BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig13522

Length=1265
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010677176.1|  PREDICTED: uncharacterized protein LOC104892855    106   1e-23   
gb|KHG25342.1|  hypothetical protein F383_32011                       55.1    2e-12   Gossypium arboreum [tree cotton]
gb|KJB67928.1|  hypothetical protein B456_010G218300                  55.1    4e-12   Gossypium raimondii
ref|XP_002532643.1|  conserved hypothetical protein                   57.4    5e-12   
ref|XP_010108937.1|  E3 ubiquitin-protein ligase SINA-like 2          55.1    6e-11   
ref|XP_008365752.1|  PREDICTED: uncharacterized protein LOC103429377  53.5    1e-10   
ref|XP_010528520.1|  PREDICTED: uncharacterized protein LOC104805598  60.1    1e-10   Tarenaya hassleriana [spider flower]
ref|XP_008229334.1|  PREDICTED: uncharacterized protein LOC103328702  53.9    1e-10   Prunus mume [ume]
ref|XP_007011252.1|  RING/U-box and TRAF-like domains                 52.4    2e-10   
ref|XP_007215313.1|  hypothetical protein PRUPE_ppa003531mg           53.9    2e-10   
ref|XP_010672819.1|  PREDICTED: protein PRRC2C-like                   56.6    3e-10   
ref|XP_006482158.1|  PREDICTED: uncharacterized protein LOC102612380  51.2    9e-10   Citrus sinensis [apfelsine]
ref|XP_006430659.1|  hypothetical protein CICLE_v10011294mg           51.2    9e-10   Citrus clementina [clementine]
gb|KDO63134.1|  hypothetical protein CISIN_1g043878mg                 51.2    9e-10   Citrus sinensis [apfelsine]
ref|XP_011002801.1|  PREDICTED: uncharacterized protein LOC105109...  47.8    3e-09   Populus euphratica
ref|XP_011002799.1|  PREDICTED: uncharacterized protein LOC105109...  47.8    3e-09   Populus euphratica
ref|XP_011002802.1|  PREDICTED: uncharacterized protein LOC105109...  47.4    3e-09   Populus euphratica
ref|XP_011002800.1|  PREDICTED: uncharacterized protein LOC105109...  47.8    3e-09   Populus euphratica
ref|XP_011002798.1|  PREDICTED: uncharacterized protein LOC105109...  47.8    3e-09   Populus euphratica
ref|XP_010665511.1|  PREDICTED: uncharacterized protein LOC104882809  49.3    3e-09   
ref|XP_002305192.1|  hypothetical protein POPTR_0004s09080g           47.8    9e-09   Populus trichocarpa [western balsam poplar]
ref|XP_007203306.1|  hypothetical protein PRUPE_ppa025878mg           43.5    4e-08   
ref|XP_006484196.1|  PREDICTED: uncharacterized protein LOC102607...  45.8    5e-07   
ref|XP_006484193.1|  PREDICTED: uncharacterized protein LOC102607...  45.8    5e-07   
ref|XP_006484194.1|  PREDICTED: uncharacterized protein LOC102607...  45.8    5e-07   



>ref|XP_010677176.1| PREDICTED: uncharacterized protein LOC104892855 [Beta vulgaris 
subsp. vulgaris]
Length=833

 Score =   106 bits (265),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 75/125 (60%), Gaps = 2/125 (2%)
 Frame = +1

Query  685   GKRDVEEGRKSEENSAAYNKLLTDWRKMWNVKSGSPITTKMPDEIIRRGDHGDAFKRDFV  864
             G + V+E  K ++N   +  L   WR +W ++ G P TTKMP+ I+  G  GD FKR FV
Sbjct  67    GPKVVKEAMKDDDNDE-FRILFEQWRSIWGLEKGCPKTTKMPERILTLG-AGDDFKRSFV  124

Query  865   VFAVSSLLRGNTGRYANYRVLKSLLNIRAISRLNWCRYTYRSFIDSYEIYKDSPTRSFRG  1044
             VF VSS L G   +   Y++L SL++   ISR++WC+YT    ID+  I+K +P   F G
Sbjct  125   VFVVSSCLHGQKNQSCTYKILFSLMDTSEISRMDWCQYTIDCLIDAILIWKKNPCGFFTG  184

Query  1045  PMVFI  1059
              ++F+
Sbjct  185   SLLFL  189


 Score = 32.0 bits (71),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = +2

Query  524  EQKDAVVDIGFGGLLHLQFSSNYSQLVEYLLKRFDVF  634
            EQ+ AV DIGFG  L L F    ++L  +L++ FD +
Sbjct  4    EQRQAVKDIGFGVFLELGFGVLNNKLSLWLIENFDPY  40



>gb|KHG25342.1| hypothetical protein F383_32011 [Gossypium arboreum]
Length=641

 Score = 55.1 bits (131),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +2

Query  473  TRMGPKQMYELVQRLTQEQKDAVVDIGFGGLLHLQFSSNYSQLVEYLLKRFDVFKSDFIL  652
            TR  P +++ ++QRLT EQKDAV  +GFG LL L+  +    L  +LL+RF+  +    +
Sbjct  133  TRCSPGRLFNVLQRLTSEQKDAVKSMGFGSLLGLRCRTLRRSLCLWLLERFNTARRSLEI  192

Query  653  DGD  661
             G+
Sbjct  193  CGE  195


 Score = 46.2 bits (108),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 28/128 (22%), Positives = 62/128 (48%), Gaps = 6/128 (5%)
 Frame = +1

Query  691   RDVEE-----GRKSEENSAAYNKLLTDWRKMWNVKSGSPITTKMPDEIIRRGDHGDAFKR  855
             RDVE       R  +  ++  + L+ D R ++N  +   I+ ++ +E +   + G+ FKR
Sbjct  202   RDVEHVMGLAARGKDVVNSGPDDLIADLRYIYNATNRG-ISVRLLEERLAAPEAGEDFKR  260

Query  856   DFVVFAVSSLLRGNTGRYANYRVLKSLLNIRAISRLNWCRYTYRSFIDSYEIYKDSPTRS  1035
              F+++A+ +LL        +   L  L+N+ A+ + NW ++     +     ++    R+
Sbjct  261   SFILYALGTLLSPTARLDVSPSFLHFLINMDAVHQYNWGKFLLDRLVQEVSRFRQGKQRA  320

Query  1036  FRGPMVFI  1059
               G ++F+
Sbjct  321   VGGCLLFL  328



>gb|KJB67928.1| hypothetical protein B456_010G218300 [Gossypium raimondii]
Length=641

 Score = 55.1 bits (131),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +2

Query  473  TRMGPKQMYELVQRLTQEQKDAVVDIGFGGLLHLQFSSNYSQLVEYLLKRFDVFKSDFIL  652
            TR  P +++ ++QRLT EQKDAV  +GFG LL L+  +    L  +LL+RF+  +    +
Sbjct  133  TRCSPGRLFNVLQRLTSEQKDAVKSMGFGSLLGLRCRTLRRSLCLWLLERFNTTRRSLEI  192

Query  653  DGD  661
             G+
Sbjct  193  CGE  195


 Score = 44.7 bits (104),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 54/107 (50%), Gaps = 1/107 (1%)
 Frame = +1

Query  739   NKLLTDWRKMWNVKSGSPITTKMPDEIIRRGDHGDAFKRDFVVFAVSSLLRGNTGRYANY  918
             + L+ D R ++N  +   I+ ++ +E +   + GD FKR F+++A+ +LL        + 
Sbjct  223   DDLIADLRYIYNATNRG-ISVRLLEERLAAPEAGDDFKRSFILYALGTLLSPTARLDVSP  281

Query  919   RVLKSLLNIRAISRLNWCRYTYRSFIDSYEIYKDSPTRSFRGPMVFI  1059
               L  L+N+ A+ + NW ++     +     ++    R+  G ++F+
Sbjct  282   SFLHFLINMDAVHQYNWGKFLLDRLVREVSRFRQGKQRAVGGCLLFL  328



>ref|XP_002532643.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29746.1| conserved hypothetical protein [Ricinus communis]
Length=421

 Score = 57.4 bits (137),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = +2

Query  473  TRMGPKQMYELVQRLTQEQKDAVVDIGFGGLLHLQFSSNYSQLVEYLLKRFDVFKSDFIL  652
            TR  P +++ ++QRLT EQKDAV D+GFG LL L+  +    L  +LL+RF+       +
Sbjct  114  TRCSPGRLFNVLQRLTPEQKDAVKDLGFGSLLGLRCRTLRRSLCLWLLQRFNTTGRSLEI  173

Query  653  DGD  661
             GD
Sbjct  174  CGD  176


 Score = 42.4 bits (98),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 54/112 (48%), Gaps = 2/112 (2%)
 Frame = +1

Query  724   NSAAYNKLLTDWRKMWNVKSGSPITTKMPDEIIRRGDHGDAFKRDFVVFAVSSLLRGNTG  903
             NS   N L+ D R+ +N  +   I+  + +E ++  + G+ FKR FV++A+ +LL     
Sbjct  200   NSGPDN-LILDLRRNYNA-TNRGISVSLLEERLKAPEAGEEFKRSFVLYALGTLLSPTAR  257

Query  904   RYANYRVLKSLLNIRAISRLNWCRYTYRSFIDSYEIYKDSPTRSFRGPMVFI  1059
                +   L  L N+  + + NW ++     +     ++    R+  G ++F+
Sbjct  258   LDVSPSFLHFLTNVDVVHQYNWGKFLLDRLVREVARFRQGKQRAVGGCLLFL  309



>ref|XP_010108937.1| E3 ubiquitin-protein ligase SINA-like 2 [Morus notabilis]
 gb|EXC20577.1| E3 ubiquitin-protein ligase SINA-like 2 [Morus notabilis]
Length=703

 Score = 55.1 bits (131),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 54/104 (52%), Gaps = 2/104 (2%)
 Frame = +2

Query  362  EDPAEPSTRQQPAATKRKRAQPPKREQVRDPDVDYFSTRMGPKQMYELVQRLTQEQKDAV  541
            ++ A+ +TR +        A PP+  + R        TR  P +++ ++Q LT EQKDAV
Sbjct  163  DEKAKFTTRAREVWDNYLSAAPPRTPKPRKQT--KLVTRCSPGRLFNVLQHLTAEQKDAV  220

Query  542  VDIGFGGLLHLQFSSNYSQLVEYLLKRFDVFKSDFILDGDILHV  673
              +GFG LL L+  +    L  +LL+RF+  +    + G  +H+
Sbjct  221  KIMGFGSLLGLRCRTLRRSLCLWLLERFNTMQRSLEICGGHIHL  264


 Score = 40.8 bits (94),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 23/107 (21%), Positives = 51/107 (48%), Gaps = 1/107 (1%)
 Frame = +1

Query  739   NKLLTDWRKMWNVKSGSPITTKMPDEIIRRGDHGDAFKRDFVVFAVSSLLRGNTGRYANY  918
             + L+ D R  +N  +   I+ ++ +E +   + GD FKR FV++A+ +LL        + 
Sbjct  288   DDLIADLRNNYNA-TNRGISVRLLEERLSAPEAGDDFKRSFVLYALGTLLSPTARLDVSP  346

Query  919   RVLKSLLNIRAISRLNWCRYTYRSFIDSYEIYKDSPTRSFRGPMVFI  1059
               L  L N+  + + NW ++     +     ++    ++  G ++F+
Sbjct  347   SFLHFLTNMSVVHQYNWGKFLLDRLVREISRFRQGKQQAVGGCLLFL  393



>ref|XP_008365752.1| PREDICTED: uncharacterized protein LOC103429377 [Malus domestica]
Length=616

 Score = 53.5 bits (127),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +2

Query  473  TRMGPKQMYELVQRLTQEQKDAVVDIGFGGLLHLQFSSNYSQLVEYLLKRFDVFKSDFIL  652
            TR  P +++ ++QRLT EQK AV  +GFG LL L+  +    L  +LL+RF+  +    +
Sbjct  120  TRCSPGRLFNVIQRLTNEQKAAVKSMGFGSLLDLRCRTLRRSLCLWLLERFNTTRXSLEI  179

Query  653  DGD  661
             G+
Sbjct  180  CGE  182


 Score = 41.6 bits (96),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 22/111 (20%), Positives = 53/111 (48%), Gaps = 1/111 (1%)
 Frame = +1

Query  727   SAAYNKLLTDWRKMWNVKSGSPITTKMPDEIIRRGDHGDAFKRDFVVFAVSSLLRGNTGR  906
             ++  + L+ D R  ++  +   I+ ++ +E +   + G+ FKR FV++A+ +LL      
Sbjct  206   NSGSDDLIADLRHXYDATNHG-ISVRLLEERLAZPEAGEEFKRSFVLYALGTLLSPTARL  264

Query  907   YANYRVLKSLLNIRAISRLNWCRYTYRSFIDSYEIYKDSPTRSFRGPMVFI  1059
               +   L  L N+  + + NW ++     +     ++    R+  G ++F+
Sbjct  265   DVSPSFLHFLTNMDVVHQYNWGKFLLDRLVCEVSRFRQGKQRAVGGCLLFL  315



>ref|XP_010528520.1| PREDICTED: uncharacterized protein LOC104805598 [Tarenaya hassleriana]
Length=499

 Score = 60.1 bits (144),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 49/84 (58%), Gaps = 7/84 (8%)
 Frame = +2

Query  419  AQPPK-REQVRDPDVDYFSTRMGPKQMYELVQRLTQEQKDAVVDIGFGGLLHLQFSSNYS  595
            +QPPK ++Q +        TR  P ++  ++QRLT EQK+AV ++GFGGLL L+  +   
Sbjct  26   SQPPKPKKQTK------LVTRCSPGRLLNVIQRLTSEQKEAVKNMGFGGLLDLRCRTLRR  79

Query  596  QLVEYLLKRFDVFKSDFILDGDIL  667
             L  +LL+RFD  K    + G  +
Sbjct  80   SLCLWLLERFDTRKCCLKICGHCI  103


 Score = 35.0 bits (79),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 21/105 (20%), Positives = 48/105 (46%), Gaps = 1/105 (1%)
 Frame = +1

Query  745   LLTDWRKMWNVKSGSPITTKMPDEIIRRGDHGDAFKRDFVVFAVSSLLRGNTGRYANYRV  924
             +++D R  +N  +   I+    +E +   + G+ FKR F+++A+ +L+        +   
Sbjct  131   VISDLRLSYNATNHG-ISVHNLEEKLLIPEAGEDFKRSFILYALGTLISPTARLDVSPSF  189

Query  925   LKSLLNIRAISRLNWCRYTYRSFIDSYEIYKDSPTRSFRGPMVFI  1059
             L  L NI  I + NW ++     +     ++     +  G ++F+
Sbjct  190   LHFLTNIDVIHQFNWGKFLLDRLVREVSRFQQRKQHAVGGCLLFL  234



>ref|XP_008229334.1| PREDICTED: uncharacterized protein LOC103328702 [Prunus mume]
Length=621

 Score = 53.9 bits (128),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 6/79 (8%)
 Frame = +2

Query  425  PPKREQVRDPDVDYFSTRMGPKQMYELVQRLTQEQKDAVVDIGFGGLLHLQFSSNYSQLV  604
            P  R+Q +        TR  P +++ ++QRLT EQK AV  +GFG LL L+  +    L 
Sbjct  105  PKPRKQAK------LVTRCSPGRLFNVIQRLTTEQKAAVKSMGFGSLLDLRCRTLRRSLC  158

Query  605  EYLLKRFDVFKSDFILDGD  661
             +LL+RFD  +    + G+
Sbjct  159  LWLLERFDTTQRSLEICGE  177


 Score = 40.8 bits (94),  Expect(2) = 1e-10, Method: Compositional matrix adjust.
 Identities = 22/107 (21%), Positives = 50/107 (47%), Gaps = 1/107 (1%)
 Frame = +1

Query  739   NKLLTDWRKMWNVKSGSPITTKMPDEIIRRGDHGDAFKRDFVVFAVSSLLRGNTGRYANY  918
             + L+ D R  ++  +   I+ ++ +E +   + G+ FKR FV++A+ +LL        + 
Sbjct  205   DDLIADLRHSYDATNHG-ISVRLLEERLAEPEAGEEFKRSFVLYALGTLLSPTARLDVSP  263

Query  919   RVLKSLLNIRAISRLNWCRYTYRSFIDSYEIYKDSPTRSFRGPMVFI  1059
               L  L N+  + + NW ++     +     +     R+  G ++F+
Sbjct  264   SFLHFLTNVDVVHQYNWGKFLLDRLVCEVSRFHQGKQRAVGGCLLFL  310



>ref|XP_007011252.1| RING/U-box and TRAF-like domains [Theobroma cacao]
 gb|EOY20062.1| RING/U-box and TRAF-like domains [Theobroma cacao]
Length=639

 Score = 52.4 bits (124),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 38/63 (60%), Gaps = 0/63 (0%)
 Frame = +2

Query  473  TRMGPKQMYELVQRLTQEQKDAVVDIGFGGLLHLQFSSNYSQLVEYLLKRFDVFKSDFIL  652
            TR  P +++ ++QRLT EQK AV  +GFG LL L+  +    L  +LL+RF+  +    +
Sbjct  131  TRCSPGRLFNVLQRLTPEQKAAVKSMGFGSLLGLRCRTLRRSLCLWLLERFNTVRHSLEI  190

Query  653  DGD  661
             G+
Sbjct  191  CGE  193


 Score = 42.0 bits (97),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 22/107 (21%), Positives = 53/107 (50%), Gaps = 1/107 (1%)
 Frame = +1

Query  739   NKLLTDWRKMWNVKSGSPITTKMPDEIIRRGDHGDAFKRDFVVFAVSSLLRGNTGRYANY  918
             + L+ D R+ +N  +   I+ ++ +E +   + G+ FKR F+++A+ +LL        + 
Sbjct  221   DDLIADLRQSYNA-TNRGISVRLLEEWLAAPEAGEDFKRSFILYALGTLLSPTARLDVSP  279

Query  919   RVLKSLLNIRAISRLNWCRYTYRSFIDSYEIYKDSPTRSFRGPMVFI  1059
               L  L+N+  + + NW ++     +     ++    R+  G ++F+
Sbjct  280   SFLHFLINMDVVHQYNWGKFLLDRLVREVSRFRQGKQRAVGGCLLFL  326



>ref|XP_007215313.1| hypothetical protein PRUPE_ppa003531mg [Prunus persica]
 gb|EMJ16512.1| hypothetical protein PRUPE_ppa003531mg [Prunus persica]
Length=567

 Score = 53.9 bits (128),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 6/79 (8%)
 Frame = +2

Query  425  PPKREQVRDPDVDYFSTRMGPKQMYELVQRLTQEQKDAVVDIGFGGLLHLQFSSNYSQLV  604
            P  R+Q +        TR  P +++ ++QRLT EQK AV  +GFG LL L+  +    L 
Sbjct  106  PKPRKQAK------LVTRCSPGRLFNVIQRLTTEQKAAVKSMGFGSLLDLRCRTLRRSLC  159

Query  605  EYLLKRFDVFKSDFILDGD  661
             +LL+RFD  +    + G+
Sbjct  160  LWLLERFDTTQRSLEICGE  178


 Score = 40.0 bits (92),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 22/107 (21%), Positives = 50/107 (47%), Gaps = 1/107 (1%)
 Frame = +1

Query  739   NKLLTDWRKMWNVKSGSPITTKMPDEIIRRGDHGDAFKRDFVVFAVSSLLRGNTGRYANY  918
             + L+ D R  ++  +   I+ ++ +E +   + G+ FKR FV++A+ +LL        + 
Sbjct  206   DDLIADLRHSYDATNHG-ISVRLLEERLAEPEAGEEFKRSFVLYALGTLLSPTARLDVSP  264

Query  919   RVLKSLLNIRAISRLNWCRYTYRSFIDSYEIYKDSPTRSFRGPMVFI  1059
               L  L N+  + + NW ++     +     +     R+  G ++F+
Sbjct  265   SFLHFLTNMDVVHQYNWGKFLLDRLVCEVSRFHQGKQRAVGGCLLFL  311



>ref|XP_010672819.1| PREDICTED: protein PRRC2C-like [Beta vulgaris subsp. vulgaris]
Length=767

 Score = 56.6 bits (135),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 57/114 (50%), Gaps = 7/114 (6%)
 Frame = +1

Query  736   YNKLLTDWRKMWNVKSGSP----ITTKMPDEIIRRGDHGDAFKRDFVVFAVSSLLRGNTG  903
             Y  +L +WR+   V+ GSP    + T + D  +   D+   +KR F+V AV+  ++    
Sbjct  452   YRLMLEEWREYVGVQRGSPYVSTMATHLADAAVPVTDN---WKRTFLVVAVNCCIKSTLN  508

Query  904   RYANYRVLKSLLNIRAISRLNWCRYTYRSFIDSYEIYKDSPTRSFRGPMVFILV  1065
                    L + +++  I   NWC+YT  S + S   +++  TR F GP+ F+ V
Sbjct  509   PQPLTGFLSTTIDVNNIPNYNWCKYTIESLLHSACSWQEDTTRFFAGPLPFLQV  562


 Score = 36.6 bits (83),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 15/43 (35%), Positives = 23/43 (53%), Gaps = 0/43 (0%)
 Frame = +2

Query  524  EQKDAVVDIGFGGLLHLQFSSNYSQLVEYLLKRFDVFKSDFIL  652
            +++ A++D+GFGGLL L    N       LL R+ V     +L
Sbjct  373  QKRQAIIDMGFGGLLELDMPKNDPIFCARLLSRYSVGSGSLML  415



>ref|XP_006482158.1| PREDICTED: uncharacterized protein LOC102612380 [Citrus sinensis]
Length=620

 Score = 51.2 bits (121),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 47/89 (53%), Gaps = 7/89 (8%)
 Frame = +2

Query  401  ATKRKRAQPPKREQVRDPDVDYFSTRMGPKQMYELVQRLTQEQKDAVVDIGFGGLLHLQF  580
            +T   RA  P+++           TR  P +++ ++QRLT +Q+ AV  +GFG LL L+ 
Sbjct  98   STAPARAPKPRKQT-------KLVTRCSPGRLFNVLQRLTTDQRAAVRSMGFGSLLVLRC  150

Query  581  SSNYSQLVEYLLKRFDVFKSDFILDGDIL  667
             +    L  +LL+RF+  +    + G+ +
Sbjct  151  RTLRRSLCLWLLERFNTTRRSLDICGECI  179


 Score = 40.8 bits (94),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 51/107 (48%), Gaps = 1/107 (1%)
 Frame = +1

Query  739   NKLLTDWRKMWNVKSGSPITTKMPDEIIRRGDHGDAFKRDFVVFAVSSLLRGNTGRYANY  918
             + L+ + R  +N  +   I+ ++ +E +   + G+ FKR FV++A+ +LL        + 
Sbjct  205   DDLIANLRHSYNATNHG-ISVRLLEERLAVPEAGEDFKRSFVLYALGTLLSPTARLDVSP  263

Query  919   RVLKSLLNIRAISRLNWCRYTYRSFIDSYEIYKDSPTRSFRGPMVFI  1059
               L  L N+  I + NW ++     +     Y+    R+  G ++F+
Sbjct  264   SFLHFLTNMDVIHQYNWGKFLLDRLVREVSRYRQGKQRAVGGCLLFL  310



>ref|XP_006430659.1| hypothetical protein CICLE_v10011294mg [Citrus clementina]
 gb|ESR43899.1| hypothetical protein CICLE_v10011294mg [Citrus clementina]
Length=623

 Score = 51.2 bits (121),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 47/89 (53%), Gaps = 7/89 (8%)
 Frame = +2

Query  401  ATKRKRAQPPKREQVRDPDVDYFSTRMGPKQMYELVQRLTQEQKDAVVDIGFGGLLHLQF  580
            +T   RA  P+++           TR  P +++ ++QRLT +Q+ AV  +GFG LL L+ 
Sbjct  98   STAPARAPKPRKQT-------KLVTRCSPGRLFNVLQRLTTDQRAAVRSMGFGSLLVLRC  150

Query  581  SSNYSQLVEYLLKRFDVFKSDFILDGDIL  667
             +    L  +LL+RF+  +    + G+ +
Sbjct  151  RTLRRSLCLWLLERFNTTRRSLDICGECI  179


 Score = 40.8 bits (94),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 51/107 (48%), Gaps = 1/107 (1%)
 Frame = +1

Query  739   NKLLTDWRKMWNVKSGSPITTKMPDEIIRRGDHGDAFKRDFVVFAVSSLLRGNTGRYANY  918
             + L+ + R  +N  +   I+ ++ +E +   + G+ FKR FV++A+ +LL        + 
Sbjct  205   DDLIANLRHSYNATNHG-ISVRLLEERLAVPEAGEDFKRSFVLYALGTLLSPTARLDVSP  263

Query  919   RVLKSLLNIRAISRLNWCRYTYRSFIDSYEIYKDSPTRSFRGPMVFI  1059
               L  L N+  I + NW ++     +     Y+    R+  G ++F+
Sbjct  264   SFLHFLTNMDVIHQYNWGKFLLDRLVREVSRYRQGKQRAVGGCLLFL  310



>gb|KDO63134.1| hypothetical protein CISIN_1g043878mg, partial [Citrus sinensis]
Length=648

 Score = 51.2 bits (121),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 47/89 (53%), Gaps = 7/89 (8%)
 Frame = +2

Query  401  ATKRKRAQPPKREQVRDPDVDYFSTRMGPKQMYELVQRLTQEQKDAVVDIGFGGLLHLQF  580
            +T   RA  P+++           TR  P +++ ++QRLT +Q+ AV  +GFG LL L+ 
Sbjct  97   STAPARAPKPRKQT-------KLVTRCSPGRLFNVLQRLTTDQRAAVRSMGFGSLLVLRC  149

Query  581  SSNYSQLVEYLLKRFDVFKSDFILDGDIL  667
             +    L  +LL+RF+  +    + G+ +
Sbjct  150  RTLRRSLCLWLLERFNTTRRSLDICGECI  178


 Score = 40.8 bits (94),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 51/107 (48%), Gaps = 1/107 (1%)
 Frame = +1

Query  739   NKLLTDWRKMWNVKSGSPITTKMPDEIIRRGDHGDAFKRDFVVFAVSSLLRGNTGRYANY  918
             + L+ + R  +N  +   I+ ++ +E +   + G+ FKR FV++A+ +LL        + 
Sbjct  204   DDLIANLRHSYNA-TNHGISVRLLEERLAVPEAGEDFKRSFVLYALGTLLSPTARLDVSP  262

Query  919   RVLKSLLNIRAISRLNWCRYTYRSFIDSYEIYKDSPTRSFRGPMVFI  1059
               L  L N+  I + NW ++     +     Y+    R+  G ++F+
Sbjct  263   SFLHFLTNMDVIHQYNWGKFLLDRLVREVSRYRQGKQRAVGGCLLFL  309



>ref|XP_011002801.1| PREDICTED: uncharacterized protein LOC105109714 isoform X4 [Populus 
euphratica]
Length=621

 Score = 47.8 bits (112),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = +2

Query  473  TRMGPKQMYELVQRLTQEQKDAVVDIGFGGLLHLQFSSNYSQLVEYLLKRFDVFKSDFIL  652
            TR  P +++ ++QRL+ EQ  AV  +GFG LL L+  +    L  +LL+RF+       +
Sbjct  114  TRCSPGRLFNVLQRLSPEQNAAVKSMGFGSLLGLRCRTLRRSLCLWLLERFNTAGCSLEI  173

Query  653  DG  658
             G
Sbjct  174  CG  175


 Score = 42.7 bits (99),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 52/107 (49%), Gaps = 1/107 (1%)
 Frame = +1

Query  739   NKLLTDWRKMWNVKSGSPITTKMPDEIIRRGDHGDAFKRDFVVFAVSSLLRGNTGRYANY  918
             + L+ D R+ +N  +   I+ ++ +E +   + G+ FKR FV++A+ +LL        + 
Sbjct  204   DDLIVDLRRSYNATNHG-ISVRLLEERLTAPEAGEDFKRSFVLYALGTLLSPTARLDVSP  262

Query  919   RVLKSLLNIRAISRLNWCRYTYRSFIDSYEIYKDSPTRSFRGPMVFI  1059
               L  L N+ A+ + NW ++     +     +     R+  G ++F+
Sbjct  263   SFLHFLTNMDAVHQYNWGKFLLDRLVREVSRFHQGKQRAVGGCLLFL  309



>ref|XP_011002799.1| PREDICTED: uncharacterized protein LOC105109714 isoform X2 [Populus 
euphratica]
Length=627

 Score = 47.8 bits (112),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = +2

Query  473  TRMGPKQMYELVQRLTQEQKDAVVDIGFGGLLHLQFSSNYSQLVEYLLKRFDVFKSDFIL  652
            TR  P +++ ++QRL+ EQ  AV  +GFG LL L+  +    L  +LL+RF+       +
Sbjct  120  TRCSPGRLFNVLQRLSPEQNAAVKSMGFGSLLGLRCRTLRRSLCLWLLERFNTAGCSLEI  179

Query  653  DG  658
             G
Sbjct  180  CG  181


 Score = 42.7 bits (99),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 52/107 (49%), Gaps = 1/107 (1%)
 Frame = +1

Query  739   NKLLTDWRKMWNVKSGSPITTKMPDEIIRRGDHGDAFKRDFVVFAVSSLLRGNTGRYANY  918
             + L+ D R+ +N  +   I+ ++ +E +   + G+ FKR FV++A+ +LL        + 
Sbjct  210   DDLIVDLRRSYNATNHG-ISVRLLEERLTAPEAGEDFKRSFVLYALGTLLSPTARLDVSP  268

Query  919   RVLKSLLNIRAISRLNWCRYTYRSFIDSYEIYKDSPTRSFRGPMVFI  1059
               L  L N+ A+ + NW ++     +     +     R+  G ++F+
Sbjct  269   SFLHFLTNMDAVHQYNWGKFLLDRLVREVSRFHQGKQRAVGGCLLFL  315



>ref|XP_011002802.1| PREDICTED: uncharacterized protein LOC105109714 isoform X5 [Populus 
euphratica]
Length=546

 Score = 47.4 bits (111),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = +2

Query  473  TRMGPKQMYELVQRLTQEQKDAVVDIGFGGLLHLQFSSNYSQLVEYLLKRFDVFKSDFIL  652
            TR  P +++ ++QRL+ EQ  AV  +GFG LL L+  +    L  +LL+RF+       +
Sbjct  39   TRCSPGRLFNVLQRLSPEQNAAVKSMGFGSLLGLRCRTLRRSLCLWLLERFNTAGCSLEI  98

Query  653  DG  658
             G
Sbjct  99   CG  100


 Score = 42.7 bits (99),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 52/107 (49%), Gaps = 1/107 (1%)
 Frame = +1

Query  739   NKLLTDWRKMWNVKSGSPITTKMPDEIIRRGDHGDAFKRDFVVFAVSSLLRGNTGRYANY  918
             + L+ D R+ +N  +   I+ ++ +E +   + G+ FKR FV++A+ +LL        + 
Sbjct  129   DDLIVDLRRSYNATNHG-ISVRLLEERLTAPEAGEDFKRSFVLYALGTLLSPTARLDVSP  187

Query  919   RVLKSLLNIRAISRLNWCRYTYRSFIDSYEIYKDSPTRSFRGPMVFI  1059
               L  L N+ A+ + NW ++     +     +     R+  G ++F+
Sbjct  188   SFLHFLTNMDAVHQYNWGKFLLDRLVREVSRFHQGKQRAVGGCLLFL  234



>ref|XP_011002800.1| PREDICTED: uncharacterized protein LOC105109714 isoform X3 [Populus 
euphratica]
Length=625

 Score = 47.8 bits (112),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = +2

Query  473  TRMGPKQMYELVQRLTQEQKDAVVDIGFGGLLHLQFSSNYSQLVEYLLKRFDVFKSDFIL  652
            TR  P +++ ++QRL+ EQ  AV  +GFG LL L+  +    L  +LL+RF+       +
Sbjct  131  TRCSPGRLFNVLQRLSPEQNAAVKSMGFGSLLGLRCRTLRRSLCLWLLERFNTAGCSLEI  190

Query  653  DG  658
             G
Sbjct  191  CG  192


 Score = 42.7 bits (99),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 52/107 (49%), Gaps = 1/107 (1%)
 Frame = +1

Query  739   NKLLTDWRKMWNVKSGSPITTKMPDEIIRRGDHGDAFKRDFVVFAVSSLLRGNTGRYANY  918
             + L+ D R+ +N  +   I+ ++ +E +   + G+ FKR FV++A+ +LL        + 
Sbjct  221   DDLIVDLRRSYNATNHG-ISVRLLEERLTAPEAGEDFKRSFVLYALGTLLSPTARLDVSP  279

Query  919   RVLKSLLNIRAISRLNWCRYTYRSFIDSYEIYKDSPTRSFRGPMVFI  1059
               L  L N+ A+ + NW ++     +     +     R+  G ++F+
Sbjct  280   SFLHFLTNMDAVHQYNWGKFLLDRLVREVSRFHQGKQRAVGGCLLFL  326



>ref|XP_011002798.1| PREDICTED: uncharacterized protein LOC105109714 isoform X1 [Populus 
euphratica]
Length=638

 Score = 47.8 bits (112),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = +2

Query  473  TRMGPKQMYELVQRLTQEQKDAVVDIGFGGLLHLQFSSNYSQLVEYLLKRFDVFKSDFIL  652
            TR  P +++ ++QRL+ EQ  AV  +GFG LL L+  +    L  +LL+RF+       +
Sbjct  131  TRCSPGRLFNVLQRLSPEQNAAVKSMGFGSLLGLRCRTLRRSLCLWLLERFNTAGCSLEI  190

Query  653  DG  658
             G
Sbjct  191  CG  192


 Score = 42.4 bits (98),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 52/107 (49%), Gaps = 1/107 (1%)
 Frame = +1

Query  739   NKLLTDWRKMWNVKSGSPITTKMPDEIIRRGDHGDAFKRDFVVFAVSSLLRGNTGRYANY  918
             + L+ D R+ +N  +   I+ ++ +E +   + G+ FKR FV++A+ +LL        + 
Sbjct  221   DDLIVDLRRSYNATNHG-ISVRLLEERLTAPEAGEDFKRSFVLYALGTLLSPTARLDVSP  279

Query  919   RVLKSLLNIRAISRLNWCRYTYRSFIDSYEIYKDSPTRSFRGPMVFI  1059
               L  L N+ A+ + NW ++     +     +     R+  G ++F+
Sbjct  280   SFLHFLTNMDAVHQYNWGKFLLDRLVREVSRFHQGKQRAVGGCLLFL  326



>ref|XP_010665511.1| PREDICTED: uncharacterized protein LOC104882809 [Beta vulgaris 
subsp. vulgaris]
Length=310

 Score = 49.3 bits (116),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 43/85 (51%), Gaps = 4/85 (5%)
 Frame = +2

Query  374  EPSTRQQPAATKRKRAQPPKREQVRDPDVDYFSTRMGPKQMYELVQRLTQEQKDAVVDIG  553
            + S  Q   + K+K+     ++   +P    F T    K++ EL +    EQK A+ +IG
Sbjct  73   DSSLNQTLQSLKKKKISTVAQQNTVNP----FRTNCCGKRLCELNEAFNSEQKKAITEIG  128

Query  554  FGGLLHLQFSSNYSQLVEYLLKRFD  628
            FG LLHL+ +   + L  +L+  FD
Sbjct  129  FGSLLHLKITRTNNALSAWLVDMFD  153


 Score = 40.8 bits (94),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/113 (24%), Positives = 54/113 (48%), Gaps = 2/113 (2%)
 Frame = +1

Query  691   RDVEEGRKSEENSAAYNKLLTDWRKMWNV--KSGSPITTKMPDEIIRRGDHGDAFKRDFV  864
             +DV +  +       Y  L   WR+ + V  + G    + +  E+ +  + G+ FK+ +V
Sbjct  186   QDVVDVSRGPNADNPYFDLKASWREYFKVNREKGQIGLSAVYYELKKLVNGGEVFKKLYV  245

Query  865   VFAVSSLLRGNTGRYANYRVLKSLLNIRAISRLNWCRYTYRSFIDSYEIYKDS  1023
             +FA SS L        + R++ ++  +R I   NWC+Y     + +  ++K+S
Sbjct  246   LFAFSSFLAPVANNTLDLRLVLAVHEVRKIPHYNWCKYILGRSMYANVLFKNS  298



>ref|XP_002305192.1| hypothetical protein POPTR_0004s09080g [Populus trichocarpa]
 gb|EEE85703.1| hypothetical protein POPTR_0004s09080g [Populus trichocarpa]
Length=628

 Score = 47.8 bits (112),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 40/78 (51%), Gaps = 6/78 (8%)
 Frame = +2

Query  425  PPKREQVRDPDVDYFSTRMGPKQMYELVQRLTQEQKDAVVDIGFGGLLHLQFSSNYSQLV  604
            P  R+Q +        TR  P +++ ++QRL+ EQ  AV  +GFG LL L+  +    L 
Sbjct  110  PKPRKQTK------LVTRCSPGRLFNVLQRLSPEQNAAVKSMGFGSLLGLRCRTLRRSLC  163

Query  605  EYLLKRFDVFKSDFILDG  658
             +LL+RF+       + G
Sbjct  164  LWLLERFNTAGCSLEICG  181


 Score = 40.8 bits (94),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 23/107 (21%), Positives = 51/107 (48%), Gaps = 1/107 (1%)
 Frame = +1

Query  739   NKLLTDWRKMWNVKSGSPITTKMPDEIIRRGDHGDAFKRDFVVFAVSSLLRGNTGRYANY  918
             + L+ D R+ +N  +   I+ ++ +E +   + G+ FKR FV++A+ +LL        + 
Sbjct  210   DDLIVDLRRSYNATNHG-ISVRLLEERLTAPEAGEDFKRSFVLYALGTLLSPTARLDVSP  268

Query  919   RVLKSLLNIRAISRLNWCRYTYRSFIDSYEIYKDSPTRSFRGPMVFI  1059
               L  L N+  + + NW ++     +     +     R+  G ++F+
Sbjct  269   SFLHFLTNMDVVHQYNWGKFLLDRLVREVSRFHQGKQRAVGGCLLFL  315



>ref|XP_007203306.1| hypothetical protein PRUPE_ppa025878mg, partial [Prunus persica]
 gb|EMJ04505.1| hypothetical protein PRUPE_ppa025878mg, partial [Prunus persica]
Length=219

 Score = 43.5 bits (101),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 53/110 (48%), Gaps = 13/110 (12%)
 Frame = +1

Query  694   DVEEGRKSEENSAAYNKLLTDWRKMWNVKSGSPITTKMPDEIIRRGDHGDAFKRDFVVFA  873
             DV++G +   NS    K L    ++  +  G+       +E+      G+ FK  F +FA
Sbjct  104   DVKDGGEEVRNSFLVGKKLLKNNELKQIMVGT-------EEV------GEFFKVGFAMFA  150

Query  874   VSSLLRGNTGRYANYRVLKSLLNIRAISRLNWCRYTYRSFIDSYEIYKDS  1023
             + +LL   T  Y N + L  L + + ISR NW  Y+++  + +   +K++
Sbjct  151   LCTLLCPTTSVYVNLKYLLPLRDSKTISRKNWASYSFKFLLHNIRSFKEN  200


 Score = 43.1 bits (100),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 22/93 (24%), Positives = 44/93 (47%), Gaps = 1/93 (1%)
 Frame = +2

Query  401  ATKRKRAQPPK-REQVRDPDVDYFSTRMGPKQMYELVQRLTQEQKDAVVDIGFGGLLHLQ  577
            AT +   +P K      +      +TR  PK + +++  LT E+K A+ ++GF  LL ++
Sbjct  3    ATHKAEYEPKKPSTNASNKSCLKMATRCSPKDVNDIINVLTDEKKAAIQEMGFVSLLEMK  62

Query  578  FSSNYSQLVEYLLKRFDVFKSDFILDGDILHVG  676
                   +  +L+ + +  +S  +L G  L + 
Sbjct  63   CGKLSHSMCRFLVDKLNPSESSIVLHGKTLKIS  95



>ref|XP_006484196.1| PREDICTED: uncharacterized protein LOC102607173 isoform X4 [Citrus 
sinensis]
Length=402

 Score = 45.8 bits (107),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 42/88 (48%), Gaps = 9/88 (10%)
 Frame = +2

Query  425  PPK---------REQVRDPDVDYFSTRMGPKQMYELVQRLTQEQKDAVVDIGFGGLLHLQ  577
            PPK          + V+    + + TR  P ++   V  L+ EQ+ AV ++G G +L L 
Sbjct  40   PPKMKWKYKVRVEQAVKGEATNTYFTRCAPDRLAAAVTNLSDEQRAAVCEMGMGSVLELN  99

Query  578  FSSNYSQLVEYLLKRFDVFKSDFILDGD  661
                  +L  +L+ R DV +   +L+G+
Sbjct  100  SGRLKRKLCGWLVDRIDVCRRVVVLNGN  127


 Score = 37.0 bits (84),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/106 (21%), Positives = 48/106 (45%), Gaps = 0/106 (0%)
 Frame = +1

Query  742   KLLTDWRKMWNVKSGSPITTKMPDEIIRRGDHGDAFKRDFVVFAVSSLLRGNTGRYANYR  921
             K +  + KM++  S      K+ + +       D FK  F++F + ++L    G + +  
Sbjct  156   KEVESYVKMFSASSTGINIKKLAEMLSNSTAADDRFKVTFMLFTLYTVLCPPGGVHISCN  215

Query  922   VLKSLLNIRAISRLNWCRYTYRSFIDSYEIYKDSPTRSFRGPMVFI  1059
              L SL ++  I + NW  + +  F++    YK+       G ++++
Sbjct  216   FLFSLKDVNCIQKRNWATFCFHKFLEGITRYKEEKLAYIGGCLLYL  261



>ref|XP_006484193.1| PREDICTED: uncharacterized protein LOC102607173 isoform X1 [Citrus 
sinensis]
Length=449

 Score = 45.8 bits (107),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 42/88 (48%), Gaps = 9/88 (10%)
 Frame = +2

Query  425  PPK---------REQVRDPDVDYFSTRMGPKQMYELVQRLTQEQKDAVVDIGFGGLLHLQ  577
            PPK          + V+    + + TR  P ++   V  L+ EQ+ AV ++G G +L L 
Sbjct  87   PPKMKWKYKVRVEQAVKGEATNTYFTRCAPDRLAAAVTNLSDEQRAAVCEMGMGSVLELN  146

Query  578  FSSNYSQLVEYLLKRFDVFKSDFILDGD  661
                  +L  +L+ R DV +   +L+G+
Sbjct  147  SGRLKRKLCGWLVDRIDVCRRVVVLNGN  174


 Score = 37.0 bits (84),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/106 (21%), Positives = 48/106 (45%), Gaps = 0/106 (0%)
 Frame = +1

Query  742   KLLTDWRKMWNVKSGSPITTKMPDEIIRRGDHGDAFKRDFVVFAVSSLLRGNTGRYANYR  921
             K +  + KM++  S      K+ + +       D FK  F++F + ++L    G + +  
Sbjct  203   KEVESYVKMFSASSTGINIKKLAEMLSNSTAADDRFKVTFMLFTLYTVLCPPGGVHISCN  262

Query  922   VLKSLLNIRAISRLNWCRYTYRSFIDSYEIYKDSPTRSFRGPMVFI  1059
              L SL ++  I + NW  + +  F++    YK+       G ++++
Sbjct  263   FLFSLKDVNCIQKRNWATFCFHKFLEGITRYKEEKLAYIGGCLLYL  308



>ref|XP_006484194.1| PREDICTED: uncharacterized protein LOC102607173 isoform X2 [Citrus 
sinensis]
 ref|XP_006484195.1| PREDICTED: uncharacterized protein LOC102607173 isoform X3 [Citrus 
sinensis]
Length=433

 Score = 45.8 bits (107),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 42/88 (48%), Gaps = 9/88 (10%)
 Frame = +2

Query  425  PPK---------REQVRDPDVDYFSTRMGPKQMYELVQRLTQEQKDAVVDIGFGGLLHLQ  577
            PPK          + V+    + + TR  P ++   V  L+ EQ+ AV ++G G +L L 
Sbjct  71   PPKMKWKYKVRVEQAVKGEATNTYFTRCAPDRLAAAVTNLSDEQRAAVCEMGMGSVLELN  130

Query  578  FSSNYSQLVEYLLKRFDVFKSDFILDGD  661
                  +L  +L+ R DV +   +L+G+
Sbjct  131  SGRLKRKLCGWLVDRIDVCRRVVVLNGN  158


 Score = 37.0 bits (84),  Expect(2) = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/106 (21%), Positives = 48/106 (45%), Gaps = 0/106 (0%)
 Frame = +1

Query  742   KLLTDWRKMWNVKSGSPITTKMPDEIIRRGDHGDAFKRDFVVFAVSSLLRGNTGRYANYR  921
             K +  + KM++  S      K+ + +       D FK  F++F + ++L    G + +  
Sbjct  187   KEVESYVKMFSASSTGINIKKLAEMLSNSTAADDRFKVTFMLFTLYTVLCPPGGVHISCN  246

Query  922   VLKSLLNIRAISRLNWCRYTYRSFIDSYEIYKDSPTRSFRGPMVFI  1059
              L SL ++  I + NW  + +  F++    YK+       G ++++
Sbjct  247   FLFSLKDVNCIQKRNWATFCFHKFLEGITRYKEEKLAYIGGCLLYL  292



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3623520585481