase [Trichophyton tonsurans CBS 112818]
Length=963

 Score =   228 bits (582),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP+ +VRDTF+ +F+   HT V SS VVP++DPTLLFANAGMNQ+K IFLGTVDPN++
Sbjct  16   VEWPALRVRDTFLDYFKKNGHTFVPSSSVVPLSDPTLLFANAGMNQYKSIFLGTVDPNSD  75

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
             ++LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAIQ++WELL
Sbjct  76   FAQLKRAHNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIQFSWELL  135

Query  615  TEVYKLPAIRIYATYFGGDE  674
            T+VY L   R+Y TYF G+E
Sbjct  136  TKVYGLDPDRLYVTYFEGNE  155



>gb|EXX57273.1| alanine--tRNA ligase [Rhizophagus irregularis DAOM 197198w]
Length=768

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = +3

Query  249  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  428
            + + WP+SKVR TFI +FESK H  + SS  +P  DPTLLFAN+GM QFK IFL TVDP+
Sbjct  8    SNINWPASKVRSTFISYFESKGHKYIPSSSTIPFEDPTLLFANSGMAQFKSIFLATVDPS  67

Query  429  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWE  608
            ++  KLKRA ++QKCIRAGGKHNDL+DVGKD YHHTFFEMLGNWSFGDYFK EAI  AWE
Sbjct  68   SDFGKLKRATNSQKCIRAGGKHNDLEDVGKDVYHHTFFEMLGNWSFGDYFKKEAIIMAWE  127

Query  609  LLTEVYKLPAIRIYATYFGGDEKMAF  686
            LLTEVY LP  R+Y TYF GDEK+  
Sbjct  128  LLTEVYGLPKERLYVTYFEGDEKLGL  153



>gb|EGE01186.1| alanyl-tRNA synthetase [Trichophyton equinum CBS 127.97]
Length=963

 Score =   228 bits (582),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP+ +VRDTF+ +F+   HT V SS VVP++DPTLLFANAGMNQ+K IFLGTVDPN++
Sbjct  16   VEWPALRVRDTFLDYFKKNGHTFVPSSSVVPLSDPTLLFANAGMNQYKSIFLGTVDPNSD  75

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
             ++LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAIQ++WELL
Sbjct  76   FAQLKRAHNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIQFSWELL  135

Query  615  TEVYKLPAIRIYATYFGGDE  674
            T+VY L   R+Y TYF G+E
Sbjct  136  TKVYGLDPDRLYVTYFEGNE  155



>gb|EZF33517.1| alanyl-tRNA synthetase [Trichophyton interdigitale H6]
 gb|KDB23468.1| alanyl-tRNA synthetase [Trichophyton interdigitale MR816]
Length=963

 Score =   228 bits (582),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP+ +VRDTF+ +F+   HT V SS VVP++DPTLLFANAGMNQ+K IFLGTVDPN++
Sbjct  16   VEWPALRVRDTFLDYFKKNGHTFVPSSSVVPLSDPTLLFANAGMNQYKSIFLGTVDPNSD  75

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
             ++LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAIQ++WELL
Sbjct  76   FAQLKRAHNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIQFSWELL  135

Query  615  TEVYKLPAIRIYATYFGGDE  674
            T+VY L   R+Y TYF G+E
Sbjct  136  TKVYGLDPDRLYVTYFEGNE  155



>gb|ERZ95099.1| hypothetical protein GLOINDRAFT_341419 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX57272.1| alanine--tRNA ligase [Rhizophagus irregularis DAOM 197198w]
Length=961

 Score =   228 bits (582),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = +3

Query  249  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  428
            + + WP+SKVR TFI +FESK H  + SS  +P  DPTLLFAN+GM QFK IFL TVDP+
Sbjct  8    SNINWPASKVRSTFISYFESKGHKYIPSSSTIPFEDPTLLFANSGMAQFKSIFLATVDPS  67

Query  429  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWE  608
            ++  KLKRA ++QKCIRAGGKHNDL+DVGKD YHHTFFEMLGNWSFGDYFK EAI  AWE
Sbjct  68   SDFGKLKRATNSQKCIRAGGKHNDLEDVGKDVYHHTFFEMLGNWSFGDYFKKEAIIMAWE  127

Query  609  LLTEVYKLPAIRIYATYFGGDEKMAF  686
            LLTEVY LP  R+Y TYF GDEK+  
Sbjct  128  LLTEVYGLPKERLYVTYFEGDEKLGL  153



>gb|AJU04002.1| Ala1p [Saccharomyces cerevisiae YJM1402]
 gb|AJU07913.1| Ala1p [Saccharomyces cerevisiae YJM1443]
 gb|AJU13767.1| Ala1p [Saccharomyces cerevisiae YJM1573]
Length=958

 Score =   228 bits (582),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++W LLT
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWTLLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVY +P  R+Y TYF GDEK+   
Sbjct  128  EVYGIPKDRLYVTYFEGDEKLGLE  151



>gb|AJU00572.1| Ala1p [Saccharomyces cerevisiae YJM1386]
Length=958

 Score =   228 bits (582),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++W LLT
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWTLLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVY +P  R+Y TYF GDEK+   
Sbjct  128  EVYGIPKDRLYVTYFEGDEKLGLE  151



>gb|EGA60508.1| Ala1p [Saccharomyces cerevisiae FostersO]
Length=833

 Score =   228 bits (580),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++W LLT
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWTLLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVY +P  R+Y TYF GDEK+   
Sbjct  128  EVYGIPKDRLYVTYFEGDEKLGLE  151



>sp|P40825.3|SYA_YEAST RecName: Full=Alanine--tRNA ligase, mitochondrial; AltName: Full=Alanyl-tRNA 
synthetase; Short=AlaRS; Flags: Precursor [Saccharomyces 
cerevisiae S288c]
Length=983

 Score =   228 bits (582),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  33   KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  92

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++W LLT
Sbjct  93   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWTLLT  152

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVY +P  R+Y TYF GDEK+   
Sbjct  153  EVYGIPKDRLYVTYFEGDEKLGLE  176



>gb|AJT75159.1| Ala1p [Saccharomyces cerevisiae YJM326]
 gb|AJT77621.1| Ala1p [Saccharomyces cerevisiae YJM456]
 gb|AJT81049.1| Ala1p [Saccharomyces cerevisiae YJM682]
 gb|AJT82028.1| Ala1p [Saccharomyces cerevisiae YJM689]
Length=958

 Score =   228 bits (581),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++W LLT
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWTLLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVY +P  R+Y TYF GDEK+   
Sbjct  128  EVYGIPKDRLYVTYFEGDEKLGLE  151



>ref|NP_593640.1| mitochondrial and cytoplasmic alanine-tRNA ligase Ala1 (predicted) 
[Schizosaccharomyces pombe 972h-]
 sp|O13914.1|SYA_SCHPO RecName: Full=Alanine--tRNA ligase; AltName: Full=Alanyl-tRNA 
synthetase; Short=AlaRS [Schizosaccharomyces pombe 972h-]
 emb|CAB11162.1| mitochondrial and cytoplasmic alanine-tRNA ligase Ala1 (predicted) 
[Schizosaccharomyces pombe]
Length=959

 Score =   228 bits (581),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            + WP++++R TF+K+FE   HT V SS V+P +DPTLLFANAGMNQFKPIFLGTVDP+++
Sbjct  8    VNWPANEIRRTFLKYFEDHGHTIVPSSSVIPYDDPTLLFANAGMNQFKPIFLGTVDPSSD  67

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
             +KLKRACD+QKCIRAGGKHNDL+DVGKD YHHT FEMLGNWSFGDYFK EAI  AW+LL
Sbjct  68   FAKLKRACDSQKCIRAGGKHNDLEDVGKDNYHHTMFEMLGNWSFGDYFKKEAIAMAWDLL  127

Query  615  TEVYKLPAIRIYATYFGGDEKMAFH  689
            T VY L   ++Y TYFGG E+    
Sbjct  128  TNVYGLKKDQLYVTYFGGHEESGLE  152



>emb|CCF49697.1| probable ALA1-alanyl-tRNA synthetase, cytosolic [Ustilago hordei]
Length=985

 Score =   228 bits (582),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +WP++KVRDTF  +F+ +AHT V SS  +P +DP+LLFANAGMNQ+KPIFL   DPN+  
Sbjct  16   DWPATKVRDTFTGYFQKRAHTFVPSSSTIPYDDPSLLFANAGMNQYKPIFLSIADPNSSF  75

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              +KRA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+ AWELLT
Sbjct  76   GSMKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEMAWELLT  135

Query  618  EVYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
             VY+LP  R+Y TYF GD K      ++  +L
Sbjct  136  VVYRLPKDRLYVTYFEGDAKQGLEPDLEARDL  167



>gb|AJT94197.1| Ala1p [Saccharomyces cerevisiae YJM1307]
Length=958

 Score =   228 bits (581),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++W LLT
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWTLLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVY +P  R+Y TYF GDEK+   
Sbjct  128  EVYGIPKDRLYVTYFEGDEKLGLE  151



>gb|EWH16115.1| Ala1p [Saccharomyces cerevisiae P283]
Length=961

 Score =   228 bits (581),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++W LLT
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWTLLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVY +P  R+Y TYF GDEK+   
Sbjct  128  EVYGIPKDRLYVTYFEGDEKLGLE  151



>ref|XP_005849315.1| hypothetical protein CHLNCDRAFT_143654 [Chlorella variabilis]
 gb|EFN57213.1| hypothetical protein CHLNCDRAFT_143654 [Chlorella variabilis]
Length=524

 Score =   222 bits (566),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 108/122 (89%), Gaps = 2/122 (2%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            LEWP ++VR TF++FF  K HT V SSPVVPVNDPTLL  NAGMNQFKPIFLGTVDPN++
Sbjct  11   LEWPVARVRSTFVEFFVGKQHTAVSSSPVVPVNDPTLL--NAGMNQFKPIFLGTVDPNSD  68

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
             +KLKRA ++QKCIRAGGKHNDLDDVGKD YHHTFFEMLGNWSFGDYFK EAI WAWELL
Sbjct  69   FAKLKRAANSQKCIRAGGKHNDLDDVGKDNYHHTFFEMLGNWSFGDYFKKEAISWAWELL  128

Query  615  TE  620
            TE
Sbjct  129  TE  130



>gb|EGA56826.1| Ala1p [Saccharomyces cerevisiae FostersB]
Length=810

 Score =   227 bits (579),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++W LLT
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWTLLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVY +P  R+Y TYF GDEK+   
Sbjct  128  EVYGIPKDRLYVTYFEGDEKLGLE  151



>gb|AJT78594.1| Ala1p [Saccharomyces cerevisiae YJM541]
 gb|AJT79090.1| Ala1p [Saccharomyces cerevisiae YJM554]
 gb|AJT89396.1| Ala1p [Saccharomyces cerevisiae YJM1199]
 gb|AJT89876.1| Ala1p [Saccharomyces cerevisiae YJM1202]
Length=958

 Score =   228 bits (581),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++W LLT
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWTLLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVY +P  R+Y TYF GDEK+   
Sbjct  128  EVYGIPKDRLYVTYFEGDEKLGLE  151



>emb|CDJ43006.1| alanyl-tRNA synthetase, putative [Eimeria tenella]
Length=1016

 Score =   228 bits (582),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = +3

Query  249  AGLEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPN  428
            +G  WPS+ VR+ +I FFE   H    SSPVVP  D TLLF NAGMNQFKPIFLG VD N
Sbjct  26   SGKGWPSADVRELYISFFEHVKHKRYPSSPVVPHGDNTLLFINAGMNQFKPIFLGQVDKN  85

Query  429  TELSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWE  608
            + L KL+R  DTQKCIRAGGKHNDL+DVGKD YHHTFFEMLGNWSFGDYFK EAI+WAW+
Sbjct  86   SPLGKLRRVVDTQKCIRAGGKHNDLEDVGKDEYHHTFFEMLGNWSFGDYFKEEAIEWAWK  145

Query  609  LLTEVYKLPAIRIYATYFGGDEK  677
            LLTEVY+LP  R+YATYFGGD K
Sbjct  146  LLTEVYRLPKDRLYATYFGGDSK  168



>gb|AJT76134.1| Ala1p [Saccharomyces cerevisiae YJM450]
Length=958

 Score =   228 bits (581),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++W LLT
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWTLLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVY +P  R+Y TYF GDEK+   
Sbjct  128  EVYGIPKDRLYVTYFEGDEKLGLE  151



>gb|AJT97628.1| Ala1p [Saccharomyces cerevisiae YJM1342]
Length=958

 Score =   228 bits (581),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++W LLT
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWTLLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVY +P  R+Y TYF GDEK+   
Sbjct  128  EVYGIPKDRLYVTYFEGDEKLGLE  151



>dbj|GAA26640.1| K7_Ala1p [Saccharomyces cerevisiae Kyokai no. 7]
 gb|AJU01548.1| Ala1p [Saccharomyces cerevisiae YJM1388]
 gb|AJU02031.1| Ala1p [Saccharomyces cerevisiae YJM1389]
 gb|AJU09847.1| Ala1p [Saccharomyces cerevisiae YJM1460]
 gb|AJU14748.1| Ala1p [Saccharomyces cerevisiae YJM1592]
Length=958

 Score =   228 bits (581),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++W LLT
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWTLLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVY +P  R+Y TYF GDEK+   
Sbjct  128  EVYGIPKDRLYVTYFEGDEKLGLE  151



>gb|AJU01059.1| Ala1p [Saccharomyces cerevisiae YJM1387]
Length=958

 Score =   228 bits (581),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++W LLT
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWTLLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVY +P  R+Y TYF GDEK+   
Sbjct  128  EVYGIPKDRLYVTYFEGDEKLGLE  151



>gb|AJT87923.1| Ala1p [Saccharomyces cerevisiae YJM1129]
Length=958

 Score =   228 bits (581),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++W LLT
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWTLLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVY +P  R+Y TYF GDEK+   
Sbjct  128  EVYGIPKDRLYVTYFEGDEKLGLE  151



>gb|AJT73685.1| Ala1p [Saccharomyces cerevisiae YJM270]
Length=958

 Score =   228 bits (581),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++W LLT
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWTLLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVY +P  R+Y TYF GDEK+   
Sbjct  128  EVYGIPKDRLYVTYFEGDEKLGLE  151



>gb|AJT72237.1| Ala1p [Saccharomyces cerevisiae YJM195]
 gb|AJT80071.1| Ala1p [Saccharomyces cerevisiae YJM627]
 gb|AJT91839.1| Ala1p [Saccharomyces cerevisiae YJM1248]
 gb|AJU05942.1| Ala1p [Saccharomyces cerevisiae YJM1419]
 gb|AJU07425.1| Ala1p [Saccharomyces cerevisiae YJM1439]
Length=958

 Score =   228 bits (581),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++W LLT
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWTLLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVY +P  R+Y TYF GDEK+   
Sbjct  128  EVYGIPKDRLYVTYFEGDEKLGLE  151



>gb|AJP41837.1| Ala1p [Saccharomyces cerevisiae YJM1078]
 gb|AJT73206.1| Ala1p [Saccharomyces cerevisiae YJM248]
 gb|AJT92736.1| Ala1p [Saccharomyces cerevisiae YJM1252]
Length=958

 Score =   228 bits (581),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++W LLT
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWTLLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVY +P  R+Y TYF GDEK+   
Sbjct  128  EVYGIPKDRLYVTYFEGDEKLGLE  151



>ref|NP_014980.3| alanine--tRNA ligase [Saccharomyces cerevisiae S288c]
 emb|CAA89980.1| ALA1 [Saccharomyces cerevisiae]
 emb|CAA99658.1| ALA1 [Saccharomyces cerevisiae]
 tpg|DAA11096.1| TPA: alanine--tRNA ligase [Saccharomyces cerevisiae S288c]
 gb|EIW07764.1| Ala1p [Saccharomyces cerevisiae CEN.PK113-7D]
Length=958

 Score =   228 bits (581),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++W LLT
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWTLLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVY +P  R+Y TYF GDEK+   
Sbjct  128  EVYGIPKDRLYVTYFEGDEKLGLE  151



>gb|AJT74669.1| Ala1p [Saccharomyces cerevisiae YJM320]
 gb|AJT75646.1| Ala1p [Saccharomyces cerevisiae YJM428]
 gb|AJT90381.1| Ala1p [Saccharomyces cerevisiae YJM1208]
 gb|AJT99595.1| Ala1p [Saccharomyces cerevisiae YJM1383]
 gb|AJU15253.1| Ala1p [Saccharomyces cerevisiae YJM1615]
Length=958

 Score =   228 bits (581),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++W LLT
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWTLLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVY +P  R+Y TYF GDEK+   
Sbjct  128  EVYGIPKDRLYVTYFEGDEKLGLE  151



>ref|XP_005709097.1| alanyl-tRNA synthetase [Galdieria sulphuraria]
 gb|EME32577.1| alanyl-tRNA synthetase [Galdieria sulphuraria]
Length=961

 Score =   228 bits (581),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            W S +VR +FI FF  K H    SSPV+P  DPTLLF NAGMNQFKP+FLGTVDP + LS
Sbjct  2    WSSVQVRRSFIDFFVQKEHVFYPSSPVIPFEDPTLLFINAGMNQFKPVFLGTVDPTSPLS  61

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
            KLKRAC++QKCIRAGGKHNDL+DVGKDTYHHTFFEMLGNWSFGDYFK EAI WA ELLT+
Sbjct  62   KLKRACNSQKCIRAGGKHNDLEDVGKDTYHHTFFEMLGNWSFGDYFKEEAIAWAMELLTQ  121

Query  621  VYKLPAIRIYATYFGGDEK  677
            V+ LP  R+YATYFGG ++
Sbjct  122  VFGLPKERMYATYFGGSKE  140



>gb|EMG50125.1| Alanyl-tRNA synthetase, putative, partial [Candida maltosa Xu316]
Length=933

 Score =   228 bits (580),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            W +SKVR TF+ FF+ K HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP ++ +
Sbjct  12   WTASKVRSTFLDFFKQKQHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASDFA  71

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
             LKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI ++WELLT+
Sbjct  72   TLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIDYSWELLTK  131

Query  621  VYKLPAIRIYATYFGGDEKMAFH  689
            VY L   R+Y TYFGGDE     
Sbjct  132  VYGLQEDRLYVTYFGGDEAQGLE  154



>gb|EDV10897.1| alanyl-tRNA synthetase [Saccharomyces cerevisiae RM11-1a]
 gb|EDZ69081.1| YOR335Cp-like protein [Saccharomyces cerevisiae AWRI1631]
 emb|CAY86616.1| Ala1p [Saccharomyces cerevisiae EC1118]
 gb|EGA84760.1| Ala1p [Saccharomyces cerevisiae VL3]
 gb|EWG83396.1| Ala1p [Saccharomyces cerevisiae R008]
 gb|EWG93270.1| Ala1p [Saccharomyces cerevisiae R103]
 gb|AHY77607.1| Ala1p [Saccharomyces cerevisiae YJM993]
 gb|AJT71260.1| Ala1p [Saccharomyces cerevisiae YJM189]
 gb|AJT71748.1| Ala1p [Saccharomyces cerevisiae YJM193]
 gb|AJT72714.1| Ala1p [Saccharomyces cerevisiae YJM244]
 gb|AJT74178.1| Ala1p [Saccharomyces cerevisiae YJM271]
 gb|AJT76634.1| Ala1p [Saccharomyces cerevisiae YJM451]
 gb|AJT77131.1| Ala1p [Saccharomyces cerevisiae YJM453]
 gb|AJT78104.1| Ala1p [Saccharomyces cerevisiae YJM470]
 gb|AJT81543.1| Ala1p [Saccharomyces cerevisiae YJM683]
 gb|AJT82522.1| Ala1p [Saccharomyces cerevisiae YJM693]
 gb|AJT83016.1| Ala1p [Saccharomyces cerevisiae YJM969]
 gb|AJT83513.1| Ala1p [Saccharomyces cerevisiae YJM972]
 gb|AJT83998.1| Ala1p [Saccharomyces cerevisiae YJM975]
 gb|AJT84491.1| Ala1p [Saccharomyces cerevisiae YJM978]
 gb|AJT84983.1| Ala1p [Saccharomyces cerevisiae YJM981]
 gb|AJT85478.1| Ala1p [Saccharomyces cerevisiae YJM984]
 gb|AJT85967.1| Ala1p [Saccharomyces cerevisiae YJM987]
 gb|AJT86461.1| Ala1p [Saccharomyces cerevisiae YJM990]
 gb|AJT86956.1| Ala1p [Saccharomyces cerevisiae YJM996]
 gb|AJT87429.1| Ala1p [Saccharomyces cerevisiae YJM1083]
 gb|AJT88408.1| Ala1p [Saccharomyces cerevisiae YJM1133]
 gb|AJT88902.1| Ala1p [Saccharomyces cerevisiae YJM1190]
 gb|AJT90868.1| Ala1p [Saccharomyces cerevisiae YJM1242]
 gb|AJT91348.1| Ala1p [Saccharomyces cerevisiae YJM1244]
 gb|AJT93229.1| Ala1p [Saccharomyces cerevisiae YJM1273]
 gb|AJT93707.1| Ala1p [Saccharomyces cerevisiae YJM1304]
 gb|AJT95166.1| Ala1p [Saccharomyces cerevisiae YJM1326]
 gb|AJT95656.1| Ala1p [Saccharomyces cerevisiae YJM1332]
 gb|AJT96150.1| Ala1p [Saccharomyces cerevisiae YJM1336]
 gb|AJT96638.1| Ala1p [Saccharomyces cerevisiae YJM1338]
 gb|AJT97132.1| Ala1p [Saccharomyces cerevisiae YJM1341]
 gb|AJT98124.1| Ala1p [Saccharomyces cerevisiae YJM1355]
 gb|AJT98615.1| Ala1p [Saccharomyces cerevisiae YJM1356]
 gb|AJT99105.1| Ala1p [Saccharomyces cerevisiae YJM1381]
 gb|AJU02520.1| Ala1p [Saccharomyces cerevisiae YJM1399]
 gb|AJU03011.1| Ala1p [Saccharomyces cerevisiae YJM1400]
 gb|AJU03503.1| Ala1p [Saccharomyces cerevisiae YJM1401]
 gb|AJU04491.1| Ala1p [Saccharomyces cerevisiae YJM1415]
 gb|AJU04981.1| Ala1p [Saccharomyces cerevisiae YJM1417]
 gb|AJU05481.1| Ala1p [Saccharomyces cerevisiae YJM1418]
 gb|AJU06437.1| Ala1p [Saccharomyces cerevisiae YJM1433]
 gb|AJU06937.1| Ala1p [Saccharomyces cerevisiae YJM1434]
 gb|AJU09359.1| Ala1p [Saccharomyces cerevisiae YJM1450]
 gb|AJU10332.1| Ala1p [Saccharomyces cerevisiae YJM1463]
 gb|AJU10824.1| Ala1p [Saccharomyces cerevisiae YJM1477]
 gb|AJU11315.1| Ala1p [Saccharomyces cerevisiae YJM1478]
 gb|AJU11805.1| Ala1p [Saccharomyces cerevisiae YJM1479]
 gb|AJU12300.1| Ala1p [Saccharomyces cerevisiae YJM1526]
 gb|AJU12775.1| Ala1p [Saccharomyces cerevisiae YJM1527]
 gb|AJU13269.1| Ala1p [Saccharomyces cerevisiae YJM1549]
 gb|AJU14258.1| Ala1p [Saccharomyces cerevisiae YJM1574]
Length=958

 Score =   228 bits (581),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++W LLT
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWTLLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVY +P  R+Y TYF GDEK+   
Sbjct  128  EVYGIPKDRLYVTYFEGDEKLGLE  151



>gb|EEU07514.1| Ala1p [Saccharomyces cerevisiae JAY291]
 gb|AJT92241.1| Ala1p [Saccharomyces cerevisiae YJM1250]
Length=958

 Score =   228 bits (581),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++W LLT
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWTLLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVY +P  R+Y TYF GDEK+   
Sbjct  128  EVYGIPKDRLYVTYFEGDEKLGLE  151



>gb|EGA76661.1| Ala1p [Saccharomyces cerevisiae Vin13]
 gb|EGA80661.1| Ala1p [Saccharomyces cerevisiae Lalvin QA23]
 gb|EHN04519.1| Ala1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
Length=958

 Score =   228 bits (581),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++W LLT
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWTLLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVY +P  R+Y TYF GDEK+   
Sbjct  128  EVYGIPKDRLYVTYFEGDEKLGLE  151



>ref|XP_002843973.1| alanyl-tRNA synthetase [Arthroderma otae CBS 113480]
 gb|EEQ34937.1| alanyl-tRNA synthetase [Arthroderma otae CBS 113480]
Length=963

 Score =   228 bits (581),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP+ +VRDTF+ +F+   HT V SS VVP++DPTLLFANAGMNQ+K IFLGT+DPN++
Sbjct  16   VEWPALRVRDTFLDYFKKNGHTFVPSSSVVPLSDPTLLFANAGMNQYKSIFLGTIDPNSD  75

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
             ++LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAIQ++WELL
Sbjct  76   FAQLKRAHNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIQFSWELL  135

Query  615  TEVYKLPAIRIYATYFGGDE  674
            T+VY L   R+Y TYF G+E
Sbjct  136  TKVYGLDPERLYVTYFEGNE  155



>gb|AJU00089.1| Ala1p [Saccharomyces cerevisiae YJM1385]
Length=958

 Score =   228 bits (580),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTATNVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI ++W LLT
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAITYSWTLLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVY +P  R+Y TYF GDEK+   
Sbjct  128  EVYGIPKDRLYVTYFEGDEKLGLE  151



>ref|XP_003676658.1| hypothetical protein NCAS_0E02290 [Naumovozyma castellii CBS 
4309]
 emb|CCC70299.1| hypothetical protein NCAS_0E02290 [Naumovozyma castellii CBS 
4309]
Length=956

 Score =   228 bits (580),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 124/152 (82%), Gaps = 0/152 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W +  VR+TF+ +F+SK HT V SSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP+++ 
Sbjct  8    KWTAQNVRNTFLDYFKSKEHTFVPSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPSSDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKRA ++QKC+RAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EAI +AWELLT
Sbjct  68   YTLKRAYNSQKCVRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAIHYAWELLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
             VY +PA R+Y TYF GD K       + ++L
Sbjct  128  VVYGIPADRLYVTYFEGDAKQGLEPDSEAQDL  159



>gb|KFG38414.1| cytosolic tRNA-Ala synthetase, partial [Toxoplasma gondii p89]
Length=457

 Score =   220 bits (561),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 114/140 (81%), Gaps = 0/140 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            W    VR  +++FFE++ H    SSPV+P  D TLLF NAGMNQFKPIFLG +D ++ LS
Sbjct  267  WSGEAVRGAYLEFFEAQGHLIYPSSPVIPRGDNTLLFINAGMNQFKPIFLGQIDRSSPLS  326

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
            KL+R  DTQKCIRAGGKHNDL+DVGKD YHHTFFEMLGNWSFGDYFK EAI WAW+LLTE
Sbjct  327  KLRRVADTQKCIRAGGKHNDLEDVGKDVYHHTFFEMLGNWSFGDYFKREAIAWAWQLLTE  386

Query  621  VYKLPAIRIYATYFGGDEKM  680
            VYK+P  R+YA+YFGGD ++
Sbjct  387  VYKIPKDRLYASYFGGDPRL  406



>emb|CDJ65254.1| alanyl-tRNA synthetase, putative [Eimeria necatrix]
Length=1013

 Score =   228 bits (581),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = +3

Query  261  WPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTELS  440
            WPS+ VR+ +I FFE   H    SSPVVP  D TLLF NAGMNQFKPIFLG VD N+ L 
Sbjct  30   WPSADVRELYISFFEHVKHKRYASSPVVPHGDNTLLFINAGMNQFKPIFLGQVDKNSPLG  89

Query  441  KLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLTE  620
            KL+R  DTQKCIRAGGKHNDL+DVGKD YHHTFFEMLGNWSFGDYFK EAI+WAW+LLTE
Sbjct  90   KLRRVVDTQKCIRAGGKHNDLEDVGKDEYHHTFFEMLGNWSFGDYFKEEAIEWAWKLLTE  149

Query  621  VYKLPAIRIYATYFGGDEK  677
            VY+LP  R+YATYFGGD K
Sbjct  150  VYRLPKDRLYATYFGGDSK  168



>ref|XP_003172403.1| alanyl-tRNA synthetase [Microsporum gypseum CBS 118893]
 gb|EFR01992.1| alanyl-tRNA synthetase [Microsporum gypseum CBS 118893]
Length=970

 Score =   228 bits (580),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +3

Query  255  LEWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +EWP+ +VRDTF+ +F+   HT V SS VVP++DPTLLFANAGMNQ+K IFLGTVDPN++
Sbjct  16   VEWPALRVRDTFLDYFKKNGHTFVPSSSVVPLSDPTLLFANAGMNQYKSIFLGTVDPNSD  75

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
             ++LKRA ++QKCIRAGGKHNDLDDVGKD+YHHTFFEMLGNWSFGDYFK EAIQ++WELL
Sbjct  76   FAQLKRAHNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKEAIQFSWELL  135

Query  615  TEVYKLPAIRIYATYFGGDE  674
            T+VY L   R+Y TYF G+E
Sbjct  136  TKVYGLDPDRLYVTYFEGNE  155



>gb|EJT44225.1| ALA1-like protein [Saccharomyces kudriavzevii IFO 1802]
Length=958

 Score =   228 bits (580),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTAANVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EA+ ++W LLT
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKIEAVTYSWTLLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVY +P  R+Y TYF GDEK+   
Sbjct  128  EVYGIPKDRLYVTYFEGDEKLGLE  151



>gb|EHN00072.1| Ala1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
Length=958

 Score =   228 bits (580),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +W ++ VR+TF+ +F+SK H  VKSSPVVP +DPTLLFANAGMNQ+KPIFLGTVDP ++ 
Sbjct  8    KWTAANVRNTFLDYFKSKEHKFVKSSPVVPFDDPTLLFANAGMNQYKPIFLGTVDPASDF  67

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              LKRA ++QKCIRAGGKHNDL+DVGKD+YHHTFFEMLGNWSFGDYFK EA+ ++W LLT
Sbjct  68   YTLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKIEAVTYSWTLLT  127

Query  618  EVYKLPAIRIYATYFGGDEKMAFH  689
            EVY +P  R+Y TYF GDEK+   
Sbjct  128  EVYGIPKDRLYVTYFEGDEKLGLE  151



>emb|CCE39704.1| hypothetical protein CPAR2_601240 [Candida parapsilosis]
Length=961

 Score =   228 bits (580),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 120/145 (83%), Gaps = 1/145 (1%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESK-AHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTE  434
            +W + KVR TF+ +F+ K  HT V SS VVP NDPTLLFANAGMNQ+KPIFLGTVDP ++
Sbjct  12   KWTAPKVRSTFLDYFKDKRQHTYVPSSSVVPHNDPTLLFANAGMNQYKPIFLGTVDPASD  71

Query  435  LSKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELL  614
             +KLKRA ++QKCIRAGGKHNDL+DVG+D+YHHTFFEMLGNWSFGDYFK EAI W+WELL
Sbjct  72   FAKLKRAANSQKCIRAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIAWSWELL  131

Query  615  TEVYKLPAIRIYATYFGGDEKMAFH  689
            T+VY L   R+Y TYFGGDEK    
Sbjct  132  TDVYGLEKDRLYVTYFGGDEKQGLE  156



>emb|CDI53029.1| probable ALA1-alanyl-tRNA synthetase, cytosolic [Melanopsichium 
pennsylvanicum 4]
Length=985

 Score =   228 bits (580),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = +3

Query  258  EWPSSKVRDTFIKFFESKAHTCVKSSPVVPVNDPTLLFANAGMNQFKPIFLGTVDPNTEL  437
            +WP++KVRDTF  +F+ + HT V SS  +P +DPTLLFANAGMNQ+KPIFLG  DPN+  
Sbjct  16   DWPATKVRDTFTGYFKQRQHTFVPSSSTIPYDDPTLLFANAGMNQYKPIFLGIADPNSAF  75

Query  438  SKLKRACDTQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKTEAIQWAWELLT  617
              +KRA ++QKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFK EAI+ AWELLT
Sbjct  76   GSMKRAVNSQKCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEMAWELLT  135

Query  618  EVYKLPAIRIYATYFGGDEKMAFHLIMKLENL  713
             VY LP  R+Y TYF GD K      ++  +L
Sbjct  136  VVYGLPKDRLYVTYFEGDAKQGLEPDLEARDL  167



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1323106870870